BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24053_g1_i5 len=995 path=[1792:0-861 2654:862-902 4484:903-930
4421:931-951 4442:952-994]

Length=995
                                                                      Score     E

ref|XP_009794376.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    454   7e-156   
ref|XP_006354604.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    446   7e-153   
ref|XP_004229511.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1     445   3e-152   
ref|XP_009594714.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    436   6e-149   
ref|XP_002264742.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    429   4e-146   Vitis vinifera
ref|XP_011093458.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    429   5e-146   
ref|XP_010097720.1|  3-hydroxyisobutyryl-CoA hydrolase 1                424   7e-144   
ref|XP_006339517.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    421   1e-142   
ref|XP_010269990.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    417   2e-141   
ref|XP_009794380.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    412   6e-140   
gb|EYU42298.1|  hypothetical protein MIMGU_mgv1a008208mg                412   3e-139   
ref|XP_006445518.1|  hypothetical protein CICLE_v10020614mg             411   5e-139   
gb|KDP32479.1|  hypothetical protein JCGZ_13404                         411   7e-139   
ref|XP_009794379.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    410   9e-139   
ref|XP_007218128.1|  hypothetical protein PRUPE_ppa007082mg             410   1e-138   
ref|XP_002264185.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1     410   2e-138   Vitis vinifera
ref|XP_010315275.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    409   2e-138   
ref|XP_006346483.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    409   3e-138   
ref|XP_010056501.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    409   5e-138   
ref|XP_010056500.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    409   6e-138   
ref|XP_011010738.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    408   7e-138   
ref|XP_002526525.1|  3-hydroxybutyryl-CoA dehydratase, putative         408   9e-138   Ricinus communis
ref|XP_006464337.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    408   1e-137   
ref|XP_009794378.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    409   1e-137   
ref|XP_008438232.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    408   1e-137   
ref|XP_002320577.1|  beta-hydroxyisobutyryl-coa hydrolase 1 famil...    407   4e-137   Populus trichocarpa [western balsam poplar]
ref|XP_004155771.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    404   3e-136   
ref|XP_008232232.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1     404   5e-136   
ref|XP_010056506.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    404   5e-136   
gb|KCW73281.1|  hypothetical protein EUGRSUZ_E01740                     403   6e-136   
ref|NP_001032155.1|  beta-hydroxyisobutyryl-CoA hydrolase 1             400   2e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010269989.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    403   3e-135   
ref|XP_007032271.1|  Beta-hydroxyisobutyryl-CoA hydrolase 1 isofo...    402   3e-135   
ref|XP_004133945.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    401   4e-135   
ref|NP_001078804.1|  beta-hydroxyisobutyryl-CoA hydrolase 1             400   5e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004307307.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    401   6e-135   
ref|XP_006445517.1|  hypothetical protein CICLE_v10020614mg             399   2e-134   
ref|XP_008344949.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    399   2e-134   
ref|NP_201395.1|  beta-hydroxyisobutyryl-CoA hydrolase 1                398   5e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865093.1|  beta-hydroxyisobutyryl-CoA hydrolase 1             398   8e-134   
ref|XP_008344943.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    397   1e-133   
ref|XP_006464338.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    396   4e-133   
ref|XP_010056502.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    395   7e-133   
ref|XP_010056510.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    395   7e-133   
ref|XP_010466396.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1     395   1e-132   
ref|XP_010444863.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    395   1e-132   
ref|XP_008796305.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    393   3e-132   
ref|XP_010056503.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    394   3e-132   
ref|XP_006409992.1|  hypothetical protein EUTSA_v10016849mg             391   4e-132   
ref|XP_010484711.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    393   6e-132   
ref|XP_006393782.1|  hypothetical protein EUTSA_v10004415mg             393   6e-132   
ref|XP_008796304.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    392   2e-131   
ref|XP_009130576.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    392   2e-131   
ref|XP_006409993.1|  hypothetical protein EUTSA_v10016849mg             390   5e-131   
gb|KCW73273.1|  hypothetical protein EUGRSUZ_E01732                     391   1e-130   
ref|XP_010654808.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    388   2e-130   
gb|KCW73269.1|  hypothetical protein EUGRSUZ_E01729                     389   5e-130   
gb|KDO85360.1|  hypothetical protein CISIN_1g016920mg                   387   7e-130   
gb|AAF01467.1|AF190450_1  enoyl-CoA-hydratase                           385   2e-129   Avicennia marina
emb|CDY55104.1|  BnaA02g34880D                                          387   2e-129   
ref|XP_010919879.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    386   4e-129   
ref|XP_011093455.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    387   5e-129   
emb|CDY57769.1|  BnaC02g45100D                                          385   5e-129   
ref|XP_010056508.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    386   8e-129   
ref|XP_010056507.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    386   9e-129   
ref|XP_009400739.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    385   1e-128   
ref|XP_006391376.1|  hypothetical protein EUTSA_v10019437mg             384   2e-128   
ref|XP_010056499.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    384   5e-128   
ref|XP_010056498.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    384   5e-128   
gb|EEE62843.1|  hypothetical protein OsJ_17646                          382   1e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008349454.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    381   4e-127   
ref|XP_006296089.1|  hypothetical protein CARUB_v10025239mg             381   4e-127   
gb|AAC02737.1|  3-hydroxyisobutyryl-coenzyme A hydrolase                380   9e-127   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180624.2|  probable 3-hydroxyisobutyryl-CoA hydrolase 3          380   9e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009400737.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    380   1e-126   
dbj|BAJ97394.1|  predicted protein                                      377   1e-126   
ref|XP_010670002.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    379   2e-126   
ref|XP_004983577.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    379   3e-126   
ref|XP_010097719.1|  3-hydroxyisobutyryl-CoA hydrolase 1                379   3e-126   
ref|XP_010275254.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    379   4e-126   
gb|EEC78762.1|  hypothetical protein OsI_18988                          379   1e-125   Oryza sativa Indica Group [Indian rice]
ref|XP_006339518.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    375   4e-125   
gb|ABA97000.2|  3-hydroxyisobutyryl-coenzyme A hydrolase, putativ...    375   5e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006598670.1|  PREDICTED: peroxisomal 3-hydroxyisobutyryl-c...    375   6e-125   
ref|XP_010235022.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    375   7e-125   
ref|XP_010526531.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxyiso...    374   2e-124   
gb|ABA96999.2|  3-hydroxyisobutyryl-coenzyme A hydrolase, putativ...    379   3e-124   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ94413.1|  predicted protein                                      374   3e-124   
ref|XP_006662093.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    374   3e-124   
dbj|BAJ89600.1|  predicted protein                                      373   3e-124   
ref|NP_001066529.1|  Os12g0264500                                       376   7e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010469817.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    372   8e-124   
ref|NP_001238393.1|  peroxisomal 3-hydroxyisobutyryl-coenzyme A h...    372   1e-123   
ref|XP_009130579.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    371   1e-123   
dbj|BAJ86945.1|  predicted protein                                      373   1e-123   
ref|XP_002881122.1|  hypothetical protein ARALYDRAFT_481983             372   3e-123   
ref|XP_007032272.1|  Beta-hydroxyisobutyryl-CoA hydrolase 1 isofo...    369   5e-123   
ref|XP_004510202.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    370   5e-123   
ref|XP_010469815.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    370   8e-123   
ref|XP_010510320.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    369   2e-122   
ref|XP_002881124.1|  predicted protein                                  369   2e-122   
gb|ABA96998.2|  3-hydroxyisobutyryl-coenzyme A hydrolase, putativ...    377   3e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004979608.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    369   3e-122   
ref|XP_010510311.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    369   3e-122   
ref|XP_010510312.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    368   4e-122   
ref|XP_010510319.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    368   5e-122   
ref|XP_009144612.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    365   8e-122   
ref|XP_006354671.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    367   9e-122   
ref|XP_006296105.1|  hypothetical protein CARUB_v10025256mg             367   1e-121   
ref|XP_010510308.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    367   1e-121   
ref|NP_001150059.1|  CHY1                                               368   1e-121   Zea mays [maize]
gb|KEH18077.1|  3-hydroxyisobutyryl-CoA hydrolase-like protein          365   1e-121   
gb|KEH18076.1|  3-hydroxyisobutyryl-CoA hydrolase-like protein          365   2e-121   
gb|ACF88035.1|  unknown                                                 368   2e-121   Zea mays [maize]
ref|XP_006393781.1|  hypothetical protein EUTSA_v10004415mg             365   5e-121   
gb|KFK23320.1|  hypothetical protein AALP_AAs74635U001000               363   2e-120   
gb|KEH18075.1|  3-hydroxyisobutyryl-CoA hydrolase-like protein          364   2e-120   
ref|XP_006662094.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    363   5e-120   
ref|XP_007134275.1|  hypothetical protein PHAVU_010G033500g             362   7e-120   
ref|XP_010414233.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    361   2e-119   
ref|XP_002464895.1|  hypothetical protein SORBIDRAFT_01g028410          361   3e-119   Sorghum bicolor [broomcorn]
gb|EPS71046.1|  hypothetical protein M569_03711                         360   6e-119   
ref|XP_009413237.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    359   1e-118   
ref|XP_010056511.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    357   2e-118   
gb|AFK49006.1|  unknown                                                 355   3e-118   
ref|XP_009140994.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    357   5e-118   
ref|XP_009140993.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    357   9e-118   
ref|NP_180623.3|  probable 3-hydroxyisobutyryl-CoA hydrolase 2          356   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010521551.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    356   2e-117   
emb|CDY62818.1|  BnaC04g56390D                                          357   3e-117   
ref|XP_010521552.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    355   5e-117   
ref|NP_001149842.1|  CHY1                                               355   5e-117   Zea mays [maize]
ref|XP_010056509.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    355   8e-117   
ref|XP_008661977.1|  PREDICTED: CHY1 isoform X1                         355   1e-116   
ref|XP_010521550.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    353   3e-116   
ref|XP_008670921.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    353   5e-116   
gb|EMS52252.1|  3-hydroxyisobutyryl-CoA hydrolase 1                     353   7e-116   
emb|CDX97894.1|  BnaC04g40450D                                          352   1e-115   
ref|XP_009140984.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    350   2e-115   
ref|XP_009144378.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    350   3e-115   
ref|XP_009140983.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    350   4e-115   
ref|XP_009400742.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    349   4e-115   
emb|CDY31775.1|  BnaA04g17110D                                          350   7e-115   
ref|XP_004307340.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    349   1e-114   
ref|XP_008670927.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    349   2e-114   
ref|XP_006295711.1|  hypothetical protein CARUB_v10024830mg             348   3e-114   
ref|XP_006598672.1|  PREDICTED: peroxisomal 3-hydroxyisobutyryl-c...    345   2e-113   
ref|XP_008671962.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    346   2e-113   
gb|ABG21948.1|  3-hydroxyisobutyryl-coenzyme A hydrolase, putativ...    339   6e-112   
ref|XP_011093456.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    340   7e-111   
gb|AAC02736.1|  3-hydroxyisobutyryl-coenzyme A hydrolase                339   2e-110   Arabidopsis thaliana [mouse-ear cress]
gb|ABG21952.1|  3-hydroxyisobutyryl-coenzyme A hydrolase, putativ...    337   2e-110   
ref|XP_004979611.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    338   2e-110   
ref|XP_007032274.1|  Beta-hydroxyisobutyryl-CoA hydrolase 1 isofo...    337   3e-110   
ref|XP_010275255.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    336   8e-110   
gb|EMT23500.1|  3-hydroxyisobutyryl-CoA hydrolase, mitochondrial        336   1e-109   
ref|XP_006847711.1|  hypothetical protein AMTR_s00149p00076580          335   4e-109   
tpg|DAA42436.1|  TPA: hypothetical protein ZEAMMB73_297463              330   7e-109   
ref|XP_006598671.1|  PREDICTED: peroxisomal 3-hydroxyisobutyryl-c...    333   1e-108   
ref|XP_010557242.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    332   3e-108   
tpg|DAA62255.1|  TPA: hypothetical protein ZEAMMB73_093839              331   1e-106   
ref|XP_002272772.2|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    326   2e-105   Vitis vinifera
ref|XP_010659005.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    324   2e-104   
ref|XP_010659007.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    323   3e-104   
ref|XP_009368998.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxyiso...    324   3e-104   
ref|XP_006346484.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    319   8e-104   
ref|XP_007219433.1|  hypothetical protein PRUPE_ppa020598mg             322   9e-104   
ref|XP_006295586.1|  hypothetical protein CARUB_v10024694mg             315   2e-103   
ref|XP_010659004.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    321   3e-103   
ref|XP_008233262.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    320   3e-103   
emb|CDY45439.1|  BnaA05g12620D                                          319   9e-103   
ref|XP_010659050.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    318   1e-102   
emb|CDY31769.1|  BnaA04g17050D                                          318   2e-102   
ref|XP_006281790.1|  hypothetical protein CARUB_v10027960mg             314   5e-102   
ref|XP_010473946.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    315   3e-101   
ref|XP_007218119.1|  hypothetical protein PRUPE_ppa007004mg             313   1e-100   
emb|CDP09332.1|  unnamed protein product                                307   1e-100   
ref|XP_006847719.1|  hypothetical protein AMTR_s00149p00080400          311   2e-100   
emb|CBI29142.3|  unnamed protein product                                310   2e-99    
ref|XP_007032273.1|  Beta-hydroxyisobutyryl-CoA hydrolase 1 isofo...    305   2e-98    
ref|XP_011013666.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    306   7e-98    
ref|XP_004308348.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    303   1e-96    
ref|XP_004307250.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    302   4e-96    
ref|XP_007043249.1|  Beta-hydroxyisobutyryl-CoA hydrolase 1             301   1e-95    
ref|XP_001766245.1|  predicted protein                                  300   2e-95    
ref|XP_002315058.2|  hypothetical protein POPTR_0010s17730g             300   8e-95    Populus trichocarpa [western balsam poplar]
emb|CBI29141.3|  unnamed protein product                                298   2e-94    
ref|XP_010659001.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    297   3e-94    
ref|XP_002271707.2|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    295   1e-93    Vitis vinifera
ref|XP_006371811.1|  hypothetical protein POPTR_0018s03870g             295   3e-93    
ref|XP_011045035.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    293   7e-93    
ref|XP_003636198.1|  3-hydroxyisobutyryl-CoA hydrolase                  286   1e-92    
ref|XP_006371812.1|  hypothetical protein POPTR_0018s03880g             292   2e-92    
ref|XP_001783594.1|  predicted protein                                  292   5e-92    
ref|XP_011045038.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    291   6e-92    
gb|KDP34950.1|  hypothetical protein JCGZ_09238                         290   1e-91    
ref|XP_010040328.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    289   1e-91    
ref|XP_010659006.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    289   1e-91    
ref|XP_010040327.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    289   4e-91    
ref|XP_006382191.1|  hypothetical protein POPTR_0006s29210g             288   6e-91    
ref|XP_006371855.1|  hypothetical protein POPTR_0018s04360g             286   1e-90    
gb|EEE51449.1|  hypothetical protein OsJ_32549                          285   3e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004308320.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    286   7e-90    
gb|KCW83008.1|  hypothetical protein EUGRSUZ_C04390                     283   1e-89    
ref|XP_010040325.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    285   2e-89    
ref|XP_001754416.1|  predicted protein                                  283   7e-89    
ref|XP_011008675.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    283   8e-89    
ref|XP_007221107.1|  hypothetical protein PRUPE_ppa017859mg             285   1e-88    
ref|XP_011091891.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    282   1e-88    
ref|XP_011091890.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    281   2e-88    
ref|XP_011091888.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    281   3e-88    
ref|XP_010050121.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    281   5e-88    
ref|XP_008354071.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    277   5e-88    
ref|XP_003636506.1|  70 kDa peptidyl-prolyl isomerase                   289   3e-87    
emb|CBI29144.3|  unnamed protein product                                274   4e-87    
emb|CDY45442.1|  BnaA05g12590D                                          276   6e-87    
ref|XP_004308616.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    278   7e-87    
ref|XP_010051658.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    278   9e-87    
ref|XP_010050119.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    277   2e-86    
gb|KCW45303.1|  hypothetical protein EUGRSUZ_L01029                     274   3e-86    
gb|KCW45305.1|  hypothetical protein EUGRSUZ_L01034                     271   2e-85    
ref|XP_007052212.1|  ATP-dependent caseinolytic protease/crotonas...    271   5e-84    
ref|XP_006354674.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    267   6e-84    
gb|KCW83005.1|  hypothetical protein EUGRSUZ_C04388                     271   8e-84    
emb|CDP02987.1|  unnamed protein product                                271   8e-84    
ref|XP_007052211.1|  ATP-dependent caseinolytic (Clp) protease/cr...    270   9e-84    
ref|XP_008670925.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    265   9e-84    
ref|XP_008670923.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    266   5e-83    
ref|XP_006346689.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    268   5e-83    
gb|KCW73142.1|  hypothetical protein EUGRSUZ_E01595                     266   1e-82    
gb|AFW56432.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...    259   3e-82    
gb|KCW73141.1|  hypothetical protein EUGRSUZ_E01595                     265   4e-82    
ref|XP_010070260.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    265   7e-82    
ref|XP_010264357.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    265   8e-82    
ref|XP_011008669.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    263   9e-82    
ref|XP_010056417.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    266   1e-81    
ref|XP_011008676.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    264   2e-81    
emb|CBI29135.3|  unnamed protein product                                263   2e-81    
ref|XP_010264353.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    264   2e-81    
ref|XP_010321273.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    263   3e-81    
ref|XP_011093291.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    263   5e-81    
ref|XP_006402575.1|  hypothetical protein EUTSA_v10006020mg             263   5e-81    
ref|XP_011091889.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    261   1e-80    
ref|XP_002511633.1|  catalytic, putative                                263   1e-80    Ricinus communis
ref|XP_006576746.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    263   1e-80    
emb|CDP09492.1|  unnamed protein product                                262   2e-80    
ref|XP_010661350.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    261   3e-80    
ref|XP_002274299.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    261   3e-80    Vitis vinifera
ref|XP_003521086.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    261   4e-80    
ref|XP_010524414.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    259   2e-79    
gb|KDO85623.1|  hypothetical protein CISIN_1g015820mg                   257   3e-79    
gb|KDO85626.1|  hypothetical protein CISIN_1g015820mg                   257   3e-79    
ref|XP_006445354.1|  hypothetical protein CICLE_v10020245mg             258   5e-79    
ref|XP_007134535.1|  hypothetical protein PHAVU_010G055600g             258   6e-79    
ref|XP_010919486.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    256   7e-79    
gb|KDO85624.1|  hypothetical protein CISIN_1g015820mg                   257   8e-79    
ref|XP_006375251.1|  hypothetical protein POPTR_0014s05650g             257   9e-79    
ref|XP_006464471.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    257   1e-78    
ref|XP_007043244.1|  Beta-hydroxyisobutyryl-CoA hydrolase 1, puta...    261   2e-78    
gb|KDO85622.1|  hypothetical protein CISIN_1g015820mg                   256   3e-78    
ref|XP_009624808.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    256   3e-78    
ref|XP_006445355.1|  hypothetical protein CICLE_v10020245mg             257   3e-78    
ref|XP_008232553.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    256   4e-78    
ref|XP_006375252.1|  enoyl-CoA hydratase/isomerase family protein       256   4e-78    
ref|XP_004307143.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    255   4e-78    
ref|XP_010919485.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    256   5e-78    
ref|XP_011033133.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    256   6e-78    
ref|XP_006477172.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    254   7e-78    
ref|XP_007218094.1|  hypothetical protein PRUPE_ppa006573mg             255   8e-78    
gb|KDP28818.1|  hypothetical protein JCGZ_14589                         255   8e-78    
ref|XP_008375791.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    255   1e-77    
ref|XP_007039803.1|  ATP-dependent caseinolytic protease/crotonas...    253   1e-77    
ref|XP_008375789.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    254   1e-77    
ref|XP_006440294.1|  hypothetical protein CICLE_v10020604mg             253   2e-77    
emb|CDX98420.1|  BnaC06g17810D                                          254   3e-77    
dbj|BAH57037.1|  AT5G65940                                              247   3e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104265.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    254   3e-77    
emb|CDX67831.1|  BnaA07g18710D                                          254   3e-77    
ref|XP_009373193.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    254   3e-77    
ref|XP_009373192.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    253   4e-77    
ref|XP_006291254.1|  hypothetical protein CARUB_v10017386mg             253   5e-77    
ref|XP_007039802.1|  ATP-dependent caseinolytic protease/crotonas...    252   8e-77    
ref|XP_008796835.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    253   8e-77    
ref|XP_009396897.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    251   1e-76    
ref|XP_004306970.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    252   1e-76    
ref|XP_002530652.1|  catalytic, putative                                252   1e-76    
gb|KDO85627.1|  hypothetical protein CISIN_1g015820mg                   249   2e-76    
ref|XP_010933711.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    252   2e-76    
ref|XP_004510112.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    251   2e-76    
ref|XP_003626696.1|  3-hydroxyisobutyryl-CoA hydrolase-like protein     251   4e-76    
ref|XP_002283319.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    250   6e-76    
ref|XP_009397870.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    250   9e-76    
gb|KDO85625.1|  hypothetical protein CISIN_1g015820mg                   248   1e-75    
ref|XP_004229773.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    249   1e-75    
ref|XP_011084401.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    250   1e-75    
ref|XP_009799926.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    248   4e-75    
ref|XP_006346690.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    246   4e-75    
ref|XP_006347921.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    248   4e-75    
ref|XP_009397521.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    245   4e-75    
ref|XP_006450284.1|  hypothetical protein CICLE_v10008491mg             247   1e-74    
gb|KHN37089.1|  3-hydroxyisobutyryl-CoA hydrolase-like protein 2,...    246   3e-74    
ref|XP_006600212.1|  PREDICTED: uncharacterized protein LOC100808...    246   4e-74    
ref|XP_006576744.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    247   4e-74    
ref|XP_007222757.1|  hypothetical protein PRUPE_ppa006533mg             246   4e-74    
ref|NP_001242643.1|  uncharacterized protein LOC100808892               246   4e-74    
gb|KDO85629.1|  hypothetical protein CISIN_1g015820mg                   242   4e-74    
ref|XP_009592644.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    245   6e-74    
ref|XP_006576745.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    246   7e-74    
ref|XP_009397519.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    245   8e-74    
ref|XP_010525900.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    245   8e-74    
ref|XP_002266134.2|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    244   9e-74    
ref|XP_008357266.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    245   9e-74    
ref|XP_008220674.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    245   1e-73    
ref|XP_011084400.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    245   2e-73    
ref|NP_001030902.1|  ATP-dependent caseinolytic (Clp) protease/cr...    241   2e-73    
ref|XP_010068816.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    242   2e-73    
ref|XP_010048778.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    243   2e-73    
ref|XP_009347296.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    243   4e-73    
ref|XP_009799925.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    243   4e-73    
emb|CDP07839.1|  unnamed protein product                                242   9e-73    
gb|AAL69373.1|AF462210_1  putative enoyl CoA hydratase                  234   9e-73    
emb|CBI37361.3|  unnamed protein product                                243   9e-73    
ref|XP_010048847.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    241   1e-72    
ref|XP_006338932.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    242   1e-72    
ref|XP_010048777.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    241   2e-72    
gb|AAK00451.1|AC060755_21  putative enoyl-CoA-hydratase                 234   2e-72    
gb|EPS67620.1|  hypothetical protein M569_07156                         240   2e-72    
ref|NP_191610.3|  ATP-dependent caseinolytic (Clp) protease/croto...    241   3e-72    
ref|XP_004139071.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    241   3e-72    
emb|CAN76843.1|  hypothetical protein VITISV_017376                     240   4e-72    
ref|XP_010512382.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    242   5e-72    
ref|XP_009592643.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    240   5e-72    
ref|XP_010068815.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    236   5e-72    
ref|XP_010048845.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    240   6e-72    
gb|KGN66573.1|  hypothetical protein Csa_1G629790                       241   6e-72    
ref|XP_010275829.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    240   6e-72    
ref|XP_002878339.1|  enoyl-CoA hydratase/isomerase family protein       239   7e-72    
ref|XP_002515426.1|  Enoyl-CoA hydratase, mitochondrial precursor...    240   7e-72    
ref|XP_007011716.1|  ATP-dependent caseinolytic (Clp) protease/cr...    239   1e-71    
ref|XP_004291959.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    239   1e-71    
ref|XP_004249576.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    239   1e-71    
ref|XP_004498810.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    239   2e-71    
ref|XP_003588857.1|  3-hydroxyisobutyryl-CoA hydrolase-like protein     239   2e-71    
ref|XP_002982321.1|  hypothetical protein SELMODRAFT_116261             237   3e-71    
ref|XP_002966249.1|  hypothetical protein SELMODRAFT_86180              236   5e-71    
ref|XP_006440293.1|  hypothetical protein CICLE_v10023636mg             236   6e-71    
ref|XP_004145499.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    237   6e-71    
ref|XP_010051659.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    234   7e-71    
ref|XP_006409988.1|  hypothetical protein EUTSA_v10017684mg             229   8e-71    
ref|XP_009108901.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    237   8e-71    
emb|CDY23311.1|  BnaA08g12350D                                          237   8e-71    
gb|KHN35521.1|  3-hydroxyisobutyryl-CoA hydrolase-like protein 2,...    237   9e-71    
ref|XP_009758034.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    237   1e-70    
ref|XP_010437990.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    237   1e-70    
emb|CDY39880.1|  BnaC03g67370D                                          237   1e-70    
ref|XP_009797072.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    229   1e-70    
gb|KDP33513.1|  hypothetical protein JCGZ_07084                         236   2e-70    
ref|XP_002324911.2|  hypothetical protein POPTR_0018s02570g             236   2e-70    
ref|XP_007161086.1|  hypothetical protein PHAVU_001G041800g             236   2e-70    
ref|XP_009799924.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    236   3e-70    
ref|XP_010432813.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    236   3e-70    
ref|XP_010413548.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    235   3e-70    
ref|XP_003544564.2|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    237   3e-70    
ref|XP_010447544.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    236   3e-70    
ref|XP_003574307.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    236   4e-70    
ref|XP_006412552.1|  hypothetical protein EUTSA_v10025339mg             235   5e-70    
gb|KHG03397.1|  hypothetical protein F383_08786                         234   7e-70    
ref|XP_009592426.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    234   9e-70    
ref|XP_008452850.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    234   1e-69    
ref|XP_002867278.1|  enoyl-CoA hydratase/isomerase family protein       234   1e-69    
ref|XP_010557148.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    233   1e-69    
ref|XP_011082166.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    233   2e-69    
ref|XP_010667590.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    233   3e-69    
gb|EFN70862.1|  3-hydroxyisobutyryl-CoA hydrolase, mitochondrial        231   5e-69    
ref|XP_001605591.2|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    232   5e-69    
ref|NP_194909.2|  ATP-dependent caseinolytic (Clp) protease/croto...    232   6e-69    
gb|EMT19260.1|  3-hydroxyisobutyryl-CoA hydrolase, mitochondrial        232   7e-69    
ref|XP_011016484.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    232   7e-69    
gb|KEH33555.1|  3-hydroxyisobutyryl-CoA hydrolase-like protein          231   9e-69    
ref|XP_006600102.1|  PREDICTED: probable 3-hydroxyisobutyryl-CoA ...    226   1e-68    
ref|XP_008450306.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    231   1e-68    
ref|NP_001065466.1|  Os10g0572800                                       224   2e-68    
dbj|BAK03131.1|  predicted protein                                      231   2e-68    
gb|EFZ13911.1|  hypothetical protein SINV_00270                         231   2e-68    
ref|XP_011033141.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    229   2e-68    
ref|XP_009799923.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    231   3e-68    
ref|XP_006464472.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    229   3e-68    
ref|XP_011082898.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    229   3e-68    
ref|NP_001239687.1|  uncharacterized protein LOC100818188               230   4e-68    
ref|XP_006450282.1|  hypothetical protein CICLE_v10008491mg             226   6e-68    
ref|XP_006282612.1|  hypothetical protein CARUB_v10004830mg             231   6e-68    
ref|XP_006601850.1|  PREDICTED: uncharacterized protein LOC100818...    228   1e-67    
ref|XP_002526648.1|  Enoyl-CoA hydratase, mitochondrial precursor...    228   1e-67    
ref|NP_172142.2|  3-hydroxyisobutyryl-CoA hydrolase-like protein 5      228   1e-67    
ref|XP_003704172.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    231   1e-67    
ref|XP_010469172.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    229   2e-67    
gb|EPS73523.1|  hypothetical protein M569_01231                         228   2e-67    
ref|XP_003532090.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    227   3e-67    
ref|XP_011001476.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    228   3e-67    
ref|XP_006369012.1|  hypothetical protein POPTR_0001s15680g             225   4e-67    
emb|CDX86518.1|  BnaC08g01850D                                          226   9e-67    
ref|XP_009600088.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    226   9e-67    
ref|XP_003692090.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    226   1e-66    
ref|NP_001190144.1|  ATP-dependent caseinolytic (Clp) protease/cr...    227   1e-66    
ref|XP_002892348.1|  predicted protein                                  226   1e-66    
gb|KDO61410.1|  hypothetical protein CISIN_1g0169552mg                  224   2e-66    
ref|XP_006662587.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    226   2e-66    
ref|XP_009773946.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    224   3e-66    
ref|XP_003626697.1|  3-hydroxyisobutyryl-CoA hydrolase-like protein     224   3e-66    
ref|XP_009416536.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    224   3e-66    
gb|KCW65136.1|  hypothetical protein EUGRSUZ_G02639                     223   3e-66    
ref|XP_004499976.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    224   4e-66    
gb|EYU29214.1|  hypothetical protein MIMGU_mgv1a006352mg                226   5e-66    
emb|CDY15584.1|  BnaA08g28680D                                          224   6e-66    
ref|XP_007529071.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    223   7e-66    
ref|XP_011050850.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    223   8e-66    
ref|XP_003400983.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    223   1e-65    
ref|XP_009592425.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    224   1e-65    
ref|XP_011050849.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    223   1e-65    
gb|EEC67414.1|  hypothetical protein OsI_34593                          224   1e-65    
ref|XP_004763453.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    221   2e-65    
gb|EZA57173.1|  3-hydroxyisobutyryl-CoA hydrolase, mitochondrial        223   2e-65    
ref|XP_009110986.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    223   2e-65    
ref|XP_009110987.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    222   2e-65    
ref|XP_002526628.1|  catalytic, putative                                218   2e-65    
ref|XP_006417903.1|  hypothetical protein EUTSA_v10007893mg             222   2e-65    
ref|XP_010413549.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    223   2e-65    
ref|XP_010692124.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    223   2e-65    
gb|KDO67449.1|  hypothetical protein CISIN_1g015492mg                   221   3e-65    
ref|XP_004763446.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    222   3e-65    
gb|EYB91664.1|  hypothetical protein Y032_0203g1825                     222   4e-65    
ref|XP_004763447.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    221   4e-65    
gb|AAB88874.1|  enoyl-CoA hydratase                                     218   4e-65    
ref|XP_009110985.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    222   4e-65    
ref|NP_001065335.2|  Os10g0552900                                       222   5e-65    
gb|KFK29781.1|  hypothetical protein AALP_AA7G178500                    222   6e-65    
ref|XP_003400984.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    223   6e-65    
emb|CDS13704.1|  hypothetical protein LRAMOSA05878                      223   8e-65    
ref|XP_005790514.1|  enoyl-CoA hydratase                                220   8e-65    
ref|XP_009764161.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    220   9e-65    
emb|CDP06150.1|  unnamed protein product                                221   1e-64    
ref|XP_008644182.1|  PREDICTED: hypothetical protein isoform X1         221   1e-64    
ref|XP_010241288.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    221   1e-64    
emb|CDJ93759.1|  Crotonase domain containing protein                    220   1e-64    
ref|XP_006450285.1|  hypothetical protein CICLE_v10008491mg             220   1e-64    
ref|XP_004983714.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    221   2e-64    
ref|XP_008380195.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    220   2e-64    
ref|XP_008052082.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    216   2e-64    
ref|XP_010924378.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    219   3e-64    
ref|XP_002464966.1|  hypothetical protein SORBIDRAFT_01g029600          220   3e-64    
ref|XP_006612321.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    219   4e-64    
ref|XP_008798297.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    219   4e-64    
gb|AAG13484.1|AC026758_21  putative enoyl-CoA-hydratase                 222   4e-64    
emb|CDM84106.1|  unnamed protein product                                219   5e-64    
gb|KDO51886.1|  hypothetical protein CISIN_1g016043mg                   219   5e-64    
ref|XP_011026231.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    219   5e-64    
ref|NP_001044263.1|  Os01g0752200                                       219   5e-64    
gb|EFN86548.1|  3-hydroxyisobutyryl-CoA hydrolase, mitochondrial        219   6e-64    
ref|XP_006612320.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    219   6e-64    
gb|KDO51885.1|  hypothetical protein CISIN_1g016043mg                   219   6e-64    
ref|XP_006484901.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    219   7e-64    
ref|XP_010142375.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    217   7e-64    
ref|XP_006484900.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    219   8e-64    
ref|XP_010475385.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    218   8e-64    
gb|KHG00065.1|  BTB/POZ domain-containing protein NPY1                  228   8e-64    
ref|XP_009764160.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    219   8e-64    
gb|AFK44259.1|  unknown                                                 218   9e-64    
gb|KFO85229.1|  hypothetical protein N320_10335                         217   9e-64    
ref|XP_005095675.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    218   9e-64    
gb|KHG00066.1|  BTB/POZ domain-containing protein NPY1                  228   1e-63    
ref|XP_006864132.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    218   1e-63    
ref|XP_002300870.1|  enoyl-CoA hydratase/isomerase family protein       218   1e-63    
ref|XP_002736257.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    218   1e-63    
ref|XP_006612319.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    219   1e-63    
ref|XP_009356607.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    218   1e-63    
ref|XP_004303884.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    217   2e-63    
gb|EAX10876.1|  3-hydroxyisobutyryl-Coenzyme A hydrolase, isoform...    215   2e-63    
emb|CDH54586.1|  mitochondrial 3-hydroxyisobutyryl-hydrolase            220   3e-63    
ref|XP_004243624.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    217   3e-63    
ref|XP_008229566.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    216   4e-63    
ref|XP_007465033.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    215   4e-63    
ref|XP_010486279.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    216   5e-63    
ref|XP_005324431.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    216   5e-63    
ref|XP_007171529.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    215   5e-63    
ref|XP_004241156.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    217   5e-63    
ref|XP_008997337.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    216   5e-63    
gb|ABK24801.1|  unknown                                                 216   6e-63    
ref|XP_396249.3|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase, m...    216   7e-63    
ref|WP_007675431.1|  enoyl-CoA hydratase                                215   8e-63    
ref|XP_006563706.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    216   8e-63    
ref|XP_001770132.1|  predicted protein                                  216   8e-63    
gb|EGI67778.1|  3-hydroxyisobutyryl-CoA hydrolase, mitochondrial        214   9e-63    
ref|NP_001127380.1|  3-hydroxyisobutyryl-CoA hydrolase, mitochond...    214   9e-63    
ref|XP_007635560.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    214   9e-63    
ref|XP_006356732.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    216   1e-62    
emb|CDJ82017.1|  Crotonase domain containing protein                    215   1e-62    
ref|XP_006346151.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    216   1e-62    
gb|KFH65120.1|  hypothetical protein MVEG_08601                         218   1e-62    
ref|XP_004392462.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    215   1e-62    
ref|XP_010457784.1|  PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase...    216   1e-62    



>ref|XP_009794376.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Nicotiana 
sylvestris]
Length=383

 Score =   454 bits (1168),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 220/280 (79%), Positives = 245/280 (88%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASLSS-NSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MA  SS N   DQVLVEE   VRTFILNR KQLNALS  M+SRLLELF A E+DSNVK+I
Sbjct  1    MAPTSSINGGADQVLVEEISSVRTFILNRPKQLNALSHQMISRLLELFHASERDSNVKII  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            +LK +GRAFCAGGDV+AVVH++R+GNWKLGA+YFR+EFT+NYV+A YSKPQVSILNGIV 
Sbjct  61   ILKGNGRAFCAGGDVTAVVHNVRRGNWKLGADYFREEFTLNYVMATYSKPQVSILNGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAGAS+HGRFRVATEKSVFAMPETALGLFPDVGASYF SRLPGFFGEY GLTG+RLDG
Sbjct  121  GGGAGASVHGRFRVATEKSVFAMPETALGLFPDVGASYFYSRLPGFFGEYAGLTGARLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFVPSERL  LE+AL  +N+SDP +IS IIS FS +PKLKE S Y+ +KI
Sbjct  181  AEMLACGLATHFVPSERLPLLEQALVKVNTSDPDVISTIISRFSHIPKLKEGSSYHKMKI  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            IDRCFSRRT+EEI+ ALESEA N  DDW+SS IQSLKKAS
Sbjct  241  IDRCFSRRTVEEIISALESEALNKNDDWVSSTIQSLKKAS  280



>ref|XP_006354604.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Solanum 
tuberosum]
Length=383

 Score =   446 bits (1148),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 216/277 (78%), Positives = 242/277 (87%), Gaps = 0/277 (0%)
 Frame = +2

Query  77   SLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLK  256
            S S+N  TDQVLVE    VRT ILNR KQLNALS  M+SRLLELF A E DSNVK+I+LK
Sbjct  4    SSSNNGGTDQVLVEVRASVRTMILNRPKQLNALSFPMISRLLELFHASEGDSNVKMIILK  63

Query  257  SSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGG  436
             +GRAFCAGGDV+AVVH++RQGNWKLGA+YFR+EFT+NY++A YSKPQVSILNGIV GGG
Sbjct  64   GNGRAFCAGGDVTAVVHNVRQGNWKLGADYFREEFTLNYLMATYSKPQVSILNGIVMGGG  123

Query  437  AGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEM  616
             GAS+HGRFRVATEKSV AMPETALGLFPDVGASYF SRLPGFFGEY GLTG+RLDGAEM
Sbjct  124  LGASVHGRFRVATEKSVCAMPETALGLFPDVGASYFYSRLPGFFGEYAGLTGARLDGAEM  183

Query  617  LACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDR  796
            LACGLATHFVPSERL  LE+AL  +N+SDP +IS IIS FS +PKLK +SPY+ +KIIDR
Sbjct  184  LACGLATHFVPSERLPFLEQALAKVNTSDPDVISTIISRFSDIPKLKAESPYHKMKIIDR  243

Query  797  CFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            CFSRRTIEEI+ +LE+EA N KDDWISS IQSLKKAS
Sbjct  244  CFSRRTIEEIISSLENEALNKKDDWISSTIQSLKKAS  280



>ref|XP_004229511.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 [Solanum lycopersicum]
Length=383

 Score =   445 bits (1145),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 216/277 (78%), Positives = 243/277 (88%), Gaps = 0/277 (0%)
 Frame = +2

Query  77   SLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLK  256
            S S+N  TDQVLVEE   VRT ILNR KQLNALS  M+SRLLELF A E DSNVK+I+LK
Sbjct  4    SSSNNGGTDQVLVEERASVRTIILNRPKQLNALSFPMISRLLELFHASEGDSNVKMIILK  63

Query  257  SSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGG  436
             +GR+FCAGGDV+AVV ++RQGNWKLGA+YFR+EFT+NY++A YSKPQVSILNGIV GGG
Sbjct  64   GNGRSFCAGGDVTAVVRNVRQGNWKLGADYFREEFTLNYLMATYSKPQVSILNGIVMGGG  123

Query  437  AGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEM  616
             GAS+HGRFRVATEKSV AMPETALGLFPDVGASYF SRLPGFFGEY GLTG+RLDGAEM
Sbjct  124  LGASVHGRFRVATEKSVCAMPETALGLFPDVGASYFYSRLPGFFGEYAGLTGARLDGAEM  183

Query  617  LACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDR  796
            LACGLATHFVPSERL  LE+AL  +N+SDP +IS IIS FS +PKLK +SPY+ +KIIDR
Sbjct  184  LACGLATHFVPSERLPFLEQALAKVNTSDPYVISTIISRFSDMPKLKAESPYHKMKIIDR  243

Query  797  CFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            CFSRRTIEEI+ +LE+EA N KDDWISSAIQSLKKAS
Sbjct  244  CFSRRTIEEIISSLENEALNKKDDWISSAIQSLKKAS  280



>ref|XP_009594714.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Nicotiana 
tomentosiformis]
Length=383

 Score =   436 bits (1122),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 220/280 (79%), Positives = 249/280 (89%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASLSS-NSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MA  SS +  T+QVLVEET  VRTFILNR KQLNALS  M+SRLLELF A E+DSNVK+I
Sbjct  1    MAHTSSIHGGTNQVLVEETSSVRTFILNRPKQLNALSHQMISRLLELFHASERDSNVKMI  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            +LK +GRAFCAGGDV+AVVH++R+GNWKLGA+YFR+EFT+NYV+A YSKPQVSILNGI+ 
Sbjct  61   ILKGNGRAFCAGGDVTAVVHNVRRGNWKLGADYFREEFTLNYVMATYSKPQVSILNGIIM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAGAS+HGRFRVATEKSVFAMPETALGLFPDVGASYF SRLPGFFGEY GLTG+RLDG
Sbjct  121  GGGAGASVHGRFRVATEKSVFAMPETALGLFPDVGASYFYSRLPGFFGEYAGLTGARLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFVPSERL  LE+AL  +N+SDP +ISAIIS FS +PKLK+ SPY+ +KI
Sbjct  181  AEMLACGLATHFVPSERLPLLEQALVKVNTSDPDVISAIISRFSHIPKLKDGSPYHKMKI  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            IDRCFSRRT+EEI+ ALESEA N  DDW+SS IQSLKKAS
Sbjct  241  IDRCFSRRTVEEIISALESEALNKNDDWVSSTIQSLKKAS  280



>ref|XP_002264742.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 isoform X1 [Vitis 
vinifera]
 emb|CBI36345.3| unnamed protein product [Vitis vinifera]
Length=383

 Score =   429 bits (1104),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 205/280 (73%), Positives = 241/280 (86%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASL-SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MA L S+  DTDQVL+++   VRT +LNR +QLNALSS M+S+LLELFLA E+DSNVKL+
Sbjct  1    MAPLGSTRGDTDQVLIDKNLFVRTLVLNRPRQLNALSSQMISKLLELFLAYEEDSNVKLV  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            ++K +GRAFC+GGDV+AVVHDI +GNWK+GA++F +E+ +NYV+A YSKPQVSILNGIV 
Sbjct  61   IMKGNGRAFCSGGDVAAVVHDINRGNWKIGAKFFWEEYILNYVMATYSKPQVSILNGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAGAS+HGRFR+ATE SVFAMPETALGLFPDVGASYFLSR PGFFGEY+GLTG+RLDG
Sbjct  121  GGGAGASVHGRFRIATENSVFAMPETALGLFPDVGASYFLSRFPGFFGEYVGLTGARLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFVPS RL  LE ALH ++SSDP IISA+I E+S  P LK+KS Y+ L I
Sbjct  181  AEMLACGLATHFVPSARLSSLEAALHKLDSSDPAIISAVIDEYSLQPYLKDKSTYHRLDI  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I+RCFSRRTIEEI+ ALE EA    DDWISS IQSL+KAS
Sbjct  241  INRCFSRRTIEEILSALEREAVKSADDWISSTIQSLQKAS  280



>ref|XP_011093458.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Sesamum 
indicum]
Length=379

 Score =   429 bits (1103),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 208/275 (76%), Positives = 235/275 (85%), Gaps = 1/275 (0%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            S+N +TDQVLVEE   VR F LNR KQLNALS  MVSRLLELFL C +DS+VKLI+LK  
Sbjct  3    STNGETDQVLVEEKSSVRVFTLNRPKQLNALSHTMVSRLLELFLDCAEDSSVKLIILKGK  62

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGGDV+AVV D+ QGNWK G +YFRKEFT+NYV+A YSKPQVSILNGIV GGGAG
Sbjct  63   GRAFCAGGDVAAVVRDLTQGNWKSGVDYFRKEFTLNYVMATYSKPQVSILNGIVMGGGAG  122

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
            ASIHGRFR+ATE S+FAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLA
Sbjct  123  ASIHGRFRIATENSLFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGTRLDGAEMLA  182

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATHFV +ERL  LEEAL   +SS+  +IS+II EFS +P LK+ S Y+ L II++CF
Sbjct  183  CGLATHFVQAERLPLLEEALITADSSNSAVISSIIGEFSHIPNLKKNSAYHRLNIINKCF  242

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            SRRT+EEI+  LE EAA+ KDDWISS IQSLKKAS
Sbjct  243  SRRTVEEIIATLEREAAD-KDDWISSTIQSLKKAS  276



>ref|XP_010097720.1| 3-hydroxyisobutyryl-CoA hydrolase 1 [Morus notabilis]
 gb|EXB70675.1| 3-hydroxyisobutyryl-CoA hydrolase 1 [Morus notabilis]
Length=383

 Score =   424 bits (1089),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 202/278 (73%), Positives = 236/278 (85%), Gaps = 0/278 (0%)
 Frame = +2

Query  74   ASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVL  253
            +S SS  + D+VLVEE    RT I NR +QLNALS  M+ R+LELF A EKDSNVKL+++
Sbjct  3    SSNSSPPEEDEVLVEEKLFARTLIFNRTRQLNALSYQMIIRMLELFRAYEKDSNVKLVIV  62

Query  254  KSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGG  433
            K  GRAFCAGGDV+AVV DI++GNW+LGA++FRKEFT+NY+IA YSKPQVSILNGIV GG
Sbjct  63   KGKGRAFCAGGDVAAVVRDIKEGNWRLGADFFRKEFTLNYLIATYSKPQVSILNGIVMGG  122

Query  434  GAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAE  613
            GAG SIHGRFRVATE SVFAMPE ALGLFPDVGASYFLSRLPGFFGEY+GLTGSRLDGAE
Sbjct  123  GAGVSIHGRFRVATENSVFAMPEAALGLFPDVGASYFLSRLPGFFGEYVGLTGSRLDGAE  182

Query  614  MLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIID  793
            MLACGLATHFVPS RL  LEEAL+ ++SSDP I+S II ++SQ P LK KS +  L +ID
Sbjct  183  MLACGLATHFVPSARLSLLEEALYKVDSSDPAIVSEIIDKYSQKPHLKAKSAHLRLDVID  242

Query  794  RCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +CFSRRT+E+I+ +LE EAAN +DDWIS+ IQ+LKKAS
Sbjct  243  KCFSRRTVEDIISSLEREAANRRDDWISATIQTLKKAS  280



>ref|XP_006339517.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Solanum tuberosum]
Length=384

 Score =   421 bits (1081),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/281 (74%), Positives = 236/281 (84%), Gaps = 2/281 (1%)
 Frame = +2

Query  71   MASLSSNS-DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MA  SSN+ +TD+VLVEE G VRTFILNR KQLNALS  M+SRL ELF A E+DSNVK+I
Sbjct  1    MAQTSSNNGETDEVLVEERGSVRTFILNRPKQLNALSFQMISRLTELFYASEEDSNVKMI  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            +LK  GRAFCAGGD+S   H IRQGNW+LGA Y R+++T+ Y+IA Y KPQVSILNGIV 
Sbjct  61   ILKGHGRAFCAGGDLSTPFHIIRQGNWQLGANYLREQYTLIYMIATYRKPQVSILNGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG SIHGRFRVATEKSVFAMPETA+GLFPDVG+SYFLSRLPGFFGEY GLTGSR DG
Sbjct  121  GGGAGVSIHGRFRVATEKSVFAMPETAMGLFPDVGSSYFLSRLPGFFGEYAGLTGSRFDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFV S++L  LE+ L  +N+SDP  ISAIIS FS +PKLKE SPY+ +KI
Sbjct  181  AEMLACGLATHFVSSDKLPLLEQELVKVNTSDPDAISAIISRFSHIPKLKEGSPYHKMKI  240

Query  788  IDRCFSRRTIEEIMVALESEAANYK-DDWISSAIQSLKKAS  907
            IDRCFSRRTIEEI+  LE+EA + K +DWISS IQ LKKAS
Sbjct  241  IDRCFSRRTIEEIISTLENEALDKKEEDWISSTIQLLKKAS  281



>ref|XP_010269990.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Nelumbo nucifera]
Length=382

 Score =   417 bits (1073),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 203/279 (73%), Positives = 231/279 (83%), Gaps = 0/279 (0%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MA  S + +TDQVLVEE  CVRT ILNR +QLNALS  MVS+LLELF+  E+DSNVKL++
Sbjct  1    MAVQSVSGNTDQVLVEEHSCVRTIILNRPRQLNALSFQMVSQLLELFITYEEDSNVKLVI  60

Query  251  LKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFG  430
            LK  GRAFCAGGDV+AV  DI +GNWKLGA++F  EFT+NY++A Y K QVSILNGIVFG
Sbjct  61   LKGEGRAFCAGGDVAAVARDINEGNWKLGAKFFWNEFTLNYIMATYRKAQVSILNGIVFG  120

Query  431  GGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGA  610
            GGAGASIHGRFRVATE SVFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDG 
Sbjct  121  GGAGASIHGRFRVATENSVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGV  180

Query  611  EMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKII  790
            EMLACGLATHFV + RL  LEEAL  +N+SDP ++SAIISEFS+   LK  S Y+   II
Sbjct  181  EMLACGLATHFVSAMRLPLLEEALFKVNTSDPAVVSAIISEFSEQSSLKATSSYHRQDII  240

Query  791  DRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +RCFSRRT+EEI+ ALE EAA   D W+S  IQSLKKAS
Sbjct  241  ERCFSRRTVEEILSALEEEAATGADKWLSETIQSLKKAS  279



>ref|XP_009794380.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X3 
[Nicotiana sylvestris]
Length=344

 Score =   412 bits (1059),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 207/295 (70%), Positives = 240/295 (81%), Gaps = 3/295 (1%)
 Frame = +2

Query  29   SLGSSFHAE*TNRSMASLSSNSD-TDQVLVEETGC-VRTFILNRQKQLNALSSAMVSRLL  202
            S GS F       +MA  SSN+  TDQVLVEET   VRTFILNR  +LNALS  M+SRLL
Sbjct  18   SPGSKFPCS-ARTTMAEASSNNGGTDQVLVEETSSSVRTFILNRPNKLNALSYEMLSRLL  76

Query  203  ELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIA  382
            ELF A E+DSNVK+I+LK +GRAFCAGGDV+AVV   RQGNWK G  YF++ + +NYV+A
Sbjct  77   ELFYASEQDSNVKMIILKGNGRAFCAGGDVTAVVPLARQGNWKFGDNYFQEGYILNYVMA  136

Query  383  AYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPG  562
             YSKPQVSILNGIV GGGAG S+ GRFRVATEKSVFAMPETALG FPD+GASY LSRLPG
Sbjct  137  TYSKPQVSILNGIVMGGGAGVSVPGRFRVATEKSVFAMPETALGFFPDIGASYCLSRLPG  196

Query  563  FFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQ  742
            FFGEY GLTG+RLDGAEMLACGLATHFV  ERL  LE+AL  +++SDP +I+AIIS FS 
Sbjct  197  FFGEYAGLTGARLDGAEMLACGLATHFVSLERLPLLEQALVKVSTSDPNVITAIISRFSH  256

Query  743  VPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
             PKLK++SPY+ +KII++CFSRRTIEEI+  LE+EA + KDDWISS +Q LKKAS
Sbjct  257  APKLKKESPYHKMKIINQCFSRRTIEEIISTLENEALDKKDDWISSTVQLLKKAS  311



>gb|EYU42298.1| hypothetical protein MIMGU_mgv1a008208mg [Erythranthe guttata]
Length=381

 Score =   412 bits (1058),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 208/279 (75%), Positives = 233/279 (84%), Gaps = 1/279 (0%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MAS    + TDQVLVEE    R F +NR KQLNALS+AMVSRLL+LFLAC  DS+VKLI+
Sbjct  1    MASTHEQT-TDQVLVEEKSSARIFTMNRPKQLNALSAAMVSRLLDLFLACAGDSSVKLII  59

Query  251  LKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFG  430
            LK  GRAFCAGGDV+AVVHDI QGNWK GA+YFRKEFTMNYV+A YSKPQVSILNGIV G
Sbjct  60   LKGKGRAFCAGGDVAAVVHDINQGNWKRGADYFRKEFTMNYVMATYSKPQVSILNGIVMG  119

Query  431  GGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGA  610
            GG GASIHGRFR+ATE S+FAMPETALGLFPDVGASYFLSRLPGFFGEY GLTG+RLDG 
Sbjct  120  GGGGASIHGRFRIATENSLFAMPETALGLFPDVGASYFLSRLPGFFGEYAGLTGTRLDGP  179

Query  611  EMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKII  790
            EMLACGLATHFV SE+L  LE AL   +SS P +IS+II EFS++P LK  S Y+ L II
Sbjct  180  EMLACGLATHFVRSEKLQLLEAALVKADSSVPAVISSIIDEFSEIPDLKRNSAYHRLNII  239

Query  791  DRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            ++CFSRRT+EEI+ ALE EA   KDD+I+S IQSLKKAS
Sbjct  240  NKCFSRRTVEEIISALEREADEKKDDFITSTIQSLKKAS  278



>ref|XP_006445518.1| hypothetical protein CICLE_v10020614mg [Citrus clementina]
 gb|ESR58758.1| hypothetical protein CICLE_v10020614mg [Citrus clementina]
Length=380

 Score =   411 bits (1057),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 197/275 (72%), Positives = 228/275 (83%), Gaps = 0/275 (0%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            S+ S  DQVL EET  VR   LNR +QLNALS+ M+SRLLELF   E DSNVKL++LK  
Sbjct  3    SAQSQEDQVLEEETSFVRILTLNRPRQLNALSAQMISRLLELFQRYETDSNVKLLILKGK  62

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGGDV+AVVH I +G+W  GA++F KEF +NY++A Y+KPQVSILNGIV GGGAG
Sbjct  63   GRAFCAGGDVAAVVHGINEGDWISGAKFFSKEFILNYLMATYTKPQVSILNGIVMGGGAG  122

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
             SIHGRFRVATE SVFAMPETALGLFPD+GASYFLSRLPGFFGEY+GLTG+RLDGAEM A
Sbjct  123  VSIHGRFRVATENSVFAMPETALGLFPDIGASYFLSRLPGFFGEYVGLTGARLDGAEMRA  182

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATHFVPS RL  LEEAL+ +NSSDP +ISA+I +FS  P LK+ S Y+ + +ID+CF
Sbjct  183  CGLATHFVPSSRLALLEEALYKVNSSDPAVISAVIDKFSLEPYLKDHSAYHWMDVIDKCF  242

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            SRRT+EEI+ ALESE+ N  D WIS AIQSLKKAS
Sbjct  243  SRRTVEEILSALESESTNRADAWISDAIQSLKKAS  277



>gb|KDP32479.1| hypothetical protein JCGZ_13404 [Jatropha curcas]
Length=383

 Score =   411 bits (1056),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 200/280 (71%), Positives = 232/280 (83%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASLSS-NSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MA+L+S     +QVL+EE    RT ILNR KQLNALS  MV+ LLE FLA E+D NVK I
Sbjct  1    MAALTSARGQQEQVLLEENLSARTLILNRPKQLNALSYQMVTFLLEHFLAYEEDPNVKFI  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            VLK +GRAFCAGGDVSAVV DIR+GNW+LGA +F KE+ +NYV+A Y+KPQVSILNGIV 
Sbjct  61   VLKGNGRAFCAGGDVSAVVRDIREGNWRLGANFFEKEYMLNYVMATYTKPQVSILNGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAGAS+HGRFRVATE S+FAMPETALGLFPDVGA+YFLSRLPGFFGEY+GLTG+RLDG
Sbjct  121  GGGAGASMHGRFRVATENSIFAMPETALGLFPDVGATYFLSRLPGFFGEYVGLTGARLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFVPSE L  LEEAL+  ++SDP IIS II E+SQ P LKE+S Y+ L++
Sbjct  181  AEMLACGLATHFVPSENLSLLEEALYKADTSDPAIISLIIDEYSQQPYLKEQSTYHRLEV  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            IDRCFS+RT+E+I+  LE E  N  D WI + IQSLKKAS
Sbjct  241  IDRCFSQRTVEDILSTLERETMNNADAWILTTIQSLKKAS  280



>ref|XP_009794379.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Nicotiana sylvestris]
Length=380

 Score =   410 bits (1055),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 207/295 (70%), Positives = 240/295 (81%), Gaps = 3/295 (1%)
 Frame = +2

Query  29   SLGSSFHAE*TNRSMASLSSNSD-TDQVLVEETGC-VRTFILNRQKQLNALSSAMVSRLL  202
            S GS F       +MA  SSN+  TDQVLVEET   VRTFILNR  +LNALS  M+SRLL
Sbjct  18   SPGSKFPCS-ARTTMAEASSNNGGTDQVLVEETSSSVRTFILNRPNKLNALSYEMLSRLL  76

Query  203  ELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIA  382
            ELF A E+DSNVK+I+LK +GRAFCAGGDV+AVV   RQGNWK G  YF++ + +NYV+A
Sbjct  77   ELFYASEQDSNVKMIILKGNGRAFCAGGDVTAVVPLARQGNWKFGDNYFQEGYILNYVMA  136

Query  383  AYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPG  562
             YSKPQVSILNGIV GGGAG S+ GRFRVATEKSVFAMPETALG FPD+GASY LSRLPG
Sbjct  137  TYSKPQVSILNGIVMGGGAGVSVPGRFRVATEKSVFAMPETALGFFPDIGASYCLSRLPG  196

Query  563  FFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQ  742
            FFGEY GLTG+RLDGAEMLACGLATHFV  ERL  LE+AL  +++SDP +I+AIIS FS 
Sbjct  197  FFGEYAGLTGARLDGAEMLACGLATHFVSLERLPLLEQALVKVSTSDPNVITAIISRFSH  256

Query  743  VPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
             PKLK++SPY+ +KII++CFSRRTIEEI+  LE+EA + KDDWISS +Q LKKAS
Sbjct  257  APKLKKESPYHKMKIINQCFSRRTIEEIISTLENEALDKKDDWISSTVQLLKKAS  311



>ref|XP_007218128.1| hypothetical protein PRUPE_ppa007082mg [Prunus persica]
 gb|EMJ19327.1| hypothetical protein PRUPE_ppa007082mg [Prunus persica]
Length=383

 Score =   410 bits (1055),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 199/280 (71%), Positives = 232/280 (83%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASL-SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS  S+  + D VLV++   VRT  LNR +QLNAL+  M+SRLLELFLA EKD NVKL+
Sbjct  1    MASFGSTRREEDSVLVQQNLFVRTLTLNRPRQLNALNFEMISRLLELFLAYEKDDNVKLV  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            ++K  GRAFCAGGDV+AVV  I +GNW+LGA +F+KEFT+NY++A YSKPQVSILNGIV 
Sbjct  61   IVKGKGRAFCAGGDVAAVVRQINEGNWRLGAYFFQKEFTLNYLLATYSKPQVSILNGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAGASIHGRFRVATE SVFAMPETALGLFPDVGASY+LSRLPGFFGEY+GLTG+RLDG
Sbjct  121  GGGAGASIHGRFRVATENSVFAMPETALGLFPDVGASYYLSRLPGFFGEYVGLTGTRLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEML CGLATHFVPS RL  LEEAL  ++SSD  II AII ++SQ P LKEKS Y  + +
Sbjct  181  AEMLVCGLATHFVPSTRLSYLEEALCKVDSSDFNIIQAIIDKYSQNPTLKEKSAYYRMDV  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            ID+CFSRRT+EEI+ ALE EA N  D W++S IQ+LKKAS
Sbjct  241  IDKCFSRRTVEEILSALEKEATNSADAWLTSTIQALKKAS  280



>ref|XP_002264185.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 [Vitis vinifera]
 emb|CBI38098.3| unnamed protein product [Vitis vinifera]
Length=383

 Score =   410 bits (1053),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 198/275 (72%), Positives = 231/275 (84%), Gaps = 0/275 (0%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            S+N D +QVLVEE   +RT ILNR +QLNALS  MVS+LLELF+A E D NVKL++LK +
Sbjct  6    STNGDGEQVLVEENLFLRTLILNRPRQLNALSFQMVSKLLELFVAYEDDCNVKLVILKGN  65

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGGDV+AVV DI  G+W+LGA++F KEF +NYV+A YSKPQVSILNGIV GGGAG
Sbjct  66   GRAFCAGGDVAAVVRDINGGDWRLGAKFFWKEFILNYVMATYSKPQVSILNGIVMGGGAG  125

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
            AS+HGRFR+ATE SVFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLA
Sbjct  126  ASMHGRFRIATENSVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLA  185

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATHFVPS RLL LE AL  ++S  P  IS+I+ E+SQ P LKE S Y+ L +I++CF
Sbjct  186  CGLATHFVPSTRLLLLEAALCKLDSGAPATISSILDEYSQQPHLKENSAYHKLAVINKCF  245

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            SRRTIEEI+  LE EA N  D+WIS+ IQSL+KAS
Sbjct  246  SRRTIEEILSTLEREAVNSADNWISATIQSLQKAS  280



>ref|XP_010315275.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Solanum 
lycopersicum]
Length=379

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/279 (73%), Positives = 233/279 (84%), Gaps = 3/279 (1%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MAS S+N  T+++LVEETG VRTFILNR K LNALSS M+ RL ELF A E+D NVK+I+
Sbjct  1    MAS-SNNGGTNEILVEETGSVRTFILNRPKMLNALSSQMIHRLTELFYASEEDPNVKMII  59

Query  251  LKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFG  430
            LK  GRAFC GGD+S ++  +R  NWK+GA +F K++T+NYV+A YSK QVSILNGIV G
Sbjct  60   LKGQGRAFCVGGDLSLILPSLR--NWKIGANFFLKQYTLNYVMATYSKTQVSILNGIVMG  117

Query  431  GGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGA  610
            GGAGASIHGRFRVATEKSVFAMPET LG FPDVGASYFLSRLPGFFGEY GLTGSRLDGA
Sbjct  118  GGAGASIHGRFRVATEKSVFAMPETVLGHFPDVGASYFLSRLPGFFGEYAGLTGSRLDGA  177

Query  611  EMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKII  790
            EMLACGLATHFV S++L  LE+AL  +NSSDP  ISAIIS FS  P LKE+SPY+ +KII
Sbjct  178  EMLACGLATHFVSSDKLPLLEQALVQVNSSDPDAISAIISCFSHTPNLKEESPYHKMKII  237

Query  791  DRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            + CFSRRTIEEI+  LESEA + KD+WISS IQSLKKAS
Sbjct  238  NHCFSRRTIEEIISTLESEALDKKDEWISSTIQSLKKAS  276



>ref|XP_006346483.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Solanum 
tuberosum]
Length=381

 Score =   409 bits (1052),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 205/280 (73%), Positives = 233/280 (83%), Gaps = 3/280 (1%)
 Frame = +2

Query  71   MASLSSNSD-TDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MA  SSN+  TD+VLVEE+GCVRTFILNR K LNALS  M+SRL ELF A E+D NVK+I
Sbjct  1    MAQTSSNNGGTDEVLVEESGCVRTFILNRPKLLNALSFQMISRLTELFYASEEDPNVKMI  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            +LK  GRAFCAGGDVS      + GNWK GA +  K++T+NYV+A YSK QVSIL+GIV 
Sbjct  61   ILKGHGRAFCAGGDVSLFFQ--KPGNWKTGANFLLKQYTLNYVMATYSKTQVSILDGIVM  118

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAGASIHGRFRVATEKSVFAMPET LG FPDVGASYFLSRLPGFFGEY GLTGSRLDG
Sbjct  119  GGGAGASIHGRFRVATEKSVFAMPETDLGHFPDVGASYFLSRLPGFFGEYAGLTGSRLDG  178

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFV S++L  LE+AL  +N+SD   ISAIIS FS +PKLKE+SP++ +KI
Sbjct  179  AEMLACGLATHFVSSDKLPLLEQALIKVNTSDQDAISAIISRFSHIPKLKEESPHHKMKI  238

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I+RCFSRRTIEEI+  LES+A + KDDWISS IQSLKKAS
Sbjct  239  INRCFSRRTIEEIISTLESKALDKKDDWISSTIQSLKKAS  278



>ref|XP_010056501.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X4 
[Eucalyptus grandis]
Length=383

 Score =   409 bits (1050),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 201/280 (72%), Positives = 230/280 (82%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASLSS-NSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS SS +   DQVLVEE   VR  ILNR KQLNALS  M++RLLELFL  EKDSNVKL+
Sbjct  1    MASFSSRDGQEDQVLVEEKSFVRALILNRPKQLNALSYDMIARLLELFLVYEKDSNVKLV  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            +LK  GRAFCAGGDV+ VV DI  GNWK G  +FRKEFT+NY++A YS+PQVSILNGIV 
Sbjct  61   ILKGKGRAFCAGGDVATVVRDINNGNWKSGEIFFRKEFTLNYLMATYSRPQVSILNGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG SIHG FRVATE SVFAMPETALGLFPD+GASYFLSRLPG FGEYL LTG+RLDG
Sbjct  121  GGGAGCSIHGSFRVATENSVFAMPETALGLFPDIGASYFLSRLPGHFGEYLDLTGARLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFVPS +L  LE AL+ ++S D  IISAII E+S++P LKE+S Y+ L +
Sbjct  181  AEMLACGLATHFVPSAKLPSLEAALYAVDSRDQAIISAIIREYSELPILKEQSAYHRLDV  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I+RCFSRRT+E+I+ ALE EA N  DDWI ++IQSLKKAS
Sbjct  241  INRCFSRRTVEDILSALEREATNKVDDWILASIQSLKKAS  280



>ref|XP_010056500.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X3 
[Eucalyptus grandis]
 gb|KCW73271.1| hypothetical protein EUGRSUZ_E01732 [Eucalyptus grandis]
 gb|KCW73272.1| hypothetical protein EUGRSUZ_E01732 [Eucalyptus grandis]
Length=383

 Score =   409 bits (1050),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 201/280 (72%), Positives = 230/280 (82%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASLSS-NSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS SS +   DQVLVEE   VR  ILNR KQLNALS  M++RLLELFL  EKDSNVKL+
Sbjct  1    MASFSSRDGQEDQVLVEEKSFVRALILNRPKQLNALSYDMIARLLELFLVYEKDSNVKLV  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            +LK  GRAFCAGGDV+ VV DI  GNWK G  +FRKEFT+NY++A YS+PQVSILNGIV 
Sbjct  61   ILKGKGRAFCAGGDVATVVRDINNGNWKSGEIFFRKEFTLNYLMATYSRPQVSILNGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG SIHG FRVATE SVFAMPETALGLFPD+GASYFLSRLPG FGEYL LTG+RLDG
Sbjct  121  GGGAGCSIHGSFRVATENSVFAMPETALGLFPDIGASYFLSRLPGHFGEYLDLTGARLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFVPS +L  LE AL+ ++S D  IISAII E+S++P LKE+S Y+ L +
Sbjct  181  AEMLACGLATHFVPSAKLPSLEAALYAVDSRDQAIISAIIREYSELPILKEQSAYHRLDV  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I+RCFSRRT+E+I+ ALE EA N  DDWI ++IQSLKKAS
Sbjct  241  INRCFSRRTVEDILSALEREATNKVDDWILASIQSLKKAS  280



>ref|XP_011010738.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Populus 
euphratica]
Length=383

 Score =   408 bits (1049),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 198/269 (74%), Positives = 228/269 (85%), Gaps = 0/269 (0%)
 Frame = +2

Query  101  DQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCA  280
            DQVLVE+    +T ILNR KQLNALS  MVSRL ELFLA EKD NVKL++LK +GRAFCA
Sbjct  12   DQVLVEDNSFSKTLILNRPKQLNALSHQMVSRLFELFLAYEKDPNVKLLLLKGNGRAFCA  71

Query  281  GGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGR  460
            GGDV+AVV DIR+ +WK GAEYFRKEFT+NY++A Y+KPQVSIL+GIV GGGAGASIHGR
Sbjct  72   GGDVAAVVRDIREAHWKSGAEYFRKEFTLNYIMATYTKPQVSILDGIVMGGGAGASIHGR  131

Query  461  FRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATH  640
            FRVATE SVFAMPETALGLFPDVGASY+LSRLPGFFGEY+GLTG+RLDGAEML CGLATH
Sbjct  132  FRVATENSVFAMPETALGLFPDVGASYYLSRLPGFFGEYVGLTGARLDGAEMLLCGLATH  191

Query  641  FVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIE  820
             VPS +L  LE+AL N++SSDP  ISAII E+S+ P LK +S Y+ L +ID+CFS RT+E
Sbjct  192  LVPSAKLPLLEKALVNLDSSDPARISAIIDEYSERPYLKGRSAYHWLDVIDKCFSLRTVE  251

Query  821  EIMVALESEAANYKDDWISSAIQSLKKAS  907
             I+ ALE EA N  +DW S+AIQSLKKAS
Sbjct  252  AILSALEKEAVNITEDWFSAAIQSLKKAS  280



>ref|XP_002526525.1| 3-hydroxybutyryl-CoA dehydratase, putative [Ricinus communis]
 gb|EEF35916.1| 3-hydroxybutyryl-CoA dehydratase, putative [Ricinus communis]
Length=384

 Score =   408 bits (1049),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 205/281 (73%), Positives = 232/281 (83%), Gaps = 2/281 (1%)
 Frame = +2

Query  71   MAS-LSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS  S+    +QVLVEE    RT ILNR KQLNALS  M+SRLL+LFLA E+D NVK +
Sbjct  1    MASPTSAEGQNEQVLVEENLFARTLILNRPKQLNALSFKMISRLLDLFLAYEEDPNVKFL  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            VLK +GRAFCAGGDVSAVV DIR+GNW+LGA++F KEF +NYV+A Y+KPQVSILNGIV 
Sbjct  61   VLKGNGRAFCAGGDVSAVVRDIREGNWRLGAKFFEKEFILNYVMATYTKPQVSILNGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAGAS+HGRFRVATE SVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTG+RLDG
Sbjct  121  GGGAGASMHGRFRVATENSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGARLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEML CGLATHFVPS +L  LEEALH I+SSDP IIS+II  + Q P LKE+S Y  L  
Sbjct  181  AEMLTCGLATHFVPSTKLYLLEEALHKIDSSDPDIISSIIDGYCQQPYLKEQSAYCWLHA  240

Query  788  IDRCFSRRTIEEIMVALESEA-ANYKDDWISSAIQSLKKAS  907
            IDRCFS+R++E+I+ ALE EA  N  D WIS+ IQ LKKAS
Sbjct  241  IDRCFSQRSVEDIISALEREAMKNKADAWISTTIQLLKKAS  281



>ref|XP_006464337.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Citrus sinensis]
 gb|KDO85359.1| hypothetical protein CISIN_1g016920mg [Citrus sinensis]
Length=380

 Score =   408 bits (1048),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 196/275 (71%), Positives = 227/275 (83%), Gaps = 0/275 (0%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            S+ S  DQVL EET  VR   LNR +QLNALS+ M+SRLLELF   E DSNVKL++LK  
Sbjct  3    SAQSQEDQVLEEETSFVRILTLNRPRQLNALSAQMISRLLELFQRYETDSNVKLLILKGK  62

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGGDV+AVV  I +G+W  GA++F KEF +NY++A Y+KPQVSILNGIV GGGAG
Sbjct  63   GRAFCAGGDVAAVVRGINEGDWISGAKFFSKEFILNYLMATYTKPQVSILNGIVMGGGAG  122

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
             SIHGRFRVATE SVFAMPETALGLFPD+GASYFLSRLPGFFGEY+GLTG+RLDGAEM A
Sbjct  123  VSIHGRFRVATENSVFAMPETALGLFPDIGASYFLSRLPGFFGEYVGLTGARLDGAEMRA  182

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATHFVPS RL  LEEAL+ +NSSDP +ISA+I +FS  P LK+ S Y+ + +ID+CF
Sbjct  183  CGLATHFVPSSRLALLEEALYKVNSSDPAVISAVIDKFSLEPYLKDHSAYHWMDVIDKCF  242

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            SRRT+EEI+ ALESE+ N  D WIS AIQSLKKAS
Sbjct  243  SRRTVEEILSALESESTNRADAWISDAIQSLKKAS  277



>ref|XP_009794378.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Nicotiana sylvestris]
Length=414

 Score =   409 bits (1051),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 207/295 (70%), Positives = 240/295 (81%), Gaps = 3/295 (1%)
 Frame = +2

Query  29   SLGSSFHAE*TNRSMASLSSNSD-TDQVLVEETGC-VRTFILNRQKQLNALSSAMVSRLL  202
            S GS F       +MA  SSN+  TDQVLVEET   VRTFILNR  +LNALS  M+SRLL
Sbjct  18   SPGSKFPCS-ARTTMAEASSNNGGTDQVLVEETSSSVRTFILNRPNKLNALSYEMLSRLL  76

Query  203  ELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIA  382
            ELF A E+DSNVK+I+LK +GRAFCAGGDV+AVV   RQGNWK G  YF++ + +NYV+A
Sbjct  77   ELFYASEQDSNVKMIILKGNGRAFCAGGDVTAVVPLARQGNWKFGDNYFQEGYILNYVMA  136

Query  383  AYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPG  562
             YSKPQVSILNGIV GGGAG S+ GRFRVATEKSVFAMPETALG FPD+GASY LSRLPG
Sbjct  137  TYSKPQVSILNGIVMGGGAGVSVPGRFRVATEKSVFAMPETALGFFPDIGASYCLSRLPG  196

Query  563  FFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQ  742
            FFGEY GLTG+RLDGAEMLACGLATHFV  ERL  LE+AL  +++SDP +I+AIIS FS 
Sbjct  197  FFGEYAGLTGARLDGAEMLACGLATHFVSLERLPLLEQALVKVSTSDPNVITAIISRFSH  256

Query  743  VPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
             PKLK++SPY+ +KII++CFSRRTIEEI+  LE+EA + KDDWISS +Q LKKAS
Sbjct  257  APKLKKESPYHKMKIINQCFSRRTIEEIISTLENEALDKKDDWISSTVQLLKKAS  311



>ref|XP_008438232.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Cucumis 
melo]
Length=383

 Score =   408 bits (1048),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 204/280 (73%), Positives = 237/280 (85%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASL-SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS  S+ +D DQVLVEE   VR   LNR KQLNALS  MVSRLLELF+A E D +VKL+
Sbjct  1    MASFDSTRTDEDQVLVEEKRFVRLLTLNRTKQLNALSLTMVSRLLELFVAYEADPSVKLV  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            V+K  GRAFCAGGDVSAVVHDI++G+WK GA +F+KEFT NY++A +SKPQVS+L+GIV 
Sbjct  61   VVKGKGRAFCAGGDVSAVVHDIKRGDWKKGAYFFQKEFTFNYLLATFSKPQVSLLDGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG SIHGRFRVATEKSVFAMPETALGLFPDVGASY+LSRLPGFFGEY+GLTG+RLDG
Sbjct  121  GGGAGVSIHGRFRVATEKSVFAMPETALGLFPDVGASYYLSRLPGFFGEYVGLTGARLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFV SERL  LEEAL   ++S+P+IIS+II +FSQ P LKE+S Y+ L +
Sbjct  181  AEMLACGLATHFVTSERLTLLEEALCRADTSEPSIISSIIDKFSQRPILKEQSVYHRLHV  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            ID+CFSRRT+E+I+ ALE EA   KDDWI+S IQ LKKAS
Sbjct  241  IDKCFSRRTVEDILAALEDEALKKKDDWITSTIQDLKKAS  280



>ref|XP_002320577.1| beta-hydroxyisobutyryl-coa hydrolase 1 family protein [Populus 
trichocarpa]
 gb|ABK96642.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE98892.1| beta-hydroxyisobutyryl-coa hydrolase 1 family protein [Populus 
trichocarpa]
Length=383

 Score =   407 bits (1045),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 198/269 (74%), Positives = 228/269 (85%), Gaps = 0/269 (0%)
 Frame = +2

Query  101  DQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCA  280
            DQVLVE+    +T ILNR KQLNALS  MVSRLLELFLA EKD NVKL++LK SGRAFCA
Sbjct  12   DQVLVEDNSFSKTLILNRPKQLNALSHQMVSRLLELFLAYEKDPNVKLLLLKGSGRAFCA  71

Query  281  GGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGR  460
            GGDV+AVV DIR+ +WK GA++F KEFT+NY++A Y+KPQVSIL+GIV GGGAGAS+HGR
Sbjct  72   GGDVAAVVRDIREAHWKSGADFFCKEFTLNYIMATYTKPQVSILDGIVMGGGAGASMHGR  131

Query  461  FRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATH  640
            FRVATE SVFAMPETALGLFPDVGASY+LSRLPGFFGEY+GLTG+RLDGAEML CGLATH
Sbjct  132  FRVATENSVFAMPETALGLFPDVGASYYLSRLPGFFGEYVGLTGARLDGAEMLLCGLATH  191

Query  641  FVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIE  820
             VPS +L  LEEAL N++SSDP  ISAII E+S+ P LK KS Y+ L +ID+CFS RT+E
Sbjct  192  LVPSAKLPLLEEALVNLDSSDPARISAIIDEYSERPYLKGKSAYHRLDVIDKCFSLRTVE  251

Query  821  EIMVALESEAANYKDDWISSAIQSLKKAS  907
             I+ ALE EA N  +DW S+AIQSLKKAS
Sbjct  252  AILSALEKEAVNITEDWFSAAIQSLKKAS  280



>ref|XP_004155771.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Cucumis 
sativus]
Length=384

 Score =   404 bits (1039),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 204/281 (73%), Positives = 238/281 (85%), Gaps = 2/281 (1%)
 Frame = +2

Query  71   MASL-SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLAC-EKDSNVKL  244
            MAS  S+ +D DQVLVEE   VR   LNR KQLNALS  MVSRLLELF+A  E D +VKL
Sbjct  1    MASFNSTRTDEDQVLVEEKRFVRLLTLNRTKQLNALSFTMVSRLLELFVAYDEADPSVKL  60

Query  245  IVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIV  424
            +V+K  GRAFCAGGDVSAVVHDI++G+WK GA +FRKEFT+NY++A +SKPQVS+L+GIV
Sbjct  61   VVVKGKGRAFCAGGDVSAVVHDIKRGDWKKGAYFFRKEFTLNYLLATFSKPQVSLLDGIV  120

Query  425  FGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLD  604
             GGGAG SIHGRFRVATEKSVFAMPETALGLFPDVGASY+LSRLPGFFGEY+GLTG+RLD
Sbjct  121  MGGGAGVSIHGRFRVATEKSVFAMPETALGLFPDVGASYYLSRLPGFFGEYVGLTGARLD  180

Query  605  GAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLK  784
            GAEMLACGLATHFV SE+L  LEEAL   ++S+P+IIS+II +FSQ P LKE+S Y+ L 
Sbjct  181  GAEMLACGLATHFVTSEKLTHLEEALCRADTSEPSIISSIIDKFSQRPILKEQSVYHRLD  240

Query  785  IIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +ID+CFSRRT+E+I+ ALE EA   KDDWI+S IQ LKKAS
Sbjct  241  VIDKCFSRRTVEDILAALEDEALKKKDDWITSTIQDLKKAS  281



>ref|XP_008232232.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 [Prunus mume]
Length=383

 Score =   404 bits (1037),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 230/280 (82%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASL-SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS  S+  + D VLV++   VRT  LNR +QLNAL+  M+S LLELFLA EKD NVKL+
Sbjct  1    MASFGSTRREEDSVLVQQNLFVRTLTLNRPRQLNALNFEMISLLLELFLAYEKDDNVKLV  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            ++K  GRAFCAGGDV+AVV  I +GNW+LGA +F+KEFT+NY++A YSKPQVSILNGIV 
Sbjct  61   IVKGKGRAFCAGGDVAAVVRQINEGNWRLGAHFFQKEFTLNYLLATYSKPQVSILNGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG SIHGRF VATE SVFAMPETALGLFPDVGASY+LSRLPGFFGEY+GLTG+RLDG
Sbjct  121  GGGAGVSIHGRFCVATENSVFAMPETALGLFPDVGASYYLSRLPGFFGEYVGLTGTRLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFVPS RL  LEEAL  ++SSD  II AII ++SQ P LKEKS Y  + +
Sbjct  181  AEMLACGLATHFVPSTRLSLLEEALCKVDSSDFAIIQAIIDKYSQNPTLKEKSAYYKMDV  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            ID+CFSRRT+EEI+ ALE EA N  D W++S IQ+LKKAS
Sbjct  241  IDKCFSRRTVEEILSALEKEATNNADAWLTSTIQALKKAS  280



>ref|XP_010056506.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Eucalyptus 
grandis]
 gb|KCW73280.1| hypothetical protein EUGRSUZ_E01740 [Eucalyptus grandis]
Length=383

 Score =   404 bits (1037),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 196/280 (70%), Positives = 230/280 (82%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASLSSNSDT-DQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS SS++D  DQVLVEE    RT I+NR KQLNA +  M+SR  ELFL  EK+SNVKL+
Sbjct  1    MASFSSSNDQEDQVLVEEKSFARTLIMNRPKQLNAATDYMISRFWELFLLYEKNSNVKLV  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            ++K  GRAFCAGGDV+AVV DI  G W+  A +FR+E+T+NY++A YSKPQVSILNGIV 
Sbjct  61   IIKGKGRAFCAGGDVAAVVRDINNGKWESAAIFFRREYTLNYLMATYSKPQVSILNGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG SIHG FRVATE SVFAMPETALGLFPDVGASYFLSRLPG FGEYLGLTG+RLDG
Sbjct  121  GGGAGCSIHGSFRVATENSVFAMPETALGLFPDVGASYFLSRLPGHFGEYLGLTGARLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFVPS +L  LE ALH ++SSD  +ISAII E+S++P LKE+S Y+ L +
Sbjct  181  AEMLACGLATHFVPSVKLPSLEAALHTVDSSDQAVISAIIGEYSELPMLKEQSAYHRLDV  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I+RCFSRRT+E+I+ ALE EA N  D WI ++IQSLKKAS
Sbjct  241  INRCFSRRTVEDILSALEREATNKVDGWILASIQSLKKAS  280



>gb|KCW73281.1| hypothetical protein EUGRSUZ_E01740 [Eucalyptus grandis]
Length=381

 Score =   403 bits (1036),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 196/280 (70%), Positives = 230/280 (82%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASLSSNSDT-DQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS SS++D  DQVLVEE    RT I+NR KQLNA +  M+SR  ELFL  EK+SNVKL+
Sbjct  1    MASFSSSNDQEDQVLVEEKSFARTLIMNRPKQLNAATDYMISRFWELFLLYEKNSNVKLV  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            ++K  GRAFCAGGDV+AVV DI  G W+  A +FR+E+T+NY++A YSKPQVSILNGIV 
Sbjct  61   IIKGKGRAFCAGGDVAAVVRDINNGKWESAAIFFRREYTLNYLMATYSKPQVSILNGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG SIHG FRVATE SVFAMPETALGLFPDVGASYFLSRLPG FGEYLGLTG+RLDG
Sbjct  121  GGGAGCSIHGSFRVATENSVFAMPETALGLFPDVGASYFLSRLPGHFGEYLGLTGARLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFVPS +L  LE ALH ++SSD  +ISAII E+S++P LKE+S Y+ L +
Sbjct  181  AEMLACGLATHFVPSVKLPSLEAALHTVDSSDQAVISAIIGEYSELPMLKEQSAYHRLDV  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I+RCFSRRT+E+I+ ALE EA N  D WI ++IQSLKKAS
Sbjct  241  INRCFSRRTVEDILSALEREATNKVDGWILASIQSLKKAS  280



>ref|NP_001032155.1| beta-hydroxyisobutyryl-CoA hydrolase 1 [Arabidopsis thaliana]
 gb|AED98129.1| beta-hydroxyisobutyryl-CoA hydrolase 1 [Arabidopsis thaliana]
Length=328

 Score =   400 bits (1028),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 190/272 (70%), Positives = 219/272 (81%), Gaps = 0/272 (0%)
 Frame = +2

Query  92   SDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRA  271
            +   QVLVEE   VR   LNR KQLNALS  M+SRLL+LFLA E+D +VKL++LK  GRA
Sbjct  6    ASQSQVLVEEKSSVRILTLNRPKQLNALSFHMISRLLQLFLAFEEDPSVKLVILKGHGRA  65

Query  272  FCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASI  451
            FCAGGDV+AVV DI QGNW+LGA YF  E+ +NYV+A YSK QVSILNGIV GGGAG S+
Sbjct  66   FCAGGDVAAVVRDINQGNWRLGANYFSSEYMLNYVMATYSKAQVSILNGIVMGGGAGVSV  125

Query  452  HGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGL  631
            HGRFR+ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGL
Sbjct  126  HGRFRIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGL  185

Query  632  ATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRR  811
            ATHFVPS RL  LE  L  INS+DPT  S I+  ++Q P+LK++S Y  L +IDRCFSRR
Sbjct  186  ATHFVPSTRLTALEADLCRINSNDPTFASTILDAYTQHPRLKQQSAYRRLDVIDRCFSRR  245

Query  812  TIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            T+EEI+ ALE EA    D WIS+ IQ+LKK S
Sbjct  246  TVEEIISALEREATQEADGWISATIQALKKGS  277



>ref|XP_010269989.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Nelumbo nucifera]
Length=408

 Score =   403 bits (1035),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 203/305 (67%), Positives = 231/305 (76%), Gaps = 26/305 (9%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MA  S + +TDQVLVEE  CVRT ILNR +QLNALS  MVS+LLELF+  E+DSNVKL++
Sbjct  1    MAVQSVSGNTDQVLVEEHSCVRTIILNRPRQLNALSFQMVSQLLELFITYEEDSNVKLVI  60

Query  251  LK--------------------------SSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFR  352
            LK                            GRAFCAGGDV+AV  DI +GNWKLGA++F 
Sbjct  61   LKVVKFLQYYITMLSAWKFKHLHGLCFQGEGRAFCAGGDVAAVARDINEGNWKLGAKFFW  120

Query  353  KEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVG  532
             EFT+NY++A Y K QVSILNGIVFGGGAGASIHGRFRVATE SVFAMPETALGLFPDVG
Sbjct  121  NEFTLNYIMATYRKAQVSILNGIVFGGGAGASIHGRFRVATENSVFAMPETALGLFPDVG  180

Query  533  ASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTI  712
            ASYFLSRLPGFFGEY+GLTG+RLDG EMLACGLATHFV + RL  LEEAL  +N+SDP +
Sbjct  181  ASYFLSRLPGFFGEYVGLTGARLDGVEMLACGLATHFVSAMRLPLLEEALFKVNTSDPAV  240

Query  713  ISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQS  892
            +SAIISEFS+   LK  S Y+   II+RCFSRRT+EEI+ ALE EAA   D W+S  IQS
Sbjct  241  VSAIISEFSEQSSLKATSSYHRQDIIERCFSRRTVEEILSALEEEAATGADKWLSETIQS  300

Query  893  LKKAS  907
            LKKAS
Sbjct  301  LKKAS  305



>ref|XP_007032271.1| Beta-hydroxyisobutyryl-CoA hydrolase 1 isoform 1 [Theobroma cacao]
 gb|EOY03197.1| Beta-hydroxyisobutyryl-CoA hydrolase 1 isoform 1 [Theobroma cacao]
Length=384

 Score =   402 bits (1032),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 196/279 (70%), Positives = 228/279 (82%), Gaps = 0/279 (0%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MAS  S+    QVLVE     R   LNR KQLNALS  M+SRLLELFLA E+D NVKL++
Sbjct  1    MASSVSSQQDHQVLVEANSSARILSLNRPKQLNALSFQMISRLLELFLAYEEDPNVKLVI  60

Query  251  LKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFG  430
            LK  GRAFCAGGDV+A+V DIR  +W+ GA++F KEFT+NY++AAYSKPQVSILNGIV G
Sbjct  61   LKGKGRAFCAGGDVAALVRDIRGDDWRAGAKFFLKEFTLNYLMAAYSKPQVSILNGIVMG  120

Query  431  GGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGA  610
            GGAGAS+HGRFRVATE SVFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTGSRLDGA
Sbjct  121  GGAGASVHGRFRVATENSVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGSRLDGA  180

Query  611  EMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKII  790
            EMLACGLATHFVPS +L  LE AL  ++SSDP IIS+II ++ + P LKE+S Y  L +I
Sbjct  181  EMLACGLATHFVPSAKLAMLEAALCIVDSSDPVIISSIIDQYCEQPSLKEQSVYKRLDVI  240

Query  791  DRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            DRCFS++T+EEI+ ALE E  +  D WIS+ IQ+LKKAS
Sbjct  241  DRCFSQKTVEEIISALERELVHKMDVWISTTIQTLKKAS  279



>ref|XP_004133945.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Cucumis 
sativus]
 gb|KGN56647.1| hypothetical protein Csa_3G127100 [Cucumis sativus]
Length=384

 Score =   401 bits (1031),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 203/281 (72%), Positives = 237/281 (84%), Gaps = 2/281 (1%)
 Frame = +2

Query  71   MASL-SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLAC-EKDSNVKL  244
            MAS  S+ +D DQVLVEE   VR   LNR KQLNALS  MVSRLLELF+A  E D +VKL
Sbjct  1    MASFDSTRTDEDQVLVEEKRFVRLLTLNRTKQLNALSFTMVSRLLELFVAYDEADPSVKL  60

Query  245  IVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIV  424
            +V+K  GRAFCAGGDVSAVVHDI++G+WK GA +FRKEFT+NY++A +SKPQVS+L+GIV
Sbjct  61   VVVKGKGRAFCAGGDVSAVVHDIKRGDWKKGAYFFRKEFTLNYLLATFSKPQVSLLDGIV  120

Query  425  FGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLD  604
             GGGAG SIHGRFRVATEKSVFAMPETALGLFPDVGASY+LSRLPGFFGEY+GLTG+RLD
Sbjct  121  MGGGAGVSIHGRFRVATEKSVFAMPETALGLFPDVGASYYLSRLPGFFGEYVGLTGARLD  180

Query  605  GAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLK  784
            GAEMLACGLATHFV SE+L  LEEAL   ++S+P+IIS+II +FSQ P LK +S Y+ L 
Sbjct  181  GAEMLACGLATHFVTSEKLTHLEEALCRADTSEPSIISSIIDKFSQRPILKGQSVYHRLD  240

Query  785  IIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +ID+CFSRRT+E+I+ ALE EA   KDDWI+S IQ LKKAS
Sbjct  241  VIDKCFSRRTVEDILAALEDEALKKKDDWITSTIQDLKKAS  281



>ref|NP_001078804.1| beta-hydroxyisobutyryl-CoA hydrolase 1 [Arabidopsis thaliana]
 dbj|BAH19440.1| AT5G65940 [Arabidopsis thaliana]
 gb|AED98130.1| beta-hydroxyisobutyryl-CoA hydrolase 1 [Arabidopsis thaliana]
Length=342

 Score =   400 bits (1027),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 190/268 (71%), Positives = 218/268 (81%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNALS  M+SRLL+LFLA E+D +VKL++LK  GRAFCAG
Sbjct  10   QVLVEEKSSVRILTLNRPKQLNALSFHMISRLLQLFLAFEEDPSVKLVILKGHGRAFCAG  69

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV+AVV DI QGNW+LGA YF  E+ +NYV+A YSK QVSILNGIV GGGAG S+HGRF
Sbjct  70   GDVAAVVRDINQGNWRLGANYFSSEYMLNYVMATYSKAQVSILNGIVMGGGAGVSVHGRF  129

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  130  RIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  189

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS RL  LE  L  INS+DPT  S I+  ++Q P+LK++S Y  L +IDRCFSRRT+EE
Sbjct  190  VPSTRLTALEADLCRINSNDPTFASTILDAYTQHPRLKQQSAYRRLDVIDRCFSRRTVEE  249

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE EA    D WIS+ IQ+LKK S
Sbjct  250  IISALEREATQEADGWISATIQALKKGS  277



>ref|XP_004307307.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Fragaria 
vesca subsp. vesca]
Length=384

 Score =   401 bits (1030),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 194/281 (69%), Positives = 229/281 (81%), Gaps = 2/281 (1%)
 Frame = +2

Query  71   MASLSSNSDTDQ--VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKL  244
            MASL+S+   D   VLV+E  C R   LNR +QLNAL+  M+SRLLE F A E+D+NVKL
Sbjct  1    MASLNSSPRDDDSVVLVQEDFCARIMTLNRTRQLNALNFEMISRLLEFFFAYEEDANVKL  60

Query  245  IVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIV  424
            ++LK  GRAFCAGGDV+AVVHDI +GNW+ GA +FRKEFT+NY++A YSKPQVS+LNGIV
Sbjct  61   VILKGKGRAFCAGGDVAAVVHDINEGNWRSGAHFFRKEFTLNYLMATYSKPQVSLLNGIV  120

Query  425  FGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLD  604
             GGGAGAS+HGRFRVATE +VFAMPETALGLFPDVGASY+LSRLPGFFGEY+GLTG+RLD
Sbjct  121  MGGGAGASVHGRFRVATENTVFAMPETALGLFPDVGASYYLSRLPGFFGEYVGLTGARLD  180

Query  605  GAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLK  784
            GAEMLACGLATHFVPS  L  LE AL  ++SS    I AI+ ++SQ P LKEKS Y+ + 
Sbjct  181  GAEMLACGLATHFVPSTSLPLLEAALCKVDSSVFATIQAILDQYSQHPALKEKSAYHRMD  240

Query  785  IIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            IID+CFSRRT+E I+ ALE EAA   D W+S+ IQSLKKAS
Sbjct  241  IIDKCFSRRTVEGILSALEEEAAKRADGWLSTTIQSLKKAS  281



>ref|XP_006445517.1| hypothetical protein CICLE_v10020614mg [Citrus clementina]
 gb|ESR58757.1| hypothetical protein CICLE_v10020614mg [Citrus clementina]
Length=375

 Score =   399 bits (1026),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/275 (71%), Positives = 225/275 (82%), Gaps = 5/275 (2%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            S+ S  DQVL EET  VR   LNR +QLNALS+ M+SRLLELF   E DSNVKL++LK  
Sbjct  3    SAQSQEDQVLEEETSFVRILTLNRPRQLNALSAQMISRLLELFQRYETDSNVKLLILKGK  62

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGGDV+AVVH I +G     A++F KEF +NY++A Y+KPQVSILNGIV GGGAG
Sbjct  63   GRAFCAGGDVAAVVHGINEG-----AKFFSKEFILNYLMATYTKPQVSILNGIVMGGGAG  117

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
             SIHGRFRVATE SVFAMPETALGLFPD+GASYFLSRLPGFFGEY+GLTG+RLDGAEM A
Sbjct  118  VSIHGRFRVATENSVFAMPETALGLFPDIGASYFLSRLPGFFGEYVGLTGARLDGAEMRA  177

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATHFVPS RL  LEEAL+ +NSSDP +ISA+I +FS  P LK+ S Y+ + +ID+CF
Sbjct  178  CGLATHFVPSSRLALLEEALYKVNSSDPAVISAVIDKFSLEPYLKDHSAYHWMDVIDKCF  237

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            SRRT+EEI+ ALESE+ N  D WIS AIQSLKKAS
Sbjct  238  SRRTVEEILSALESESTNRADAWISDAIQSLKKAS  272



>ref|XP_008344949.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Malus domestica]
Length=383

 Score =   399 bits (1026),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/278 (68%), Positives = 231/278 (83%), Gaps = 0/278 (0%)
 Frame = +2

Query  74   ASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVL  253
            +S S+  + D VLV++   VRT  LNR +QLNAL+  M+SRLLELFLA + D+NVKL+++
Sbjct  3    SSTSTPREEDSVLVQKNLFVRTLTLNRPRQLNALNFDMISRLLELFLAYDDDANVKLLIV  62

Query  254  KSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGG  433
            K  GRAFCAGGDV+AVV  I +GNW+L A +F+KEFT+NY++A YSKPQVSIL+GIV GG
Sbjct  63   KGKGRAFCAGGDVAAVVRQINEGNWRLAAHFFQKEFTLNYLLATYSKPQVSILDGIVMGG  122

Query  434  GAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAE  613
            GAGASIHGRFRVATE SVFAMPETALGLFPDVGASY+LSRLPGFFGEY+GLTG+RLDGAE
Sbjct  123  GAGASIHGRFRVATENSVFAMPETALGLFPDVGASYYLSRLPGFFGEYVGLTGTRLDGAE  182

Query  614  MLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIID  793
            MLACGLATHFVPS RL  LEEAL+ ++SSD   I AII ++SQ P LK+KS Y  + +ID
Sbjct  183  MLACGLATHFVPSIRLSLLEEALNKVDSSDFANIQAIIDKYSQSPALKKKSAYFRMDVID  242

Query  794  RCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +CFSRRT+EEI+ AL+ EA N  DDW++S +Q+L KAS
Sbjct  243  KCFSRRTVEEIISALDEEANNRADDWLTSTVQALTKAS  280



>ref|NP_201395.1| beta-hydroxyisobutyryl-CoA hydrolase 1 [Arabidopsis thaliana]
 sp|Q9LKJ1.1|HIBC1_ARATH RecName: Full=3-hydroxyisobutyryl-CoA hydrolase 1; AltName: Full=CoA-thioester 
hydrolase CHY1 [Arabidopsis thaliana]
 gb|AAF77193.1|AF276301_1 CoA-thioester hydrolase CHY1 [Arabidopsis thaliana]
 dbj|BAB11141.1| 3-hydroxyisobutyryl-coenzyme A hydrolase [Arabidopsis thaliana]
 gb|AAN41356.1| putative 3-hydroxyisobutyryl-coenzyme A hydrolase [Arabidopsis 
thaliana]
 gb|AED98128.1| beta-hydroxyisobutyryl-CoA hydrolase 1 [Arabidopsis thaliana]
Length=378

 Score =   398 bits (1023),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 190/268 (71%), Positives = 218/268 (81%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNALS  M+SRLL+LFLA E+D +VKL++LK  GRAFCAG
Sbjct  10   QVLVEEKSSVRILTLNRPKQLNALSFHMISRLLQLFLAFEEDPSVKLVILKGHGRAFCAG  69

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV+AVV DI QGNW+LGA YF  E+ +NYV+A YSK QVSILNGIV GGGAG S+HGRF
Sbjct  70   GDVAAVVRDINQGNWRLGANYFSSEYMLNYVMATYSKAQVSILNGIVMGGGAGVSVHGRF  129

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  130  RIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  189

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS RL  LE  L  INS+DPT  S I+  ++Q P+LK++S Y  L +IDRCFSRRT+EE
Sbjct  190  VPSTRLTALEADLCRINSNDPTFASTILDAYTQHPRLKQQSAYRRLDVIDRCFSRRTVEE  249

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE EA    D WIS+ IQ+LKK S
Sbjct  250  IISALEREATQEADGWISATIQALKKGS  277



>ref|XP_002865093.1| beta-hydroxyisobutyryl-CoA hydrolase 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41352.1| beta-hydroxyisobutyryl-CoA hydrolase 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=381

 Score =   398 bits (1022),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 189/268 (71%), Positives = 221/268 (82%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNALS  M+SRLL+LFLA E+DS+VKL++LK +GRAFCAG
Sbjct  10   QVLVEEKSSVRILTLNRPKQLNALSFQMISRLLQLFLAFEEDSSVKLVILKGNGRAFCAG  69

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV+AVV DI QGNW+LGA +F  E+ +NYV+A YSK QVSILNGIV GGGAG S+HGRF
Sbjct  70   GDVAAVVRDIEQGNWRLGANFFSDEYMLNYVMATYSKAQVSILNGIVMGGGAGVSVHGRF  129

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  130  RIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  189

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS RL  LE  L  + S+DPT  S I++ ++Q P+LK +S Y+ L +IDRCFSRRT+EE
Sbjct  190  VPSTRLTALEADLCRVGSNDPTFASTILNAYTQHPRLKPQSAYHRLDVIDRCFSRRTVEE  249

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE EA    D WIS+ IQ+LKKAS
Sbjct  250  IISALEREATQEADGWISATIQALKKAS  277



>ref|XP_008344943.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Malus domestica]
Length=384

 Score =   397 bits (1021),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/279 (68%), Positives = 232/279 (83%), Gaps = 1/279 (0%)
 Frame = +2

Query  74   ASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVL  253
            +S S+  + D VLV++   VRT  LNR +QLNAL+  M+SRLLELFLA + D+NVKL+++
Sbjct  3    SSTSTPREEDSVLVQKNLFVRTLTLNRPRQLNALNFDMISRLLELFLAYDDDANVKLLIV  62

Query  254  KSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGG  433
            K  GRAFCAGGDV+AVV  I +GNW+L A +F+KEFT+NY++A YSKPQVSIL+GIV GG
Sbjct  63   KGKGRAFCAGGDVAAVVRQINEGNWRLAAHFFQKEFTLNYLLATYSKPQVSILDGIVMGG  122

Query  434  GAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAE  613
            GAGASIHGRFRVATE SVFAMPETALGLFPDVGASY+LSRLPGFFGEY+GLTG+RLDGAE
Sbjct  123  GAGASIHGRFRVATENSVFAMPETALGLFPDVGASYYLSRLPGFFGEYVGLTGTRLDGAE  182

Query  614  MLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIID  793
            MLACGLATHFVPS RL  LEEAL+ ++SSD   I AII ++SQ P LK+KS Y  + +ID
Sbjct  183  MLACGLATHFVPSIRLSLLEEALNKVDSSDFANIQAIIDKYSQSPALKKKSAYFRMDVID  242

Query  794  RCFSRRTIEEIMVALESEAANYK-DDWISSAIQSLKKAS  907
            +CFSRRT+EEI+ ALE E AN + DDW++S +Q+L KAS
Sbjct  243  KCFSRRTVEEIISALEDEEANNRADDWLTSTVQALTKAS  281



>ref|XP_006464338.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Citrus sinensis]
 gb|KDO85361.1| hypothetical protein CISIN_1g016920mg [Citrus sinensis]
Length=375

 Score =   396 bits (1017),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 194/275 (71%), Positives = 224/275 (81%), Gaps = 5/275 (2%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            S+ S  DQVL EET  VR   LNR +QLNALS+ M+SRLLELF   E DSNVKL++LK  
Sbjct  3    SAQSQEDQVLEEETSFVRILTLNRPRQLNALSAQMISRLLELFQRYETDSNVKLLILKGK  62

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGGDV+AVV  I +G     A++F KEF +NY++A Y+KPQVSILNGIV GGGAG
Sbjct  63   GRAFCAGGDVAAVVRGINEG-----AKFFSKEFILNYLMATYTKPQVSILNGIVMGGGAG  117

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
             SIHGRFRVATE SVFAMPETALGLFPD+GASYFLSRLPGFFGEY+GLTG+RLDGAEM A
Sbjct  118  VSIHGRFRVATENSVFAMPETALGLFPDIGASYFLSRLPGFFGEYVGLTGARLDGAEMRA  177

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATHFVPS RL  LEEAL+ +NSSDP +ISA+I +FS  P LK+ S Y+ + +ID+CF
Sbjct  178  CGLATHFVPSSRLALLEEALYKVNSSDPAVISAVIDKFSLEPYLKDHSAYHWMDVIDKCF  237

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            SRRT+EEI+ ALESE+ N  D WIS AIQSLKKAS
Sbjct  238  SRRTVEEILSALESESTNRADAWISDAIQSLKKAS  272



>ref|XP_010056502.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X5 
[Eucalyptus grandis]
Length=383

 Score =   395 bits (1016),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 193/280 (69%), Positives = 225/280 (80%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASLSS-NSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS SS N   DQVLVEE    RT ILNR +QLNA +  M+SR LEL L  EKDSNVKL+
Sbjct  1    MASFSSSNGQEDQVLVEEKSFARTLILNRPEQLNAATDYMISRFLELLLLYEKDSNVKLV  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            ++K  GRAF AGGDV++ VHDI  G WK  A +FRK +T++Y+IA YSKPQVSI+NGIV 
Sbjct  61   IVKGKGRAFSAGGDVTSAVHDINSGKWKSVAIFFRKNYTLHYLIATYSKPQVSIMNGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG S HG FRVATE SVF+MPETALGLFPDVGASYFLSRLPG FGEYLGLTG+RLDG
Sbjct  121  GGGAGCSTHGSFRVATENSVFSMPETALGLFPDVGASYFLSRLPGHFGEYLGLTGARLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFVPS +L  LE ALH ++SSD  +ISAII E+S++P LKE+S Y+ L +
Sbjct  181  AEMLACGLATHFVPSAKLPSLEAALHTVDSSDQAVISAIIGEYSELPMLKEQSAYHRLDV  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I+RCFSRRT+E+I+ ALE EA N  D WI ++IQSLKKAS
Sbjct  241  INRCFSRRTVEDILSALEREATNKVDGWILASIQSLKKAS  280



>ref|XP_010056510.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X4 
[Eucalyptus grandis]
 gb|KCW73279.1| hypothetical protein EUGRSUZ_E01739 [Eucalyptus grandis]
Length=383

 Score =   395 bits (1016),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 193/280 (69%), Positives = 226/280 (81%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASLSSN-SDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS SS+    DQVLVEE    RT ILNR KQLNA +  M+SR LEL L  EKDSNVKL+
Sbjct  1    MASFSSSYGQEDQVLVEEKSFARTLILNRPKQLNAATDYMISRFLELLLLYEKDSNVKLV  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            ++K  GRAF AGGDV++ VHDI  G WK  A +FRK +T++Y+IA YSKPQVSILNGIV 
Sbjct  61   IVKGKGRAFSAGGDVTSAVHDINSGKWKSVAIFFRKNYTLDYLIATYSKPQVSILNGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG SIHG FRVATE SVFAMPETALGLFPD+GASYFLSRLPG FGEYLGLTG+RLDG
Sbjct  121  GGGAGCSIHGSFRVATENSVFAMPETALGLFPDIGASYFLSRLPGHFGEYLGLTGARLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEML CGLATHFVPS +L  LE ALH ++SS+  +ISAII ++S++P LKE+S Y+ L +
Sbjct  181  AEMLVCGLATHFVPSPKLPSLEAALHTVDSSNQAVISAIIGKYSELPTLKEQSAYHRLDV  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I+RCFSRRT+E+I+ ALE EAAN  D WI ++IQSLKKAS
Sbjct  241  INRCFSRRTVEDILSALEREAANKVDGWILASIQSLKKAS  280



>ref|XP_010466396.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 [Camelina sativa]
Length=381

 Score =   395 bits (1015),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/268 (70%), Positives = 218/268 (81%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNALS  M+SRLL+L LA E+D +VKL++LK  GRAFCAG
Sbjct  10   QVLVEEKSGVRILTLNRPKQLNALSFQMISRLLQLCLAYEEDPSVKLVILKGLGRAFCAG  69

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV+AVV DI+QGNW+LGA YF  E+ +NYV+A YSKPQVSILNGIV GGGAG S+HGRF
Sbjct  70   GDVAAVVRDIKQGNWRLGANYFSDEYILNYVMATYSKPQVSILNGIVMGGGAGVSVHGRF  129

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPD+GASYFLSRLPGFFGEY+GLTG+RLDGAEML CGLATHF
Sbjct  130  RIATENTVFAMPETALGLFPDIGASYFLSRLPGFFGEYVGLTGARLDGAEMLTCGLATHF  189

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS+RL  LE  L  + SSDPT  S I+  ++Q P+LK++S Y  L +IDRCFSRRT+EE
Sbjct  190  VPSKRLTALEADLCRVGSSDPTFASTILDAYTQKPRLKQQSAYRRLDVIDRCFSRRTVEE  249

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE EA    D WIS+ I SLKKAS
Sbjct  250  IISALEREATQEADGWISATILSLKKAS  277



>ref|XP_010444863.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Camelina 
sativa]
Length=381

 Score =   395 bits (1014),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/268 (70%), Positives = 219/268 (82%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNALS  M+SRLL+L LA E+D +VKL++LK  GRAFCAG
Sbjct  10   QVLVEEKSGVRILTLNRPKQLNALSFQMISRLLQLCLAYEEDPSVKLVILKGLGRAFCAG  69

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV+AVV DI+QGNW+LGA YF  E+ +NYV+A YSKPQVSILNGIV GGGAG S+HGRF
Sbjct  70   GDVAAVVRDIKQGNWRLGANYFSDEYILNYVMATYSKPQVSILNGIVMGGGAGVSVHGRF  129

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPD+GASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  130  RIATENTVFAMPETALGLFPDIGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  189

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS+RL  LE  L  + SSDPT  S I+  ++Q P+LK++S Y  L +ID+CFSRRT+EE
Sbjct  190  VPSKRLTALEADLCRVGSSDPTFASTILDAYTQKPRLKQQSAYRRLDVIDKCFSRRTVEE  249

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE EA    D WIS+ I SLKKAS
Sbjct  250  IISALEREATQEADGWISATILSLKKAS  277



>ref|XP_008796305.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 isoform X2 [Phoenix 
dactylifera]
Length=349

 Score =   393 bits (1009),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 189/275 (69%), Positives = 222/275 (81%), Gaps = 1/275 (0%)
 Frame = +2

Query  86   SNSD-TDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            ++SD TDQVLVEE G  R   LNR +QLNALS  M+ RLL+LF+A E D  VKL+++K +
Sbjct  7    TDSDGTDQVLVEEYGFTRILALNRPRQLNALSFPMIMRLLKLFIAYEGDPKVKLLIMKGN  66

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGGDV+AV H I +G+W  GA +FR EFT+NY+IA YSKPQVSIL  IV GGGAG
Sbjct  67   GRAFCAGGDVAAVAHSITEGHWTFGANFFRNEFTLNYIIATYSKPQVSILATIVMGGGAG  126

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
             SIHGRFRVATEK+VFAMPETALGLFPD+GASYFLSRLPGFFGEY+GLTG RLDG EMLA
Sbjct  127  VSIHGRFRVATEKTVFAMPETALGLFPDIGASYFLSRLPGFFGEYVGLTGVRLDGPEMLA  186

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATHFVPS +L  LEEAL  +++SDP +I AII + SQ   LKE S Y  L +ID+CF
Sbjct  187  CGLATHFVPSMKLASLEEALTKVDTSDPNVICAIIDQLSQQVPLKESSAYKRLDLIDKCF  246

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            S+RT+EEI+ ALE EA N   +WI++AIQSLKKAS
Sbjct  247  SKRTVEEILSALEQEAENGATEWITAAIQSLKKAS  281



>ref|XP_010056503.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X6 
[Eucalyptus grandis]
Length=383

 Score =   394 bits (1012),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 192/280 (69%), Positives = 225/280 (80%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASLSS-NSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS SS +   DQVLVEE    RT ILNR +QLNA +  M+SR LEL L  EKDSNVKL+
Sbjct  1    MASFSSRDGQEDQVLVEEKSFARTLILNRPEQLNAATDYMISRFLELLLLYEKDSNVKLV  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            ++K  GRAF AGGDV++ VHDI  G WK  A +FRK +T++Y+IA YSKPQVSI+NGIV 
Sbjct  61   IVKGKGRAFSAGGDVTSAVHDINSGKWKSVAIFFRKNYTLHYLIATYSKPQVSIMNGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG S HG FRVATE SVF+MPETALGLFPDVGASYFLSRLPG FGEYLGLTG+RLDG
Sbjct  121  GGGAGCSTHGSFRVATENSVFSMPETALGLFPDVGASYFLSRLPGHFGEYLGLTGARLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFVPS +L  LE ALH ++SSD  +ISAII E+S++P LKE+S Y+ L +
Sbjct  181  AEMLACGLATHFVPSAKLPSLEAALHTVDSSDQAVISAIIGEYSELPMLKEQSAYHRLDV  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I+RCFSRRT+E+I+ ALE EA N  D WI ++IQSLKKAS
Sbjct  241  INRCFSRRTVEDILSALEREATNKVDGWILASIQSLKKAS  280



>ref|XP_006409992.1| hypothetical protein EUTSA_v10016849mg [Eutrema salsugineum]
 gb|ESQ51445.1| hypothetical protein EUTSA_v10016849mg [Eutrema salsugineum]
Length=318

 Score =   391 bits (1005),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 188/272 (69%), Positives = 218/272 (80%), Gaps = 0/272 (0%)
 Frame = +2

Query  92   SDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRA  271
            S   QVLVEE   VR   LNR KQLNAL   M+SRLL+LFLA E+D +VKL++LK  GRA
Sbjct  2    SSQTQVLVEEKSSVRILTLNRPKQLNALCFDMISRLLQLFLAYEEDPSVKLVILKGQGRA  61

Query  272  FCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASI  451
            FCAGGDV  VV DI+QG W+LGA++F  E+T+NYV+A  SKPQVSILNGIV GGGAG SI
Sbjct  62   FCAGGDVPPVVRDIKQGKWRLGADFFTDEYTLNYVLATNSKPQVSILNGIVMGGGAGLSI  121

Query  452  HGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGL  631
            HGRFRVATE SVFAMPET LGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGL
Sbjct  122  HGRFRVATENSVFAMPETELGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGL  181

Query  632  ATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRR  811
            ATHFVPS RL  LE  L  I+SSDPT +S I+  ++Q P LK+ S Y+ + +IDRCFS+R
Sbjct  182  ATHFVPSTRLTALEADLFRISSSDPTFVSTILDAYNQKPDLKQHSAYHRIDVIDRCFSKR  241

Query  812  TIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            T+EEI+ ALE EA    +DWIS+ I +LKKAS
Sbjct  242  TVEEIVSALEREATQEPNDWISTIIGALKKAS  273



>ref|XP_010484711.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Camelina 
sativa]
Length=381

 Score =   393 bits (1010),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 187/268 (70%), Positives = 219/268 (82%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNALS  M+SRLL+L LA E+D +VKL++LK  GRAFCAG
Sbjct  10   QVLVEEKSGVRILTLNRPKQLNALSFQMISRLLQLCLAYEEDPSVKLVILKGLGRAFCAG  69

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV+AVV DI+QGNW+LGA YF  E+ +NYV+A YSKPQVSILNGIV GGGAG S+HGRF
Sbjct  70   GDVAAVVRDIKQGNWRLGANYFSDEYILNYVMATYSKPQVSILNGIVMGGGAGVSVHGRF  129

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPD+GASYFLSRLPGFFGEY+GLTG+RLDGAEML CGLATHF
Sbjct  130  RIATENTVFAMPETALGLFPDIGASYFLSRLPGFFGEYVGLTGARLDGAEMLTCGLATHF  189

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS+RL  LE  L ++ SSDPT  S I+  ++Q P+LK++S Y  L +ID+CFSRRT+EE
Sbjct  190  VPSKRLTALEADLCSVGSSDPTFASTILDAYNQKPRLKQQSAYRRLDVIDKCFSRRTVEE  249

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE EA    D WIS+ I SLKKAS
Sbjct  250  IISALEREATQEADGWISATILSLKKAS  277



>ref|XP_006393782.1| hypothetical protein EUTSA_v10004415mg [Eutrema salsugineum]
 gb|ESQ31068.1| hypothetical protein EUTSA_v10004415mg [Eutrema salsugineum]
Length=376

 Score =   393 bits (1009),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 188/270 (70%), Positives = 221/270 (82%), Gaps = 2/270 (1%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNALS  M+SRLL+LFLA EKD +VKL++LK  GRAFCAG
Sbjct  6    QVLVEEKSSVRILTLNRPKQLNALSFHMISRLLQLFLAHEKDPSVKLVILKGQGRAFCAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDVSAVVHDIRQGNW+LGA +F  E+ +NYV+A YSK Q+SIL+GIV GGGAG S+HGRF
Sbjct  66   GDVSAVVHDIRQGNWRLGANFFSDEYMLNYVMATYSKAQISILDGIVMGGGAGVSVHGRF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  126  RIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  185

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH--LKIIDRCFSRRTI  817
            VPS RL  LE  L  ++S+DPT  S I+  ++Q P LK++S Y+   L +ID+CFS RT+
Sbjct  186  VPSARLTALEADLSRVDSTDPTFASTILDGYTQHPHLKQQSAYHRQVLDVIDKCFSGRTV  245

Query  818  EEIMVALESEAANYKDDWISSAIQSLKKAS  907
            EEIM ALE EA++  DDWI + I +LKKAS
Sbjct  246  EEIMCALEREASHEADDWILATIGALKKAS  275



>ref|XP_008796304.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 isoform X1 [Phoenix 
dactylifera]
Length=382

 Score =   392 bits (1007),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/275 (69%), Positives = 222/275 (81%), Gaps = 1/275 (0%)
 Frame = +2

Query  86   SNSD-TDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            ++SD TDQVLVEE G  R   LNR +QLNALS  M+ RLL+LF+A E D  VKL+++K +
Sbjct  7    TDSDGTDQVLVEEYGFTRILALNRPRQLNALSFPMIMRLLKLFIAYEGDPKVKLLIMKGN  66

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGGDV+AV H I +G+W  GA +FR EFT+NY+IA YSKPQVSIL  IV GGGAG
Sbjct  67   GRAFCAGGDVAAVAHSITEGHWTFGANFFRNEFTLNYIIATYSKPQVSILATIVMGGGAG  126

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
             SIHGRFRVATEK+VFAMPETALGLFPD+GASYFLSRLPGFFGEY+GLTG RLDG EMLA
Sbjct  127  VSIHGRFRVATEKTVFAMPETALGLFPDIGASYFLSRLPGFFGEYVGLTGVRLDGPEMLA  186

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATHFVPS +L  LEEAL  +++SDP +I AII + SQ   LKE S Y  L +ID+CF
Sbjct  187  CGLATHFVPSMKLASLEEALTKVDTSDPNVICAIIDQLSQQVPLKESSAYKRLDLIDKCF  246

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            S+RT+EEI+ ALE EA N   +WI++AIQSLKKAS
Sbjct  247  SKRTVEEILSALEQEAENGATEWITAAIQSLKKAS  281



>ref|XP_009130576.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 isoform X1 [Brassica 
rapa]
 ref|XP_009130577.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 isoform X1 [Brassica 
rapa]
 ref|XP_009130578.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 isoform X1 [Brassica 
rapa]
Length=374

 Score =   392 bits (1006),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/268 (69%), Positives = 221/268 (82%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNALS  M+SRLL+LFLA E+D +VKL++LK  GRAFCAG
Sbjct  6    QVLVEEKSSVRILTLNRPKQLNALSFQMISRLLQLFLAYEEDPSVKLVILKGQGRAFCAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDVSAVV DI QGNW+LGA++F  E+ +NYV+A Y+KPQVSILNGIV GGGAG S+HG F
Sbjct  66   GDVSAVVRDIGQGNWRLGAKFFADEYMLNYVMATYTKPQVSILNGIVMGGGAGVSVHGPF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPET LGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGA+MLACGLATH+
Sbjct  126  RIATENTVFAMPETVLGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGADMLACGLATHY  185

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            +PS RL  LE  L  ++SSDP ++S I+  ++Q P LK++S Y+ L +IDRCFS RT+EE
Sbjct  186  LPSTRLTALEAELCRVDSSDPALVSTILDAYTQNPHLKQQSAYHRLDVIDRCFSGRTVEE  245

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE EA +  DDWISS I++LKKAS
Sbjct  246  IIAALEREATHGGDDWISSTIRALKKAS  273



>ref|XP_006409993.1| hypothetical protein EUTSA_v10016849mg [Eutrema salsugineum]
 gb|ESQ51446.1| hypothetical protein EUTSA_v10016849mg [Eutrema salsugineum]
Length=362

 Score =   390 bits (1002),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 188/272 (69%), Positives = 218/272 (80%), Gaps = 0/272 (0%)
 Frame = +2

Query  92   SDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRA  271
            S   QVLVEE   VR   LNR KQLNAL   M+SRLL+LFLA E+D +VKL++LK  GRA
Sbjct  2    SSQTQVLVEEKSSVRILTLNRPKQLNALCFDMISRLLQLFLAYEEDPSVKLVILKGQGRA  61

Query  272  FCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASI  451
            FCAGGDV  VV DI+QG W+LGA++F  E+T+NYV+A  SKPQVSILNGIV GGGAG SI
Sbjct  62   FCAGGDVPPVVRDIKQGKWRLGADFFTDEYTLNYVLATNSKPQVSILNGIVMGGGAGLSI  121

Query  452  HGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGL  631
            HGRFRVATE SVFAMPET LGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGL
Sbjct  122  HGRFRVATENSVFAMPETELGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGL  181

Query  632  ATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRR  811
            ATHFVPS RL  LE  L  I+SSDPT +S I+  ++Q P LK+ S Y+ + +IDRCFS+R
Sbjct  182  ATHFVPSTRLTALEADLFRISSSDPTFVSTILDAYNQKPDLKQHSAYHRIDVIDRCFSKR  241

Query  812  TIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            T+EEI+ ALE EA    +DWIS+ I +LKKAS
Sbjct  242  TVEEIVSALEREATQEPNDWISTIIGALKKAS  273



>gb|KCW73273.1| hypothetical protein EUGRSUZ_E01732 [Eucalyptus grandis]
Length=415

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 201/312 (64%), Positives = 230/312 (74%), Gaps = 33/312 (11%)
 Frame = +2

Query  71   MASLSS-NSDTDQVLVEETGCVRTFILNRQKQLNALS-----------------------  178
            MAS SS +   DQVLVEE   VR  ILNR KQLNALS                       
Sbjct  1    MASFSSRDGQEDQVLVEEKSFVRALILNRPKQLNALSYDMCWMGFFCYIGRQFAVSLLRL  60

Query  179  ---------SAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWK  331
                       M++RLLELFL  EKDSNVKL++LK  GRAFCAGGDV+ VV DI  GNWK
Sbjct  61   FKLITGVAFCEMIARLLELFLVYEKDSNVKLVILKGKGRAFCAGGDVATVVRDINNGNWK  120

Query  332  LGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETAL  511
             G  +FRKEFT+NY++A YS+PQVSILNGIV GGGAG SIHG FRVATE SVFAMPETAL
Sbjct  121  SGEIFFRKEFTLNYLMATYSRPQVSILNGIVMGGGAGCSIHGSFRVATENSVFAMPETAL  180

Query  512  GLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNI  691
            GLFPD+GASYFLSRLPG FGEYL LTG+RLDGAEMLACGLATHFVPS +L  LE AL+ +
Sbjct  181  GLFPDIGASYFLSRLPGHFGEYLDLTGARLDGAEMLACGLATHFVPSAKLPSLEAALYAV  240

Query  692  NSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDW  871
            +S D  IISAII E+S++P LKE+S Y+ L +I+RCFSRRT+E+I+ ALE EA N  DDW
Sbjct  241  DSRDQAIISAIIREYSELPILKEQSAYHRLDVINRCFSRRTVEDILSALEREATNKVDDW  300

Query  872  ISSAIQSLKKAS  907
            I ++IQSLKKAS
Sbjct  301  ILASIQSLKKAS  312



>ref|XP_010654808.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 isoform X2 [Vitis 
vinifera]
Length=344

 Score =   388 bits (997),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/241 (76%), Positives = 212/241 (88%), Gaps = 0/241 (0%)
 Frame = +2

Query  185  MVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFT  364
            M+S+LLELFLA E+DSNVKL+++K +GRAFC+GGDV+AVVHDI +GNWK+GA++F +E+ 
Sbjct  1    MISKLLELFLAYEEDSNVKLVIMKGNGRAFCSGGDVAAVVHDINRGNWKIGAKFFWEEYI  60

Query  365  MNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYF  544
            +NYV+A YSKPQVSILNGIV GGGAGAS+HGRFR+ATE SVFAMPETALGLFPDVGASYF
Sbjct  61   LNYVMATYSKPQVSILNGIVMGGGAGASVHGRFRIATENSVFAMPETALGLFPDVGASYF  120

Query  545  LSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAI  724
            LSR PGFFGEY+GLTG+RLDGAEMLACGLATHFVPS RL  LE ALH ++SSDP IISA+
Sbjct  121  LSRFPGFFGEYVGLTGARLDGAEMLACGLATHFVPSARLSSLEAALHKLDSSDPAIISAV  180

Query  725  ISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKA  904
            I E+S  P LK+KS Y+ L II+RCFSRRTIEEI+ ALE EA    DDWISS IQSL+KA
Sbjct  181  IDEYSLQPYLKDKSTYHRLDIINRCFSRRTIEEILSALEREAVKSADDWISSTIQSLQKA  240

Query  905  S  907
            S
Sbjct  241  S  241



>gb|KCW73269.1| hypothetical protein EUGRSUZ_E01729 [Eucalyptus grandis]
Length=389

 Score =   389 bits (998),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 193/286 (67%), Positives = 225/286 (79%), Gaps = 7/286 (2%)
 Frame = +2

Query  71   MASLSS-NSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS SS N   DQVLVEE    RT ILNR +QLNA +  M+SR LEL L  EKDSNVKL+
Sbjct  1    MASFSSSNGQEDQVLVEEKSFARTLILNRPEQLNAATDYMISRFLELLLLYEKDSNVKLV  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQ------VSI  409
            ++K  GRAF AGGDV++ VHDI  G WK  A +FRK +T++Y+IA YSKPQ      VSI
Sbjct  61   IVKGKGRAFSAGGDVTSAVHDINSGKWKSVAIFFRKNYTLHYLIATYSKPQEICHYFVSI  120

Query  410  LNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLT  589
            +NGIV GGGAG S HG FRVATE SVF+MPETALGLFPDVGASYFLSRLPG FGEYLGLT
Sbjct  121  MNGIVMGGGAGCSTHGSFRVATENSVFSMPETALGLFPDVGASYFLSRLPGHFGEYLGLT  180

Query  590  GSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSP  769
            G+RLDGAEMLACGLATHFVPS +L  LE ALH ++SSD  +ISAII E+S++P LKE+S 
Sbjct  181  GARLDGAEMLACGLATHFVPSAKLPSLEAALHTVDSSDQAVISAIIGEYSELPMLKEQSA  240

Query  770  YNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            Y+ L +I+RCFSRRT+E+I+ ALE EA N  D WI ++IQSLKKAS
Sbjct  241  YHRLDVINRCFSRRTVEDILSALEREATNKVDGWILASIQSLKKAS  286



>gb|KDO85360.1| hypothetical protein CISIN_1g016920mg [Citrus sinensis]
Length=373

 Score =   387 bits (995),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 190/275 (69%), Positives = 220/275 (80%), Gaps = 7/275 (3%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            S+ S  DQVL EET  VR   LNR +QLNALS+ M+SRLLELF   E DSNVKL++LK  
Sbjct  3    SAQSQEDQVLEEETSFVRILTLNRPRQLNALSAQMISRLLELFQRYETDSNVKLLILKGK  62

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGGDV+AVV  I +G+W  GA++F KEF +NY++A Y+KPQVSILNGIV GGGAG
Sbjct  63   GRAFCAGGDVAAVVRGINEGDWISGAKFFSKEFILNYLMATYTKPQVSILNGIVMGGGAG  122

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
             SIHGRFRVATE SVFAMPETALGLFPD+GASYFLSRLPGFF       G+RLDGAEM A
Sbjct  123  VSIHGRFRVATENSVFAMPETALGLFPDIGASYFLSRLPGFF-------GARLDGAEMRA  175

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATHFVPS RL  LEEAL+ +NSSDP +ISA+I +FS  P LK+ S Y+ + +ID+CF
Sbjct  176  CGLATHFVPSSRLALLEEALYKVNSSDPAVISAVIDKFSLEPYLKDHSAYHWMDVIDKCF  235

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            SRRT+EEI+ ALESE+ N  D WIS AIQSLKKAS
Sbjct  236  SRRTVEEILSALESESTNRADAWISDAIQSLKKAS  270



>gb|AAF01467.1|AF190450_1 enoyl-CoA-hydratase [Avicennia marina]
Length=344

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/241 (77%), Positives = 207/241 (86%), Gaps = 0/241 (0%)
 Frame = +2

Query  185  MVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFT  364
            MV RLLELFLAC +DS+VKLI+LK  GRAFCAGGDVSA  HDI QGNWK  A YFRKEFT
Sbjct  1    MVVRLLELFLACAEDSSVKLIILKGKGRAFCAGGDVSAAAHDINQGNWKAAANYFRKEFT  60

Query  365  MNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYF  544
            MNYV+A +SKPQVSILNGIV GGGAGASIHGRFRVATE S+FAMPETALGLFPD+GASYF
Sbjct  61   MNYVVATHSKPQVSILNGIVMGGGAGASIHGRFRVATENSLFAMPETALGLFPDIGASYF  120

Query  545  LSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAI  724
            LSRLPGFFGEY+GL G+RLDGAEMLACGLATHFV SE+L  LEEAL   +SSDP +IS+ 
Sbjct  121  LSRLPGFFGEYVGLAGARLDGAEMLACGLATHFVHSEKLPLLEEALVKADSSDPAVISST  180

Query  725  ISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKA  904
            I EFS  P LK+ S  + L II++CFSRRTIEEI++ALE EAA+ KDDW+SS IQSLKKA
Sbjct  181  IDEFSLTPNLKKNSACHRLNIINKCFSRRTIEEIIMALEREAADRKDDWLSSTIQSLKKA  240

Query  905  S  907
            S
Sbjct  241  S  241



>emb|CDY55104.1| BnaA02g34880D [Brassica napus]
Length=376

 Score =   387 bits (993),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/270 (68%), Positives = 221/270 (82%), Gaps = 2/270 (1%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNALS  M+SRLL+LFLA E+D +VKL++LK  GRAFCAG
Sbjct  6    QVLVEEKSSVRILTLNRPKQLNALSFQMISRLLQLFLAYEEDPSVKLVILKGQGRAFCAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDVSAVV DI QGNW+LGA++F  E+ +NYV+A Y+KPQVSILNGIV GGGAG S+HG F
Sbjct  66   GDVSAVVRDIGQGNWRLGAKFFADEYMLNYVMATYTKPQVSILNGIVMGGGAGVSVHGPF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPET LGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGA+MLACGLATH+
Sbjct  126  RIATENTVFAMPETVLGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGADMLACGLATHY  185

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH--LKIIDRCFSRRTI  817
            +PS RL  LE  L  ++SSDP ++S I+  ++Q P LK++S Y+   L +IDRCFS RT+
Sbjct  186  LPSTRLTALEAELCRVDSSDPALVSTILDAYTQNPHLKQQSAYHRQVLDVIDRCFSGRTV  245

Query  818  EEIMVALESEAANYKDDWISSAIQSLKKAS  907
            EEI+ ALE EA +  DDWISS I++LKKAS
Sbjct  246  EEIIAALEREATHGGDDWISSTIRALKKAS  275



>ref|XP_010919879.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010919880.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010919881.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 isoform X1 [Elaeis 
guineensis]
Length=382

 Score =   386 bits (991),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 186/275 (68%), Positives = 222/275 (81%), Gaps = 1/275 (0%)
 Frame = +2

Query  86   SNSD-TDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            +N D TD VLVEE G  R   LNR +QLNALS  M+ RLL+LF+A E D  VKL+++K +
Sbjct  7    TNGDGTDLVLVEEYGFTRILALNRPRQLNALSFPMIMRLLKLFVAYEGDPKVKLLIMKGN  66

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGGDV+AV H I +G+W  GA +FR EFT+NY+IA YSKPQVSIL+ IV GGGAG
Sbjct  67   GRAFCAGGDVAAVAHSITEGHWTFGANFFRNEFTLNYIIATYSKPQVSILHSIVMGGGAG  126

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
             SIHG+FRVATEK+VFAMPETALGLFPD+GASYFLSRLPGFFGEY+GLTG RLDG EMLA
Sbjct  127  VSIHGKFRVATEKTVFAMPETALGLFPDIGASYFLSRLPGFFGEYVGLTGVRLDGPEMLA  186

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATHFVPS +L  LEE+L  +++SDP +I AII  FSQ   +KE S YN L +I++CF
Sbjct  187  CGLATHFVPSMKLALLEESLTRVDTSDPNVICAIIDRFSQQAPVKESSAYNRLDLIEKCF  246

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            S+RT+EEI+ ALE EA N   +WI++AIQSLKKAS
Sbjct  247  SKRTVEEILSALEQEAENGAIEWITAAIQSLKKAS  281



>ref|XP_011093455.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Sesamum indicum]
Length=418

 Score =   387 bits (994),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 194/276 (70%), Positives = 230/276 (83%), Gaps = 1/276 (0%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            S++ +TDQVLVEE    R   LNR KQLNALS+AMVSRLL++FLAC +DS++KLI+LK +
Sbjct  46   STSEETDQVLVEEKPSARIITLNRPKQLNALSAAMVSRLLDIFLACAEDSSIKLIILKGN  105

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAF AG DV+AV  +I QGNWK GA+YF KEFTMNYV+A Y+KPQVS LNGIV GGGAG
Sbjct  106  GRAFSAGADVAAVARNINQGNWKSGADYFAKEFTMNYVMATYNKPQVSFLNGIVMGGGAG  165

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
            AS+HG+FR+ATE ++FAMPETALG FPD+G+SYFLSRLPGFFGEYLGLTG RLDGAEM  
Sbjct  166  ASVHGKFRIATENTIFAMPETALGFFPDIGSSYFLSRLPGFFGEYLGLTGVRLDGAEMFK  225

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATHFV SERL  LEEAL   +SS+P +IS++I EFSQ+P LK+ S Y+ + II++CF
Sbjct  226  CGLATHFVQSERLTSLEEALVKADSSNPVVISSVIGEFSQIPNLKDNSAYHKMDIINKCF  285

Query  803  SRRTIEEIMVALESEAANYK-DDWISSAIQSLKKAS  907
            SR TIEEI+ ALE E A +K DDWISS IQSLKKAS
Sbjct  286  SRGTIEEIIAALEEEEAAHKDDDWISSTIQSLKKAS  321



>emb|CDY57769.1| BnaC02g45100D [Brassica napus]
Length=373

 Score =   385 bits (990),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 184/270 (68%), Positives = 223/270 (83%), Gaps = 5/270 (2%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNALS  M+SRLL+LFLA E+D +VKL++LK  GRAFCAG
Sbjct  6    QVLVEEKSSVRILTLNRPKQLNALSFQMISRLLQLFLAYEEDPSVKLVILKGQGRAFCAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDVSAVV DI QGNW+LGA++F  E+ +NYV+A Y+KPQVSILNGIV GGGAG S+HG F
Sbjct  66   GDVSAVVRDIGQGNWRLGAKFFADEYMLNYVMATYTKPQVSILNGIVMGGGAGVSVHGPF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+AT+ +VFAMPET LGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGA+MLACGLATH+
Sbjct  126  RIATQNTVFAMPETVLGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGADMLACGLATHY  185

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH--LKIIDRCFSRRTI  817
            +PS RL  LE  L  ++SSDPT++SAI+  ++Q P LK++S Y+   L +IDRCFS RT+
Sbjct  186  LPSTRLTALEAELCRVDSSDPTVVSAILDAYTQNPHLKQQSAYHRQVLDVIDRCFSGRTV  245

Query  818  EEIMVALESEAANYKDDWISSAIQSLKKAS  907
            EEI+ ALE EA+   DDWIS+ I++LKKAS
Sbjct  246  EEIIAALEREAS---DDWISTTIRALKKAS  272



>ref|XP_010056508.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Eucalyptus grandis]
Length=399

 Score =   386 bits (991),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 186/267 (70%), Positives = 218/267 (82%), Gaps = 0/267 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            VLVEE    RT ILNR KQLNA +  M+SR LEL L  EKDSNVKL+++K  GRAF AGG
Sbjct  37   VLVEEKSFARTLILNRPKQLNAATDYMISRFLELLLLYEKDSNVKLVIVKGKGRAFSAGG  96

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV++ VHDI  G WK  A +FRK +T++Y+IA YSKPQVSILNGIV GGGAG SIHG FR
Sbjct  97   DVTSAVHDINSGKWKSVAIFFRKNYTLDYLIATYSKPQVSILNGIVMGGGAGCSIHGSFR  156

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            VATE SVFAMPETALGLFPD+GASYFLSRLPG FGEYLGLTG+RLDGAEML CGLATHFV
Sbjct  157  VATENSVFAMPETALGLFPDIGASYFLSRLPGHFGEYLGLTGARLDGAEMLVCGLATHFV  216

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
            PS +L  LE ALH ++SS+  +ISAII ++S++P LKE+S Y+ L +I+RCFSRRT+E+I
Sbjct  217  PSPKLPSLEAALHTVDSSNQAVISAIIGKYSELPTLKEQSAYHRLDVINRCFSRRTVEDI  276

Query  827  MVALESEAANYKDDWISSAIQSLKKAS  907
            + ALE EAAN  D WI ++IQSLKKAS
Sbjct  277  LSALEREAANKVDGWILASIQSLKKAS  303



>ref|XP_010056507.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Eucalyptus grandis]
Length=406

 Score =   386 bits (991),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 186/267 (70%), Positives = 218/267 (82%), Gaps = 0/267 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            VLVEE    RT ILNR KQLNA +  M+SR LEL L  EKDSNVKL+++K  GRAF AGG
Sbjct  37   VLVEEKSFARTLILNRPKQLNAATDYMISRFLELLLLYEKDSNVKLVIVKGKGRAFSAGG  96

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV++ VHDI  G WK  A +FRK +T++Y+IA YSKPQVSILNGIV GGGAG SIHG FR
Sbjct  97   DVTSAVHDINSGKWKSVAIFFRKNYTLDYLIATYSKPQVSILNGIVMGGGAGCSIHGSFR  156

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            VATE SVFAMPETALGLFPD+GASYFLSRLPG FGEYLGLTG+RLDGAEML CGLATHFV
Sbjct  157  VATENSVFAMPETALGLFPDIGASYFLSRLPGHFGEYLGLTGARLDGAEMLVCGLATHFV  216

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
            PS +L  LE ALH ++SS+  +ISAII ++S++P LKE+S Y+ L +I+RCFSRRT+E+I
Sbjct  217  PSPKLPSLEAALHTVDSSNQAVISAIIGKYSELPTLKEQSAYHRLDVINRCFSRRTVEDI  276

Query  827  MVALESEAANYKDDWISSAIQSLKKAS  907
            + ALE EAAN  D WI ++IQSLKKAS
Sbjct  277  LSALEREAANKVDGWILASIQSLKKAS  303



>ref|XP_009400739.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009400740.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009400741.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=386

 Score =   385 bits (989),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/283 (66%), Positives = 226/283 (80%), Gaps = 4/283 (1%)
 Frame = +2

Query  71   MASLSSNSDTD----QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNV  238
            MAS S N+  D    QVLVE+    R   LNR +QLNALS+ M+ +LL+LF+A EKDS+V
Sbjct  1    MASSSQNASNDGTTNQVLVEDCRFTRILTLNRPRQLNALSTPMIMKLLKLFVAYEKDSDV  60

Query  239  KLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNG  418
            KL+++K +GRAF AGGDV+AVV  + QG+W LGAE+FR E+T+NY+IA YSKPQVSIL+G
Sbjct  61   KLLIMKGNGRAFSAGGDVAAVVQSVTQGHWTLGAEFFRNEYTLNYIIATYSKPQVSILDG  120

Query  419  IVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSR  598
            IV GGGAG SIHGRFRV TEK+VFAMPETALG FPD+GASYFLSRLPGFFGEY+GLTG+R
Sbjct  121  IVMGGGAGISIHGRFRVVTEKTVFAMPETALGFFPDIGASYFLSRLPGFFGEYVGLTGAR  180

Query  599  LDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH  778
            LDGAEMLACGLATHFVPS  L  LE+ L  + +SDP +I AII +FS++  LK  S YN 
Sbjct  181  LDGAEMLACGLATHFVPSMNLTYLEDLLTKVETSDPFVICAIIDQFSKMVPLKVSSAYNR  240

Query  779  LKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            L IID+CFS+ T+E+I+ ALE E+A+  D+WI  AIQ LKKAS
Sbjct  241  LDIIDKCFSKETVEDIISALEKESASMADEWIVVAIQELKKAS  283



>ref|XP_006391376.1| hypothetical protein EUTSA_v10019437mg [Eutrema salsugineum]
 gb|ESQ28662.1| hypothetical protein EUTSA_v10019437mg [Eutrema salsugineum]
Length=377

 Score =   384 bits (986),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/272 (68%), Positives = 216/272 (79%), Gaps = 0/272 (0%)
 Frame = +2

Query  92   SDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRA  271
            S   QVLVEE   VR   LNR KQLNALS  M+SRLL+LFLA E+D +VKL++LK  GRA
Sbjct  2    SSQTQVLVEEKSSVRILTLNRPKQLNALSFDMISRLLQLFLAYEEDPSVKLVILKGQGRA  61

Query  272  FCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASI  451
            FCAGGDV +VV DI+QG W+LGA++F  E+T+NYV+A  +K QVSILNGIV GGGAG SI
Sbjct  62   FCAGGDVLSVVRDIKQGKWRLGADFFTDEYTLNYVMATNTKAQVSILNGIVMGGGAGVSI  121

Query  452  HGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGL  631
            HGRFRVATEK+VFAMPET LGLFPDVGASYFLSRLPGF GEY+GLTG+RLDGAEMLACGL
Sbjct  122  HGRFRVATEKTVFAMPETELGLFPDVGASYFLSRLPGFLGEYVGLTGARLDGAEMLACGL  181

Query  632  ATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRR  811
            ATHFVPS RL  LE  L  + SS+P   S II  ++Q P LK+ S Y+ L +IDRCFS+R
Sbjct  182  ATHFVPSTRLTALEADLCEVRSSNPIFASTIIDAYTQKPHLKQHSAYHRLDVIDRCFSKR  241

Query  812  TIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            T+EEI+ ALE EA    +DWIS+ I +LKKAS
Sbjct  242  TVEEIVSALEREATQEPNDWISTTIGALKKAS  273



>ref|XP_010056499.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Eucalyptus grandis]
Length=406

 Score =   384 bits (986),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/267 (69%), Positives = 217/267 (81%), Gaps = 0/267 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            VLVEE    RT ILNR +QLNA +  M+SR LEL L  EKDSNVKL+++K  GRAF AGG
Sbjct  37   VLVEEKSFARTLILNRPEQLNAATDYMISRFLELLLLYEKDSNVKLVIVKGKGRAFSAGG  96

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV++ VHDI  G WK  A +FRK +T++Y+IA YSKPQVSI+NGIV GGGAG S HG FR
Sbjct  97   DVTSAVHDINSGKWKSVAIFFRKNYTLHYLIATYSKPQVSIMNGIVMGGGAGCSTHGSFR  156

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            VATE SVF+MPETALGLFPDVGASYFLSRLPG FGEYLGLTG+RLDGAEMLACGLATHFV
Sbjct  157  VATENSVFSMPETALGLFPDVGASYFLSRLPGHFGEYLGLTGARLDGAEMLACGLATHFV  216

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
            PS +L  LE ALH ++SSD  +ISAII E+S++P LKE+S Y+ L +I+RCFSRRT+E+I
Sbjct  217  PSAKLPSLEAALHTVDSSDQAVISAIIGEYSELPMLKEQSAYHRLDVINRCFSRRTVEDI  276

Query  827  MVALESEAANYKDDWISSAIQSLKKAS  907
            + ALE EA N  D WI ++IQSLKKAS
Sbjct  277  LSALEREATNKVDGWILASIQSLKKAS  303



>ref|XP_010056498.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Eucalyptus grandis]
Length=408

 Score =   384 bits (986),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/267 (69%), Positives = 217/267 (81%), Gaps = 0/267 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            VLVEE    RT ILNR +QLNA +  M+SR LEL L  EKDSNVKL+++K  GRAF AGG
Sbjct  39   VLVEEKSFARTLILNRPEQLNAATDYMISRFLELLLLYEKDSNVKLVIVKGKGRAFSAGG  98

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV++ VHDI  G WK  A +FRK +T++Y+IA YSKPQVSI+NGIV GGGAG S HG FR
Sbjct  99   DVTSAVHDINSGKWKSVAIFFRKNYTLHYLIATYSKPQVSIMNGIVMGGGAGCSTHGSFR  158

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            VATE SVF+MPETALGLFPDVGASYFLSRLPG FGEYLGLTG+RLDGAEMLACGLATHFV
Sbjct  159  VATENSVFSMPETALGLFPDVGASYFLSRLPGHFGEYLGLTGARLDGAEMLACGLATHFV  218

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
            PS +L  LE ALH ++SSD  +ISAII E+S++P LKE+S Y+ L +I+RCFSRRT+E+I
Sbjct  219  PSAKLPSLEAALHTVDSSDQAVISAIIGEYSELPMLKEQSAYHRLDVINRCFSRRTVEDI  278

Query  827  MVALESEAANYKDDWISSAIQSLKKAS  907
            + ALE EA N  D WI ++IQSLKKAS
Sbjct  279  LSALEREATNKVDGWILASIQSLKKAS  305



>gb|EEE62843.1| hypothetical protein OsJ_17646 [Oryza sativa Japonica Group]
Length=378

 Score =   382 bits (981),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/274 (66%), Positives = 220/274 (80%), Gaps = 0/274 (0%)
 Frame = +2

Query  86   SNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSG  265
            S +D+DQVLVE  G  RT +LNR KQLNALSSAM++  L  F A E+D  VKL+++K  G
Sbjct  2    SPADSDQVLVEANGVTRTLVLNRPKQLNALSSAMITCFLRCFTAYEEDDGVKLLIVKGKG  61

Query  266  RAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGA  445
            RAFCAGGDV+AVV  I   +WK GA +FR EF +NY+IA YSKPQVS+L GIV GGGAG 
Sbjct  62   RAFCAGGDVAAVVRSINNDSWKYGAHFFRNEFLLNYIIATYSKPQVSLLTGIVMGGGAGV  121

Query  446  SIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLAC  625
            SIHGRFRV T+ +VFAMPETALGLFPD+GASYFLSRL GF+GEY+GLTG RLD AEMLAC
Sbjct  122  SIHGRFRVVTDSTVFAMPETALGLFPDIGASYFLSRLLGFYGEYVGLTGVRLDAAEMLAC  181

Query  626  GLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFS  805
            GLATHFVPS+RL  LEE+L  +++SDP  I  II ++SQ P LKEKS  N L+II++CFS
Sbjct  182  GLATHFVPSDRLSLLEESLKKVDTSDPFAICGIIDQYSQQPSLKEKSALNRLEIINKCFS  241

Query  806  RRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            ++T+EEI+ +LE EA N  D+WI+SAIQS++KAS
Sbjct  242  KKTVEEIIASLEQEAPNVADEWIASAIQSMRKAS  275



>ref|XP_008349454.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Malus domestica]
Length=374

 Score =   381 bits (978),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 183/270 (68%), Positives = 220/270 (81%), Gaps = 1/270 (0%)
 Frame = +2

Query  101  DQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCA  280
            D VLV++    RT  LNR +QLNAL+  M+SRL E FLA E D+NVKL+++K  GRAFCA
Sbjct  13   DSVLVQKNLIARTLTLNRPRQLNALNFDMISRLWEHFLAFEDDANVKLVIVKGKGRAFCA  72

Query  281  GGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGR  460
            GGDV+AVV  I +GNW+L A +F+KE+T+NY++A YSKPQVSIL+GIV GGGAGASIHGR
Sbjct  73   GGDVAAVVRQINEGNWRLAAYFFQKEYTLNYLLATYSKPQVSILDGIVMGGGAGASIHGR  132

Query  461  FRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATH  640
            FRVATE SVFAMPETALGLFPDVGASY+LSRLPGFFGEY+GLTG+RLDGAEMLAC LATH
Sbjct  133  FRVATENSVFAMPETALGLFPDVGASYYLSRLPGFFGEYVGLTGTRLDGAEMLACSLATH  192

Query  641  FVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIE  820
            FVPS RL  LEEAL+ ++SSD  II A+  ++S  P LK+KS Y  + +ID+CFSRRT+E
Sbjct  193  FVPSTRLSLLEEALYKVDSSDFAIIQAVXDKYSHSPALKKKSAYYRMDVIDKCFSRRTVE  252

Query  821  EIMVALES-EAANYKDDWISSAIQSLKKAS  907
            EI+ ALE  EA N  D W++S I +LKKAS
Sbjct  253  EIVSALEDEEAPNGXDAWLTSTIXALKKAS  282



>ref|XP_006296089.1| hypothetical protein CARUB_v10025239mg [Capsella rubella]
 gb|EOA28987.1| hypothetical protein CARUB_v10025239mg [Capsella rubella]
Length=381

 Score =   381 bits (978),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 185/271 (68%), Positives = 216/271 (80%), Gaps = 3/271 (1%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNAL  +M+SRLLELF   EKD +VKL++LK  GRAFCAG
Sbjct  6    QVLVEEKSSVRILTLNRPKQLNALCFSMISRLLELFREYEKDPSVKLVILKGHGRAFCAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV  VV +I QG W+LGA+YF  E+T+NYV+A +SK QVSILNGIV GGGAGASIHGRF
Sbjct  66   GDVPPVVRNIIQGKWRLGADYFTNEYTLNYVMATFSKNQVSILNGIVMGGGAGASIHGRF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASYFLSRL GFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  126  RIATENTVFAMPETALGLFPDVGASYFLSRLTGFFGEYVGLTGARLDGAEMLACGLATHF  185

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS RL  LE  L  ++S+DP  +S I+  ++Q P LK+ SPY+ L +I+RCFSRRT+EE
Sbjct  186  VPSTRLAALEADLWRVDSNDPNFVSKILDAYTQHPHLKQHSPYHRLHVINRCFSRRTVEE  245

Query  824  IMVALESEA---ANYKDDWISSAIQSLKKAS  907
            I+ ALE EA       +DWIS AI +LKKAS
Sbjct  246  IISALEREATRPTQEPNDWISKAISALKKAS  276



>gb|AAC02737.1| 3-hydroxyisobutyryl-coenzyme A hydrolase [Arabidopsis thaliana]
Length=376

 Score =   380 bits (975),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 178/268 (66%), Positives = 215/268 (80%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNAL   M+SRLL+LF A E+D +VKL++LK  GRAFCAG
Sbjct  6    QVLVEEKSSVRILTLNRPKQLNALCFNMISRLLQLFRAYEEDPSVKLVILKGQGRAFCAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV  VV ++ QG W+LGA++FR ++T+NYV+A YSKPQVSILNGIV G GAG SIHGRF
Sbjct  66   GDVPPVVQNMVQGKWRLGADFFRDQYTLNYVMATYSKPQVSILNGIVMGAGAGVSIHGRF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPET+LGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAE+LACGLATHF
Sbjct  126  RIATENTVFAMPETSLGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAELLACGLATHF  185

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS RL  LE  L  + SSDP+ +S I+  ++Q P LK+KS Y+ L +IDRCFS+RT+EE
Sbjct  186  VPSTRLTALETDLCKVGSSDPSFVSTILDAYTQHPHLKQKSAYHRLDVIDRCFSKRTMEE  245

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE E     DDW  + I++LKK+S
Sbjct  246  IISALERETTQELDDWSLTTIRALKKSS  273



>ref|NP_180624.2| probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Arabidopsis thaliana]
 sp|Q6NMB0.1|HIBC3_ARATH RecName: Full=Probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Arabidopsis 
thaliana]
 gb|AAS49114.1| At2g30660 [Arabidopsis thaliana]
 dbj|BAF01625.1| 3-hydroxyisobutyryl-coenzyme A hydrolase [Arabidopsis thaliana]
 gb|AEC08424.1| probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Arabidopsis thaliana]
Length=378

 Score =   380 bits (975),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 178/268 (66%), Positives = 215/268 (80%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNAL   M+SRLL+LF A E+D +VKL++LK  GRAFCAG
Sbjct  6    QVLVEEKSSVRILTLNRPKQLNALCFNMISRLLQLFRAYEEDPSVKLVILKGQGRAFCAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV  VV ++ QG W+LGA++FR ++T+NYV+A YSKPQVSILNGIV G GAG SIHGRF
Sbjct  66   GDVPPVVQNMVQGKWRLGADFFRDQYTLNYVMATYSKPQVSILNGIVMGAGAGVSIHGRF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPET+LGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAE+LACGLATHF
Sbjct  126  RIATENTVFAMPETSLGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAELLACGLATHF  185

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS RL  LE  L  + SSDP+ +S I+  ++Q P LK+KS Y+ L +IDRCFS+RT+EE
Sbjct  186  VPSTRLTALETDLCKVGSSDPSFVSTILDAYTQHPHLKQKSAYHRLDVIDRCFSKRTMEE  245

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE E     DDW  + I++LKK+S
Sbjct  246  IISALERETTQELDDWSLTTIRALKKSS  273



>ref|XP_009400737.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=386

 Score =   380 bits (975),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/283 (64%), Positives = 223/283 (79%), Gaps = 4/283 (1%)
 Frame = +2

Query  71   MASLSSNSD----TDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNV  238
            MA+ S N+D    +DQVLVE+    R   LNR +QLNALS+ M+ +LL+LF+A EKDS+V
Sbjct  1    MAASSPNADNDGTSDQVLVEDCRFTRILTLNRPQQLNALSTPMIMKLLKLFVAYEKDSDV  60

Query  239  KLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNG  418
            KL+++K +GRAF AGGDV+AV   + QG W LG E+ R ++T+NY+IA Y KPQVSILNG
Sbjct  61   KLLIVKGNGRAFSAGGDVAAVARSVAQGQWALGTEFLRNQYTLNYIIATYGKPQVSILNG  120

Query  419  IVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSR  598
            IV GGGAG SIHGRFRV TEK+VFAMPET+LG FPD+GASYFLSRLPGFFGEYLGLTG+R
Sbjct  121  IVMGGGAGVSIHGRFRVVTEKTVFAMPETSLGFFPDIGASYFLSRLPGFFGEYLGLTGAR  180

Query  599  LDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH  778
            LDGAEMLACGLATHFVPS  L  LE+ L  + +SDP +I A I +FSQ+  LK  S YN 
Sbjct  181  LDGAEMLACGLATHFVPSMNLAYLEDLLTKVETSDPFVICASIDQFSQMVPLKASSAYNR  240

Query  779  LKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            L IID+CFS+ T++EI+ ALE E+A+  D+WI  AIQ+LKKAS
Sbjct  241  LDIIDKCFSKETVQEIISALEKESASMADEWIVVAIQALKKAS  283



>dbj|BAJ97394.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score =   377 bits (967),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/279 (65%), Positives = 222/279 (80%), Gaps = 1/279 (0%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MAS +S SD+DQVLVE  G  RT ILNR KQLNALSSAMV+ LL+ F + E+++ VKL++
Sbjct  1    MASPAS-SDSDQVLVEANGSTRTLILNRPKQLNALSSAMVTGLLKCFTSYEEENTVKLLI  59

Query  251  LKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFG  430
            +K +GRAFCAGGDV+ V   I   +WK GA++FR EF +NY+IA YSKPQVS+L GIV G
Sbjct  60   VKGNGRAFCAGGDVAEVAQSINNDSWKYGADFFRTEFLLNYIIATYSKPQVSLLTGIVMG  119

Query  431  GGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGA  610
            GGAG SIHGRFRVATE +VFAMPETALGLFPD+GASYFLSRLPGF+GEY+GLTG+RLDGA
Sbjct  120  GGAGVSIHGRFRVATENTVFAMPETALGLFPDIGASYFLSRLPGFYGEYVGLTGARLDGA  179

Query  611  EMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKII  790
            EMLACGLATHFVP  R+  LEE+L  +++SDP  I  II +FS+ P LK  S  N + II
Sbjct  180  EMLACGLATHFVPLNRMSLLEESLKRVDASDPFAICGIIDQFSKQPSLKGSSSLNRMDII  239

Query  791  DRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +RCFS+ T+EEI+  LE EA +  D  +++AIQSL+KAS
Sbjct  240  NRCFSKGTVEEIISTLEQEAPSVSDKLVTAAIQSLRKAS  278



>ref|XP_010670002.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670003.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670004.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670005.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670006.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010670007.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   379 bits (974),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/275 (67%), Positives = 223/275 (81%), Gaps = 0/275 (0%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            +++S+ DQ+LV++   V+T ILNR KQLNALS  M+S+LLELF A E DS+VKL++LK +
Sbjct  6    TASSEFDQILVQDKQSVQTVILNRPKQLNALSYQMISQLLELFQAYENDSSVKLVLLKGN  65

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGGDV+ VV DI +GNWKLGA +F KEF +NY++A Y KPQVSILNGIV GGGAG
Sbjct  66   GRAFCAGGDVATVVRDISEGNWKLGANFFEKEFILNYIMATYRKPQVSILNGIVMGGGAG  125

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
            ASIHGRFR+ TE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDG EMLA
Sbjct  126  ASIHGRFRIVTENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGTRLDGPEMLA  185

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATHFV S++L  LE+ L  +N  DP  I  II ++ +VP LKEKS Y  L I+D+CF
Sbjct  186  CGLATHFVHSKQLPLLEKELCEVNIDDPLDICKIIDKYVEVPILKEKSAYRELHIVDKCF  245

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            S RT+E+I+ +LE+E A     WIS+AI+SLK AS
Sbjct  246  SCRTVEDILSSLENENAERSGGWISAAIESLKTAS  280



>ref|XP_004983577.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Setaria 
italica]
Length=386

 Score =   379 bits (973),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 182/283 (64%), Positives = 222/283 (78%), Gaps = 4/283 (1%)
 Frame = +2

Query  71   MASL----SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNV  238
            MASL    ++ +D+DQ+LVE     RT ILNR KQLNALSSAM+  LL  F A EKD  V
Sbjct  1    MASLPPAGAAGADSDQLLVEANDSTRTLILNRPKQLNALSSAMIMGLLRCFTAYEKDDGV  60

Query  239  KLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNG  418
            KL+++K  GRAFCAGGDV+AVV  I  G+WK GA++FR EF +NY+IA YSKPQVS+L G
Sbjct  61   KLLIMKGKGRAFCAGGDVAAVVRAINNGSWKYGADFFRNEFLLNYIIATYSKPQVSLLAG  120

Query  419  IVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSR  598
            IV GGGAG S+HGRFRV TE +VFAMPETALGLFPD+GASYFLSRLPGF+GEY+ L G+R
Sbjct  121  IVMGGGAGVSLHGRFRVVTENTVFAMPETALGLFPDIGASYFLSRLPGFYGEYVALAGAR  180

Query  599  LDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH  778
            LDGAEM ACGLATHFV   RL  LEE+L  +++S+P ++  II +F+Q P LKE S  N 
Sbjct  181  LDGAEMHACGLATHFVQINRLPSLEESLKKVDTSNPFVVCGIIDQFAQQPSLKENSSLNR  240

Query  779  LKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            L+II++CFS+RT+EEI+ ALE E +N  D+WI+S IQSLKKAS
Sbjct  241  LEIINKCFSKRTVEEIISALEQETSNSADEWIASTIQSLKKAS  283



>ref|XP_010097719.1| 3-hydroxyisobutyryl-CoA hydrolase 1 [Morus notabilis]
 gb|EXB70674.1| 3-hydroxyisobutyryl-CoA hydrolase 1 [Morus notabilis]
Length=386

 Score =   379 bits (973),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 184/281 (65%), Positives = 220/281 (78%), Gaps = 3/281 (1%)
 Frame = +2

Query  74   ASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVL  253
            +S++   D  QV+VEE    R   LNR ++LN+LS  M+SRL E+  ACE DSN+KL+++
Sbjct  3    SSITIWPDDQQVVVEEKLFARILTLNRPRKLNSLSYQMISRLFEVLSACEADSNIKLVIV  62

Query  254  KSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGG  433
            K  G+AFCAG DV A+V DI +GNW+L A+ FRKE T+ Y++A Y KPQVSILNGIV GG
Sbjct  63   KGKGKAFCAGADVVALVRDINEGNWRLSAQLFRKELTLIYLLATYCKPQVSILNGIVMGG  122

Query  434  GAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFG---EYLGLTGSRLD  604
            GAG S+HGRFRVATE SVFAMPETALG FPDVGASYFLSRL GFF    EYLGLTGSRLD
Sbjct  123  GAGVSMHGRFRVATENSVFAMPETALGHFPDVGASYFLSRLSGFFSNGREYLGLTGSRLD  182

Query  605  GAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLK  784
            GAEMLACGLATHFVPS RL  LEEAL  ++SSDP IIS II ++SQ P LK+KS Y  L 
Sbjct  183  GAEMLACGLATHFVPSTRLCLLEEALCKVDSSDPAIISGIIDKYSQQPNLKDKSSYLRLN  242

Query  785  IIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +ID+CFS+RT+E+I+ +LE EA N  DDWI + IQ+LKKAS
Sbjct  243  VIDKCFSQRTVEQIISSLEREAINKADDWIPATIQTLKKAS  283



>ref|XP_010275254.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Nelumbo nucifera]
Length=383

 Score =   379 bits (972),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 193/279 (69%), Positives = 228/279 (82%), Gaps = 0/279 (0%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MA  S +  TDQ+LVEE   VRT ILNR +QLNALS  MVS LLELF   E+D NVKL++
Sbjct  1    MADNSISGKTDQILVEEHSYVRTLILNRPRQLNALSLQMVSHLLELFTIYEEDRNVKLLI  60

Query  251  LKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFG  430
            LK  GRAFCAGGDV+AVV D   G+W+LGA +F  E+T+NY++A Y+KPQVSILNGI+FG
Sbjct  61   LKGEGRAFCAGGDVAAVVKDTTDGHWRLGARFFWIEYTLNYIMATYNKPQVSILNGIIFG  120

Query  431  GGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGA  610
            GGAGASIHGRFR+ATE SVF+MPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGA
Sbjct  121  GGAGASIHGRFRIATENSVFSMPETALGLFPDVGASYFLSRLPGFFGEYIGLTGARLDGA  180

Query  611  EMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKII  790
            EMLACGLATHFVP+ +L  LEEAL  +N+SDP ++S II + S+ P LK K  Y+ L  I
Sbjct  181  EMLACGLATHFVPAMKLSLLEEALFKVNTSDPAVVSTIIDKISEHPPLKAKCAYHRLDAI  240

Query  791  DRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +RCFS+RT+EEI+ ALE EAAN  D+W+S  IQSLKKAS
Sbjct  241  NRCFSKRTVEEILSALEKEAANGADNWLSETIQSLKKAS  279



>gb|EEC78762.1| hypothetical protein OsI_18988 [Oryza sativa Indica Group]
Length=437

 Score =   379 bits (973),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/268 (66%), Positives = 216/268 (81%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            +VLVE  G  RT +LNR KQLNALSSAM++  L  F A E+D  VKL+++K  GRAFCAG
Sbjct  66   EVLVEANGVTRTLVLNRPKQLNALSSAMITCFLRCFTAYEEDDGVKLLIVKGKGRAFCAG  125

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV+AVV  I   +WK GA +FR EF +NY+IA YSKPQVS+L GIV GGGAG SIHGRF
Sbjct  126  GDVAAVVRSINNDSWKYGAHFFRNEFLLNYIIATYSKPQVSLLTGIVMGGGAGVSIHGRF  185

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            RV T+ +VFAMPETALGLFPD+GASYFLSRLPGF+GEY+GLTG RLD AEMLACGLATHF
Sbjct  186  RVVTDSTVFAMPETALGLFPDIGASYFLSRLPGFYGEYVGLTGVRLDAAEMLACGLATHF  245

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS+RL  LEE+L  +++SDP  I  II ++SQ P LKEKS  N L+II++CFS++T+EE
Sbjct  246  VPSDRLSLLEESLKKVDTSDPFAICGIIDQYSQQPSLKEKSALNRLEIINKCFSKKTVEE  305

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ +LE EA N  D+WI+SAIQS++KAS
Sbjct  306  IIASLEQEAPNVADEWIASAIQSMRKAS  333



>ref|XP_006339518.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Solanum tuberosum]
Length=361

 Score =   375 bits (963),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 192/281 (68%), Positives = 216/281 (77%), Gaps = 25/281 (9%)
 Frame = +2

Query  71   MASLSSNS-DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MA  SSN+ +TD+VLVEE G VRTFILNR KQLNALS  M                    
Sbjct  1    MAQTSSNNGETDEVLVEERGSVRTFILNRPKQLNALSFQM--------------------  40

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
                 GRAFCAGGD+S   H IRQGNW+LGA Y R+++T+ Y+IA Y KPQVSILNGIV 
Sbjct  41   ---GHGRAFCAGGDLSTPFHIIRQGNWQLGANYLREQYTLIYMIATYRKPQVSILNGIVM  97

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG SIHGRFRVATEKSVFAMPETA+GLFPDVG+SYFLSRLPGFFGEY GLTGSR DG
Sbjct  98   GGGAGVSIHGRFRVATEKSVFAMPETAMGLFPDVGSSYFLSRLPGFFGEYAGLTGSRFDG  157

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEMLACGLATHFV S++L  LE+ L  +N+SDP  ISAIIS FS +PKLKE SPY+ +KI
Sbjct  158  AEMLACGLATHFVSSDKLPLLEQELVKVNTSDPDAISAIISRFSHIPKLKEGSPYHKMKI  217

Query  788  IDRCFSRRTIEEIMVALESEAANYK-DDWISSAIQSLKKAS  907
            IDRCFSRRTIEEI+  LE+EA + K +DWISS IQ LKKAS
Sbjct  218  IDRCFSRRTIEEIISTLENEALDKKEEDWISSTIQLLKKAS  258



>gb|ABA97000.2| 3-hydroxyisobutyryl-coenzyme A hydrolase, putative, expressed 
[Oryza sativa Japonica Group]
 gb|ABG21949.1| 3-hydroxyisobutyryl-coenzyme A hydrolase, putative, expressed 
[Oryza sativa Japonica Group]
 gb|ABG21950.1| 3-hydroxyisobutyryl-coenzyme A hydrolase, putative, expressed 
[Oryza sativa Japonica Group]
 gb|ABG21951.1| 3-hydroxyisobutyryl-coenzyme A hydrolase, putative, expressed 
[Oryza sativa Japonica Group]
 gb|ABG21953.1| 3-hydroxyisobutyryl-coenzyme A hydrolase, putative, expressed 
[Oryza sativa Japonica Group]
 gb|ABG21954.1| 3-hydroxyisobutyryl-coenzyme A hydrolase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG94822.1| unnamed protein product [Oryza sativa Japonica Group]
Length=373

 Score =   375 bits (964),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 178/268 (66%), Positives = 215/268 (80%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVE  G  RT +LNR KQLNALSSAM++  L  F A E+D  VKL+++K  GRAFCAG
Sbjct  3    QVLVEANGVTRTLVLNRPKQLNALSSAMITCFLRCFTAYEEDDGVKLLIVKGKGRAFCAG  62

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV+AVV  I   +WK GA +FR EF +NY+IA YSKPQVS+L GIV GGGAG SIHGRF
Sbjct  63   GDVAAVVRSINNDSWKYGAHFFRNEFLLNYIIATYSKPQVSLLTGIVMGGGAGVSIHGRF  122

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            RV T+ +VFAMPETALGLFPD+GASYFLSRL GF+GEY+GLTG RLD AEMLACGLATHF
Sbjct  123  RVVTDSTVFAMPETALGLFPDIGASYFLSRLLGFYGEYVGLTGVRLDAAEMLACGLATHF  182

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS+RL  LEE+L  +++SDP  I  II ++SQ P LKEKS  N L+II++CFS++T+EE
Sbjct  183  VPSDRLSLLEESLKKVDTSDPFAICGIIDQYSQQPSLKEKSALNRLEIINKCFSKKTVEE  242

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ +LE EA N  D+WI+SAIQS++KAS
Sbjct  243  IIASLEQEAPNVADEWIASAIQSMRKAS  270



>ref|XP_006598670.1| PREDICTED: peroxisomal 3-hydroxyisobutyryl-coenzyme A hydrolase 
isoform X1 [Glycine max]
 gb|KHM99999.1| 3-hydroxyisobutyryl-CoA hydrolase 1 [Glycine soja]
Length=382

 Score =   375 bits (964),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 177/277 (64%), Positives = 219/277 (79%), Gaps = 0/277 (0%)
 Frame = +2

Query  77   SLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLK  256
            +  S  D +QVLV+     R   LNR KQLNALS  MVSRLLE+F   EKDS++KL+V+K
Sbjct  2    AFPSKGDDEQVLVQRKSNARVLTLNRTKQLNALSFYMVSRLLEIFSEDEKDSDIKLVVVK  61

Query  257  SSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGG  436
             +GRAFCAGGDV+AV  D  +G+W+ GA +F+ EF +NY++A YSKPQVSILNGIV GGG
Sbjct  62   GNGRAFCAGGDVAAVARDGSKGDWRFGANFFQSEFKLNYLMATYSKPQVSILNGIVMGGG  121

Query  437  AGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEM  616
            AG S+HGRFRV TE +VFAMPETALGLFPD+G+SYFLSRLPGF GEY GLTG+RLDGAEM
Sbjct  122  AGVSVHGRFRVVTENTVFAMPETALGLFPDIGSSYFLSRLPGFLGEYAGLTGARLDGAEM  181

Query  617  LACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDR  796
            LACGLATHFVPS +L  LEEAL  + +SDP  +SAII+++S+ P LKE S Y+ + +I++
Sbjct  182  LACGLATHFVPSSKLSLLEEALCKVETSDPNAVSAIINKYSEQPFLKEDSVYHRMDVINK  241

Query  797  CFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            CFS++ +EEI+ +LE EA    D WIS+ IQSLKKAS
Sbjct  242  CFSKKAVEEILSSLEVEATRKADPWISATIQSLKKAS  278



>ref|XP_010235022.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Brachypodium 
distachyon]
Length=381

 Score =   375 bits (963),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 181/279 (65%), Positives = 224/279 (80%), Gaps = 1/279 (0%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MAS +S S +DQVLVE  G  RT ILNR +QLNALSSAMV+ LL  F + E+++ VKL++
Sbjct  1    MASPAS-SASDQVLVEANGSTRTLILNRPRQLNALSSAMVTGLLRCFNSYEEENAVKLLI  59

Query  251  LKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFG  430
            +K  GRAFCAGGDV+ V   +    WK GA++FR EF +NY+IA YSKPQVS+L GIV G
Sbjct  60   VKGKGRAFCAGGDVAEVAQSVNNDTWKYGADFFRTEFLLNYIIATYSKPQVSLLTGIVMG  119

Query  431  GGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGA  610
            GGAG SIHGRFRVATE +VFAMPETALGLFPD+GASYFLSRLPGF+GEY+GLTG+RLDGA
Sbjct  120  GGAGVSIHGRFRVATENTVFAMPETALGLFPDIGASYFLSRLPGFYGEYVGLTGARLDGA  179

Query  611  EMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKII  790
            EMLACGLATHFV   R+  LEE+L  +++SDP  I  II +FSQ P +KE S  N L+II
Sbjct  180  EMLACGLATHFVHLNRMSLLEESLKKMDTSDPFEICGIIDQFSQQPSIKESSTLNRLEII  239

Query  791  DRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            ++CFS+RT+EEI+ ALE EAA+  D+W+++AI+SL+KAS
Sbjct  240  NKCFSKRTVEEIVSALEQEAASATDEWVTAAIRSLRKAS  278



>ref|XP_010526531.1| PREDICTED: LOW QUALITY PROTEIN: 3-hydroxyisobutyryl-CoA hydrolase 
1-like [Tarenaya hassleriana]
Length=369

 Score =   374 bits (959),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/268 (67%), Positives = 212/268 (79%), Gaps = 5/268 (2%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNALS  M+SRLLELF+A E D  VKL++LK  GR     
Sbjct  4    QVLVEEKPSVRILTLNRPKQLNALSFPMISRLLELFIAYEDDPTVKLVILKGQGRX----  59

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
             DV+AVVHDIR+G+W+LGA +F KEF +NYV+A YSKPQVS LNGIV GGGAG S+HGRF
Sbjct  60   -DVAAVVHDIRRGHWRLGAHFFSKEFVLNYVMATYSKPQVSFLNGIVMGGGAGVSVHGRF  118

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPET+LGLFPD+GASYFLSRLPGFFGEYLGLTG+R+DGAEMLACGLATHF
Sbjct  119  RIATENTVFAMPETSLGLFPDIGASYFLSRLPGFFGEYLGLTGARIDGAEMLACGLATHF  178

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            V S  L  LEE L    + D   IS II  +SQ P+LKE+S Y+ L +I++CFSRRT+EE
Sbjct  179  VLSTSLTALEEDLFRAGTGDTASISTIIDAYSQQPRLKEQSAYHRLDVINKCFSRRTVEE  238

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE E A+  DDW+S+ IQ+LKKAS
Sbjct  239  IIFALEREVAHQADDWVSATIQALKKAS  266



>gb|ABA96999.2| 3-hydroxyisobutyryl-coenzyme A hydrolase, putative, expressed 
[Oryza sativa Japonica Group]
Length=523

 Score =   379 bits (972),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/268 (66%), Positives = 215/268 (80%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVE  G  RT +LNR KQLNALSSAM++  L  F A E+D  VKL+++K  GRAFCAG
Sbjct  244  QVLVEANGVTRTLVLNRPKQLNALSSAMITCFLRCFTAYEEDDGVKLLIVKGKGRAFCAG  303

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV+AVV  I   +WK GA +FR EF +NY+IA YSKPQVS+L GIV GGGAG SIHGRF
Sbjct  304  GDVAAVVRSINNDSWKYGAHFFRNEFLLNYIIATYSKPQVSLLTGIVMGGGAGVSIHGRF  363

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            RV T+ +VFAMPETALGLFPD+GASYFLSRL GF+GEY+GLTG RLD AEMLACGLATHF
Sbjct  364  RVVTDSTVFAMPETALGLFPDIGASYFLSRLLGFYGEYVGLTGVRLDAAEMLACGLATHF  423

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS+RL  LEE+L  +++SDP  I  II ++SQ P LKEKS  N L+II++CFS++T+EE
Sbjct  424  VPSDRLSLLEESLKKVDTSDPFAICGIIDQYSQQPSLKEKSALNRLEIINKCFSKKTVEE  483

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ +LE EA N  D+WI+SAIQS++KAS
Sbjct  484  IIASLEQEAPNVADEWIASAIQSMRKAS  511



>dbj|BAJ94413.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   374 bits (959),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/279 (65%), Positives = 222/279 (80%), Gaps = 1/279 (0%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MAS +S SD+DQVLVE  G  RT ILNR KQLNALSSAMV+ LL+ F + E+++ VKL++
Sbjct  1    MASPAS-SDSDQVLVEANGSTRTLILNRPKQLNALSSAMVTGLLKCFTSYEEENTVKLLI  59

Query  251  LKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFG  430
            +K +GRAFCAGGDV+ V   I   +WK GA++FR EF +NY+IA YSKPQVS+L GIV G
Sbjct  60   VKGNGRAFCAGGDVAEVAQSINNDSWKYGADFFRTEFLLNYIIATYSKPQVSLLTGIVMG  119

Query  431  GGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGA  610
            GGAG SIHGRFRVATE +VFAMPETALGLFPD+GASYFLSRLPGF+GEY+GLTG+RLDGA
Sbjct  120  GGAGVSIHGRFRVATENTVFAMPETALGLFPDIGASYFLSRLPGFYGEYVGLTGARLDGA  179

Query  611  EMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKII  790
            EMLACGLATHFVP  R+  LEE+L  +++SDP  I  II +FS+ P LK  S  N + II
Sbjct  180  EMLACGLATHFVPLNRMSLLEESLKRVDASDPFAICGIIDQFSKQPSLKGSSSLNRMDII  239

Query  791  DRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +RCFS+ T+EEI+  LE EA +  D  +++AIQSL+KAS
Sbjct  240  NRCFSKGTVEEIISTLEQEAPSVSDKLVTAAIQSLRKAS  278



>ref|XP_006662093.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Oryza brachyantha]
Length=382

 Score =   374 bits (959),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 179/279 (64%), Positives = 213/279 (76%), Gaps = 0/279 (0%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MAS    +DTD VLVE  G  RT +LNR KQLNA S  M+ + L  F A E+D  VKL++
Sbjct  1    MASPPPPADTDLVLVEANGATRTLVLNRPKQLNAFSYEMIMKFLRCFTAYEEDEGVKLLI  60

Query  251  LKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFG  430
            +K  GRAFCAGGDVSAVV  I   +WK GA +F  EF +NY+IA  +KPQVS+L GIV G
Sbjct  61   VKGKGRAFCAGGDVSAVVRSINNDSWKYGAHFFGNEFLLNYIIATCNKPQVSLLTGIVMG  120

Query  431  GGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGA  610
            GGAG SIHGRFRV TE ++FAMPETALGLFPD+GASYFLSRLPGF+GEY GLTG RLD  
Sbjct  121  GGAGISIHGRFRVVTESTIFAMPETALGLFPDIGASYFLSRLPGFYGEYAGLTGVRLDAP  180

Query  611  EMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKII  790
            EMLACGLATHFVPS+RL  LEE+L  +++SDP  I  II ++SQ P LKEKS  N L+II
Sbjct  181  EMLACGLATHFVPSDRLALLEESLKKVDTSDPFAICGIIDQYSQQPSLKEKSALNRLEII  240

Query  791  DRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            ++CFS+RT+EEI+ +LE EA N  D+WI  AIQS+KKAS
Sbjct  241  NKCFSKRTVEEIIASLEQEALNVADEWIPVAIQSMKKAS  279



>dbj|BAJ89600.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   373 bits (958),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/279 (65%), Positives = 222/279 (80%), Gaps = 1/279 (0%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MAS +S SD+DQVLVE  G  RT ILNR KQLNALSSAMV+ LL+ F + E+++ VKL++
Sbjct  1    MASPAS-SDSDQVLVEANGSTRTLILNRPKQLNALSSAMVTGLLKCFTSYEEENTVKLLI  59

Query  251  LKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFG  430
            +K +GRAFCAGGDV+ V   I   +WK GA++FR EF +NY+IA YSKPQVS+L GIV G
Sbjct  60   VKGNGRAFCAGGDVAEVAQSINNDSWKYGADFFRTEFLLNYIIATYSKPQVSLLTGIVMG  119

Query  431  GGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGA  610
            GGAG SIHGRFRVATE +VFAMPETALGLFPD+GASYFLSRLPGF+GEY+GLTG+RLDGA
Sbjct  120  GGAGVSIHGRFRVATENTVFAMPETALGLFPDIGASYFLSRLPGFYGEYVGLTGARLDGA  179

Query  611  EMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKII  790
            EMLACGLATHFVP  R+  LEE+L  +++SDP  I  II +FS+ P LK  S  N + II
Sbjct  180  EMLACGLATHFVPLNRMSLLEESLKRVDASDPFAICGIIDQFSKQPSLKGSSSLNRMDII  239

Query  791  DRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +RCFS+ T+EEI+  LE EA +  D  +++AIQSL+KAS
Sbjct  240  NRCFSKGTVEEIISTLEQEAPSVSDKLVTAAIQSLRKAS  278



>ref|NP_001066529.1| Os12g0264500 [Oryza sativa Japonica Group]
 dbj|BAF29548.1| Os12g0264500, partial [Oryza sativa Japonica Group]
Length=489

 Score =   376 bits (966),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 178/268 (66%), Positives = 215/268 (80%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVE  G  RT +LNR KQLNALSSAM++  L  F A E+D  VKL+++K  GRAFCAG
Sbjct  119  QVLVEANGVTRTLVLNRPKQLNALSSAMITCFLRCFTAYEEDDGVKLLIVKGKGRAFCAG  178

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV+AVV  I   +WK GA +FR EF +NY+IA YSKPQVS+L GIV GGGAG SIHGRF
Sbjct  179  GDVAAVVRSINNDSWKYGAHFFRNEFLLNYIIATYSKPQVSLLTGIVMGGGAGVSIHGRF  238

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            RV T+ +VFAMPETALGLFPD+GASYFLSRL GF+GEY+GLTG RLD AEMLACGLATHF
Sbjct  239  RVVTDSTVFAMPETALGLFPDIGASYFLSRLLGFYGEYVGLTGVRLDAAEMLACGLATHF  298

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS+RL  LEE+L  +++SDP  I  II ++SQ P LKEKS  N L+II++CFS++T+EE
Sbjct  299  VPSDRLSLLEESLKKVDTSDPFAICGIIDQYSQQPSLKEKSALNRLEIINKCFSKKTVEE  358

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ +LE EA N  D+WI+SAIQS++KAS
Sbjct  359  IIASLEQEAPNVADEWIASAIQSMRKAS  386



>ref|XP_010469817.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Camelina 
sativa]
Length=375

 Score =   372 bits (956),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 175/268 (65%), Positives = 211/268 (79%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            Q+LVEE   VR   LNR +QLNALSS M+SRLL+LF A E+D +V L++LK  GRAFCAG
Sbjct  6    QILVEEKSSVRILTLNRPRQLNALSSNMISRLLQLFRAYEEDPSVTLVILKGQGRAFCAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GD+  ++  + QG W+LGA +F  ++T+NYV+A YSK QVSILNGIV G GAG SIHGRF
Sbjct  66   GDIPPLLSYVIQGKWRLGAPFFADQYTLNYVLATYSKAQVSILNGIVMGAGAGVSIHGRF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGL PDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  126  RIATENTVFAMPETALGLLPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  185

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS RL  LEE L  + SSDP+  S I+  +++ P +K+ S Y+ L +IDRCFSRRT+E+
Sbjct  186  VPSTRLTSLEEDLCTVGSSDPSFASTILDAYTERPHVKQNSAYHRLDVIDRCFSRRTVED  245

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE E     DDWISS  Q+LKKAS
Sbjct  246  IISALEREFTQRPDDWISSTTQALKKAS  273



>ref|NP_001238393.1| peroxisomal 3-hydroxyisobutyryl-coenzyme A hydrolase [Glycine 
max]
 dbj|BAG09371.1| peroxisomal 3-hydroxyisobutyryl-coenzyme A hydrolase [Glycine 
max]
Length=387

 Score =   372 bits (956),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/282 (63%), Positives = 220/282 (78%), Gaps = 5/282 (2%)
 Frame = +2

Query  77   SLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLK  256
            +  S  D +QVLV+     R   LNR KQLNALS  MVSRLLE+F   EKDS++KL+V+K
Sbjct  2    AFPSKGDDEQVLVQRKSNARVLTLNRTKQLNALSFYMVSRLLEIFSEDEKDSDIKLVVVK  61

Query  257  SS-----GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGI  421
            SS     GRAFCAGGDV+AV  D  +G+W+ GA +F+ EF +NY++A YSKPQVSILNGI
Sbjct  62   SSVIKGNGRAFCAGGDVAAVARDGSKGDWRFGANFFQSEFKLNYLMATYSKPQVSILNGI  121

Query  422  VFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRL  601
            V GGGAG S+HGRFRV TE +VFAMPETALGLFPD+G+SYFLSRLPGF GEY GLTG+RL
Sbjct  122  VMGGGAGVSVHGRFRVVTENTVFAMPETALGLFPDIGSSYFLSRLPGFLGEYAGLTGARL  181

Query  602  DGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHL  781
            DGAEMLACGLATHFVPS +L  LEEAL  + +SDP  +SAII+++S+ P LKE S Y+ +
Sbjct  182  DGAEMLACGLATHFVPSSKLSLLEEALCKVETSDPNAVSAIINKYSEQPFLKEDSVYHRM  241

Query  782  KIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
             +I++CFS++ +EEI+ +LE EA    D WIS+ IQSLKKAS
Sbjct  242  DVINKCFSKKAVEEILSSLEVEATRKADPWISATIQSLKKAS  283



>ref|XP_009130579.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1 isoform X2 [Brassica 
rapa]
Length=367

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/268 (66%), Positives = 214/268 (80%), Gaps = 7/268 (3%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNALS  M+SRLL+LFLA E+D +VKL++LK  GRAFCAG
Sbjct  6    QVLVEEKSSVRILTLNRPKQLNALSFQMISRLLQLFLAYEEDPSVKLVILKGQGRAFCAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDVSAVV DI QGNW+LGA++F  E+ +NYV+A Y+KPQVSILNGIV GGGAG S+HG F
Sbjct  66   GDVSAVVRDIGQGNWRLGAKFFADEYMLNYVMATYTKPQVSILNGIVMGGGAGVSVHGPF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPET LGLFPDVGASYFLSRLPGFF       G+RLDGA+MLACGLATH+
Sbjct  126  RIATENTVFAMPETVLGLFPDVGASYFLSRLPGFF-------GARLDGADMLACGLATHY  178

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            +PS RL  LE  L  ++SSDP ++S I+  ++Q P LK++S Y+ L +IDRCFS RT+EE
Sbjct  179  LPSTRLTALEAELCRVDSSDPALVSTILDAYTQNPHLKQQSAYHRLDVIDRCFSGRTVEE  238

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE EA +  DDWISS I++LKKAS
Sbjct  239  IIAALEREATHGGDDWISSTIRALKKAS  266



>dbj|BAJ86945.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88128.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=422

 Score =   373 bits (958),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/279 (65%), Positives = 222/279 (80%), Gaps = 1/279 (0%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MAS +S SD+DQVLVE  G  RT ILNR KQLNALSSAMV+ LL+ F + E+++ VKL++
Sbjct  42   MASPAS-SDSDQVLVEANGSTRTLILNRPKQLNALSSAMVTGLLKCFTSYEEENTVKLLI  100

Query  251  LKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFG  430
            +K +GRAFCAGGDV+ V   I   +WK GA++FR EF +NY+IA YSKPQVS+L GIV G
Sbjct  101  VKGNGRAFCAGGDVAEVAQSINNDSWKYGADFFRTEFLLNYIIATYSKPQVSLLTGIVMG  160

Query  431  GGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGA  610
            GGAG SIHGRFRVATE +VFAMPETALGLFPD+GASYFLSRLPGF+GEY+GLTG+RLDGA
Sbjct  161  GGAGVSIHGRFRVATENTVFAMPETALGLFPDIGASYFLSRLPGFYGEYVGLTGARLDGA  220

Query  611  EMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKII  790
            EMLACGLATHFVP  R+  LEE+L  +++SDP  I  II +FS+ P LK  S  N + II
Sbjct  221  EMLACGLATHFVPLNRMSLLEESLKRVDASDPFAICGIIDQFSKQPSLKGSSSLNRMDII  280

Query  791  DRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +RCFS+ T+EEI+  LE EA +  D  +++AIQSL+KAS
Sbjct  281  NRCFSKGTVEEIISTLEQEAPSVSDKLVTAAIQSLRKAS  319



>ref|XP_002881122.1| hypothetical protein ARALYDRAFT_481983 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57381.1| hypothetical protein ARALYDRAFT_481983 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   372 bits (954),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/281 (64%), Positives = 218/281 (78%), Gaps = 13/281 (5%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   V    LNR KQLNAL   M+SRLL+LFLA E+D +VKL++LK  GRAFCAG
Sbjct  6    QVLVEEKSSVGILTLNRPKQLNALCFNMISRLLQLFLAYEEDPSVKLVILKGQGRAFCAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV  VV+++ QG W+LGA++FR ++T+NYV+A YSKPQVSILNGIV G GAGASIHGRF
Sbjct  66   GDVPPVVNNMVQGKWRLGADFFRDQYTLNYVMATYSKPQVSILNGIVMGAGAGASIHGRF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  126  RIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  185

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH-------------LK  784
            VPS RL  LE  L  + +SDP+ +S I+  ++Q P LK+ S Y+              L 
Sbjct  186  VPSSRLTALEADLCKVGTSDPSFVSTILDAYTQHPHLKQNSLYHRQYIACFININLQLLD  245

Query  785  IIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +IDRCFS+RT+EEI+ ALE +A    DDWI + I++LKK+S
Sbjct  246  VIDRCFSKRTMEEIISALERDATQELDDWILTTIRALKKSS  286



>ref|XP_007032272.1| Beta-hydroxyisobutyryl-CoA hydrolase 1 isoform 2 [Theobroma cacao]
 gb|EOY03198.1| Beta-hydroxyisobutyryl-CoA hydrolase 1 isoform 2 [Theobroma cacao]
Length=346

 Score =   369 bits (948),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 176/241 (73%), Positives = 207/241 (86%), Gaps = 0/241 (0%)
 Frame = +2

Query  185  MVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFT  364
            M+SRLLELFLA E+D NVKL++LK  GRAFCAGGDV+A+V DIR  +W+ GA++F KEFT
Sbjct  1    MISRLLELFLAYEEDPNVKLVILKGKGRAFCAGGDVAALVRDIRGDDWRAGAKFFLKEFT  60

Query  365  MNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYF  544
            +NY++AAYSKPQVSILNGIV GGGAGAS+HGRFRVATE SVFAMPETALGLFPDVGASYF
Sbjct  61   LNYLMAAYSKPQVSILNGIVMGGGAGASVHGRFRVATENSVFAMPETALGLFPDVGASYF  120

Query  545  LSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAI  724
            LSRLPGFFGEY+GLTGSRLDGAEMLACGLATHFVPS +L  LE AL  ++SSDP IIS+I
Sbjct  121  LSRLPGFFGEYVGLTGSRLDGAEMLACGLATHFVPSAKLAMLEAALCIVDSSDPVIISSI  180

Query  725  ISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKA  904
            I ++ + P LKE+S Y  L +IDRCFS++T+EEI+ ALE E  +  D WIS+ IQ+LKKA
Sbjct  181  IDQYCEQPSLKEQSVYKRLDVIDRCFSQKTVEEIISALERELVHKMDVWISTTIQTLKKA  240

Query  905  S  907
            S
Sbjct  241  S  241



>ref|XP_004510202.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Cicer arietinum]
Length=382

 Score =   370 bits (951),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 180/283 (64%), Positives = 222/283 (78%), Gaps = 0/283 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            D +QVLVE     R   LNR KQLNALS  MVS+LLE+F   E +S+VKL+V+K +GRAF
Sbjct  8    DHNQVLVERKSSARVLTLNRPKQLNALSYFMVSKLLEIFQNDEGNSDVKLVVVKGNGRAF  67

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV+AVV D R G+W+ GA +F  E+ +NY++A YSKPQ+SILNGIV GGGAGASIH
Sbjct  68   CAGGDVAAVVRDARGGDWRFGAIFFDTEYKLNYLMATYSKPQISILNGIVMGGGAGASIH  127

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            GRFRV TE +VFAMPET LGLFPDVGASYFLSRL GFFGEY+GLTG+RLDGAEMLACGLA
Sbjct  128  GRFRVVTENTVFAMPETDLGLFPDVGASYFLSRLVGFFGEYVGLTGARLDGAEMLACGLA  187

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFVPS +L  LEE+L  + +SDP  +SAII ++S+ P LKE S Y+ L +I++CFS +T
Sbjct  188  THFVPSSKLSLLEESLCKVETSDPAAVSAIIDKYSEQPFLKEDSVYHRLDVINKCFSGKT  247

Query  815  IEEIMVALESEAANYKDDWISSAIQSLKKASIDFNGCLLMLFR  943
            +EEI+ +LE+EA N  D+WIS+ +++LKKAS       L L R
Sbjct  248  MEEILSSLETEAMNKADNWISATLETLKKASPTSLKVFLRLIR  290



>ref|XP_010469815.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Camelina 
sativa]
Length=381

 Score =   370 bits (950),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 174/268 (65%), Positives = 211/268 (79%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            Q+LVEE   VR   LNR +QLNALSS M+SRLL+LF A E+D +V L++LK  GRAFCAG
Sbjct  12   QILVEEKSSVRILTLNRPRQLNALSSNMISRLLQLFRAYEEDPSVTLVILKGQGRAFCAG  71

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GD+  ++  + QG W+LGA +F  ++T+NYV+A YSK QVSILNGIV G GAG SIHGRF
Sbjct  72   GDLRPLLSYVIQGKWRLGAAFFADQYTLNYVLATYSKAQVSILNGIVMGAGAGVSIHGRF  131

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETA+G+FPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  132  RIATENTVFAMPETAIGIFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  191

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS RL  LE  L  + SSDP+  S I+  +++ P +K+ S Y+ L IIDRCFSRRT+E+
Sbjct  192  VPSTRLTALEADLCTVGSSDPSFASKILDAYTERPNVKQNSAYHRLDIIDRCFSRRTVED  251

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE E     DDWISS  Q+LKKAS
Sbjct  252  IISALEREFTQIPDDWISSTTQALKKAS  279



>ref|XP_010510320.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 isoform 
X1 [Camelina sativa]
 ref|XP_010510321.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 isoform 
X2 [Camelina sativa]
Length=377

 Score =   369 bits (947),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/267 (66%), Positives = 210/267 (79%), Gaps = 0/267 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            +LVEE    R   LNR KQLN LS  M++RLL+LFLA E+D +VKL++LK  GRAFCAGG
Sbjct  7    ILVEEKSSARILTLNRPKQLNVLSFNMMTRLLQLFLAYEEDPSVKLVILKGQGRAFCAGG  66

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV   V +I QGNW+L A+ F +E+ +NYV+A Y K QVSILNGIV GGGAG S+HGRFR
Sbjct  67   DVKPTVRNIVQGNWRLSADIFAEEYMLNYVMATYRKAQVSILNGIVMGGGAGLSVHGRFR  126

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            +ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHFV
Sbjct  127  IATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHFV  186

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
            PS  L  LE  L  ++S+DP  +  I+  ++Q P LK+ S Y+ L +IDRCFSRRTIEEI
Sbjct  187  PSTSLTLLEADLCGVDSNDPNFVPTILDAYTQHPHLKQDSAYHRLNVIDRCFSRRTIEEI  246

Query  827  MVALESEAANYKDDWISSAIQSLKKAS  907
            + ALE EA    +DWIS+ I++LKKAS
Sbjct  247  ISALEREATQEPNDWISTTIRALKKAS  273



>ref|XP_002881124.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57383.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=382

 Score =   369 bits (947),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/271 (67%), Positives = 213/271 (79%), Gaps = 3/271 (1%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR  QLNAL   M+SRLL+LFLA E+D +VKL++LK  GRAFCAG
Sbjct  6    QVLVEEKSSVRILTLNRPNQLNALCLNMISRLLQLFLAYEEDPSVKLVILKGQGRAFCAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GD   +V DI QG W+L A +   ++T+NYV+A YSKPQVSILNGIV GGG G SIHGRF
Sbjct  66   GDALPLVRDIVQGKWRLAANFLTYQYTLNYVLATYSKPQVSILNGIVMGGGVGLSIHGRF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  126  RIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  185

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPY--NHLKIIDRCFSRRTI  817
            VPS RL  LEE L  + SSDP+ +S I+  ++Q P LK+KS +    L +IDRCFSRRT+
Sbjct  186  VPSTRLTALEEDLCKVGSSDPSFVSTILDAYTQHPHLKQKSVFLRQVLDVIDRCFSRRTV  245

Query  818  EEIMVALESEAANYK-DDWISSAIQSLKKAS  907
            EEI+ ALE E A+ +  DWIS+ I +LKKAS
Sbjct  246  EEILSALERETAHQEPHDWISTIIGALKKAS  276



>gb|ABA96998.2| 3-hydroxyisobutyryl-coenzyme A hydrolase, putative, expressed 
[Oryza sativa Japonica Group]
Length=614

 Score =   377 bits (967),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/268 (66%), Positives = 215/268 (80%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVE  G  RT +LNR KQLNALSSAM++  L  F A E+D  VKL+++K  GRAFCAG
Sbjct  244  QVLVEANGVTRTLVLNRPKQLNALSSAMITCFLRCFTAYEEDDGVKLLIVKGKGRAFCAG  303

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV+AVV  I   +WK GA +FR EF +NY+IA YSKPQVS+L GIV GGGAG SIHGRF
Sbjct  304  GDVAAVVRSINNDSWKYGAHFFRNEFLLNYIIATYSKPQVSLLTGIVMGGGAGVSIHGRF  363

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            RV T+ +VFAMPETALGLFPD+GASYFLSRL GF+GEY+GLTG RLD AEMLACGLATHF
Sbjct  364  RVVTDSTVFAMPETALGLFPDIGASYFLSRLLGFYGEYVGLTGVRLDAAEMLACGLATHF  423

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS+RL  LEE+L  +++SDP  I  II ++SQ P LKEKS  N L+II++CFS++T+EE
Sbjct  424  VPSDRLSLLEESLKKVDTSDPFAICGIIDQYSQQPSLKEKSALNRLEIINKCFSKKTVEE  483

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ +LE EA N  D+WI+SAIQS++KAS
Sbjct  484  IIASLEQEAPNVADEWIASAIQSMRKAS  511



>ref|XP_004979608.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Setaria 
italica]
Length=386

 Score =   369 bits (946),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/283 (62%), Positives = 222/283 (78%), Gaps = 4/283 (1%)
 Frame = +2

Query  71   MASLSSNS----DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNV  238
            MASL   S    + DQ+LVEE G  RT ILNR KQLNALSSAM+  LL  F+A E++  V
Sbjct  1    MASLRPESTGGAEADQLLVEENGSTRTLILNRPKQLNALSSAMIKGLLRCFVAYEEEDGV  60

Query  239  KLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNG  418
            KL+++K  GRAFCAGGDV+A +  I    WK GA++FR +++++Y+IA Y+KPQVS+L G
Sbjct  61   KLLIMKGKGRAFCAGGDVTATIRSIHNEGWKWGADFFRNQYSLDYIIATYTKPQVSLLTG  120

Query  419  IVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSR  598
            IV GGGAG S+HGRFRVAT+K+VFAMPETALGLFPDVGASYFLSRLPGF+GEY+ L G+R
Sbjct  121  IVMGGGAGVSLHGRFRVATDKTVFAMPETALGLFPDVGASYFLSRLPGFYGEYVALAGAR  180

Query  599  LDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH  778
            LDGAEMLACGLATHFV S RL+ LEE+L  +++S+ + +  II++F++ P LKE S  N 
Sbjct  181  LDGAEMLACGLATHFVRSNRLVLLEESLKKLDTSNTSAVCDIINQFAEKPPLKENSSLNR  240

Query  779  LKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            L II++CFS+RT+EEI+ ALE  A+N  D+W+   IQSLKKAS
Sbjct  241  LDIINKCFSKRTVEEIISALEQVASNLADEWVVVTIQSLKKAS  283



>ref|XP_010510311.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 isoform 
X1 [Camelina sativa]
Length=381

 Score =   369 bits (946),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/283 (64%), Positives = 215/283 (76%), Gaps = 6/283 (2%)
 Frame = +2

Query  59   TNRSMASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNV  238
            T+  MAS S      Q+LVEE   VRT  LNR KQLNALSS M+SRLL LF A E+D +V
Sbjct  3    TSTEMASHS------QILVEEKSSVRTLTLNRPKQLNALSSNMISRLLRLFRAYEEDPSV  56

Query  239  KLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNG  418
             L++LK  GRAFCAGGD+  ++  + QG W+LGA +F  ++T+NYV+A  SK QVSILNG
Sbjct  57   TLVILKGQGRAFCAGGDIPPLLSYVIQGKWRLGAAFFADQYTLNYVLATCSKAQVSILNG  116

Query  419  IVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSR  598
            IV G GAG SIHGRFR+ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+R
Sbjct  117  IVMGAGAGVSIHGRFRIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGAR  176

Query  599  LDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH  778
            LDGAEMLACGLATHFVPS RL  LE  L  + SSDP+  S I+  +++   +K+ S Y+ 
Sbjct  177  LDGAEMLACGLATHFVPSTRLTALEAELCTVASSDPSFASTILDAYTEHQHVKQNSAYHR  236

Query  779  LKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            L +IDRCFSRRT+E+I+ ALE E     DDWISS  Q+LKKAS
Sbjct  237  LDVIDRCFSRRTVEDIISALEREFTQRPDDWISSTTQALKKAS  279



>ref|XP_010510312.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 isoform 
X2 [Camelina sativa]
Length=381

 Score =   368 bits (945),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 180/283 (64%), Positives = 215/283 (76%), Gaps = 6/283 (2%)
 Frame = +2

Query  59   TNRSMASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNV  238
            T+  MAS S      Q+LVEE   VRT  LNR KQLNALSS M+SRLL LF A E+D +V
Sbjct  3    TSTEMASHS------QILVEEKSSVRTLTLNRPKQLNALSSNMISRLLRLFRAYEEDPSV  56

Query  239  KLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNG  418
             L++LK  GRAFCAGGD+  ++  + QG W+LGA +F  ++T+NYV+A  SK QVSILNG
Sbjct  57   TLVILKGQGRAFCAGGDIPPLLSYVIQGKWRLGAAFFADQYTLNYVLATCSKAQVSILNG  116

Query  419  IVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSR  598
            IV G GAG SIHGRFR+ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+R
Sbjct  117  IVMGAGAGVSIHGRFRIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGAR  176

Query  599  LDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH  778
            LDGAEMLACGLATHFVPS RL  LE  L  + SSDP+  S I+  +++   +K+ S Y+ 
Sbjct  177  LDGAEMLACGLATHFVPSTRLTALEAELCTVASSDPSFASTILDAYTEHQHVKQNSAYHR  236

Query  779  LKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            L +IDRCFSRRT+E+I+ ALE E     DDWISS  Q+LKKAS
Sbjct  237  LDVIDRCFSRRTVEDIISALEREFTQRPDDWISSTTQALKKAS  279



>ref|XP_010510319.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Camelina 
sativa]
Length=381

 Score =   368 bits (944),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/267 (64%), Positives = 212/267 (79%), Gaps = 0/267 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            +LVEE    R   LNR KQLN LS  M++RLL+L LA E+D +VKL++LK  GRAFCAGG
Sbjct  11   ILVEEKSSARILTLNRPKQLNVLSFNMMTRLLQLLLAYEEDPSVKLVILKGQGRAFCAGG  70

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV   V +I QGNWKL A+ F +++ +NY +A YSKPQVS+L+GIV GGGAG S+HGRFR
Sbjct  71   DVKPAVRNILQGNWKLSADIFAEQYKLNYAMATYSKPQVSVLHGIVMGGGAGVSVHGRFR  130

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            +ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG++LDGAEMLACGLATHFV
Sbjct  131  IATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGAKLDGAEMLACGLATHFV  190

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
            PS RL  LE  L  ++S+DP  +S I++ ++Q P LK+ S  + L +IDRCFS+RT+EEI
Sbjct  191  PSTRLTALETDLWGVDSNDPNFVSTILNAYTQHPHLKQHSANHRLDVIDRCFSKRTVEEI  250

Query  827  MVALESEAANYKDDWISSAIQSLKKAS  907
            + ALE EA    +DWIS+ I++LKKAS
Sbjct  251  ISALEREATQEPNDWISTTIRALKKAS  277



>ref|XP_009144612.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Brassica 
rapa]
Length=333

 Score =   365 bits (938),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 173/269 (64%), Positives = 214/269 (80%), Gaps = 1/269 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVL+E+   VR   LNR  Q+NALS  M++RLL+LFLA + D  VKL++LK  G+AFCAG
Sbjct  12   QVLMEDKYTVRILTLNRPNQMNALSWNMITRLLQLFLAYKDDPRVKLVILKGQGKAFCAG  71

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV  V+ DI QG W+LGA++   ++T+NYV+A YSK Q+SI+NGIV GGGAG SIHGRF
Sbjct  72   GDVRPVICDIVQGKWRLGADFLSDQYTLNYVMATYSKIQISIMNGIVMGGGAGVSIHGRF  131

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATEK+VFAMPET LGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  132  RIATEKTVFAMPETELGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  191

Query  644  VPSERLLPLEEALHNINSSDP-TIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIE  820
            VPS RL  LE  L  + S+DP T  S I++ ++Q P LK+ S Y+ L +ID+CFSRRT+E
Sbjct  192  VPSTRLTALEADLCRVVSNDPDTFSSKILNAYTQHPHLKQHSAYHRLDVIDKCFSRRTVE  251

Query  821  EIMVALESEAANYKDDWISSAIQSLKKAS  907
            EI+ ALE EA    D+WIS+ +++LKKAS
Sbjct  252  EIISALEREAIQEPDEWISATLRALKKAS  280



>ref|XP_006354671.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Solanum 
tuberosum]
Length=381

 Score =   367 bits (943),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 180/275 (65%), Positives = 220/275 (80%), Gaps = 2/275 (1%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            S+N   D++LVEE    RTFILNR KQLNAL+  M+ RLLELF A E +S VK+I+LK +
Sbjct  6    SNNGGIDEILVEEEANFRTFILNRPKQLNALTFQMIYRLLELFHASEGNSKVKMIILKGN  65

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGG V+ + H++ QGNWKL A++ R+ FT+NY++A YSKPQV ILNG+V GGG  
Sbjct  66   GRAFCAGGAVTFLAHNVHQGNWKLSADFIRELFTLNYMMATYSKPQVFILNGMVMGGGLV  125

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
             S+HGRFRVATEK+V AMPETALG+ P  GAS+F SR+PGFFGEY GLTG+RLDGAEML 
Sbjct  126  VSVHGRFRVATEKTVCAMPETALGIVP--GASHFYSRIPGFFGEYAGLTGARLDGAEMLD  183

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
             GLATHFVPSE+L  L++ L  +N+SD  +IS IIS FS +P LK +SP + +KIIDRCF
Sbjct  184  VGLATHFVPSEKLPFLKQELAKVNTSDADVISVIISLFSTIPNLKAESPCHKMKIIDRCF  243

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            S+RTIEEI+ +LE+EA N KDDWISS IQSLKKAS
Sbjct  244  SQRTIEEIISSLENEALNNKDDWISSTIQSLKKAS  278



>ref|XP_006296105.1| hypothetical protein CARUB_v10025256mg [Capsella rubella]
 gb|EOA29003.1| hypothetical protein CARUB_v10025256mg [Capsella rubella]
Length=368

 Score =   367 bits (941),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/271 (65%), Positives = 213/271 (79%), Gaps = 3/271 (1%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE G VR   LN+ K LNALSS M+SRLL+LF A E+D  VKL++LK  GRAF AG
Sbjct  6    QVLVEEKGSVRILTLNKPKALNALSSNMISRLLQLFCAYEEDPGVKLVILKGQGRAFSAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GD+  V+ +I +G W+LGA++F  ++T+NYV+A Y K QVSILNGIV GGGAG SIHGRF
Sbjct  66   GDIPPVLSNIVKGKWRLGADFFSDQYTLNYVLATYGKAQVSILNGIVMGGGAGVSIHGRF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASYFLSRLPG+FGEY+GLTG++LDGAEMLACGLATHF
Sbjct  126  RIATENTVFAMPETALGLFPDVGASYFLSRLPGYFGEYVGLTGAKLDGAEMLACGLATHF  185

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS RL  LE  L  + SSDP+  S I+  ++Q P +K+ S Y+ L +IDRCFS+RT+EE
Sbjct  186  VPSTRLTALEADLCTVRSSDPSFASTILDAYTQHPHVKQNSAYHRLDVIDRCFSKRTVEE  245

Query  824  IMVALESEA---ANYKDDWISSAIQSLKKAS  907
            I+ ALE EA       +DWIS+ I +LKKAS
Sbjct  246  IVSALEREATRPTQEPNDWISTTISALKKAS  276



>ref|XP_010510308.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Camelina 
sativa]
Length=375

 Score =   367 bits (941),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/268 (64%), Positives = 210/268 (78%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            +VL EE   VR   LN+ KQLNAL   M+SRLL+LFLA E+D  VKL++LK  GRAFCAG
Sbjct  6    KVLAEEKSSVRILTLNKPKQLNALCFDMISRLLQLFLAYEEDPGVKLVILKGQGRAFCAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GD+  V+++I QG W+LGA +F  ++T+NYV+A YSK QVSILNGIV GGGAG SIHGRF
Sbjct  66   GDIPPVLNNIVQGKWRLGAAFFYDQYTLNYVLATYSKAQVSILNGIVMGGGAGVSIHGRF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPE A+GLFPDVGASYFLSRLPG+FGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  126  RIATENTVFAMPEAAVGLFPDVGASYFLSRLPGYFGEYVGLTGARLDGAEMLACGLATHF  185

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            V S RL  LE  L  + SSDP+  S I+  +++ P +++ S Y+ L +IDRCFSRRT+EE
Sbjct  186  VHSTRLTALEAGLCTVGSSDPSFASTILDAYTEHPHVQQNSAYHRLDVIDRCFSRRTVEE  245

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE E     DDWIS+  Q+LKKAS
Sbjct  246  IISALEREVTQKPDDWISNTTQALKKAS  273



>ref|NP_001150059.1| CHY1 [Zea mays]
 gb|ACG37647.1| CHY1 [Zea mays]
Length=419

 Score =   368 bits (945),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/267 (65%), Positives = 214/267 (80%), Gaps = 0/267 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            +LVE  G  RT ILNR KQLNALSS M+  LL  F A EKD  VKL+++K  GRAFCAGG
Sbjct  50   ILVEVNGFTRTLILNRPKQLNALSSTMIMGLLRCFTAYEKDDGVKLLIMKGKGRAFCAGG  109

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV+AVV  I + +WK GA++FR EF +NY+IA Y+KPQVS+L+GIV GGGAG S+HGRFR
Sbjct  110  DVAAVVRSIHKDSWKYGADFFRNEFLLNYIIATYTKPQVSLLSGIVMGGGAGVSLHGRFR  169

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            VAT+ +VFAMPETALGLFPD+GASYFLSRLPGF+GEY+GL G+RLDG EMLACGLATHFV
Sbjct  170  VATDNTVFAMPETALGLFPDIGASYFLSRLPGFYGEYVGLAGARLDGGEMLACGLATHFV  229

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
             S  LL LEE+L  +++S+   +  II +F+Q P LKE S  N L+II++CFS+RT+EEI
Sbjct  230  QSNSLLSLEESLKKVDTSNAFAVCGIIDQFAQQPSLKESSSLNRLEIINKCFSKRTVEEI  289

Query  827  MVALESEAANYKDDWISSAIQSLKKAS  907
            + ALE EA+N  D+W+++ IQSLKKAS
Sbjct  290  ISALEVEASNSADEWVATTIQSLKKAS  316



>gb|KEH18077.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula]
Length=324

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/283 (64%), Positives = 224/283 (79%), Gaps = 0/283 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            D DQVLVE     R   LNR KQLNALS  MVS+LLE+F   E + +VKLIVLK +GRAF
Sbjct  8    DKDQVLVERKSSARVLTLNRPKQLNALSFYMVSKLLEIFHDDEGNPDVKLIVLKGNGRAF  67

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV+AV +D R G+W+ GA +F  E+ MNY++A YSKPQVSILNGIV GGGAGAS+H
Sbjct  68   CAGGDVAAVANDARGGDWRFGAIFFDTEYKMNYLMATYSKPQVSILNGIVMGGGAGASMH  127

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            GRFRV TEK+VFAMPETALGLFPDVGASY+LSRL GFFGEY+GLTG+RLDGAEMLACGLA
Sbjct  128  GRFRVVTEKTVFAMPETALGLFPDVGASYYLSRLAGFFGEYVGLTGARLDGAEMLACGLA  187

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFVPS +L  LEE+L  + +SDP I+SAII ++S+ P LK+ S Y+ + II++CFSR+T
Sbjct  188  THFVPSSKLSSLEESLCKVETSDPAIVSAIIDKYSEQPSLKKDSVYHRMDIINKCFSRKT  247

Query  815  IEEIMVALESEAANYKDDWISSAIQSLKKASIDFNGCLLMLFR  943
            +E+I+ +LE+EA +  D WIS+ +++LKKAS       L L R
Sbjct  248  VEDILYSLETEAMSKADSWISATVETLKKASPTSLKVFLRLIR  290



>gb|KEH18076.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula]
Length=341

 Score =   365 bits (937),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/283 (64%), Positives = 224/283 (79%), Gaps = 0/283 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            D DQVLVE     R   LNR KQLNALS  MVS+LLE+F   E + +VKLIVLK +GRAF
Sbjct  8    DKDQVLVERKSSARVLTLNRPKQLNALSFYMVSKLLEIFHDDEGNPDVKLIVLKGNGRAF  67

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV+AV +D R G+W+ GA +F  E+ MNY++A YSKPQVSILNGIV GGGAGAS+H
Sbjct  68   CAGGDVAAVANDARGGDWRFGAIFFDTEYKMNYLMATYSKPQVSILNGIVMGGGAGASMH  127

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            GRFRV TEK+VFAMPETALGLFPDVGASY+LSRL GFFGEY+GLTG+RLDGAEMLACGLA
Sbjct  128  GRFRVVTEKTVFAMPETALGLFPDVGASYYLSRLAGFFGEYVGLTGARLDGAEMLACGLA  187

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFVPS +L  LEE+L  + +SDP I+SAII ++S+ P LK+ S Y+ + II++CFSR+T
Sbjct  188  THFVPSSKLSSLEESLCKVETSDPAIVSAIIDKYSEQPSLKKDSVYHRMDIINKCFSRKT  247

Query  815  IEEIMVALESEAANYKDDWISSAIQSLKKASIDFNGCLLMLFR  943
            +E+I+ +LE+EA +  D WIS+ +++LKKAS       L L R
Sbjct  248  VEDILYSLETEAMSKADSWISATVETLKKASPTSLKVFLRLIR  290



>gb|ACF88035.1| unknown [Zea mays]
Length=419

 Score =   368 bits (944),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/267 (65%), Positives = 214/267 (80%), Gaps = 0/267 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            +LVE  G  RT ILNR KQLNALSS M+  LL  F A EKD  VKL+++K  GRAFCAGG
Sbjct  50   ILVEVNGFTRTLILNRPKQLNALSSTMIMGLLRCFTAYEKDDGVKLLIMKGKGRAFCAGG  109

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV+AVV  I + +WK GA++FR EF +NY+IA Y+KPQVS+L+GIV GGGAG S+HGRFR
Sbjct  110  DVAAVVRSIHKDSWKYGADFFRNEFLLNYIIATYTKPQVSLLSGIVMGGGAGVSLHGRFR  169

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            VAT+ +VFAMPETALGLFPD+GASYFLSRLPGF+GEY+GL G+RLDG EMLACGLATHFV
Sbjct  170  VATDNTVFAMPETALGLFPDIGASYFLSRLPGFYGEYVGLAGARLDGGEMLACGLATHFV  229

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
             S  LL LEE+L  +++S+   +  II +F+Q P LKE S  N L+II++CFS+RT+EEI
Sbjct  230  QSNSLLSLEESLKKVDTSNAFAVCGIIDQFAQQPSLKESSSLNRLEIINKCFSKRTVEEI  289

Query  827  MVALESEAANYKDDWISSAIQSLKKAS  907
            + ALE EA+N  D+W+++ IQSLKKAS
Sbjct  290  ISALEVEASNSADEWVATTIQSLKKAS  316



>ref|XP_006393781.1| hypothetical protein EUTSA_v10004415mg [Eutrema salsugineum]
 gb|ESQ31067.1| hypothetical protein EUTSA_v10004415mg [Eutrema salsugineum]
Length=363

 Score =   365 bits (936),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 178/270 (66%), Positives = 209/270 (77%), Gaps = 15/270 (6%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNALS  M             D +VKL++LK  GRAFCAG
Sbjct  6    QVLVEEKSSVRILTLNRPKQLNALSFHM-------------DPSVKLVILKGQGRAFCAG  52

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDVSAVVHDIRQGNW+LGA +F  E+ +NYV+A YSK Q+SIL+GIV GGGAG S+HGRF
Sbjct  53   GDVSAVVHDIRQGNWRLGANFFSDEYMLNYVMATYSKAQISILDGIVMGGGAGVSVHGRF  112

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  113  RIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  172

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH--LKIIDRCFSRRTI  817
            VPS RL  LE  L  ++S+DPT  S I+  ++Q P LK++S Y+   L +ID+CFS RT+
Sbjct  173  VPSARLTALEADLSRVDSTDPTFASTILDGYTQHPHLKQQSAYHRQVLDVIDKCFSGRTV  232

Query  818  EEIMVALESEAANYKDDWISSAIQSLKKAS  907
            EEIM ALE EA++  DDWI + I +LKKAS
Sbjct  233  EEIMCALEREASHEADDWILATIGALKKAS  262



>gb|KFK23320.1| hypothetical protein AALP_AAs74635U001000 [Arabis alpina]
Length=350

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/244 (69%), Positives = 202/244 (83%), Gaps = 0/244 (0%)
 Frame = +2

Query  176  SSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRK  355
            S +  SRLL+LFLA E+D +VKLI+LK  GRAFCAGGDV  VV DI+QG W+LGA++F  
Sbjct  3    SQSQTSRLLQLFLAYEEDPSVKLIILKGQGRAFCAGGDVPPVVRDIQQGKWRLGADFFTD  62

Query  356  EFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGA  535
            E+T+NYV+A YSK QVS+LNGIV GGGAG SIHGRFRVATE +VFAMPETALGLFPDVGA
Sbjct  63   EYTLNYVMATYSKSQVSVLNGIVMGGGAGVSIHGRFRVATENTVFAMPETALGLFPDVGA  122

Query  536  SYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTII  715
            SYFLSRLPGFFGEY+GLTG++LDGAEMLACGLATHFVPS RL+ LE  L  ++SSDPT  
Sbjct  123  SYFLSRLPGFFGEYVGLTGAKLDGAEMLACGLATHFVPSTRLIALETDLCRVDSSDPTFA  182

Query  716  SAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSL  895
            S I+  ++Q P LK++S Y  L +IDRCFSRRT+EEI+ ALE EA    DDWI++ I++L
Sbjct  183  SRILDAYTQHPHLKQQSAYQRLDVIDRCFSRRTVEEIIFALEREATQKPDDWIAATIRAL  242

Query  896  KKAS  907
            KKA+
Sbjct  243  KKAA  246



>gb|KEH18075.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula]
Length=382

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/283 (64%), Positives = 224/283 (79%), Gaps = 0/283 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            D DQVLVE     R   LNR KQLNALS  MVS+LLE+F   E + +VKLIVLK +GRAF
Sbjct  8    DKDQVLVERKSSARVLTLNRPKQLNALSFYMVSKLLEIFHDDEGNPDVKLIVLKGNGRAF  67

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV+AV +D R G+W+ GA +F  E+ MNY++A YSKPQVSILNGIV GGGAGAS+H
Sbjct  68   CAGGDVAAVANDARGGDWRFGAIFFDTEYKMNYLMATYSKPQVSILNGIVMGGGAGASMH  127

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            GRFRV TEK+VFAMPETALGLFPDVGASY+LSRL GFFGEY+GLTG+RLDGAEMLACGLA
Sbjct  128  GRFRVVTEKTVFAMPETALGLFPDVGASYYLSRLAGFFGEYVGLTGARLDGAEMLACGLA  187

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFVPS +L  LEE+L  + +SDP I+SAII ++S+ P LK+ S Y+ + II++CFSR+T
Sbjct  188  THFVPSSKLSSLEESLCKVETSDPAIVSAIIDKYSEQPSLKKDSVYHRMDIINKCFSRKT  247

Query  815  IEEIMVALESEAANYKDDWISSAIQSLKKASIDFNGCLLMLFR  943
            +E+I+ +LE+EA +  D WIS+ +++LKKAS       L L R
Sbjct  248  VEDILYSLETEAMSKADSWISATVETLKKASPTSLKVFLRLIR  290



>ref|XP_006662094.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Oryza brachyantha]
Length=379

 Score =   363 bits (931),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 173/267 (65%), Positives = 206/267 (77%), Gaps = 0/267 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            VLVE  G  RT +LNR KQLNA S  M+ + L  F A E+D  VKL+++K  GRAFCAGG
Sbjct  10   VLVEANGATRTLVLNRPKQLNAFSYEMIMKFLRCFTAYEEDEGVKLLIVKGKGRAFCAGG  69

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DVSAVV  I   +WK GA +F  EF +NY+IA  +KPQVS+L GIV GGGAG SIHGRFR
Sbjct  70   DVSAVVRSINNDSWKYGAHFFGNEFLLNYIIATCNKPQVSLLTGIVMGGGAGISIHGRFR  129

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            V TE ++FAMPETALGLFPD+GASYFLSRLPGF+GEY GLTG RLD  EMLACGLATHFV
Sbjct  130  VVTESTIFAMPETALGLFPDIGASYFLSRLPGFYGEYAGLTGVRLDAPEMLACGLATHFV  189

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
            PS+RL  LEE+L  +++SDP  I  II ++SQ P LKEKS  N L+II++CFS+RT+EEI
Sbjct  190  PSDRLALLEESLKKVDTSDPFAICGIIDQYSQQPSLKEKSALNRLEIINKCFSKRTVEEI  249

Query  827  MVALESEAANYKDDWISSAIQSLKKAS  907
            + +LE EA N  D+WI  AIQS+KKAS
Sbjct  250  IASLEQEALNVADEWIPVAIQSMKKAS  276



>ref|XP_007134275.1| hypothetical protein PHAVU_010G033500g [Phaseolus vulgaris]
 gb|ESW06269.1| hypothetical protein PHAVU_010G033500g [Phaseolus vulgaris]
Length=382

 Score =   362 bits (930),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 178/291 (61%), Positives = 222/291 (76%), Gaps = 1/291 (0%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MASLS   D  Q+LVE     R   LNR KQLNALS  MVSRLLE+F   E++S++KL+V
Sbjct  1    MASLS-QGDHQQILVERKLNARVLTLNRPKQLNALSFYMVSRLLEVFSEDEENSDIKLVV  59

Query  251  LKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFG  430
            +K +GR+FCAGGDV+AV  +  +G+WK GA++F  E+ +NY++A YSKPQVSILNGIV G
Sbjct  60   VKGNGRSFCAGGDVAAVAREGSKGDWKTGAKFFLTEYKLNYLMATYSKPQVSILNGIVMG  119

Query  431  GGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGA  610
            GGAGAS+HGRFRV TE +VFAMPETALGLFPDVGA+YFLSRLPGFFGEY+GLTG+RLDGA
Sbjct  120  GGAGASVHGRFRVVTENTVFAMPETALGLFPDVGATYFLSRLPGFFGEYVGLTGARLDGA  179

Query  611  EMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKII  790
            EMLACGLATHFVPS +L  LEE L  + +SDP  +S II ++S+ P LK+ S Y+ + +I
Sbjct  180  EMLACGLATHFVPSSKLSLLEEELCKVEASDPNAVSVIIDKYSEQPFLKDDSVYHRMDVI  239

Query  791  DRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKASIDFNGCLLMLFR  943
            ++CFSR++IE I+ +LE E     D WIS  +Q+LKKAS       L L R
Sbjct  240  NKCFSRKSIEGIISSLEIETMGKADHWISETVQALKKASPTSLKIFLRLIR  290



>ref|XP_010414233.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Camelina 
sativa]
Length=382

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/279 (63%), Positives = 215/279 (77%), Gaps = 4/279 (1%)
 Frame = +2

Query  74   ASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVL  253
            A ++S+S   Q+LVEE   VR   LNR +QLNALS  M+SRLL+LF A E+D +V L++L
Sbjct  5    AEMASHS---QILVEEKSSVRILTLNRPRQLNALSYNMISRLLQLFRAYEEDPSVTLVIL  61

Query  254  KSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGG  433
            K  GRAFCAGGD+  ++  + QG W+LGA +F  ++T+NYV+A YSK QVSILNGIV G 
Sbjct  62   KGQGRAFCAGGDIPPLLSYVIQGKWRLGAAFFADQYTLNYVLATYSKAQVSILNGIVMGA  121

Query  434  GAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFG-EYLGLTGSRLDGA  610
            GAG SIHGRFR+ATE +VFAMPETALGLFPDVGASYFLSRLPGFFG +Y+GLTG+RLDGA
Sbjct  122  GAGVSIHGRFRIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGNKYVGLTGARLDGA  181

Query  611  EMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKII  790
            EMLACGLATHFVPS RL  LE  L  + SSDP+  S I+  +++ P +K+ S Y+ L +I
Sbjct  182  EMLACGLATHFVPSTRLTALEADLCTVGSSDPSFASKILDAYTERPHVKKNSAYHRLDVI  241

Query  791  DRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
             RCFSRRT+E+I+ ALE E     DDWISS  Q+LKKAS
Sbjct  242  HRCFSRRTVEDIISALEREFTQRPDDWISSTTQALKKAS  280



>ref|XP_002464895.1| hypothetical protein SORBIDRAFT_01g028410 [Sorghum bicolor]
 gb|EER91893.1| hypothetical protein SORBIDRAFT_01g028410 [Sorghum bicolor]
Length=386

 Score =   361 bits (926),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/283 (63%), Positives = 222/283 (78%), Gaps = 4/283 (1%)
 Frame = +2

Query  71   MASL----SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNV  238
            MAS+    ++ +D+DQ+LVE  G  RT ILNR KQLNALSS M+  LL  F A EKD  V
Sbjct  1    MASMPPPSAAGADSDQILVEVNGFTRTLILNRPKQLNALSSTMIMGLLRCFTAYEKDDGV  60

Query  239  KLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNG  418
            KL+++K  GRAFCAGGDV+ VV  I + +WK GA++FR EF +NY+IA Y+KPQVS+L G
Sbjct  61   KLLIMKGKGRAFCAGGDVAGVVRSIHKDSWKYGADFFRNEFLLNYIIATYTKPQVSLLTG  120

Query  419  IVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSR  598
            IV GGGAG S+HGRFRVAT+ +VFAMPETALGLFPD+GASYFLSRLPGF+GEY+ L G+R
Sbjct  121  IVMGGGAGVSLHGRFRVATDNTVFAMPETALGLFPDIGASYFLSRLPGFYGEYVALAGAR  180

Query  599  LDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH  778
            LDG EMLACGLATHFV S RLL LEE+L  +++S+   +  II +F+Q P LKE S  N 
Sbjct  181  LDGVEMLACGLATHFVHSNRLLLLEESLKKVDTSNTFAVCGIIDQFAQQPSLKESSSLNR  240

Query  779  LKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            L+II++CFS+RT+EEI+ ALE EA N  D+W+++ IQSLKKAS
Sbjct  241  LEIINKCFSKRTVEEIISALELEATNLADEWVATTIQSLKKAS  283



>gb|EPS71046.1| hypothetical protein M569_03711, partial [Genlisea aurea]
Length=372

 Score =   360 bits (923),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 176/270 (65%), Positives = 222/270 (82%), Gaps = 2/270 (1%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAM--VSRLLELFLACEKDSNVKLIVLKSSGRAFC  277
            QVLVE+  C     LNR KQLNALS+AM  VS LLELFL  E+DS++K+I+LK  GR+FC
Sbjct  1    QVLVEKKSCALILTLNRPKQLNALSAAMACVSCLLELFLKYEEDSSIKMIILKGKGRSFC  60

Query  278  AGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHG  457
            AGGDV++ V  I +G+ K  A++F  E+ MNYV+A Y KPQ+S LNG+V GGGAGAS+HG
Sbjct  61   AGGDVASAVSSIAKGDCKTAADFFMAEYVMNYVMATYGKPQISFLNGLVMGGGAGASVHG  120

Query  458  RFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLAT  637
            RFR++TEK++FAMPETALGLFPDVGASYFLSRLPG+FGEY+GLTG+RLDGAEMLACGL+T
Sbjct  121  RFRISTEKTLFAMPETALGLFPDVGASYFLSRLPGYFGEYVGLTGARLDGAEMLACGLST  180

Query  638  HFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTI  817
            HFV SE+L  LEEAL   NS++P++IS++I +FS VP LK+ S Y+ L  I++CFSRR++
Sbjct  181  HFVQSEKLSSLEEALIRANSAEPSVISSVIDQFSHVPALKQSSAYHRLSGINKCFSRRSV  240

Query  818  EEIMVALESEAANYKDDWISSAIQSLKKAS  907
            EEI+ ALE E +  +++WISSAIQSLKKAS
Sbjct  241  EEIIEALEREGSENEEEWISSAIQSLKKAS  270



>ref|XP_009413237.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Musa acuminata 
subsp. malaccensis]
Length=378

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/275 (63%), Positives = 211/275 (77%), Gaps = 0/275 (0%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            S+N   DQVL EE G  R   LNR +QLNALS  M+ +LL   +A EKD  VKL++LK  
Sbjct  7    STNDGADQVLTEERGYTRLLTLNRPRQLNALSFPMIMQLLNNLIAYEKDPEVKLLILKGR  66

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGGDV+A+   + +G+W  GA+ F  EF +NY+IA YSKPQVSILNGIV GGGAG
Sbjct  67   GRAFCAGGDVAAISRSVTEGHWTSGAQIFWNEFILNYIIATYSKPQVSILNGIVMGGGAG  126

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
             SIHGRFRVATEK+VFAMPET+LGLFPD+GASYFLSRLPGFFGEY+GLTG+RLDGAEMLA
Sbjct  127  LSIHGRFRVATEKTVFAMPETSLGLFPDIGASYFLSRLPGFFGEYVGLTGARLDGAEMLA  186

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATHFVPS +L  LE+ L  + +SD   I AII +FS+   LKE S +N   +I++CF
Sbjct  187  CGLATHFVPSMKLTLLEDTLAKVETSDHFAICAIIDQFSRRVPLKESSAFNGFDVINKCF  246

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            S+ T+EEI+ ALE E  +  ++WI  AI+SLKKAS
Sbjct  247  SKETVEEILSALELETVDAANEWIVVAIRSLKKAS  281



>ref|XP_010056511.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X5 
[Eucalyptus grandis]
Length=344

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/241 (71%), Positives = 201/241 (83%), Gaps = 0/241 (0%)
 Frame = +2

Query  185  MVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFT  364
            M+SR LEL L  EKDSNVKL+++K  GRAF AGGDV++ VHDI  G WK  A +FRK +T
Sbjct  1    MISRFLELLLLYEKDSNVKLVIVKGKGRAFSAGGDVTSAVHDINSGKWKSVAIFFRKNYT  60

Query  365  MNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYF  544
            ++Y+IA YSKPQVSILNGIV GGGAG SIHG FRVATE SVFAMPETALGLFPD+GASYF
Sbjct  61   LDYLIATYSKPQVSILNGIVMGGGAGCSIHGSFRVATENSVFAMPETALGLFPDIGASYF  120

Query  545  LSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAI  724
            LSRLPG FGEYLGLTG+RLDGAEML CGLATHFVPS +L  LE ALH ++SS+  +ISAI
Sbjct  121  LSRLPGHFGEYLGLTGARLDGAEMLVCGLATHFVPSPKLPSLEAALHTVDSSNQAVISAI  180

Query  725  ISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKA  904
            I ++S++P LKE+S Y+ L +I+RCFSRRT+E+I+ ALE EAAN  D WI ++IQSLKKA
Sbjct  181  IGKYSELPTLKEQSAYHRLDVINRCFSRRTVEDILSALEREAANKVDGWILASIQSLKKA  240

Query  905  S  907
            S
Sbjct  241  S  241



>gb|AFK49006.1| unknown [Medicago truncatula]
Length=279

 Score =   355 bits (910),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 173/268 (65%), Positives = 216/268 (81%), Gaps = 0/268 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            D DQVLVE     R   LNR KQLNALS  MVS+LLE+F   E + +VKLIV K +GRAF
Sbjct  8    DKDQVLVERKSSARVLTLNRPKQLNALSFYMVSKLLEIFHDDEGNPDVKLIVPKGNGRAF  67

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV+AV +D R G+W+ GA +F  E+ MNY++A YSKPQVSILNGIV GGGAGAS+H
Sbjct  68   CAGGDVAAVANDARGGDWRFGAIFFDTEYKMNYLMATYSKPQVSILNGIVMGGGAGASMH  127

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            GRFRV TEK+VFAMPETALGLFPDVGASY+LSRL GFFGEY+GLTG+RLDGAEMLACGLA
Sbjct  128  GRFRVVTEKTVFAMPETALGLFPDVGASYYLSRLAGFFGEYVGLTGARLDGAEMLACGLA  187

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFVPS +L  LEE+L  + +SDP I+SAII ++S+ P LK+ S Y+ + II++CFSR+T
Sbjct  188  THFVPSSKLSSLEESLCKVETSDPAIVSAIIDKYSEQPSLKKDSVYHTMDIINKCFSRKT  247

Query  815  IEEIMVALESEAANYKDDWISSAIQSLK  898
            +E+I+ +LE+EA +  D WIS+ +++ +
Sbjct  248  VEDILYSLETEAMSKADSWISATVETFQ  275



>ref|XP_009140994.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Brassica rapa]
Length=366

 Score =   357 bits (917),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 177/269 (66%), Positives = 208/269 (77%), Gaps = 1/269 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            Q+LVEE   VR   LNR KQLNALS  MV+RLL+LFLA E DS VKL++LK  GRAFCAG
Sbjct  8    QILVEEKPSVRILTLNRPKQLNALSLNMVTRLLQLFLAFEVDSTVKLVILKGQGRAFCAG  67

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDVSAVV DI  G W+  A++   E+T+NYV+A Y K Q+SILNGIV GGGAG  +HGRF
Sbjct  68   GDVSAVVRDIVLGKWRRSADFMSLEYTLNYVMATYCKAQISILNGIVMGGGAGVCVHGRF  127

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASYFLSRL GFFGEY+GLTG+RL+GAEMLACGLATHF
Sbjct  128  RIATENTVFAMPETALGLFPDVGASYFLSRLSGFFGEYVGLTGARLNGAEMLACGLATHF  187

Query  644  VPSERLLPLEEALHNINSSDP-TIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIE  820
            VPS RL  L+  L  + SSDP T  S I+  ++Q    + +S +  L +I+RCFSRRTIE
Sbjct  188  VPSTRLTALQADLCKVGSSDPVTFASTILDAYTQHTHPERQSAFCRLDVINRCFSRRTIE  247

Query  821  EIMVALESEAANYKDDWISSAIQSLKKAS  907
            EIM ALE EA +  DDWIS+ I +LKKAS
Sbjct  248  EIMSALEIEATHKPDDWISATIGALKKAS  276



>ref|XP_009140993.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Brassica rapa]
Length=380

 Score =   357 bits (916),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 177/269 (66%), Positives = 208/269 (77%), Gaps = 1/269 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            Q+LVEE   VR   LNR KQLNALS  MV+RLL+LFLA E DS VKL++LK  GRAFCAG
Sbjct  8    QILVEEKPSVRILTLNRPKQLNALSLNMVTRLLQLFLAFEVDSTVKLVILKGQGRAFCAG  67

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDVSAVV DI  G W+  A++   E+T+NYV+A Y K Q+SILNGIV GGGAG  +HGRF
Sbjct  68   GDVSAVVRDIVLGKWRRSADFMSLEYTLNYVMATYCKAQISILNGIVMGGGAGVCVHGRF  127

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASYFLSRL GFFGEY+GLTG+RL+GAEMLACGLATHF
Sbjct  128  RIATENTVFAMPETALGLFPDVGASYFLSRLSGFFGEYVGLTGARLNGAEMLACGLATHF  187

Query  644  VPSERLLPLEEALHNINSSDP-TIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIE  820
            VPS RL  L+  L  + SSDP T  S I+  ++Q    + +S +  L +I+RCFSRRTIE
Sbjct  188  VPSTRLTALQADLCKVGSSDPVTFASTILDAYTQHTHPERQSAFCRLDVINRCFSRRTIE  247

Query  821  EIMVALESEAANYKDDWISSAIQSLKKAS  907
            EIM ALE EA +  DDWIS+ I +LKKAS
Sbjct  248  EIMSALEIEATHKPDDWISATIGALKKAS  276



>ref|NP_180623.3| probable 3-hydroxyisobutyryl-CoA hydrolase 2 [Arabidopsis thaliana]
 sp|Q1PEY5.1|HIBC2_ARATH RecName: Full=Probable 3-hydroxyisobutyryl-CoA hydrolase 2 [Arabidopsis 
thaliana]
 gb|ABE65876.1| 3-hydroxyisobutyryl-coenzyme A hydrolase [Arabidopsis thaliana]
 gb|AEC08423.1| probable 3-hydroxyisobutyryl-CoA hydrolase 2 [Arabidopsis thaliana]
Length=378

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/268 (65%), Positives = 206/268 (77%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR    NR KQLNALS  MVSRLL+LFLA E+D +VKL+VLK  GRAF AG
Sbjct  6    QVLVEEKSSVRILTFNRPKQLNALSFHMVSRLLQLFLAYEEDPSVKLVVLKGQGRAFSAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GD+  +V DI QG    GA YF+  +T+NYV++ Y KPQVSILNGIV GGGAG S +GRF
Sbjct  66   GDIPPIVRDILQGKLIRGAHYFKVGYTLNYVLSTYRKPQVSILNGIVMGGGAGLSTNGRF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  126  RIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  185

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS  L  LE  L+ + SS+ T IS I+  +++ P L + S Y+ L +IDRCFS+RT+EE
Sbjct  186  VPSISLTALEAELYKVGSSNQTFISTILDAYAEYPHLNQHSSYHRLDVIDRCFSKRTVEE  245

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I  ALE E     +DW+ + IQ+L+KAS
Sbjct  246  IFSALEREVTQKPNDWLLATIQALEKAS  273



>ref|XP_010521551.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 isoform 
X2 [Tarenaya hassleriana]
Length=374

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/268 (65%), Positives = 206/268 (77%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLN L+S M+SRLLELFL+ +K+ NVKLI+LK  GRAFCAG
Sbjct  4    QVLVEEKSVVRILTLNRPKQLNVLTSPMISRLLELFLSYQKNPNVKLIILKGQGRAFCAG  63

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV + V+DIR+G W+L  ++  K++ ++YVIA   KPQVSI++GIV GGGAG SIHGRF
Sbjct  64   GDVISCVNDIRRGCWRLATDFMYKQYVLDYVIATSPKPQVSIMDGIVMGGGAGISIHGRF  123

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPE ALG F DVGASYFLSRLPGFFGEYLGL G+RLDGAEMLA GLATHF
Sbjct  124  RIATENTVFAMPEAALGHFADVGASYFLSRLPGFFGEYLGLAGARLDGAEMLASGLATHF  183

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            VPS RL  L E L    +SD   IS II  ++Q P LK+ S Y+ L +ID+CFSR T+EE
Sbjct  184  VPSMRLKELTEDLCGSGASDAASISKIIDTYTQQPHLKDSSAYHRLDVIDKCFSRNTVEE  243

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALE E A+  DDW+S  I S+KKAS
Sbjct  244  IIFALEREIAHKTDDWVSRTILSMKKAS  271



>emb|CDY62818.1| BnaC04g56390D [Brassica napus]
Length=401

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 180/290 (62%), Positives = 212/290 (73%), Gaps = 22/290 (8%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEET  VR   LNR KQLNALS  M++RLL+LFLA E+D +VKL++LK  GRAFCAG
Sbjct  8    QVLVEETSNVRILTLNRPKQLNALSLNMITRLLQLFLAYEEDPSVKLVILKGQGRAFCAG  67

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDVSAVV DIR G W+  A++   ++T+NYV+A YSK Q+SILNGIV GGGAG  +HGRF
Sbjct  68   GDVSAVVRDIRLGKWRRSADFMSLQYTLNYVMATYSKAQISILNGIVMGGGAGVCVHGRF  127

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY GLTG+RLDGAEMLACGLATHF
Sbjct  128  RIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYAGLTGARLDGAEMLACGLATHF  187

Query  644  VPSERLLPLEEALHNINSSDP-TIISAIISEFSQVPKLKEKSPYN---------------  775
            VPS RL  L   L  + SSDP T  S I+  ++Q P  K+KS  +               
Sbjct  188  VPSTRLTALGADLCRVGSSDPVTFASTILDAYTQHPHPKQKSACHRQIFNGNLCHQFLIS  247

Query  776  ------HLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
                   L +ID+CFSRRT+EEI+ ALE +A +  DDWIS+   SLKKAS
Sbjct  248  IYFSLCRLDVIDKCFSRRTVEEIISALERDATHKPDDWISATTGSLKKAS  297



>ref|XP_010521552.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Tarenaya 
hassleriana]
 ref|XP_010521554.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Tarenaya 
hassleriana]
Length=376

 Score =   355 bits (911),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 172/270 (64%), Positives = 207/270 (77%), Gaps = 0/270 (0%)
 Frame = +2

Query  98   TDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFC  277
            +  +LVEE   VR   LNR KQLNAL+S M+SRLLELFL+ E+D NVKLI+LK  GRAFC
Sbjct  3    SQMMLVEEKSDVRILTLNRPKQLNALTSPMISRLLELFLSYEEDPNVKLIILKGQGRAFC  62

Query  278  AGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHG  457
            AGGDV A V+DIR+G W+L A++  KE+ ++YV+A Y KPQVSI++GIV GGGAG S+HG
Sbjct  63   AGGDVIACVNDIRRGCWRLAADFMYKEYALDYVMATYGKPQVSIMDGIVMGGGAGISVHG  122

Query  458  RFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLAT  637
            RFR+ATE +VFAMPE ALG F DVGASYFLSRLPGFFGEYLGL G+RLDGAEMLA GL T
Sbjct  123  RFRIATENTVFAMPEAALGHFADVGASYFLSRLPGFFGEYLGLAGARLDGAEMLASGLGT  182

Query  638  HFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTI  817
            HFVPS R   L E L    +SD   IS II  ++Q P LKE S Y+ + +ID+CFS+ T+
Sbjct  183  HFVPSMRSKELIEDLCGSGASDAASISKIIDTYTQQPHLKESSAYHRMDVIDKCFSKNTV  242

Query  818  EEIMVALESEAANYKDDWISSAIQSLKKAS  907
            EEI+ ALE E A+  DDW+S  I S+KKAS
Sbjct  243  EEIIFALEREIAHKTDDWVSKTISSMKKAS  272



>ref|NP_001149842.1| CHY1 [Zea mays]
 gb|ACG36959.1| CHY1 [Zea mays]
Length=369

 Score =   355 bits (910),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 169/283 (60%), Positives = 219/283 (77%), Gaps = 4/283 (1%)
 Frame = +2

Query  71   MASL----SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNV  238
            MA+L    ++ +D+DQ+LVE  G  RT ILNR KQLNALSS M+  LL  F A EKD  V
Sbjct  1    MATLPREGAAAADSDQLLVEAHGSTRTLILNRPKQLNALSSEMIKGLLWYFTAFEKDDGV  60

Query  239  KLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNG  418
            +L+++K + R FC+GGD++     +  GNWK   ++F+ E+ +NY+IA Y KPQVSIL+G
Sbjct  61   RLLIMKGNRRVFCSGGDIAQCARCLYNGNWKWVDDFFQNEYLLNYIIATYIKPQVSILSG  120

Query  419  IVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSR  598
            IV GGGAG SIHGRFRVAT+ ++FAMPETALGLFPDVGASYFLSRLPGF+GEY+GLTG+R
Sbjct  121  IVMGGGAGVSIHGRFRVATDNTIFAMPETALGLFPDVGASYFLSRLPGFYGEYVGLTGAR  180

Query  599  LDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH  778
            LDGAEMLACGLATHFVPS+RL  LEE+L  +++S    +S II +FSQ P +K+ S  N 
Sbjct  181  LDGAEMLACGLATHFVPSKRLPLLEESLKKLDTSSTFAVSGIIDQFSQRPLVKDSSSLNR  240

Query  779  LKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            ++ I++CFS+RT+EEI+ ALE E +N  D W+++ I+SLKKAS
Sbjct  241  METINKCFSKRTVEEIIDALEQEISNVSDKWVAATIKSLKKAS  283



>ref|XP_010056509.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X3 
[Eucalyptus grandis]
Length=394

 Score =   355 bits (911),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 176/267 (66%), Positives = 208/267 (78%), Gaps = 12/267 (4%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            VLVEE    RT ILNR KQLNA +  M+SR LEL L  EKDSNVKL+++K  GRAF AGG
Sbjct  37   VLVEEKSFARTLILNRPKQLNAATDYMISRFLELLLLYEKDSNVKLVIVKGKGRAFSAGG  96

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV++ VHDI  G WK  A +FRK +T++Y+IA YSKPQVSILNGIV GGGAG SIHG FR
Sbjct  97   DVTSAVHDINSGKWKSVAIFFRKNYTLDYLIATYSKPQVSILNGIVMGGGAGCSIHGSFR  156

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            VATE SVFAMPETALGLFPD+GASYFLSRLPG FGEYLGLTG+RLDGAEML         
Sbjct  157  VATENSVFAMPETALGLFPDIGASYFLSRLPGHFGEYLGLTGARLDGAEML---------  207

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
               +L  LE ALH ++SS+  +ISAII ++S++P LKE+S Y+ L +I+RCFSRRT+E+I
Sbjct  208  ---KLPSLEAALHTVDSSNQAVISAIIGKYSELPTLKEQSAYHRLDVINRCFSRRTVEDI  264

Query  827  MVALESEAANYKDDWISSAIQSLKKAS  907
            + ALE EAAN  D WI ++IQSLKKAS
Sbjct  265  LSALEREAANKVDGWILASIQSLKKAS  291



>ref|XP_008661977.1| PREDICTED: CHY1 isoform X1 [Zea mays]
 gb|ACF82030.1| unknown [Zea mays]
 gb|AFW56433.1| CHY1 [Zea mays]
Length=386

 Score =   355 bits (910),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/283 (60%), Positives = 219/283 (77%), Gaps = 4/283 (1%)
 Frame = +2

Query  71   MASL----SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNV  238
            MA+L    ++ +D+DQ+LVE  G  RT ILNR KQLNALSS M+  LL  F A EKD  V
Sbjct  1    MATLPREGAAAADSDQLLVEAHGSTRTLILNRPKQLNALSSEMIKGLLWYFTAFEKDDGV  60

Query  239  KLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNG  418
            +L+++K + R FC+GGD++     +  GNWK   ++F+ E+ +NY+IA Y KPQVSIL+G
Sbjct  61   RLLIMKGNRRVFCSGGDIAQCARCLYNGNWKWVDDFFQNEYLLNYIIATYIKPQVSILSG  120

Query  419  IVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSR  598
            IV GGGAG SIHGRFRVAT+ ++FAMPETALGLFPDVGASYFLSRLPGF+GEY+GLTG+R
Sbjct  121  IVMGGGAGVSIHGRFRVATDNTIFAMPETALGLFPDVGASYFLSRLPGFYGEYVGLTGAR  180

Query  599  LDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH  778
            LDGAEMLACGLATHFVPS+RL  LEE+L  +++S    +S II +FSQ P +K+ S  N 
Sbjct  181  LDGAEMLACGLATHFVPSKRLPLLEESLKKLDTSSTFAVSGIIDQFSQRPLVKDSSSLNR  240

Query  779  LKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            ++ I++CFS+RT+EEI+ ALE E +N  D W+++ I+SLKKAS
Sbjct  241  METINKCFSKRTVEEIIDALEQEISNVSDKWVAATIKSLKKAS  283



>ref|XP_010521550.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 isoform 
X1 [Tarenaya hassleriana]
Length=375

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/267 (64%), Positives = 205/267 (77%), Gaps = 0/267 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            VLVEE   VR   LNR KQLN L+S M+SRLLELFL+ +K+ NVKLI+LK  GRAFCAGG
Sbjct  6    VLVEEKSVVRILTLNRPKQLNVLTSPMISRLLELFLSYQKNPNVKLIILKGQGRAFCAGG  65

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV + V+DIR+G W+L  ++  K++ ++YVIA   KPQVSI++GIV GGGAG SIHGRFR
Sbjct  66   DVISCVNDIRRGCWRLATDFMYKQYVLDYVIATSPKPQVSIMDGIVMGGGAGISIHGRFR  125

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            +ATE +VFAMPE ALG F DVGASYFLSRLPGFFGEYLGL G+RLDGAEMLA GLATHFV
Sbjct  126  IATENTVFAMPEAALGHFADVGASYFLSRLPGFFGEYLGLAGARLDGAEMLASGLATHFV  185

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
            PS RL  L E L    +SD   IS II  ++Q P LK+ S Y+ L +ID+CFSR T+EEI
Sbjct  186  PSMRLKELTEDLCGSGASDAASISKIIDTYTQQPHLKDSSAYHRLDVIDKCFSRNTVEEI  245

Query  827  MVALESEAANYKDDWISSAIQSLKKAS  907
            + ALE E A+  DDW+S  I S+KKAS
Sbjct  246  IFALEREIAHKTDDWVSRTILSMKKAS  272



>ref|XP_008670921.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 isoform 
X1 [Zea mays]
Length=383

 Score =   353 bits (905),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/271 (61%), Positives = 210/271 (77%), Gaps = 0/271 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            +++Q+LVE  G  RT ILNR KQLNALS AM+ RLL  F A  KD  VKL+++K SGRAF
Sbjct  10   NSEQLLVEAHGNTRTLILNRPKQLNALSYAMIKRLLRCFTAYVKDDGVKLLIIKGSGRAF  69

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV A V  I    WK G ++FR ++ +NY+IA   KPQ+S+L GIV GGGAG S+H
Sbjct  70   CAGGDVVACVQSINNDGWKWGDDFFRDQYFLNYIIATCIKPQISLLTGIVMGGGAGVSLH  129

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            GRFRVAT+ +VFAMPET LG FPDVGASYFLSRLPGF+GEY+ LTG+RLDGAEMLACGLA
Sbjct  130  GRFRVATDNTVFAMPETFLGHFPDVGASYFLSRLPGFYGEYVALTGARLDGAEMLACGLA  189

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFVPS R+L LEE+L  +N+S+  ++ + I +FSQ P LK+KS  N L+II++CFS+RT
Sbjct  190  THFVPSNRMLLLEESLKKVNTSNSFVVCSTIDQFSQQPSLKQKSSLNRLEIINKCFSKRT  249

Query  815  IEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +EEI+ +LE  A+N  D+W +  I+ LK+AS
Sbjct  250  VEEIISSLEQVASNMADEWAAETIRYLKRAS  280



>gb|EMS52252.1| 3-hydroxyisobutyryl-CoA hydrolase 1 [Triticum urartu]
Length=425

 Score =   353 bits (907),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 176/312 (56%), Positives = 222/312 (71%), Gaps = 26/312 (8%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            +VLVE  G  RT +LNR KQLNALSSAMV+ LL+ F + E+++ VKL+++K  GRAFCAG
Sbjct  22   RVLVEANGSTRTLVLNRPKQLNALSSAMVTGLLKCFTSYEEENTVKLLIVKGKGRAFCAG  81

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV+ V   I    WK GA++F  EF +NY+IA YSKPQVS+L GIV GGGAG SIHGRF
Sbjct  82   GDVAEVAQSINNDTWKYGADFFHTEFLLNYIIATYSKPQVSLLTGIVMGGGAGVSIHGRF  141

Query  464  RVATEKS-------------VFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLD  604
            RVAT  +             VFAMPETALGLFPD+GASYFLSRLPGF+GEY+GLTG+RLD
Sbjct  142  RVATGNTKFSYRGYTPCWPKVFAMPETALGLFPDIGASYFLSRLPGFYGEYVGLTGARLD  201

Query  605  GAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLK  784
            GAEMLACGLATHFVP  R+  LEE+L  +++SDP  I  II +FSQ P +K  S  N ++
Sbjct  202  GAEMLACGLATHFVPLNRMPLLEESLKKVDTSDPFAICGIIDQFSQQPSVKGSSAMNRME  261

Query  785  IIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKASI-------------DFNGC  925
            II+RCFS+RT+EEI+ ALE EA +  D  +++AIQSL+KAS               F   
Sbjct  262  IINRCFSKRTVEEIISALEQEAPSVADKLVTAAIQSLRKASPTSLKISLASVSVKHFQNI  321

Query  926  LLMLFRLELTII  961
            +L++  +E+ +I
Sbjct  322  ILVMLTIEVVVI  333



>emb|CDX97894.1| BnaC04g40450D [Brassica napus]
Length=388

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/277 (63%), Positives = 208/277 (75%), Gaps = 9/277 (3%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            Q+LVEE   VR   LNR KQLNALS  MV+RLL+LFLA E D  VKL++LK  GRAFCAG
Sbjct  8    QILVEEKPSVRILTLNRPKQLNALSLNMVTRLLQLFLAYEVDPTVKLVILKGQGRAFCAG  67

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDVSAVV DI  G W+  A++   E+T+NYV+A Y K Q+SILNGIV GGGAG  +HGRF
Sbjct  68   GDVSAVVRDIGLGKWRRSADFMSLEYTLNYVMATYCKAQISILNGIVMGGGAGVCVHGRF  127

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASY LSRL GFFGEY+GLTG+RL+GAEMLACGLATHF
Sbjct  128  RIATENTVFAMPETALGLFPDVGASYLLSRLSGFFGEYVGLTGARLNGAEMLACGLATHF  187

Query  644  VPSERLLPLEEALHNINSSDP-TIISAIISEFSQVPKLKEKSPYNH--------LKIIDR  796
            VPS RL  L+  L  + SSDP T  S I+  ++Q P  + +S +          L +ID+
Sbjct  188  VPSTRLTALQADLCKVGSSDPVTFASTILDAYTQHPHPERQSAFYRQCSLVFFSLDVIDK  247

Query  797  CFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            CFSRRTIEEIM ALE EA +  DDWIS+ +++LKKAS
Sbjct  248  CFSRRTIEEIMSALEREATHKPDDWISATVEALKKAS  284



>ref|XP_009140984.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Brassica rapa]
Length=364

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/269 (64%), Positives = 207/269 (77%), Gaps = 3/269 (1%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEET  VR   LNR K LNALS  M++RLL+LFLA E+D +VKL++LK  GRAFCAG
Sbjct  8    QVLVEETSSVRILTLNRPKHLNALSLNMITRLLQLFLAYEEDPSVKLVILKGQGRAFCAG  67

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV A+V DIR G W+  A++    + ++YV+A Y K QVSILNGIV G   G  +HGRF
Sbjct  68   GDVPAIVRDIRLGKWRRSADFMSLGYNLHYVMATYCKAQVSILNGIVMG--VGVCVHGRF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPET+LG+FPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  126  RIATENTVFAMPETSLGIFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  185

Query  644  VPSERLLPLEEALHNINSSDP-TIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIE  820
            VPS RL  LE  L  + SSDP T  S I+  ++Q P  K+KS  + L +ID+CFSRRT+E
Sbjct  186  VPSTRLTALEADLCRVGSSDPVTYASTILDAYTQHPHPKQKSACHRLDVIDKCFSRRTVE  245

Query  821  EIMVALESEAANYKDDWISSAIQSLKKAS  907
            EI+ ALE EA +  DDWIS+ I +LKKAS
Sbjct  246  EIISALEREATHKPDDWISATIGALKKAS  274



>ref|XP_009144378.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Brassica 
rapa]
Length=380

 Score =   350 bits (899),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/271 (63%), Positives = 215/271 (79%), Gaps = 3/271 (1%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLV++   VR   LNR KQLNAL+S M++ L++LFL  E+D NVK+++LK  GRAFC G
Sbjct  6    QVLVDDKSSVRILTLNRPKQLNALNSNMITLLMQLFLEYEEDPNVKIVILKGQGRAFCVG  65

Query  284  GDVSAVVHDIR-QG-NWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHG  457
            GD   V  DI  QG +W++GA++F +++ +++ +A YSK Q+SILNGIV GGGAG S+HG
Sbjct  66   GDPLPVFRDIVIQGKSWRVGADFFSEQYKLDHFMATYSKVQISILNGIVMGGGAGISVHG  125

Query  458  RFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLAT  637
            RFR+ATEK+VFAMPET LGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLAT
Sbjct  126  RFRIATEKTVFAMPETELGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLAT  185

Query  638  HFVPSERLLPLEEALHNINSSDP-TIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            HFVPS RL  LE  L  + SSDP T  SAI++ +++ PKLK+ S Y  L +IDRCFSRRT
Sbjct  186  HFVPSSRLNALEADLCKVGSSDPVTFASAILNAYTKHPKLKQHSAYYRLDVIDRCFSRRT  245

Query  815  IEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +EEI+ ALE EA    ++WIS+ I++LKKAS
Sbjct  246  MEEIISALEKEATEKPNEWISATIRALKKAS  276



>ref|XP_009140983.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Brassica rapa]
Length=378

 Score =   350 bits (898),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 172/269 (64%), Positives = 207/269 (77%), Gaps = 3/269 (1%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEET  VR   LNR K LNALS  M++RLL+LFLA E+D +VKL++LK  GRAFCAG
Sbjct  8    QVLVEETSSVRILTLNRPKHLNALSLNMITRLLQLFLAYEEDPSVKLVILKGQGRAFCAG  67

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV A+V DIR G W+  A++    + ++YV+A Y K QVSILNGIV G   G  +HGRF
Sbjct  68   GDVPAIVRDIRLGKWRRSADFMSLGYNLHYVMATYCKAQVSILNGIVMG--VGVCVHGRF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPET+LG+FPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  126  RIATENTVFAMPETSLGIFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  185

Query  644  VPSERLLPLEEALHNINSSDP-TIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIE  820
            VPS RL  LE  L  + SSDP T  S I+  ++Q P  K+KS  + L +ID+CFSRRT+E
Sbjct  186  VPSTRLTALEADLCRVGSSDPVTYASTILDAYTQHPHPKQKSACHRLDVIDKCFSRRTVE  245

Query  821  EIMVALESEAANYKDDWISSAIQSLKKAS  907
            EI+ ALE EA +  DDWIS+ I +LKKAS
Sbjct  246  EIISALEREATHKPDDWISATIGALKKAS  274



>ref|XP_009400742.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=342

 Score =   349 bits (895),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/238 (69%), Positives = 199/238 (84%), Gaps = 0/238 (0%)
 Frame = +2

Query  194  RLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNY  373
            +LL+LF+A EKDS+VKL+++K +GRAF AGGDV+AVV  + QG+W LGAE+FR E+T+NY
Sbjct  2    KLLKLFVAYEKDSDVKLLIMKGNGRAFSAGGDVAAVVQSVTQGHWTLGAEFFRNEYTLNY  61

Query  374  VIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSR  553
            +IA YSKPQVSIL+GIV GGGAG SIHGRFRV TEK+VFAMPETALG FPD+GASYFLSR
Sbjct  62   IIATYSKPQVSILDGIVMGGGAGISIHGRFRVVTEKTVFAMPETALGFFPDIGASYFLSR  121

Query  554  LPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISE  733
            LPGFFGEY+GLTG+RLDGAEMLACGLATHFVPS  L  LE+ L  + +SDP +I AII +
Sbjct  122  LPGFFGEYVGLTGARLDGAEMLACGLATHFVPSMNLTYLEDLLTKVETSDPFVICAIIDQ  181

Query  734  FSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            FS++  LK  S YN L IID+CFS+ T+E+I+ ALE E+A+  D+WI  AIQ LKKAS
Sbjct  182  FSKMVPLKVSSAYNRLDIIDKCFSKETVEDIISALEKESASMADEWIVVAIQELKKAS  239



>emb|CDY31775.1| BnaA04g17110D [Brassica napus]
Length=383

 Score =   350 bits (897),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 176/272 (65%), Positives = 207/272 (76%), Gaps = 4/272 (1%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            Q+LVEE   VR   LNR KQLNALS  MV+RLL+LFLA E DS VKL++LK  GRAFCAG
Sbjct  8    QILVEEKPSVRILTLNRPKQLNALSLNMVTRLLQLFLAFEVDSTVKLVILKGQGRAFCAG  67

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDVSAVV DI  G W+  A++   E+T+NYV+A Y K Q+SILNGIV GGGAG  +HGRF
Sbjct  68   GDVSAVVRDIGLGKWRRSADFMSLEYTLNYVMATYCKAQISILNGIVMGGGAGVCVHGRF  127

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGASYFLSRL GFFGEY+GLTG+RL+GAEMLACGLATHF
Sbjct  128  RIATENTVFAMPETALGLFPDVGASYFLSRLSGFFGEYVGLTGARLNGAEMLACGLATHF  187

Query  644  VPSERLLPLEEALHNINSSDP-TIISAIISEFSQVPKLKEKSPYNHL---KIIDRCFSRR  811
            VPS RL  L+  L  + SSDP T  S I+  ++Q    + +S +       +I+RCFSRR
Sbjct  188  VPSTRLTALQADLCKVGSSDPVTFASTILDAYTQHTHPERQSAFCRQVLSNVINRCFSRR  247

Query  812  TIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            TIEEIM ALE EA +  DDWIS+ I +LKKAS
Sbjct  248  TIEEIMSALEIEATHKPDDWISATIGALKKAS  279



>ref|XP_004307340.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Fragaria 
vesca subsp. vesca]
Length=392

 Score =   349 bits (896),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/287 (62%), Positives = 216/287 (75%), Gaps = 8/287 (3%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MAS  ++   DQ+L++     R   LNR +QLNALS  M+SRL +LF A E D+NVKL++
Sbjct  1    MASFINSDQDDQILIQRDSFARILTLNRPRQLNALSYEMMSRLCQLFHAYEDDANVKLVI  60

Query  251  LKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFG  430
            LK  GRAFCAGGDV  V   + +GNW+ GA   ++ +T+ Y+IA  + PQVS LNGIV G
Sbjct  61   LKGKGRAFCAGGDVVVVARHLFEGNWRFGARQGKRVYTLGYLIAKNTTPQVSFLNGIVMG  120

Query  431  GGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGA  610
            GGAG SIHGRFRVATE SVFA+PETALGLFPD+GASYFLSRLPGFFGEYLGLTG+RLDG 
Sbjct  121  GGAGVSIHGRFRVATENSVFALPETALGLFPDLGASYFLSRLPGFFGEYLGLTGARLDGP  180

Query  611  EMLACGLATHFVPSERLLPLEEAL---HNINSSDPTI-ISAIISEFSQVPKLKEKSPYNH  778
            EMLACGLATHFVPS +L  LEEAL    NI+SSD    ISAII+E+SQ P +KEKS  + 
Sbjct  181  EMLACGLATHFVPSAKLASLEEALVASTNISSSDLVDNISAIINEYSQQPAVKEKSVCHR  240

Query  779  LKIIDRCFSRRTIEEIMVALESEAANY----KDDWISSAIQSLKKAS  907
            + +ID+CFS+ T+EEI+ +LE E A      +D W+SS+I SLKKAS
Sbjct  241  IDVIDKCFSKSTVEEILSSLEKELATTGIHDRDHWLSSSIASLKKAS  287



>ref|XP_008670927.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Zea mays]
Length=386

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/271 (61%), Positives = 207/271 (76%), Gaps = 0/271 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            D+ Q+LVE  G  RT ILNR  QLN LSSAM+  LL  F A  KD  VKL+++K SGRAF
Sbjct  13   DSKQLLVEADGNTRTLILNRPNQLNVLSSAMIKGLLSCFTAFVKDDGVKLLIMKGSGRAF  72

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV A V  I    WK GA++FR ++ +NY+IA   KPQVS+L GIV GGGAG S+H
Sbjct  73   CAGGDVVAGVQSINNEGWKWGADFFRDQYFLNYIIATCIKPQVSLLTGIVMGGGAGVSLH  132

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            G+FRVAT+ +VFAMPET+LGLFPDVGASYFL+RLPGF+GEY+ L G+RLDGAEMLACGLA
Sbjct  133  GKFRVATDNTVFAMPETSLGLFPDVGASYFLARLPGFYGEYVALVGARLDGAEMLACGLA  192

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFVPS R+L LEE+L  +++S+  ++ +II +F Q P LK+KS  N L+II++CFS RT
Sbjct  193  THFVPSNRMLLLEESLKKVDTSNSFVVCSIIDQFCQQPSLKQKSSLNRLEIINKCFSNRT  252

Query  815  IEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +EEI+ +LE  A+N    W++  IQ LKKAS
Sbjct  253  VEEIISSLEEVASNSASKWVAQTIQYLKKAS  283



>ref|XP_006295711.1| hypothetical protein CARUB_v10024830mg [Capsella rubella]
 gb|EOA28609.1| hypothetical protein CARUB_v10024830mg [Capsella rubella]
Length=383

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 170/273 (62%), Positives = 209/273 (77%), Gaps = 5/273 (2%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
             +LVEE    R   LNR  QLN LS  M++RLL+LFLA E+D +VKL++LK  GRAFCAG
Sbjct  6    HILVEEKFSARILTLNRPAQLNVLSLDMMTRLLKLFLAYEEDPSVKLVILKGQGRAFCAG  65

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV   V +I +G W+L A+ F +E+ +NYV+A +SK QVSILNGIV GGGAG SIHGRF
Sbjct  66   GDVKPTVRNIVEGKWRLSADIFAEEYMLNYVMATFSKIQVSILNGIVMGGGAGLSIHGRF  125

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPETALGLFPDVGAS+FLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  126  RIATENTVFAMPETALGLFPDVGASHFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  185

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH--LKIIDRCFSRRTI  817
            VPS RL  LE  L  ++S+DP  +S I+  ++Q P LK+ S Y    L +IDRCFS+RT+
Sbjct  186  VPSTRLTALEADLWRVDSNDPNFVSKILDAYAQHPNLKQHSAYYRQVLHVIDRCFSKRTV  245

Query  818  EEIMVALESE---AANYKDDWISSAIQSLKKAS  907
            E+I+ ALE E        +DWIS+ I++LKKAS
Sbjct  246  EDIISALERELTRPTQEPNDWISTTIRALKKAS  278



>ref|XP_006598672.1| PREDICTED: peroxisomal 3-hydroxyisobutyryl-coenzyme A hydrolase 
isoform X3 [Glycine max]
Length=345

 Score =   345 bits (884),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/241 (66%), Positives = 199/241 (83%), Gaps = 0/241 (0%)
 Frame = +2

Query  185  MVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFT  364
            MVSRLLE+F   EKDS++KL+V+K +GRAFCAGGDV+AV  D  +G+W+ GA +F+ EF 
Sbjct  1    MVSRLLEIFSEDEKDSDIKLVVVKGNGRAFCAGGDVAAVARDGSKGDWRFGANFFQSEFK  60

Query  365  MNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYF  544
            +NY++A YSKPQVSILNGIV GGGAG S+HGRFRV TE +VFAMPETALGLFPD+G+SYF
Sbjct  61   LNYLMATYSKPQVSILNGIVMGGGAGVSVHGRFRVVTENTVFAMPETALGLFPDIGSSYF  120

Query  545  LSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAI  724
            LSRLPGF GEY GLTG+RLDGAEMLACGLATHFVPS +L  LEEAL  + +SDP  +SAI
Sbjct  121  LSRLPGFLGEYAGLTGARLDGAEMLACGLATHFVPSSKLSLLEEALCKVETSDPNAVSAI  180

Query  725  ISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKA  904
            I+++S+ P LKE S Y+ + +I++CFS++ +EEI+ +LE EA    D WIS+ IQSLKKA
Sbjct  181  INKYSEQPFLKEDSVYHRMDVINKCFSKKAVEEILSSLEVEATRKADPWISATIQSLKKA  240

Query  905  S  907
            S
Sbjct  241  S  241



>ref|XP_008671962.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Zea 
mays]
 tpg|DAA42429.1| TPA: hypothetical protein ZEAMMB73_011042 [Zea mays]
Length=386

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/271 (61%), Positives = 206/271 (76%), Gaps = 0/271 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            D+ QVLVE  G  RT ILNR  QLN LSSAM+  LL  F A  KD  VKL+++K SGRAF
Sbjct  13   DSKQVLVEADGNTRTLILNRPNQLNVLSSAMIKGLLNCFTAFVKDDGVKLLIMKGSGRAF  72

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV A V  I    WK GA++FR ++ +NY+IA   KPQVS+L GIV GGGAG S+H
Sbjct  73   CAGGDVVAGVQSINNEGWKWGADFFRDQYFLNYIIARCIKPQVSLLTGIVMGGGAGVSLH  132

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            G+FRVAT  +VFAMPET+LGLFPDVGASYFL+RLPGF+GEY+ L G+RLDGAEMLACGLA
Sbjct  133  GKFRVATNNTVFAMPETSLGLFPDVGASYFLARLPGFYGEYVALVGARLDGAEMLACGLA  192

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFVPS R+L LEE+L  +++S+  ++ + I +F Q P LK+KS  N L+II++CFS+RT
Sbjct  193  THFVPSNRMLLLEESLKKVDTSNSFVVCSTIDQFCQQPSLKQKSSLNRLEIINKCFSKRT  252

Query  815  IEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +EEI+ +LE  A+N    W++  I+ LKKAS
Sbjct  253  VEEIISSLEEVASNSASKWVAQTIKYLKKAS  283



>gb|ABG21948.1| 3-hydroxyisobutyryl-coenzyme A hydrolase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG89197.1| unnamed protein product [Oryza sativa Japonica Group]
Length=297

 Score =   339 bits (870),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 194/241 (80%), Gaps = 0/241 (0%)
 Frame = +2

Query  185  MVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFT  364
            M++  L  F A E+D  VKL+++K  GRAFCAGGDV+AVV  I   +WK GA +FR EF 
Sbjct  1    MITCFLRCFTAYEEDDGVKLLIVKGKGRAFCAGGDVAAVVRSINNDSWKYGAHFFRNEFL  60

Query  365  MNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYF  544
            +NY+IA YSKPQVS+L GIV GGGAG SIHGRFRV T+ +VFAMPETALGLFPD+GASYF
Sbjct  61   LNYIIATYSKPQVSLLTGIVMGGGAGVSIHGRFRVVTDSTVFAMPETALGLFPDIGASYF  120

Query  545  LSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAI  724
            LSRL GF+GEY+GLTG RLD AEMLACGLATHFVPS+RL  LEE+L  +++SDP  I  I
Sbjct  121  LSRLLGFYGEYVGLTGVRLDAAEMLACGLATHFVPSDRLSLLEESLKKVDTSDPFAICGI  180

Query  725  ISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKA  904
            I ++SQ P LKEKS  N L+II++CFS++T+EEI+ +LE EA N  D+WI+SAIQS++KA
Sbjct  181  IDQYSQQPSLKEKSALNRLEIINKCFSKKTVEEIIASLEQEAPNVADEWIASAIQSMRKA  240

Query  905  S  907
            S
Sbjct  241  S  241



>ref|XP_011093456.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Sesamum indicum]
Length=395

 Score =   340 bits (871),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 178/276 (64%), Positives = 208/276 (75%), Gaps = 24/276 (9%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            S++ +TDQVLVEE    R   LNR KQLNALS+AM                        +
Sbjct  46   STSEETDQVLVEEKPSARIITLNRPKQLNALSAAM-----------------------GN  82

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAF AG DV+AV  +I QGNWK GA+YF KEFTMNYV+A Y+KPQVS LNGIV GGGAG
Sbjct  83   GRAFSAGADVAAVARNINQGNWKSGADYFAKEFTMNYVMATYNKPQVSFLNGIVMGGGAG  142

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
            AS+HG+FR+ATE ++FAMPETALG FPD+G+SYFLSRLPGFFGEYLGLTG RLDGAEM  
Sbjct  143  ASVHGKFRIATENTIFAMPETALGFFPDIGSSYFLSRLPGFFGEYLGLTGVRLDGAEMFK  202

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATHFV SERL  LEEAL   +SS+P +IS++I EFSQ+P LK+ S Y+ + II++CF
Sbjct  203  CGLATHFVQSERLTSLEEALVKADSSNPVVISSVIGEFSQIPNLKDNSAYHKMDIINKCF  262

Query  803  SRRTIEEIMVALESEAANYK-DDWISSAIQSLKKAS  907
            SR TIEEI+ ALE E A +K DDWISS IQSLKKAS
Sbjct  263  SRGTIEEIIAALEEEEAAHKDDDWISSTIQSLKKAS  298



>gb|AAC02736.1| 3-hydroxyisobutyryl-coenzyme A hydrolase [Arabidopsis thaliana]
Length=410

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/274 (62%), Positives = 202/274 (74%), Gaps = 12/274 (4%)
 Frame = +2

Query  86   SNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSG  265
            SN    QVLVEE   VR    NR KQLNALS  MVSRLL+LFLA E+D +VKL+VLK  G
Sbjct  44   SNLVRSQVLVEEKSSVRILTFNRPKQLNALSFHMVSRLLQLFLAYEEDPSVKLVVLKGQG  103

Query  266  RAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGA  445
            RAF AGGD+  +V DI QG    GA YF+  +T+NYV++ Y KPQVSILNGIV GGGAG 
Sbjct  104  RAFSAGGDIPPIVRDILQGKLIRGAHYFKVGYTLNYVLSTYRKPQVSILNGIVMGGGAGL  163

Query  446  SIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLAC  625
            S +GRFR+ATE +VFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLAC
Sbjct  164  STNGRFRIATENTVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLAC  223

Query  626  GLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFS  805
            GLATHFVPS  L  LE  L+ + SS+ T IS I+  +++            L +IDRCFS
Sbjct  224  GLATHFVPSISLTALEAELYKVGSSNQTFISTILDAYAE------------LDVIDRCFS  271

Query  806  RRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +RT+EEI  ALE E     +DW+ + IQ+L+KAS
Sbjct  272  KRTVEEIFSALEREVTQKPNDWLLATIQALEKAS  305



>gb|ABG21952.1| 3-hydroxyisobutyryl-coenzyme A hydrolase, putative, expressed 
[Oryza sativa Japonica Group]
Length=344

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 194/241 (80%), Gaps = 0/241 (0%)
 Frame = +2

Query  185  MVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFT  364
            M++  L  F A E+D  VKL+++K  GRAFCAGGDV+AVV  I   +WK GA +FR EF 
Sbjct  1    MITCFLRCFTAYEEDDGVKLLIVKGKGRAFCAGGDVAAVVRSINNDSWKYGAHFFRNEFL  60

Query  365  MNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYF  544
            +NY+IA YSKPQVS+L GIV GGGAG SIHGRFRV T+ +VFAMPETALGLFPD+GASYF
Sbjct  61   LNYIIATYSKPQVSLLTGIVMGGGAGVSIHGRFRVVTDSTVFAMPETALGLFPDIGASYF  120

Query  545  LSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAI  724
            LSRL GF+GEY+GLTG RLD AEMLACGLATHFVPS+RL  LEE+L  +++SDP  I  I
Sbjct  121  LSRLLGFYGEYVGLTGVRLDAAEMLACGLATHFVPSDRLSLLEESLKKVDTSDPFAICGI  180

Query  725  ISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKA  904
            I ++SQ P LKEKS  N L+II++CFS++T+EEI+ +LE EA N  D+WI+SAIQS++KA
Sbjct  181  IDQYSQQPSLKEKSALNRLEIINKCFSKKTVEEIIASLEQEAPNVADEWIASAIQSMRKA  240

Query  905  S  907
            S
Sbjct  241  S  241



>ref|XP_004979611.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3-like 
[Setaria italica]
Length=386

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/283 (60%), Positives = 213/283 (75%), Gaps = 4/283 (1%)
 Frame = +2

Query  71   MASL----SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNV  238
            MASL    +++ D +Q+LVE  G  RT ILNR KQLNALSS M+  LL  F+A EKD  V
Sbjct  1    MASLPFGSTASVDCNQLLVETNGSTRTLILNRPKQLNALSSTMIKELLRCFIAYEKDDGV  60

Query  239  KLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNG  418
            KL+++K  GRAFCAGGD +          WK GA +F+  + +NY+IA   KPQVS+L G
Sbjct  61   KLLIMKGKGRAFCAGGDAAVGFQSALNEGWKWGANFFKNLYLLNYIIATCIKPQVSLLTG  120

Query  419  IVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSR  598
            IV GGGAG S+HGRFRVATEK++FAMPETALGLFPDVG SYFLSRLPGF+GEY+ L G+R
Sbjct  121  IVMGGGAGVSLHGRFRVATEKTIFAMPETALGLFPDVGGSYFLSRLPGFYGEYVALAGAR  180

Query  599  LDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH  778
            LDGAE+LACGLATHFV S RLL LEE+L  +++S+P I+  II +FS+ P  KE S  N 
Sbjct  181  LDGAEVLACGLATHFVHSNRLLLLEESLKKVDTSNPFIVCGIIDQFSEQPSPKENSSLNR  240

Query  779  LKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            L+II++CFS+RT+EEI+ +LE  A+N  D+W+++ IQSLK AS
Sbjct  241  LEIINKCFSKRTVEEIISSLEQVASNLPDEWVAATIQSLKNAS  283



>ref|XP_007032274.1| Beta-hydroxyisobutyryl-CoA hydrolase 1 isoform 4 [Theobroma cacao]
 gb|EOY03200.1| Beta-hydroxyisobutyryl-CoA hydrolase 1 isoform 4 [Theobroma cacao]
Length=350

 Score =   337 bits (863),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 175/279 (63%), Positives = 201/279 (72%), Gaps = 34/279 (12%)
 Frame = +2

Query  71   MASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIV  250
            MAS  S+    QVLVE     R   LNR KQLNALS  M+SRLLELFLA E+D NVKL++
Sbjct  1    MASSVSSQQDHQVLVEANSSARILSLNRPKQLNALSFQMISRLLELFLAYEEDPNVKLVI  60

Query  251  LKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFG  430
            LK                                  FT+NY++AAYSKPQVSILNGIV G
Sbjct  61   LK----------------------------------FTLNYLMAAYSKPQVSILNGIVMG  86

Query  431  GGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGA  610
            GGAGAS+HGRFRVATE SVFAMPETALGLFPDVGASYFLSRLPGFFGEY+GLTGSRLDGA
Sbjct  87   GGAGASVHGRFRVATENSVFAMPETALGLFPDVGASYFLSRLPGFFGEYVGLTGSRLDGA  146

Query  611  EMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKII  790
            EMLACGLATHFVPS +L  LE AL  ++SSDP IIS+II ++ + P LKE+S Y  L +I
Sbjct  147  EMLACGLATHFVPSAKLAMLEAALCIVDSSDPVIISSIIDQYCEQPSLKEQSVYKRLDVI  206

Query  791  DRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            DRCFS++T+EEI+ ALE E  +  D WIS+ IQ+LKKAS
Sbjct  207  DRCFSQKTVEEIISALERELVHKMDVWISTTIQTLKKAS  245



>ref|XP_010275255.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Nelumbo nucifera]
Length=356

 Score =   336 bits (861),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 169/240 (70%), Positives = 201/240 (84%), Gaps = 0/240 (0%)
 Frame = +2

Query  188  VSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTM  367
            VS LLELF   E+D NVKL++LK  GRAFCAGGDV+AVV D   G+W+LGA +F  E+T+
Sbjct  13   VSHLLELFTIYEEDRNVKLLILKGEGRAFCAGGDVAAVVKDTTDGHWRLGARFFWIEYTL  72

Query  368  NYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFL  547
            NY++A Y+KPQVSILNGI+FGGGAGASIHGRFR+ATE SVF+MPETALGLFPDVGASYFL
Sbjct  73   NYIMATYNKPQVSILNGIIFGGGAGASIHGRFRIATENSVFSMPETALGLFPDVGASYFL  132

Query  548  SRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAII  727
            SRLPGFFGEY+GLTG+RLDGAEMLACGLATHFVP+ +L  LEEAL  +N+SDP ++S II
Sbjct  133  SRLPGFFGEYIGLTGARLDGAEMLACGLATHFVPAMKLSLLEEALFKVNTSDPAVVSTII  192

Query  728  SEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
             + S+ P LK K  Y+ L  I+RCFS+RT+EEI+ ALE EAAN  D+W+S  IQSLKKAS
Sbjct  193  DKISEHPPLKAKCAYHRLDAINRCFSKRTVEEILSALEKEAANGADNWLSETIQSLKKAS  252



>gb|EMT23500.1| 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial [Aegilops tauschii]
Length=372

 Score =   336 bits (862),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/284 (60%), Positives = 207/284 (73%), Gaps = 25/284 (9%)
 Frame = +2

Query  71   MASLSSNSDTDQV-----------LVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLA  217
            MAS +S  D+DQV           LVE  G  RT +LNR KQLNALSSAMV+ LL+ F++
Sbjct  1    MASPASG-DSDQVISLYSSVPGRVLVEANGSTRTLVLNRPKQLNALSSAMVTGLLKCFIS  59

Query  218  CEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKP  397
             E+++ VKL+++K  GRAFCAGGDV+ V   I    WK GA++FR EF +NY+IA YSKP
Sbjct  60   YEEETTVKLLIVKGKGRAFCAGGDVAEVAQSINNDTWKYGADFFRTEFLLNYIIATYSKP  119

Query  398  QVSILNGIVFGGGAGASIHGRFRVATEKS-------------VFAMPETALGLFPDVGAS  538
            QVS+L GIV GGGAG SIHGRFRVATE +             VFAMPETALGLFPD+GAS
Sbjct  120  QVSLLTGIVMGGGAGVSIHGRFRVATENTKFSYRGYTPCWPKVFAMPETALGLFPDIGAS  179

Query  539  YFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIIS  718
            YFLSRLPGF+GEY+GLTG+RLDGAEMLACGLATHFVP  R+  LEE+L  +++SDP  I 
Sbjct  180  YFLSRLPGFYGEYVGLTGARLDGAEMLACGLATHFVPLNRMSLLEESLKKVDTSDPFAIC  239

Query  719  AIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEA  850
             II +FSQ P +K  S  N ++II+RCFS+RT+EEI+ AL  E 
Sbjct  240  GIIDQFSQQPSVKGSSAMNRMEIINRCFSKRTVEEIISALIREG  283



>ref|XP_006847711.1| hypothetical protein AMTR_s00149p00076580 [Amborella trichopoda]
 gb|ERN09292.1| hypothetical protein AMTR_s00149p00076580 [Amborella trichopoda]
Length=372

 Score =   335 bits (858),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 201/267 (75%), Gaps = 0/267 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            +L+E    VR  ILNR  QLNALS  M+S LLE FL  E+D NVKL+++K  GRAFC+GG
Sbjct  2    ILIEGNSNVRILILNRPWQLNALSHQMISGLLEKFLTYEEDPNVKLLIVKGQGRAFCSGG  61

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV++V     +G W L A++F +E+ +N+ +A    PQVS+LNGIV GGGAG SIHGRFR
Sbjct  62   DVASVARLGNEGRWDLAAKFFWEEYVLNFTLATNMTPQVSLLNGIVMGGGAGVSIHGRFR  121

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            V TEK+VFA PET+LGLFPDVGA+YFL RLPGF GEY+GLTG+RLDGAEMLACGLATHFV
Sbjct  122  VVTEKTVFATPETSLGLFPDVGATYFLPRLPGFLGEYVGLTGTRLDGAEMLACGLATHFV  181

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
             S +L  LEE L  +++S+P II  +I  FSQ   LKE S +  L +ID+ FS+RT+EEI
Sbjct  182  FSSKLASLEEELSKVDTSNPDIICTVIDRFSQKVPLKEGSAFRRLNVIDKFFSQRTVEEI  241

Query  827  MVALESEAANYKDDWISSAIQSLKKAS  907
            + ALE EAAN  D W+S+ I+SLK AS
Sbjct  242  LSALEKEAANGADAWLSATIKSLKAAS  268



>tpg|DAA42436.1| TPA: hypothetical protein ZEAMMB73_297463 [Zea mays]
Length=265

 Score =   330 bits (846),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 155/250 (62%), Positives = 194/250 (78%), Gaps = 0/250 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            D+ Q+LVE  G  RT ILNR  QLN LSSAM+  LL  F A  KD  VKL+++K SGRAF
Sbjct  13   DSKQLLVEADGNTRTLILNRPNQLNVLSSAMIKGLLSCFTAFVKDDGVKLLIMKGSGRAF  72

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV A V  I    WK GA++FR ++ +NY+IA   KPQVS+L GIV GGGAG S+H
Sbjct  73   CAGGDVVAGVQSINNEGWKWGADFFRDQYFLNYIIATCIKPQVSLLTGIVMGGGAGVSLH  132

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            G+FRVAT+ +VFAMPET+LGLFPDVGASYFL+RLPGF+GEY+ L G+RLDGAEMLACGLA
Sbjct  133  GKFRVATDNTVFAMPETSLGLFPDVGASYFLARLPGFYGEYVALVGARLDGAEMLACGLA  192

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFVPS R+L LEE+L  +++S+  ++ +II +F Q P LK+KS  N L+II++CFS RT
Sbjct  193  THFVPSNRMLLLEESLKKVDTSNSFVVCSIIDQFCQQPSLKQKSSLNRLEIINKCFSNRT  252

Query  815  IEEIMVALES  844
            +EEI+ +L S
Sbjct  253  VEEIISSLVS  262



>ref|XP_006598671.1| PREDICTED: peroxisomal 3-hydroxyisobutyryl-coenzyme A hydrolase 
isoform X2 [Glycine max]
Length=359

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/277 (58%), Positives = 199/277 (72%), Gaps = 23/277 (8%)
 Frame = +2

Query  77   SLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLK  256
            +  S  D +QVLV+     R   LNR KQLNALS  M                       
Sbjct  2    AFPSKGDDEQVLVQRKSNARVLTLNRTKQLNALSFYM-----------------------  38

Query  257  SSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGG  436
             +GRAFCAGGDV+AV  D  +G+W+ GA +F+ EF +NY++A YSKPQVSILNGIV GGG
Sbjct  39   GNGRAFCAGGDVAAVARDGSKGDWRFGANFFQSEFKLNYLMATYSKPQVSILNGIVMGGG  98

Query  437  AGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEM  616
            AG S+HGRFRV TE +VFAMPETALGLFPD+G+SYFLSRLPGF GEY GLTG+RLDGAEM
Sbjct  99   AGVSVHGRFRVVTENTVFAMPETALGLFPDIGSSYFLSRLPGFLGEYAGLTGARLDGAEM  158

Query  617  LACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDR  796
            LACGLATHFVPS +L  LEEAL  + +SDP  +SAII+++S+ P LKE S Y+ + +I++
Sbjct  159  LACGLATHFVPSSKLSLLEEALCKVETSDPNAVSAIINKYSEQPFLKEDSVYHRMDVINK  218

Query  797  CFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            CFS++ +EEI+ +LE EA    D WIS+ IQSLKKAS
Sbjct  219  CFSKKAVEEILSSLEVEATRKADPWISATIQSLKKAS  255



>ref|XP_010557242.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Tarenaya 
hassleriana]
Length=375

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 172/269 (64%), Positives = 212/269 (79%), Gaps = 1/269 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE  CVR F L+R +QLNALS  M+SRLLELFLA E+D NVKL++LK  GRAFC+G
Sbjct  4    QVLVEEKSCVRIFTLSRPQQLNALSFPMLSRLLELFLAFEEDPNVKLVILKGQGRAFCSG  63

Query  284  GDVSAVVHDIRQG-NWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGR  460
            GDV+A   DIR+G +W+  A++  K +  +YVIA  SKPQ+SILNGIV GGG G S+HGR
Sbjct  64   GDVAAGFPDIRRGGHWRPVADFMYKLYVTSYVIATNSKPQISILNGIVMGGGVGISVHGR  123

Query  461  FRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATH  640
            FR+ TE +VF+MPET LG FPDVGASYFLSRLPG FGEY+GLTG++LDGAE LACGLATH
Sbjct  124  FRIVTENTVFSMPETFLGHFPDVGASYFLSRLPGSFGEYIGLTGTKLDGAETLACGLATH  183

Query  641  FVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIE  820
            FVPS RL  LE  L   +++D   IS II+ +SQ P LKE S Y+ L++ID+CFSR+T+E
Sbjct  184  FVPSSRLDALEADLCRASATDAASISEIINAYSQKPCLKESSAYHRLEVIDKCFSRQTVE  243

Query  821  EIMVALESEAANYKDDWISSAIQSLKKAS  907
            EI+ +LE EAA   DDW+S+A+ +LKKAS
Sbjct  244  EILYSLEREAAREADDWVSTAVLALKKAS  272



>tpg|DAA62255.1| TPA: hypothetical protein ZEAMMB73_093839 [Zea mays]
Length=457

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/289 (58%), Positives = 207/289 (72%), Gaps = 27/289 (9%)
 Frame = +2

Query  65   RSMASLSSNS----DTDQVL-----VEETGCVRTFILNRQKQLNALSSAMVSRLLELFLA  217
            + M S+S  S    D+DQVL     VE  G  RT ILNR KQLNALSS M+  LL  F A
Sbjct  80   KRMTSMSPPSAAGDDSDQVLFLYILVEVNGFTRTLILNRPKQLNALSSTMIMGLLRCFTA  139

Query  218  CEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKP  397
             EKD  VKL+++K  GRAFCAGGDV+AVV  I + +WK GA++FR EF +NY+IA Y+KP
Sbjct  140  YEKDDGVKLLIMKGKGRAFCAGGDVAAVVRSIHKDSWKYGADFFRNEFLLNYIIATYTKP  199

Query  398  QVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEY  577
            QVS+L+GIV GGGAG S+HGRFRVAT+ +VFAMPETALGLFPD+GASYFLSRLPGF+GEY
Sbjct  200  QVSLLSGIVMGGGAGVSLHGRFRVATDNTVFAMPETALGLFPDIGASYFLSRLPGFYGEY  259

Query  578  LGLTGSRLDGAEMLACGLATHFVPS------------------ERLLPLEEALHNINSSD  703
            +GL G+RLDG EMLACGLATHFV S                  + LL LEE+L  +++S+
Sbjct  260  VGLAGARLDGGEMLACGLATHFVQSNVGCVCASLITPSKYSVPQSLLSLEESLKKVDTSN  319

Query  704  PTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEA  850
               +  II +F+Q P LKE S  N L+II++CFS+RT+EEI+ AL  E 
Sbjct  320  AFAVCGIIDQFAQQPSLKESSSLNRLEIINKCFSKRTVEEIISALIREG  368



>ref|XP_002272772.2| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Vitis vinifera]
 emb|CBI29145.3| unnamed protein product [Vitis vinifera]
Length=409

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/280 (58%), Positives = 208/280 (74%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASLS-SNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS S S+ + +QVL EE+ CVR  ILNR  +LN+L+  M+S++L      EKD  VKL+
Sbjct  27   MASRSLSHPEPNQVLFEESSCVRKVILNRPHKLNSLTYEMISQILRNLEVYEKDPMVKLL  86

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            +LK  G+AFCAGGDV  +V  I +G+W  GA +++K+ T++Y++A  +KP VS++NGIV 
Sbjct  87   ILKGQGKAFCAGGDVVGMVLSINEGHWSFGASFYKKQLTLDYLLATSTKPLVSLINGIVM  146

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG S++  FRV TE +VFAMPE  +G FPDVGASYFLSRLPG+FGEYLGLTG+RLDG
Sbjct  147  GGGAGLSMNSMFRVVTENTVFAMPEGQIGFFPDVGASYFLSRLPGYFGEYLGLTGARLDG  206

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
             EMLACGLATHFV S+ LL LE AL  + SSD + IS +IS FS    LK++S Y  L+ 
Sbjct  207  KEMLACGLATHFVLSKDLLLLENALSEVASSDASTISRVISGFSSKISLKKESAYRRLET  266

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I++CFSRRT+EEI+  LE+EAAN  + WI  AI S+K AS
Sbjct  267  INKCFSRRTVEEILSMLENEAANGDNKWIIQAISSMKSAS  306



>ref|XP_010659005.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Vitis vinifera]
Length=409

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/274 (57%), Positives = 204/274 (74%), Gaps = 0/274 (0%)
 Frame = +2

Query  86   SNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSG  265
            S+ + +QVL EE+ CVR  ILNR  +LN+L+  M+S++L      EKD  VKL++LK  G
Sbjct  33   SHPEPNQVLFEESSCVRKVILNRPHKLNSLTYEMISQILRNLEVYEKDPIVKLLILKGQG  92

Query  266  RAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGA  445
            + FCAGGDV  +V  I +G+W  GA +++K+ T++Y++A  +KP VS++NGI+ GGGAG 
Sbjct  93   KTFCAGGDVVGMVLSINEGHWSFGASFYKKQLTLDYLLATSTKPLVSLINGIIMGGGAGL  152

Query  446  SIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLAC  625
            S++  FRV TE +VFAMPE  +GLFPDVGASYFLSRLPG+FGEYLGLTG+RLDG EMLAC
Sbjct  153  SMNSMFRVVTENTVFAMPEGQIGLFPDVGASYFLSRLPGYFGEYLGLTGARLDGKEMLAC  212

Query  626  GLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFS  805
            GLATHFV S+ LL LE AL  + SSD + IS +IS FS    LK++S Y  L+ I++CFS
Sbjct  213  GLATHFVLSKDLLLLENALSEVASSDASTISRVISGFSSKISLKKESAYRRLETINKCFS  272

Query  806  RRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            RRT+EEI+  LE+EAAN  + WI  AI S+K AS
Sbjct  273  RRTVEEILSMLENEAANGDNKWIIQAISSMKSAS  306



>ref|XP_010659007.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Vitis vinifera]
Length=412

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 161/283 (57%), Positives = 209/283 (74%), Gaps = 4/283 (1%)
 Frame = +2

Query  71   MASLS-SNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS S S+ + +QVL EE+ CVR  ILNR  +LN+L+  M+S++L      EKD  VKL+
Sbjct  27   MASRSLSHPEPNQVLFEESSCVRKVILNRPHKLNSLTYEMISQILRNLEVYEKDPMVKLL  86

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            +LK  G+AFCAGGDV  +V  I +G+W  GA +++K+ T++Y++A  +KP VS++NGIV 
Sbjct  87   ILKGQGKAFCAGGDVVGMVLSINEGHWSFGASFYKKQLTLDYLLATSTKPLVSLINGIVM  146

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG S++  FRV TE +VFAMPE  +G FPDVGASYFLSRLPG+FGEYLGLTG+RLDG
Sbjct  147  GGGAGLSMNSMFRVVTENTVFAMPEGQIGFFPDVGASYFLSRLPGYFGEYLGLTGARLDG  206

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
             EMLACGLATHFV S+ LL LE AL  + SSD + IS +IS FS    LK++S Y  L+ 
Sbjct  207  KEMLACGLATHFVLSKDLLLLENALSEVASSDASTISRVISGFSSKISLKKESAYRRLET  266

Query  788  IDRCFSRRTIEEI---MVALESEAANYKDDWISSAIQSLKKAS  907
            I++CFSRRT+EEI   +V +E+EAAN  + WI  AI S+K AS
Sbjct  267  INKCFSRRTVEEILSMLVTMENEAANGDNKWIIQAISSMKSAS  309



>ref|XP_009368998.1| PREDICTED: LOW QUALITY PROTEIN: 3-hydroxyisobutyryl-CoA hydrolase 
1-like [Pyrus x bretschneideri]
Length=445

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 174/292 (60%), Positives = 214/292 (73%), Gaps = 16/292 (5%)
 Frame = +2

Query  77   SLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLK  256
            SL+S +  DQVLV+ET  VRT  LNR +QLNALS  M++RL EL LA E ++NVKLI++K
Sbjct  50   SLASFNSDDQVLVQETLSVRTLTLNRPRQLNALSLEMIARLSELLLAYENNANVKLIIVK  109

Query  257  SSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGG  436
             +GRAF AGGD++ +     +GN + GA   +   T+ ++IA  SKPQVS LNGIV GGG
Sbjct  110  GNGRAFSAGGDLATIHGHFLKGNLRFGARVSQTLLTLTFLIATLSKPQVSFLNGIVMGGG  169

Query  437  AGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEM  616
            AG S+HG+FRVATE SVFAMPET LG FPDVGASYFLSRLPGFFGEYLGLTG+ LDGAEM
Sbjct  170  AGISVHGKFRVATENSVFAMPETDLGFFPDVGASYFLSRLPGFFGEYLGLTGANLDGAEM  229

Query  617  LACGLATHFVPSERLLPLEEALH-NINSSDPTI------ISAIISEFS-QVPKLKEKSPY  772
            LACGLATH+VPS +L  LEEAL   + S   +I      +SAII E+S + P L EKS Y
Sbjct  230  LACGLATHYVPSAKLSXLEEALTCRVASYTSSICDLASTVSAIIDEYSLKKPALSEKSAY  289

Query  773  NHLKIIDRCFSRRTIEEIMVALESE-------AANYKDDWISSAIQSLKKAS  907
                IID+CFS+ T+EEI+ ALE E       A ++K +W+++AIQSLKKAS
Sbjct  290  YKKGIIDKCFSKPTVEEILSALEEELTKANTRAGDHK-EWLAAAIQSLKKAS  340



>ref|XP_006346484.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Solanum 
tuberosum]
Length=326

 Score =   319 bits (818),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 162/232 (70%), Positives = 185/232 (80%), Gaps = 12/232 (5%)
 Frame = +2

Query  242  LIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGI  421
            +I+LK  GRAFCAGGDVS    +   GNWK+ A + +K++T+NYV+A YSK Q+SILNGI
Sbjct  1    MIILKGQGRAFCAGGDVSLCFQN--PGNWKICANFLQKQYTLNYVMATYSKTQISILNGI  58

Query  422  VFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRL  601
            V GGGAGASIHGRFRVATEKSVFAMPE  LG FPDVGASYFLSRLPGFFGEY GLTGSRL
Sbjct  59   VMGGGAGASIHGRFRVATEKSVFAMPEADLGHFPDVGASYFLSRLPGFFGEYAGLTGSRL  118

Query  602  DGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHL  781
            DGAEMLACGLATHFV S++L  LE+AL  +N SDP  ISAIIS FS +P LKE+SP + +
Sbjct  119  DGAEMLACGLATHFVSSDKLPLLEQALVKVNKSDPDAISAIISCFSHIPNLKEESPCHKM  178

Query  782  KIIDRCFSRRTIEEIMVAL----------ESEAANYKDDWISSAIQSLKKAS  907
            KII+ CFSRRTIEEI+  L          ESEA + KD+WISSAIQSLKKAS
Sbjct  179  KIINHCFSRRTIEEIISTLVRLGDGWSFDESEALDKKDEWISSAIQSLKKAS  230



>ref|XP_007219433.1| hypothetical protein PRUPE_ppa020598mg [Prunus persica]
 gb|EMJ20632.1| hypothetical protein PRUPE_ppa020598mg [Prunus persica]
Length=391

 Score =   322 bits (824),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 169/283 (60%), Positives = 205/283 (72%), Gaps = 14/283 (5%)
 Frame = +2

Query  101  DQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCA  280
            DQVLV+ET  VRT  LNR +QLN LS  M+S+L ELFLA E D+N KLI+LK  GRAFCA
Sbjct  8    DQVLVQETMFVRTLTLNRPRQLNTLSLEMISQLSELFLAYEDDANAKLIILKGRGRAFCA  67

Query  281  GGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGR  460
            GG+++AV     +GN K G +  +K   + Y+IA YSKPQVSILNGI  G G G S+HG+
Sbjct  68   GGNLAAVHRHFLEGNLKYGEKVSQKIINLTYLIATYSKPQVSILNGIAMGAGVGISVHGK  127

Query  461  FRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATH  640
            FRVATE S+FA PE  LG FP+VGASYFLSRLPGFFGEYLGLTG+RLDGAEMLACGLATH
Sbjct  128  FRVATENSIFATPENGLGFFPNVGASYFLSRLPGFFGEYLGLTGARLDGAEMLACGLATH  187

Query  641  FVPSERLLPLEEAL----HNINSS--DPTIISAIISEFS-QVPKLKEKSPYNHLKIIDRC  799
            FVPS +L  LE+AL     ++ SS  D   ISAII E S + P L EKS  + + +ID+C
Sbjct  188  FVPSAKLPLLEKALISRAASVTSSSFDLAFISAIIDEHSLRQPALNEKSALHKMDVIDKC  247

Query  800  FSRRTIEEIMVALESEAA-------NYKDDWISSAIQSLKKAS  907
            FSR T+EEI+ ALE EAA       +++ +W++  I  LKKAS
Sbjct  248  FSRPTVEEILSALEREAAEAHMADDDHRHEWLALTILLLKKAS  290



>ref|XP_006295586.1| hypothetical protein CARUB_v10024694mg [Capsella rubella]
 gb|EOA28484.1| hypothetical protein CARUB_v10024694mg [Capsella rubella]
Length=230

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 182/232 (78%), Gaps = 3/232 (1%)
 Frame = +2

Query  80   LSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKS  259
            ++SNS   QVLVEE   VR   LNR KQLNALSS M+SRLL+LF A E+D +VKL++LK 
Sbjct  1    MASNS---QVLVEEKASVRILTLNRPKQLNALSSNMISRLLQLFRAYEEDPSVKLVILKG  57

Query  260  SGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGA  439
             GRAFCAGGDV  +V D  QGNW+L ++YF+  +T+NYV++ Y KPQVSILNGIV GGGA
Sbjct  58   QGRAFCAGGDVPPLVRDALQGNWRLASDYFKNAYTLNYVLSTYRKPQVSILNGIVMGGGA  117

Query  440  GASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEML  619
            G SIHGRFRVATE +VFAMPETALG FPDVGASYFLSRLPGFFGEY+GLTG++LDGA+ML
Sbjct  118  GISIHGRFRVATENTVFAMPETALGHFPDVGASYFLSRLPGFFGEYVGLTGAKLDGADML  177

Query  620  ACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYN  775
            ACGLATHFVPS  L  LE  +  + S + T  S I+  ++Q P L ++S Y+
Sbjct  178  ACGLATHFVPSTNLDALEADICKVESREQTFPSTILDAYTQYPHLSQQSSYH  229



>ref|XP_010659004.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Vitis vinifera]
Length=412

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/277 (56%), Positives = 205/277 (74%), Gaps = 3/277 (1%)
 Frame = +2

Query  86   SNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSG  265
            S+ + +QVL EE+ CVR  ILNR  +LN+L+  M+S++L      EKD  VKL++LK  G
Sbjct  33   SHPEPNQVLFEESSCVRKVILNRPHKLNSLTYEMISQILRNLEVYEKDPIVKLLILKGQG  92

Query  266  RAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGA  445
            + FCAGGDV  +V  I +G+W  GA +++K+ T++Y++A  +KP VS++NGI+ GGGAG 
Sbjct  93   KTFCAGGDVVGMVLSINEGHWSFGASFYKKQLTLDYLLATSTKPLVSLINGIIMGGGAGL  152

Query  446  SIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLAC  625
            S++  FRV TE +VFAMPE  +GLFPDVGASYFLSRLPG+FGEYLGLTG+RLDG EMLAC
Sbjct  153  SMNSMFRVVTENTVFAMPEGQIGLFPDVGASYFLSRLPGYFGEYLGLTGARLDGKEMLAC  212

Query  626  GLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFS  805
            GLATHFV S+ LL LE AL  + SSD + IS +IS FS    LK++S Y  L+ I++CFS
Sbjct  213  GLATHFVLSKDLLLLENALSEVASSDASTISRVISGFSSKISLKKESAYRRLETINKCFS  272

Query  806  RRTIEEI---MVALESEAANYKDDWISSAIQSLKKAS  907
            RRT+EEI   +V +E+EAAN  + WI  AI S+K AS
Sbjct  273  RRTVEEILSMLVTMENEAANGDNKWIIQAISSMKSAS  309



>ref|XP_008233262.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Prunus mume]
Length=386

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 169/280 (60%), Positives = 201/280 (72%), Gaps = 13/280 (5%)
 Frame = +2

Query  101  DQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCA  280
            DQVLV+ET  VRT  LNR +QLN LS  M+SRL ELF A E D+N KLI+LK  GRAFCA
Sbjct  8    DQVLVQETLFVRTLTLNRPRQLNTLSLEMISRLSELFQAYEDDTNAKLIILKGRGRAFCA  67

Query  281  GGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGR  460
            GGD++A+     +GN K G    +K   + Y+IA +SKPQVSI+NGI  G G   S+HG+
Sbjct  68   GGDLAAMHRHFLEGNLKYGENIVQKILNLTYLIATHSKPQVSIMNGIAMGAGVCISVHGK  127

Query  461  FRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATH  640
            FRVATE S+FAMPE ALGLFPDVG  +FLSRLPGFFGEYLGLTG+RLDGAEMLACGLATH
Sbjct  128  FRVATENSIFAMPENALGLFPDVG--HFLSRLPGFFGEYLGLTGTRLDGAEMLACGLATH  185

Query  641  FVPSERLLPLEEAL-----HNINSSDPTIISAIISE-FSQVPKLKEKSPYNHLKIIDRCF  802
            FVPS +L  LE+AL        +S D   ISAII E F Q P L EKS  + + +ID+CF
Sbjct  186  FVPSAKLSLLEKALISRAASATSSCDLAFISAIIDEYFLQQPALNEKSALHKMDVIDKCF  245

Query  803  SRRTIEEIMVALESE-----AANYKDDWISSAIQSLKKAS  907
            SR T+E+I+ ALE E     A    D+W++S IQSLKKAS
Sbjct  246  SRPTVEDILSALEKEVTTRDANRAGDEWLASTIQSLKKAS  285



>emb|CDY45439.1| BnaA05g12620D [Brassica napus]
Length=395

 Score =   319 bits (818),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 203/265 (77%), Gaps = 13/265 (5%)
 Frame = +2

Query  131  VRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHD  310
            VR   LNR KQLNAL+S M++RL++LFL  E+D NVK+++LK  GRAFC GGD   V  D
Sbjct  34   VRILTLNRPKQLNALNSNMITRLMQLFLEYEEDPNVKIVILKGQGRAFCVGGDPLPVFRD  93

Query  311  IR-QG-NWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKS  484
            I  QG +W++GA++F +++ +++ +A YSK Q+SI       GGAG S+HGRFR+ATEK+
Sbjct  94   IVIQGKSWRVGADFFSEQYKLDHFMATYSKVQISI-------GGAGISVHGRFRIATEKT  146

Query  485  VFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLL  664
            VFAMPET LGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHFVPS RL 
Sbjct  147  VFAMPETELGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHFVPSSRLN  206

Query  665  PLEEALHNINSSDP-TIISAIISEFSQVPKLKE---KSPYNHLKIIDRCFSRRTIEEIMV  832
             LE  L  + SSDP T  SAI++ +++ PKLK+    S    L +IDRCFSRRT+EEI+ 
Sbjct  207  ALEADLCKVGSSDPVTFASAILNAYTKHPKLKQHTFNSSLRRLDVIDRCFSRRTMEEIIS  266

Query  833  ALESEAANYKDDWISSAIQSLKKAS  907
            ALE EA    ++WIS+ I++LKKAS
Sbjct  267  ALEKEATEKPNEWISATIRALKKAS  291



>ref|XP_010659050.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Vitis vinifera]
Length=383

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/280 (57%), Positives = 204/280 (73%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASLS-SNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MASL  SN +T+QVL EE+   R  ILNR  +LN+L+  M+S++L      EKD  +KL+
Sbjct  1    MASLFLSNPETNQVLFEESSYARKMILNRPHKLNSLTYEMISQILRNLEVYEKDPMIKLL  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            ++K  G+AFCAGGDV  VV  I +G+W  GA +++K+ T++Y +A  +KP VS++NGIV 
Sbjct  61   IVKGQGKAFCAGGDVVRVVLSINEGHWSFGASFYKKQLTLDYFLATCTKPLVSLINGIVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG S++  FRV TE +VFAMPE  +G FPDVGASYFLSRLPG FGEYLGLTG+RLDG
Sbjct  121  GGGAGLSMNSMFRVVTENTVFAMPEGQIGFFPDVGASYFLSRLPGSFGEYLGLTGARLDG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
             EMLACGLATHFV S+ LL LE AL  + SSD + IS +IS FS    LK+ S Y  L+ 
Sbjct  181  NEMLACGLATHFVLSKDLLLLESALSGVASSDASTISRVISGFSSKISLKKDSAYRRLET  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I++CFSRRT+EEI+  LE+EAAN  + WI  AI S+K AS
Sbjct  241  INKCFSRRTVEEILSILENEAANGDNKWIIQAISSMKSAS  280



>emb|CDY31769.1| BnaA04g17050D [Brassica napus]
Length=401

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 173/290 (60%), Positives = 208/290 (72%), Gaps = 22/290 (8%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEET  VR   LNR K LNALS  M++RLL+LFLA E+D +VKL++LK  GRAFCAG
Sbjct  8    QVLVEETSSVRILTLNRPKHLNALSLNMITRLLQLFLAYEEDPSVKLVILKGQGRAFCAG  67

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV A+V DIR G W+  A++    + ++YV+A Y K QVSILNGIV GGG G  +HGRF
Sbjct  68   GDVPAIVRDIRLGKWRRSADFMSLGYNLHYVMATYCKAQVSILNGIVMGGGVGVCVHGRF  127

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            R+ATE +VFAMPET+LG+FPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHF
Sbjct  128  RIATENTVFAMPETSLGIFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHF  187

Query  644  VPSERLLPLEEALHNINSSDP-TIISAIISEFSQVPKLKEKSPYN---------------  775
            VPS RL  LE  L  + SSDP T  S I+  ++Q P  K+KS  +               
Sbjct  188  VPSTRLTALEADLCRVGSSDPVTYASTILDAYTQHPHPKQKSACHRQIFNGNLCHQFLIS  247

Query  776  ------HLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
                   L +ID+CFSRRT+EEI+ ALE EA +  DDWIS+ I + KKAS
Sbjct  248  INFSLCRLDVIDKCFSRRTVEEIISALEREATHKPDDWISATIGAFKKAS  297



>ref|XP_006281790.1| hypothetical protein CARUB_v10027960mg [Capsella rubella]
 gb|EOA14688.1| hypothetical protein CARUB_v10027960mg [Capsella rubella]
Length=306

 Score =   314 bits (805),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 183/244 (75%), Gaps = 19/244 (8%)
 Frame = +2

Query  176  SSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRK  355
            S + +SRLL+LFLA E+D +V L++LK  GRAFCAGGDV+AVV DI QGNW+LGA++F  
Sbjct  7    SHSQISRLLQLFLAYEEDPSVNLVILKGLGRAFCAGGDVAAVVRDIEQGNWRLGAKFFSD  66

Query  356  EFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGA  535
            E+ +NYV+A YSK Q+SILNGIV GGGAG S+HGRFR+ATE +VFAMPETALGLFPD+GA
Sbjct  67   EYMLNYVMATYSKAQISILNGIVMGGGAGVSVHGRFRIATESTVFAMPETALGLFPDIGA  126

Query  536  SYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTII  715
            SYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHFVPS+RL  LE  L  I SSDPT  
Sbjct  127  SYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHFVPSKRLTALEADLCKIGSSDPTFA  186

Query  716  SAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSL  895
            S ++  ++Q P+LK++S Y+                     E EA    D WI + I +L
Sbjct  187  STVLDAYTQQPRLKQQSAYHR-------------------QEREATQEADGWIPATILAL  227

Query  896  KKAS  907
            KKAS
Sbjct  228  KKAS  231



>ref|XP_010473946.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 2 [Camelina 
sativa]
Length=378

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 167/273 (61%), Positives = 196/273 (72%), Gaps = 15/273 (5%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVEE   VR   LNR KQLNALS  MV     LF      S V    L  S   F  G
Sbjct  11   QVLVEEKASVRILTLNRPKQLNALSPNMV-----LF-----PSLVVSSSLSCSCYIFSXG  60

Query  284  --GDVS---AVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGAS  448
              G V+    VV D+ QG W LGAEYF+ ++T++YV+A + KPQVSILNGIV GGGAG S
Sbjct  61   VNGTVNLSIXVVRDVLQGKWSLGAEYFKNKYTLDYVLATHRKPQVSILNGIVMGGGAGLS  120

Query  449  IHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACG  628
            IHGRFR+ATE +VFAMPETALG FPDVGASYFLSRLPGFFGEY+GLTG++LDGAEMLACG
Sbjct  121  IHGRFRIATENTVFAMPETALGHFPDVGASYFLSRLPGFFGEYVGLTGAKLDGAEMLACG  180

Query  629  LATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSR  808
            LATHFVPS  L  LE  L  ++SSD T  SAI+  ++Q P L++KS Y+ L +IDRCFS+
Sbjct  181  LATHFVPSTSLTALEADLCKVDSSDQTFASAILYAYTQYPHLRQKSAYHRLDVIDRCFSK  240

Query  809  RTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            RT+EEI+ ALE E     DDWI + IQ+L+KAS
Sbjct  241  RTVEEIISALEREVTQEPDDWILATIQALEKAS  273



>ref|XP_007218119.1| hypothetical protein PRUPE_ppa007004mg [Prunus persica]
 gb|EMJ19318.1| hypothetical protein PRUPE_ppa007004mg [Prunus persica]
Length=386

 Score =   313 bits (803),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 166/280 (59%), Positives = 199/280 (71%), Gaps = 13/280 (5%)
 Frame = +2

Query  101  DQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCA  280
            DQVLV+ET  VRT  LNR +QLN LS  M+SRL ELF A   D+N KLI+LK  GRAFCA
Sbjct  8    DQVLVQETLFVRTLTLNRPRQLNTLSLEMISRLSELFQAYVDDNNAKLIILKGRGRAFCA  67

Query  281  GGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGR  460
            GGD+ A+     +GN K G  + +K   + Y+IA +SKPQVSI+NGI  G G   S+HG+
Sbjct  68   GGDLVAMHRHFLEGNLKYGENFAQKILNLTYLIATHSKPQVSIMNGIAMGAGVCISVHGK  127

Query  461  FRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATH  640
            FRVATE S+FAMPE ALGLFPDVG  +FLSRLPGFFGEYLGLTG+ LDGAEMLACGLATH
Sbjct  128  FRVATENSIFAMPENALGLFPDVG--HFLSRLPGFFGEYLGLTGTMLDGAEMLACGLATH  185

Query  641  FVPSERLLPLEEAL-----HNINSSDPTIISAIISEFS-QVPKLKEKSPYNHLKIIDRCF  802
            FVPS +L  LE+AL        +S D   ISAII E+S Q P L EKS    + +ID+CF
Sbjct  186  FVPSAKLSLLEKALISRAASATSSCDLAFISAIIDEYSLQQPVLNEKSALRKMDVIDKCF  245

Query  803  SRRTIEEIMVALESE-----AANYKDDWISSAIQSLKKAS  907
            SR T+E+I+ ALE E     A    D+W++S I+SLKKAS
Sbjct  246  SRPTVEDILSALEKEVTTTDANRAGDEWLASTIRSLKKAS  285



>emb|CDP09332.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   307 bits (786),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  86   SNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSG  265
            ++S+TD +LVEE    R ++LNR KQLNAL+  MVSRLL+LFL  EKD +VKLIVLK  G
Sbjct  7    TSSETDLILVEEKSSARVWVLNRPKQLNALNFPMVSRLLDLFLETEKDLSVKLIVLKGIG  66

Query  266  RAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGA  445
            RAFCAGGDV+ VV DI QGNW+LGA +FR EFT+NY+IA YSKPQVSILNGIV GGGAG 
Sbjct  67   RAFCAGGDVANVVRDISQGNWRLGAHFFRTEFTLNYLIATYSKPQVSILNGIVMGGGAGV  126

Query  446  SIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLAC  625
            SIHGRFRVATE SVFAMPETALGLFPD+GASYFLS+LPGF GEY+GLTG+RLDGAEMLA 
Sbjct  127  SIHGRFRVATENSVFAMPETALGLFPDIGASYFLSKLPGFLGEYVGLTGARLDGAEMLAT  186

Query  626  GLATHFVPSE  655
            GLATHFVP++
Sbjct  187  GLATHFVPAQ  196



>ref|XP_006847719.1| hypothetical protein AMTR_s00149p00080400 [Amborella trichopoda]
 gb|ERN09300.1| hypothetical protein AMTR_s00149p00080400 [Amborella trichopoda]
Length=355

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/277 (58%), Positives = 209/277 (75%), Gaps = 2/277 (1%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            +++V+ T  VRT +LNR +QLNALS  M+S LLE F++ E D +VKL++LK  GRAFC+G
Sbjct  31   RIIVDGTSSVRTLVLNRPQQLNALSYQMISNLLEKFVSYEDDPSVKLVILKGQGRAFCSG  90

Query  284  GDVSAVVH-DIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGR  460
            GD+ +V      +G W + ++YFR E+T+NY++A    PQVSILNGI+ GGG G SIHGR
Sbjct  91   GDLLSVAQIGTTEGRWDVCSKYFRVEYTLNYIMATNETPQVSILNGIIMGGGTGISIHGR  150

Query  461  FRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATH  640
            FR+ATEK+ FAMPET  G+FP VGASYFLS+LPGFFGEY+GLTG RLDGAEMLACGLATH
Sbjct  151  FRIATEKTYFAMPETTRGIFPVVGASYFLSKLPGFFGEYIGLTGPRLDGAEMLACGLATH  210

Query  641  FVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIE  820
            FVPS+ L  LE+ L  +++ DP++I A+I  F+Q   L + S Y+ L +I+RCFSRRTIE
Sbjct  211  FVPSKALPSLEKELSKVDTLDPSVICAMIDWFAQKVPLMDNSAYHRLDVINRCFSRRTIE  270

Query  821  EIMVALESEAANYKDDWISSAIQSLKKAS-IDFNGCL  928
            EI+ ALE+EA +  D W+S AI+SL  AS I    CL
Sbjct  271  EILSALENEAEHGADAWLSKAIKSLNSASPISLKICL  307



>emb|CBI29142.3| unnamed protein product [Vitis vinifera]
Length=385

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/268 (57%), Positives = 195/268 (73%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            +VL EE+   R  ILNR  +LN+L+  M+S++L      EKD  +KL+++K  G+AFCAG
Sbjct  26   KVLFEESSYARKMILNRPHKLNSLTYEMISQILRNLEVYEKDPMIKLLIVKGQGKAFCAG  85

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV  VV  I +G+W  GA +++K+ T++Y +A  +KP VS++NGIV GGGAG S++  F
Sbjct  86   GDVVRVVLSINEGHWSFGASFYKKQLTLDYFLATCTKPLVSLINGIVMGGGAGLSMNSMF  145

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            RV TE +VFAMPE  +G FPDVGASYFLSRLPG FGEYLGLTG+RLDG EMLACGLATHF
Sbjct  146  RVVTENTVFAMPEGQIGFFPDVGASYFLSRLPGSFGEYLGLTGARLDGNEMLACGLATHF  205

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
            V S+ LL LE AL  + SSD + IS +IS FS    LK+ S Y  L+ I++CFSRRT+EE
Sbjct  206  VLSKDLLLLESALSGVASSDASTISRVISGFSSKISLKKDSAYRRLETINKCFSRRTVEE  265

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+  LE+EAAN  + WI  AI S+K AS
Sbjct  266  ILSILENEAANGDNKWIIQAISSMKSAS  293



>ref|XP_007032273.1| Beta-hydroxyisobutyryl-CoA hydrolase 1 isoform 3 [Theobroma cacao]
 gb|EOY03199.1| Beta-hydroxyisobutyryl-CoA hydrolase 1 isoform 3 [Theobroma cacao]
Length=312

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/241 (64%), Positives = 180/241 (75%), Gaps = 34/241 (14%)
 Frame = +2

Query  185  MVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFT  364
            M+SRLLELFLA E+D NVKL++LK                                  FT
Sbjct  1    MISRLLELFLAYEEDPNVKLVILK----------------------------------FT  26

Query  365  MNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYF  544
            +NY++AAYSKPQVSILNGIV GGGAGAS+HGRFRVATE SVFAMPETALGLFPDVGASYF
Sbjct  27   LNYLMAAYSKPQVSILNGIVMGGGAGASVHGRFRVATENSVFAMPETALGLFPDVGASYF  86

Query  545  LSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAI  724
            LSRLPGFFGEY+GLTGSRLDGAEMLACGLATHFVPS +L  LE AL  ++SSDP IIS+I
Sbjct  87   LSRLPGFFGEYVGLTGSRLDGAEMLACGLATHFVPSAKLAMLEAALCIVDSSDPVIISSI  146

Query  725  ISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKA  904
            I ++ + P LKE+S Y  L +IDRCFS++T+EEI+ ALE E  +  D WIS+ IQ+LKKA
Sbjct  147  IDQYCEQPSLKEQSVYKRLDVIDRCFSQKTVEEIISALERELVHKMDVWISTTIQTLKKA  206

Query  905  S  907
            S
Sbjct  207  S  207



>ref|XP_011013666.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Populus 
euphratica]
Length=384

 Score =   306 bits (784),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 198/276 (72%), Gaps = 0/276 (0%)
 Frame = +2

Query  80   LSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKS  259
             S   + +QVL E     R  ILNR ++LN L+  MVS++L+   A E DS V+L++LK 
Sbjct  5    FSYRKELNQVLFEGDSISRKVILNRPEKLNILNYEMVSQMLKNLKAFENDSAVRLVILKG  64

Query  260  SGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGA  439
            +G  FCAGGD+ +    + QG+W  G +++ K+  ++Y++A Y KP +S+++GIV GGGA
Sbjct  65   NGNIFCAGGDIVSNFLCVTQGHWSYGEKFYEKQLILDYILATYRKPLISLVDGIVMGGGA  124

Query  440  GASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEML  619
            G S+HGRFR+ TE +VFAMPET +G FPD+GAS+FLSRLPG FGEYLGLTG+RLDGAEML
Sbjct  125  GLSMHGRFRIVTENTVFAMPETLIGHFPDLGASHFLSRLPGHFGEYLGLTGARLDGAEML  184

Query  620  ACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRC  799
            ACGLATHFV S+ LL LE AL  + SSD   IS  I+ F Q P +K+ S Y  L++I++C
Sbjct  185  ACGLATHFVLSKDLLALENALQALGSSDTATISEAINNFGQKPTIKDDSAYGRLEVINKC  244

Query  800  FSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            FS+ T+EE++++LE E  N ++ WI  AI+S+K  S
Sbjct  245  FSKETVEEVLLSLEHEVENRREKWILVAIKSIKSVS  280



>ref|XP_004308348.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Fragaria 
vesca subsp. vesca]
Length=397

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 207/295 (70%), Gaps = 16/295 (5%)
 Frame = +2

Query  71   MASLSSN---SDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVK  241
            MASL S+   SD + ++ +    V T  LNR ++LNALS +M+SRL ELFL C+ D +VK
Sbjct  1    MASLISDLHSSDPEILVRKNNRFVTTLTLNRPRKLNALSVSMLSRLSELFLRCDNDPHVK  60

Query  242  LIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGI  421
            L++LK++G+ F  GGD+++V   +  GN +     F   +++ Y++A  ++PQVS LNG+
Sbjct  61   LVILKATGKTFSPGGDIASVAQHLYNGNVRAACRSFATAYSLMYLVATKTRPQVSFLNGM  120

Query  422  VFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRL  601
              G GAG SIHG FRV TEK+VFAMPE A+G FPDVG+SYFLSRLPGFFGEYLGLTG++L
Sbjct  121  TMGTGAGVSIHGSFRVTTEKTVFAMPEAAIGGFPDVGSSYFLSRLPGFFGEYLGLTGAKL  180

Query  602  DGAEMLACGLATHFVPSERLLPLEEAL--------HNINSSDPTIISAIISEFSQVPKLK  757
            DG EMLA GLATHFVPS +L  LEEAL        +  +S D   ISAI+  +S+ P LK
Sbjct  181  DGPEMLALGLATHFVPSSKLASLEEALVRTLGALPNTSSSDDRAFISAILDAYSEQPALK  240

Query  758  EKSPYNHLKIIDRCFSRRTIEEIMVALESEAA---NYKD--DWISSAIQSLKKAS  907
             KS Y+ + +ID+CFS+ T+EEI+ +LE E A   N  D  +W+SS+IQS+K AS
Sbjct  241  AKSAYHRMDVIDKCFSQSTVEEILSSLEKEYATSTNTSDHHEWLSSSIQSMKSAS  295



>ref|XP_004307250.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Fragaria 
vesca subsp. vesca]
Length=405

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 162/302 (54%), Positives = 211/302 (70%), Gaps = 23/302 (8%)
 Frame = +2

Query  71   MASLSSNSDTD-----QVLVEETGC-VRTFILNRQKQLNALSSAMVSRLLELFLACEKDS  232
            MASL S+  +D     +VL++E    VRT  LNR +QLNALS  M+SRL ELFLA E D+
Sbjct  1    MASLMSSFSSDDLCHPEVLIQENNPFVRTLTLNRPRQLNALSLEMLSRLSELFLALEHDA  60

Query  233  NVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSIL  412
             VKL++LK +G+AFCAGGD   +   +  G+W+ G +   + + + Y+IA YSKPQVS+L
Sbjct  61   KVKLVILKGNGKAFCAGGDAVVLARHLYNGDWRFGTKTTEESYKLLYLIATYSKPQVSVL  120

Query  413  NGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTG  592
            +G+  G GA  SI  RFR+ATE S+F++PE ALG FPDVGASYFLSRLPGFFGEY+ LTG
Sbjct  121  DGVCLGRGAAISISCRFRIATENSIFSVPEVALGGFPDVGASYFLSRLPGFFGEYVALTG  180

Query  593  SRLDGAEMLACGLATHFVPSERLLPLEEAL--------HNINSSD-PTIISAIISEFSQV  745
            ++LDG EMLACGLATHFVPS +L  LEEAL        +NI+S D P  ISAII+++S  
Sbjct  181  AQLDGPEMLACGLATHFVPSTKLALLEEALASKVASSTNNISSQDLPFYISAIINDYSIR  240

Query  746  PKLKEK-SPYNHLKIIDRCFSRRTIEEIMVALESEAANYK-------DDWISSAIQSLKK  901
            P +  K S  + + +I +CFS+ ++EEI+ ALE EAA+         D W+SS IQSL+K
Sbjct  241  PAVNRKGSAIHKMDVIQKCFSKGSVEEILSALEKEAADKNLQDPINGDVWLSSTIQSLQK  300

Query  902  AS  907
            AS
Sbjct  301  AS  302



>ref|XP_007043249.1| Beta-hydroxyisobutyryl-CoA hydrolase 1 [Theobroma cacao]
 gb|EOX99080.1| Beta-hydroxyisobutyryl-CoA hydrolase 1 [Theobroma cacao]
Length=405

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/271 (52%), Positives = 195/271 (72%), Gaps = 0/271 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            + +QVL E     +  ILNR K+LN LS  M+ ++L  F A E+DS    ++LKS+GRAF
Sbjct  32   EHNQVLFEGDSSAKKVILNRPKKLNVLSYEMICQMLTNFQAYEEDSTTNFVILKSNGRAF  91

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV A++  +  G+W  GA +++K++ ++Y++A Y KP +S++NG+V GGGAG S+H
Sbjct  92   CAGGDVVAILSAMIIGHWSFGANFYQKQYPLDYLLATYKKPLISLINGVVMGGGAGLSMH  151

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
             +FR+ TE +VFAMPE ++GLFPDVGASYFLSRLPG+FGEYLGLTG+RLDG EMLACGLA
Sbjct  152  AKFRIVTENAVFAMPEASIGLFPDVGASYFLSRLPGYFGEYLGLTGARLDGMEMLACGLA  211

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFV S+ L+ LE  L  + +SD T I+  I  FS    +K +S Y  L  I++CFS+ T
Sbjct  212  THFVLSKDLVLLENELDKVGTSDTTEIARQIERFSCAAPIKRESAYARLDTINKCFSKNT  271

Query  815  IEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +E+I++ALE E     + WI  AI+S++ AS
Sbjct  272  VEDILLALEKEMKYKAEKWIIKAIKSMEAAS  302



>ref|XP_001766245.1| predicted protein [Physcomitrella patens]
 gb|EDQ68877.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 194/269 (72%), Gaps = 1/269 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVE+    +  ILNR K+LNAL+  M+ RLLEL+   EKD +V++++L  +GR FCAG
Sbjct  1    QVLVEDGFATKVAILNRPKKLNALNENMIDRLLELYAKWEKDKHVRMVILTGAGRGFCAG  60

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GDV++V H  + G  + G  +F KE+ +NYV+  + K  V++L+G+  GGG G S+HG+F
Sbjct  61   GDVASVYHFGKAGQQERGNTFFNKEYHLNYVLGTFKKIHVALLDGVCMGGGNGISMHGKF  120

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFF-GEYLGLTGSRLDGAEMLACGLATH  640
            RVATE ++FAMPETA+GL PDVGASYFLSRLPG   GEYLGLTGSRLDGA++L+CGLATH
Sbjct  121  RVATENTLFAMPETAIGLHPDVGASYFLSRLPGHLAGEYLGLTGSRLDGADLLSCGLATH  180

Query  641  FVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIE  820
            FVPS+RL  LE+ L  +N+ DP ++   I EF  V    +KSP +  + ID CF + T+E
Sbjct  181  FVPSQRLADLEDRLGGLNTGDPEVVGIAIDEFCDVVYPGDKSPLHRYEDIDECFEKETVE  240

Query  821  EIMVALESEAANYKDDWISSAIQSLKKAS  907
            EI+  LE++A + +D+W S+ +  +KK S
Sbjct  241  EIVDTLETKAGSNEDEWYSNTLALMKKVS  269



>ref|XP_002315058.2| hypothetical protein POPTR_0010s17730g [Populus trichocarpa]
 gb|EEF01229.2| hypothetical protein POPTR_0010s17730g [Populus trichocarpa]
Length=443

 Score =   300 bits (769),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/276 (51%), Positives = 195/276 (71%), Gaps = 0/276 (0%)
 Frame = +2

Query  80   LSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKS  259
             S   + +QVL E     R  ILNR ++LN L+  MVS++L+   A E DS V+L++LK 
Sbjct  64   FSYRKELNQVLFEGDSISRKVILNRPEKLNILNYEMVSQMLKNLKAFENDSAVRLVILKG  123

Query  260  SGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGA  439
            +G  FCAGGD+ +    + QG+W    +++ K+  ++Y++A Y KP +S+++GIV GGGA
Sbjct  124  NGNIFCAGGDIVSNFLSVTQGHWSYVEKFYEKQLILDYILATYRKPLISLVDGIVMGGGA  183

Query  440  GASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEML  619
            G S+HGRFR+ TE +VFAMPET +G FPD+GAS+FLSRLPG FGEYLGLTG+RLDGAEML
Sbjct  184  GLSMHGRFRIVTENTVFAMPETLIGHFPDLGASHFLSRLPGHFGEYLGLTGARLDGAEML  243

Query  620  ACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRC  799
            ACGLATHFV S  LL LE AL  + SSD   IS  I+ F   P +K+ S Y  L++I++C
Sbjct  244  ACGLATHFVLSRDLLALENALQALGSSDTATISEAINNFGHKPTIKDDSAYGRLEVINKC  303

Query  800  FSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            FS+ T+EE++++LE+E  N  + WI  AI+S+K  S
Sbjct  304  FSKETVEEVLLSLENEVENRTEKWILVAIKSIKSVS  339



>emb|CBI29141.3| unnamed protein product [Vitis vinifera]
Length=385

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 194/274 (71%), Gaps = 1/274 (0%)
 Frame = +2

Query  86   SNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSG  265
            S+ + +QVL EE+   R  ILNR  +LN+L+  M+S++       E D  VK+++LK  G
Sbjct  7    SDPEPNQVLFEESSYARKMILNRPHKLNSLTYEMISQISRNLEVYENDHLVKILILKGQG  66

Query  266  RAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGA  445
            +AFCAGGDV  ++  I  G+W  GA +++K+ T++Y+IA  +KP VS++NGIV GGGAG 
Sbjct  67   KAFCAGGDVVGILLSIINGHWSFGARFYKKQLTLDYLIATSTKPLVSLINGIVMGGGAGL  126

Query  446  SIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLAC  625
            S++  FRV TE +VFAMPE  +GLFPDVGASYFLSRL G FGEYLGLTG+RLDG+EMLAC
Sbjct  127  SMNSMFRVVTENTVFAMPEGQIGLFPDVGASYFLSRLSGSFGEYLGLTGARLDGSEMLAC  186

Query  626  GLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFS  805
            GLATHFV S+ LL LE AL  + SSD   IS +IS FS    LK+ S +  L+ I++CFS
Sbjct  187  GLATHFVLSKDLLLLENALSEVASSDALTISRVISAFSSKISLKKDSAFRRLETINKCFS  246

Query  806  RRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            + T+EEI+  LE+E  N  D WI  AI S+K AS
Sbjct  247  KGTVEEILSTLENEVVN-GDKWIVHAISSMKSAS  279



>ref|XP_010659001.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Vitis 
vinifera]
Length=382

 Score =   297 bits (760),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 194/274 (71%), Gaps = 1/274 (0%)
 Frame = +2

Query  86   SNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSG  265
            S+ + +QVL EE+   R  ILNR  +LN+L+  M+S++       E D  VK+++LK  G
Sbjct  7    SDPEPNQVLFEESSYARKMILNRPHKLNSLTYEMISQISRNLEVYENDHLVKILILKGQG  66

Query  266  RAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGA  445
            +AFCAGGDV  ++  I  G+W  GA +++K+ T++Y+IA  +KP VS++NGIV GGGAG 
Sbjct  67   KAFCAGGDVVGILLSIINGHWSFGARFYKKQLTLDYLIATSTKPLVSLINGIVMGGGAGL  126

Query  446  SIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLAC  625
            S++  FRV TE +VFAMPE  +GLFPDVGASYFLSRL G FGEYLGLTG+RLDG+EMLAC
Sbjct  127  SMNSMFRVVTENTVFAMPEGQIGLFPDVGASYFLSRLSGSFGEYLGLTGARLDGSEMLAC  186

Query  626  GLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFS  805
            GLATHFV S+ LL LE AL  + SSD   IS +IS FS    LK+ S +  L+ I++CFS
Sbjct  187  GLATHFVLSKDLLLLENALSEVASSDALTISRVISAFSSKISLKKDSAFRRLETINKCFS  246

Query  806  RRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            + T+EEI+  LE+E  N  D WI  AI S+K AS
Sbjct  247  KGTVEEILSTLENEVVN-GDKWIVHAISSMKSAS  279



>ref|XP_002271707.2| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Vitis vinifera]
Length=382

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 193/271 (71%), Gaps = 1/271 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            +TDQVL EE+  VR  ILNR  +LN+LS  M++++L      E D  VKL++LK  G+ F
Sbjct  10   ETDQVLFEESPGVRKMILNRPNKLNSLSYEMITQILRKLEVYENDPTVKLLILKGQGKVF  69

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            C+GGDV A+V  I  G+W  G  ++RK+ T++Y+ A   K  VS++NGIV GGG G S++
Sbjct  70   CSGGDVVAMVLSIYGGHWSFGESFYRKQITLDYLFATSEKTLVSLINGIVMGGGVGLSMN  129

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
             RFRV TE +VFAMPE  +G FPDVG SYFLSRLPGFFGEYLGLTG++L+G EMLACGLA
Sbjct  130  SRFRVVTENTVFAMPEAQMGHFPDVGVSYFLSRLPGFFGEYLGLTGAQLNGTEMLACGLA  189

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFV S+ LL LE AL    +SD + I  +I+ F++   LK+ S +  L+II++CFS +T
Sbjct  190  THFVLSKDLLLLETALSEA-ASDTSTIPKVINRFARKTFLKQDSAFMRLEIINKCFSAKT  248

Query  815  IEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +EEI++ L++E AN  D WI  AI S+K AS
Sbjct  249  VEEILLLLQNEVANGSDAWIIEAISSMKSAS  279



>ref|XP_006371811.1| hypothetical protein POPTR_0018s03870g [Populus trichocarpa]
 gb|ERP49608.1| hypothetical protein POPTR_0018s03870g [Populus trichocarpa]
Length=383

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 192/272 (71%), Gaps = 0/272 (0%)
 Frame = +2

Query  89   NSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGR  268
            + D DQVL E   CV+  ILNR  +LN+L+  M  ++++   A E D  VK+++LK +G+
Sbjct  8    DKDVDQVLFEGNSCVKKVILNRPHKLNSLTYHMTCQMIKELKAYEVDPKVKIVILKGNGK  67

Query  269  AFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGAS  448
            AFCAGGDV A    +  G+W  G  +++K+  ++Y++A Y KP V+I++GIV GGGAG S
Sbjct  68   AFCAGGDVLASYTCMVAGHWSYGTNFYKKQIMLDYLVATYGKPVVAIIDGIVMGGGAGLS  127

Query  449  IHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACG  628
            + G FR+ TE +VFAMPETA+G F DVG+SYFLSRLPGFFGEYLGLTG+++ GAEM+ CG
Sbjct  128  LQGTFRIVTENTVFAMPETAIGHFTDVGSSYFLSRLPGFFGEYLGLTGAKIRGAEMVECG  187

Query  629  LATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSR  808
            LATHF+ ++    LE AL  + S+D T IS IIS+F   P +K+   ++ L+II++CFSR
Sbjct  188  LATHFMLAKDARLLETALDEVTSTDTTTISEIISKFMHKPNVKQHGAFSRLEIINKCFSR  247

Query  809  RTIEEIMVALESEAANYKDDWISSAIQSLKKA  904
             T+EEI+ +LESEA    + WI  AI  +K A
Sbjct  248  TTVEEILSSLESEAGTESEKWILDAINWMKSA  279



>ref|XP_011045035.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Populus 
euphratica]
 ref|XP_011045036.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Populus 
euphratica]
Length=386

 Score =   293 bits (751),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 191/272 (70%), Gaps = 0/272 (0%)
 Frame = +2

Query  89   NSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGR  268
            + D DQVL E   CV+  ILNR  +LN+L+  M  ++++   A E D  VK+++LK +G+
Sbjct  8    DKDVDQVLFEGNSCVKKVILNRPHKLNSLTYHMTCQMIKQLKAYEVDPKVKMVILKGNGK  67

Query  269  AFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGAS  448
            AFCAGGDV A    +  G+W  G  +++K+  M+Y++A Y KP V+I++GIV GGGAG S
Sbjct  68   AFCAGGDVLASYTCMVAGHWSYGINFYKKQIIMDYLVATYGKPVVAIIDGIVMGGGAGLS  127

Query  449  IHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACG  628
            + G FR+ TE +VFAMPETA+G F DVG+SYFLSRLPGFFGEYLGLTG+++ GAEM+ CG
Sbjct  128  LQGTFRIVTENTVFAMPETAIGHFTDVGSSYFLSRLPGFFGEYLGLTGTKIRGAEMVECG  187

Query  629  LATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSR  808
            LA HF+ S+ +  LE AL  + SSD   IS IIS+F   P +K+   ++ L+II++CFSR
Sbjct  188  LANHFMLSKDVRLLETALDEVTSSDTKTISEIISKFMHKPNVKQHGAFSRLEIINKCFSR  247

Query  809  RTIEEIMVALESEAANYKDDWISSAIQSLKKA  904
             T+EEI+ +LESEA    + WI  A+  +K A
Sbjct  248  TTVEEILSSLESEAETRAEKWILEAMDWMKSA  279



>ref|XP_003636198.1| 3-hydroxyisobutyryl-CoA hydrolase [Medicago truncatula]
Length=212

 Score =   286 bits (733),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            D DQVLVE     R   LNR KQLNALS  MVS+LLE+F   E + +VKLIVLK +GRAF
Sbjct  8    DKDQVLVERKSSARVLTLNRPKQLNALSFYMVSKLLEIFHDDEGNPDVKLIVLKGNGRAF  67

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV+AV +D R G+W+ GA +F  E+ MNY++A YSKPQVSILNGIV GGGAGAS+H
Sbjct  68   CAGGDVAAVANDARGGDWRFGAIFFDTEYKMNYLMATYSKPQVSILNGIVMGGGAGASMH  127

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            GRFRV TEK+VFAMPETALGLFPDVGASY+LSRL GFFGEY+GLTG+RLDGAEMLACGLA
Sbjct  128  GRFRVVTEKTVFAMPETALGLFPDVGASYYLSRLAGFFGEYVGLTGARLDGAEMLACGLA  187

Query  635  THFVPS  652
            THFVPS
Sbjct  188  THFVPS  193



>ref|XP_006371812.1| hypothetical protein POPTR_0018s03880g [Populus trichocarpa]
 gb|ERP49609.1| hypothetical protein POPTR_0018s03880g [Populus trichocarpa]
Length=383

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 191/272 (70%), Gaps = 0/272 (0%)
 Frame = +2

Query  89   NSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGR  268
            + D DQVL E   CV+  ILNR  +LN+L+  M  ++++   A E D  VK+++LK +G+
Sbjct  8    DKDVDQVLFEGNSCVKKVILNRPHKLNSLTYHMTCQMIKELKAYEVDPKVKIVILKGNGK  67

Query  269  AFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGAS  448
            AFCAGGDV A    +  G+W  G  +++K+  ++Y++A Y KP V+I++GIV GGGAG S
Sbjct  68   AFCAGGDVLASYTCMVAGHWSYGINFYKKQIMLDYLVATYGKPVVAIIDGIVMGGGAGLS  127

Query  449  IHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACG  628
            + G FR+ TE +VFAMPETA+G F DVG+SYFLSRLPGFFGEYLGLTG+++ GAEM+ CG
Sbjct  128  LQGTFRIVTENTVFAMPETAIGHFTDVGSSYFLSRLPGFFGEYLGLTGTKIRGAEMVECG  187

Query  629  LATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSR  808
            LA HF+ S+ +  LE AL  + SSD   IS IIS+F   P +K+   ++ L+II++CFSR
Sbjct  188  LANHFMLSKDVRLLETALDEVTSSDTKTISEIISKFMHKPNVKQHGAFSRLEIINKCFSR  247

Query  809  RTIEEIMVALESEAANYKDDWISSAIQSLKKA  904
             T+EEI+ +LESEA    + WI  AI  +K A
Sbjct  248  TTVEEILSSLESEAETRAEKWILEAINWMKSA  279



>ref|XP_001783594.1| predicted protein [Physcomitrella patens]
 gb|EDQ51626.1| predicted protein [Physcomitrella patens]
Length=421

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 189/269 (70%), Gaps = 0/269 (0%)
 Frame = +2

Query  101  DQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCA  280
            D+VL E+    +  ILNR K+LNA++  M+ RLLEL++  E D +V++++L  +GR FCA
Sbjct  50   DEVLSEDGFATKVAILNRPKKLNAVNENMIDRLLELYVKWENDKHVRMVILAGAGRGFCA  109

Query  281  GGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGR  460
            GGDV+ V H  + G  + G  +F KE+ +NY++  Y K  V++L+GI  GGG G S+HG+
Sbjct  110  GGDVATVYHLGKAGQQERGNAFFYKEYHLNYILGTYKKIHVALLDGICMGGGNGISMHGK  169

Query  461  FRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATH  640
            FRVATE ++FAMPETA+GL PDVGASYFLSRL G  GEYLGLTG+RLDGA++L+CGLATH
Sbjct  170  FRVATENTLFAMPETAIGLHPDVGASYFLSRLRGHLGEYLGLTGTRLDGADLLSCGLATH  229

Query  641  FVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIE  820
            FVPS+RL  LE+ L  +N+ D  ++   I EF  V    +KSP +   +I  CF + T+E
Sbjct  230  FVPSQRLADLEDRLGGLNTGDAGVVGTAIDEFCDVVYPGDKSPLHRRDVIAECFGKETVE  289

Query  821  EIMVALESEAANYKDDWISSAIQSLKKAS  907
            EI+  LE++AA+  D+W S  +  +KK S
Sbjct  290  EIVETLEAKAASSDDEWFSETLAIMKKVS  318



>ref|XP_011045038.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Populus 
euphratica]
Length=383

 Score =   291 bits (745),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/272 (50%), Positives = 191/272 (70%), Gaps = 0/272 (0%)
 Frame = +2

Query  89   NSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGR  268
            + D DQVL E   CV+  ILNR  +LN+L+  M  ++++   A E D  VK+++LK +G+
Sbjct  8    DKDVDQVLFEGNSCVKKVILNRPHKLNSLTYHMTCQMIKELKAYEVDPKVKMVILKGNGK  67

Query  269  AFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGAS  448
            AFCAGGDV A    +  G+W  G  +++K+  ++Y++A Y KP V+I++GIV GGGAG S
Sbjct  68   AFCAGGDVLASYTCMVAGHWSYGTNFYKKQIMLDYLVATYGKPVVAIIDGIVMGGGAGLS  127

Query  449  IHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACG  628
            + G FR+ TE +VFAMPETA+G F DVG+SYFLSRLPGFFGEYLGLTG+++ GAEM+ CG
Sbjct  128  LQGTFRIVTENTVFAMPETAIGHFTDVGSSYFLSRLPGFFGEYLGLTGAKIRGAEMVECG  187

Query  629  LATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSR  808
            LATHF+ ++ +  LE AL  +  +D   IS IIS+F   P +K+   ++ L+II++CFSR
Sbjct  188  LATHFMLAKDVRLLETALDEVTYTDTKTISEIISKFMHKPNVKQHGAFSRLEIINKCFSR  247

Query  809  RTIEEIMVALESEAANYKDDWISSAIQSLKKA  904
             T+EEI+ +LESEA    + WI  AI  +K A
Sbjct  248  TTVEEILSSLESEAETKSEKWILDAINWMKSA  279



>gb|KDP34950.1| hypothetical protein JCGZ_09238 [Jatropha curcas]
Length=363

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/242 (56%), Positives = 182/242 (75%), Gaps = 2/242 (1%)
 Frame = +2

Query  188  VSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTM  367
            +S++L  F A E D  +K ++LK +G+AFCAGGDV + +  I  G+W  GA ++ K+F +
Sbjct  14   ISQMLTKFRAFETDPTIKFVILKGNGKAFCAGGDVVSSLTAIIAGHWSYGARFYEKQFNL  73

Query  368  NYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFL  547
            +Y++A Y KP + +++GIV GGGAG ++HGRFR+ TE +VFAMPE  +GLFPD+GAS FL
Sbjct  74   DYLLATYKKPLIPLIDGIVMGGGAGLTMHGRFRIVTENAVFAMPEVHIGLFPDLGASQFL  133

Query  548  SRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAII  727
            SRLPG+FGEYLGLTG+R+DGAEM ACGLATHFV S+ LL LE AL    S + T I  +I
Sbjct  134  SRLPGYFGEYLGLTGARVDGAEMFACGLATHFVSSKDLLNLENALEIQTSLEMTKIYKVI  193

Query  728  SEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEA--ANYKDDWISSAIQSLKK  901
             +F+Q PK+KE SPYN L+IID+CFS+ T+EEI++ALE+E    N  ++WI  AI S+K 
Sbjct  194  EKFAQNPKIKEDSPYNRLEIIDKCFSKDTVEEILLALENEVKLKNKAENWIIKAINSMKS  253

Query  902  AS  907
            AS
Sbjct  254  AS  255



>ref|XP_010040328.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Eucalyptus grandis]
Length=354

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 195/268 (73%), Gaps = 1/268 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            VL EE    R  ILNR  +LN L+  MVS++       E D  V L++LK +G+AFCAGG
Sbjct  19   VLFEEYSGARKVILNRPSKLNTLTLEMVSQMSNKLQIYEGDHTVNLVILKGNGKAFCAGG  78

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV   +  +  G+W  GA +++KE T++++IA Y KP + +++G+V GGGAG S+HG FR
Sbjct  79   DVIGNMCSVLTGHWSYGASFYKKELTLDHLIATYKKPLICLIDGVVMGGGAGISMHGSFR  138

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            V TEK+V AMPE ++GLFPDVGASYFLS+LPG+FGEYLGLTG+R+DGA MLACGLATHFV
Sbjct  139  VVTEKTVLAMPEASIGLFPDVGASYFLSQLPGYFGEYLGLTGARIDGATMLACGLATHFV  198

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
             S+ L PLE AL ++ SS+ + I ++IS+++    LKE+  +  LK I++CFSR+T+E+I
Sbjct  199  FSKDLPPLEHALSSVESSNASEILSVISKYTHKSNLKEEEFHKRLKSINKCFSRQTVEDI  258

Query  827  MVALESE-AANYKDDWISSAIQSLKKAS  907
            + +LE +   N+ + WI+ A++++K AS
Sbjct  259  LHSLEEKLLDNFTEKWIADAVKNMKSAS  286



>ref|XP_010659006.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X3 
[Vitis vinifera]
Length=347

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 182/244 (75%), Gaps = 3/244 (1%)
 Frame = +2

Query  185  MVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFT  364
            M+S++L      EKD  VKL++LK  G+ FCAGGDV  +V  I +G+W  GA +++K+ T
Sbjct  1    MISQILRNLEVYEKDPIVKLLILKGQGKTFCAGGDVVGMVLSINEGHWSFGASFYKKQLT  60

Query  365  MNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYF  544
            ++Y++A  +KP VS++NGI+ GGGAG S++  FRV TE +VFAMPE  +GLFPDVGASYF
Sbjct  61   LDYLLATSTKPLVSLINGIIMGGGAGLSMNSMFRVVTENTVFAMPEGQIGLFPDVGASYF  120

Query  545  LSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAI  724
            LSRLPG+FGEYLGLTG+RLDG EMLACGLATHFV S+ LL LE AL  + SSD + IS +
Sbjct  121  LSRLPGYFGEYLGLTGARLDGKEMLACGLATHFVLSKDLLLLENALSEVASSDASTISRV  180

Query  725  ISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI---MVALESEAANYKDDWISSAIQSL  895
            IS FS    LK++S Y  L+ I++CFSRRT+EEI   +V +E+EAAN  + WI  AI S+
Sbjct  181  ISGFSSKISLKKESAYRRLETINKCFSRRTVEEILSMLVTMENEAANGDNKWIIQAISSM  240

Query  896  KKAS  907
            K AS
Sbjct  241  KSAS  244



>ref|XP_010040327.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Eucalyptus grandis]
Length=392

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 195/268 (73%), Gaps = 1/268 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            VL EE    R  ILNR  +LN L+  MVS++       E D  V L++LK +G+AFCAGG
Sbjct  19   VLFEEYSGARKVILNRPSKLNTLTLEMVSQMSNKLQIYEGDHTVNLVILKGNGKAFCAGG  78

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV   +  +  G+W  GA +++KE T++++IA Y KP + +++G+V GGGAG S+HG FR
Sbjct  79   DVIGNMCSVLTGHWSYGASFYKKELTLDHLIATYKKPLICLIDGVVMGGGAGISMHGSFR  138

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            V TEK+V AMPE ++GLFPDVGASYFLS+LPG+FGEYLGLTG+R+DGA MLACGLATHFV
Sbjct  139  VVTEKTVLAMPEASIGLFPDVGASYFLSQLPGYFGEYLGLTGARIDGATMLACGLATHFV  198

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
             S+ L PLE AL ++ SS+ + I ++IS+++    LKE+  +  LK I++CFSR+T+E+I
Sbjct  199  FSKDLPPLEHALSSVESSNASEILSVISKYTHKSNLKEEEFHKRLKSINKCFSRQTVEDI  258

Query  827  MVALESE-AANYKDDWISSAIQSLKKAS  907
            + +LE +   N+ + WI+ A++++K AS
Sbjct  259  LHSLEEKLLDNFTEKWIADAVKNMKSAS  286



>ref|XP_006382191.1| hypothetical protein POPTR_0006s29210g [Populus trichocarpa]
 gb|ERP59988.1| hypothetical protein POPTR_0006s29210g [Populus trichocarpa]
Length=390

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/280 (50%), Positives = 192/280 (69%), Gaps = 0/280 (0%)
 Frame = +2

Query  68   SMASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            +M   S + D DQVL +    V+  ILNR ++LN ++  M+S + +     E D  VK++
Sbjct  8    AMIRHSFDKDVDQVLFQGNSYVKKIILNRPQKLNCINHHMISEMTKKLKVYEIDPEVKVV  67

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            VLK +G+AFCAGGDV A    +  G+W  GA  ++K+  ++Y +A Y KP V++++GIV 
Sbjct  68   VLKGNGKAFCAGGDVVASYIYMVAGHWSYGANTYKKKLILDYAVATYGKPVVALIDGIVM  127

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            G GAG S+HG F++ TE +VFAMPETA+G F DVGAS+FLSRLPGF GEYLGLTG+ + G
Sbjct  128  GAGAGLSMHGAFKIVTENTVFAMPETAIGHFVDVGASHFLSRLPGFLGEYLGLTGTTIRG  187

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
              M+ACGLATHFV S+ L  +E AL  + SSD   IS IIS+F   P +K+   Y+ L+I
Sbjct  188  EGMVACGLATHFVLSKDLHLVESALDEVTSSDTNKISKIISKFEHKPNVKQDDVYSRLEI  247

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I++CFSR+T+EEI+ +LE EA N  D W+  AI+S+K  S
Sbjct  248  INKCFSRKTVEEILSSLEIEAGNRADKWVLEAIKSMKAGS  287



>ref|XP_006371855.1| hypothetical protein POPTR_0018s04360g, partial [Populus trichocarpa]
 gb|ERP49652.1| hypothetical protein POPTR_0018s04360g, partial [Populus trichocarpa]
Length=332

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 188/266 (71%), Gaps = 0/266 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            VL E   CV+  ILNR  +LN+L+  M  ++++   A E D  VK+++LK +G+AFCAGG
Sbjct  22   VLFEGNSCVKKVILNRPHKLNSLTYHMTCQMIKELKAYEVDPKVKIVILKGNGKAFCAGG  81

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV A    +  G+W  G  +++K+  ++Y++A Y KP V+I++GIV GGGAG S+ G FR
Sbjct  82   DVLASYTCMVAGHWSYGTNFYKKQIMLDYLVATYGKPVVAIIDGIVMGGGAGLSLQGTFR  141

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            + TE +VFAMPETA+G F DVG+SYFLSRLPGFFGEYLGLTG+++ GAEM+ CGLATHF+
Sbjct  142  IVTENTVFAMPETAIGHFTDVGSSYFLSRLPGFFGEYLGLTGAKIRGAEMVECGLATHFM  201

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
             ++ +  LE AL  + S+D   IS IIS+F   P +K+   ++ L+II++CFSR T+EEI
Sbjct  202  LAKDVRLLETALVEVTSTDTKTISEIISKFMHKPNVKQHGAFSRLEIINKCFSRTTVEEI  261

Query  827  MVALESEAANYKDDWISSAIQSLKKA  904
            + +LESEA    + WI  AI  +K A
Sbjct  262  LSSLESEAGTESEKWILDAINWMKSA  287



>gb|EEE51449.1| hypothetical protein OsJ_32549 [Oryza sativa Japonica Group]
Length=330

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/272 (54%), Positives = 177/272 (65%), Gaps = 51/272 (19%)
 Frame = +2

Query  92   SDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRA  271
            +D+DQVLVE  G  RT ++NR KQLNALSSAM                         GRA
Sbjct  7    TDSDQVLVEANGVTRTLLMNRPKQLNALSSAM-----------------------GKGRA  43

Query  272  FCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASI  451
            FCAGGDV+AVV  I   +WK  A +FR EF +NY+IA Y+KPQVS+L GIV GGGAG SI
Sbjct  44   FCAGGDVAAVVRSINNDSWKYSAHFFRNEFLLNYIIATYNKPQVSLLTGIVMGGGAGVSI  103

Query  452  HGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGL  631
            HGRFRV TE +VFAMPETALGLFPD+GASYFLSRLPGF+                     
Sbjct  104  HGRFRVVTESTVFAMPETALGLFPDIGASYFLSRLPGFY---------------------  142

Query  632  ATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRR  811
                    RL  LEE+L  +++SDP  I  II ++SQ P LKEKS  N L+II++CFS+R
Sbjct  143  -------VRLALLEESLKKVDTSDPFAICGIIDQYSQQPSLKEKSALNRLEIINKCFSKR  195

Query  812  TIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            T+EEI+ +LE EA N  D+W++SAIQSL+KAS
Sbjct  196  TVEEIIASLEQEAPNVADEWVASAIQSLRKAS  227



>ref|XP_004308320.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Fragaria 
vesca subsp. vesca]
Length=397

 Score =   286 bits (732),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 154/292 (53%), Positives = 198/292 (68%), Gaps = 13/292 (4%)
 Frame = +2

Query  71   MASLSSNSDTD-QVLVEETGC-VRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKL  244
            MAS +SN   D +VLV+E    VRT  LNR +++N LS  M+SRL EL LA + D+ VKL
Sbjct  1    MASYNSNHRPDPEVLVQENNSSVRTLTLNRPQRMNVLSLEMLSRLSELLLAYDHDTKVKL  60

Query  245  IVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIV  424
            ++LK +G+AF  GGD++ + H +R G+W+   +     F + ++I  YSKPQ+S+LNGI 
Sbjct  61   VMLKGNGKAFSTGGDIAVMAHHLRNGDWRSVVKESEVLFKLIFLIETYSKPQLSVLNGIA  120

Query  425  FGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLD  604
             G   G  +  RFR+  E + F MPETA+G FPD GASYFL RLPGFFGEYL LTG+RLD
Sbjct  121  MGRATGIYLASRFRIVPENATFCMPETAMGGFPDTGASYFLPRLPGFFGEYLALTGARLD  180

Query  605  GAEMLACGLATHFVPSERLLPLEEAL--------HNINSSDPTI-ISAIISEFSQV-PKL  754
            G EMLACGLATHFVP+ +L  LEEAL           + +D  I ISAII+E+  V P L
Sbjct  181  GPEMLACGLATHFVPATKLALLEEALVCKVALTKDGTSITDLEISISAIINEYLVVQPAL  240

Query  755  KEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDD-WISSAIQSLKKAS  907
            K  S  + + +I+ CFSRR++EEI+ ALE EA   +DD WISS IQSLKKAS
Sbjct  241  KRGSALHKMDVIENCFSRRSVEEILSALEKEATYLEDDAWISSTIQSLKKAS  292



>gb|KCW83008.1| hypothetical protein EUGRSUZ_C04390 [Eucalyptus grandis]
Length=311

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 192/272 (71%), Gaps = 2/272 (1%)
 Frame = +2

Query  98   TDQ-VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            T+Q VL EE   VR  ILNR  +LN+L+  M+S++       + D  V  ++LK +G+AF
Sbjct  15   TEQPVLFEEHSGVRKVILNRPSKLNSLNLEMISQMFSKLKIYKDDPTVNAVILKGNGKAF  74

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV   +  +  G+W  GA +++K+ T++++IA Y KP V + NG+V GGGAG S+H
Sbjct  75   CAGGDVFQSICSMLTGHWSFGASFYKKQLTLDHLIATYKKPLVCLTNGVVMGGGAGLSMH  134

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
              FRV TEK+VFAMPE  LG FPDVGAS+FLS+LPG+FGEYLGLTG+RLDG  MLACGLA
Sbjct  135  ASFRVVTEKTVFAMPEAILGYFPDVGASHFLSKLPGYFGEYLGLTGARLDGETMLACGLA  194

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFV S+ L  LE AL +++SS+ + I ++I+ ++    +KE+ P+  LK I+RCFSR+T
Sbjct  195  THFVFSKDLPLLEHALSSVDSSNASDILSVINNYACKSNMKEEEPHKRLKSINRCFSRQT  254

Query  815  IEEIMVALESEAANYK-DDWISSAIQSLKKAS  907
            +E I+ +LE E  N   + WI+ A+ S+K AS
Sbjct  255  VEGILHSLEEELLNNSAEKWIAEAVNSMKSAS  286



>ref|XP_010040325.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Eucalyptus 
grandis]
Length=392

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 195/268 (73%), Gaps = 1/268 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            VL EE    R  ILNR  +LN L+  MVS++       E D  V L++LK +G+AFCAGG
Sbjct  19   VLFEEYSGTRKVILNRPSKLNTLTLEMVSQMSNKLQIYEGDHTVNLVILKGNGKAFCAGG  78

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV   +  +  G+W  GA +++K+ T++++IA Y KP + +++G+V GGGAG S+HG FR
Sbjct  79   DVIGNMCSMLTGHWSYGASFYKKQLTLDHLIATYKKPLICLIDGVVMGGGAGISMHGSFR  138

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            V TEK+VFAMPE ++GLFPD GASYFLS+LPG+FGEYLGLTG+R+DGA MLACGLATHFV
Sbjct  139  VVTEKTVFAMPEASIGLFPDAGASYFLSKLPGYFGEYLGLTGARMDGATMLACGLATHFV  198

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
             S+ L PLE AL ++ SS+ + I ++IS+++    +KE+  +  LK I++CFSR+T+++I
Sbjct  199  FSKDLPPLEHALSSVESSNASEILSVISKYTHKSNVKEEEFHKRLKSINKCFSRQTVDDI  258

Query  827  MVALESE-AANYKDDWISSAIQSLKKAS  907
            + +LE +   N+ + W++ A++++K AS
Sbjct  259  LHSLEEKLLDNFTEKWMADAVKNMKSAS  286



>ref|XP_001754416.1| predicted protein [Physcomitrella patens]
 gb|EDQ80866.1| predicted protein [Physcomitrella patens]
Length=392

 Score =   283 bits (725),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/270 (52%), Positives = 194/270 (72%), Gaps = 0/270 (0%)
 Frame = +2

Query  98   TDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFC  277
            T++VLVEE+   +  ILNR ++LN+L+  M+ RLLEL++  EKD  V+++++  +GR FC
Sbjct  20   TEEVLVEESFAAKAAILNRPRKLNSLNENMIDRLLELYMKWEKDERVRMVIIAGAGRGFC  79

Query  278  AGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHG  457
            AGGDV+ V    + G+   G  +F KEF +NY++  Y K  V++L+G+V GGG G S+HG
Sbjct  80   AGGDVAVVYLLGKSGDKDRGNTFFGKEFRLNYILGTYEKTHVALLDGVVMGGGNGVSMHG  139

Query  458  RFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLAT  637
            +FR+ATE + FAMPETA+GL PD+GASYFLSRLPG  GEYLGLTG+RLDGA++L+CGL T
Sbjct  140  KFRIATENTKFAMPETAIGLHPDIGASYFLSRLPGHLGEYLGLTGTRLDGADLLSCGLVT  199

Query  638  HFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTI  817
            HFVPS+RL  L + L N+NS DP ++S+ I EF  V    +KSP +    IDRCF   T+
Sbjct  200  HFVPSKRLDDLVDRLGNLNSGDPDVVSSAIDEFCDVVCPGDKSPLHRRDAIDRCFGHDTV  259

Query  818  EEIMVALESEAANYKDDWISSAIQSLKKAS  907
            EEI+ ALE +A   +D+W ++ +  LKK S
Sbjct  260  EEIVQALEIQAGRSEDEWYTNTLALLKKMS  289



>ref|XP_011008675.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X1 
[Populus euphratica]
Length=384

 Score =   283 bits (724),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 136/271 (50%), Positives = 189/271 (70%), Gaps = 0/271 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            D +QVL E    V+  ILNR ++LN ++  M+S + +   A E D  VK++VLK +G+AF
Sbjct  11   DVNQVLFEGNSYVKKIILNRPQKLNCINHHMISEMTKKLKAYEIDPEVKVVVLKGNGKAF  70

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV A    +  G+W  G   ++K   + +V+A Y KP V++++GIV G GAG S++
Sbjct  71   CAGGDVVASYISMVAGHWSHGGHTYKKNLILYFVVATYGKPVVALIDGIVMGAGAGLSMN  130

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            G F++ TE +VFAMPET +G F DVGAS+FLSRLPGFFGEYLGL G+R+ G +M+ACGLA
Sbjct  131  GAFKIVTENTVFAMPETIIGHFVDVGASHFLSRLPGFFGEYLGLPGTRIRGEDMVACGLA  190

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFV S+ L  +E AL  + SSD   IS IIS+F   P +K+   ++ L+II++CFSR+T
Sbjct  191  THFVLSKDLHLVESALDEVTSSDTNKISEIISKFEHKPNVKQDGVFSRLEIINKCFSRKT  250

Query  815  IEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +EEI+ +LE EA N  D W+  AI+S+K AS
Sbjct  251  VEEILSSLEIEAGNRADKWVLEAIKSMKAAS  281



>ref|XP_007221107.1| hypothetical protein PRUPE_ppa017859mg [Prunus persica]
 gb|EMJ22306.1| hypothetical protein PRUPE_ppa017859mg [Prunus persica]
Length=473

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 164/281 (58%), Positives = 198/281 (70%), Gaps = 24/281 (9%)
 Frame = +2

Query  101  DQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCA  280
            DQVL++ET  VR   LNR +QLNALS  M+SRL +LFLA E D+N KLI+LK  GRAFCA
Sbjct  8    DQVLIQETLFVRILTLNRPRQLNALSLEMLSRLSQLFLAYEDDANAKLIILKGKGRAFCA  67

Query  281  GGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGR  460
            GG            N K G +   K  T+ Y++A  SKPQVSILNGIV GGG G S++G+
Sbjct  68   GG------------NLKFGEKLGEKLLTLTYLVATCSKPQVSILNGIVMGGGVGISVNGK  115

Query  461  FRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATH  640
            FRVATE S FAMPE +LGLFPDVG+SYFLSRLPGFFGEYLGLTG+RLDGAEMLACGLATH
Sbjct  116  FRVATENSNFAMPENSLGLFPDVGSSYFLSRLPGFFGEYLGLTGARLDGAEMLACGLATH  175

Query  641  FVPSERLLPLEEALHNINSSDP------TIISAIISEFS-QVPKLKEKSPYNHLKIIDRC  799
             VPS +L  LE+AL +  +S          ISAII E+S Q P L EKS  + + +ID+C
Sbjct  176  LVPSAKLSLLEKALISRAASATSSSCGLAFISAIIDEYSLQQPALNEKSALHKMDVIDKC  235

Query  800  FSRRTIEEIMVALESE-----AANYKDDWISSAIQSLKKAS  907
            FSR T+E+I+ ALE E     A    D+W++S ++SL KAS
Sbjct  236  FSRPTVEDILSALEKEITTTDANKAGDEWLASTVRSLNKAS  276


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 7/96 (7%)
 Frame = +2

Query  590  GSRLDGAEMLACGLATHFVPSERLLPLEEAL------HNINSSDPTIISAIISEF-SQVP  748
            G RLDGAEMLACGLAT+FVPS +L  LE+AL         +S D   ISAII E+  Q P
Sbjct  370  GPRLDGAEMLACGLATNFVPSAKLPLLEKALISRAASATSSSRDLASISAIIDEYLLQQP  429

Query  749  KLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAAN  856
             L EKS ++ + +I +CFSR T+E+I+ ALE EA  
Sbjct  430  ALNEKSAFHKMDVIAKCFSRPTVEQILSALEMEATT  465



>ref|XP_011091891.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 isoform 
X2 [Sesamum indicum]
Length=372

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 193/280 (69%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MAS-LSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS LS + D  QVL EE   +R  ILNR +QLN+L+  M+S++       E D  +KLI
Sbjct  1    MASPLSFDRDLSQVLFEENQGLRKVILNRPQQLNSLTLEMISQMKRALEEYEVDDTIKLI  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            +LK  G+AFCAGGDV   V  + +G+W L A +++K+  ++Y+IA Y+KP V ++NG+V 
Sbjct  61   ILKGQGKAFCAGGDVVRFVQLVSEGHWSLAARFYQKQLLLDYLIATYNKPLVVLMNGVVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG S++  FRV TE +VFAMPE ++G FPDVGASYFLSRL G FGEYLGLTG+++ G
Sbjct  121  GGGAGLSMNASFRVVTENTVFAMPEASIGHFPDVGASYFLSRLSGHFGEYLGLTGAKISG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            +EML CGLATHFV S+ +  LE  L      D + I + + +F     L++ S +  L I
Sbjct  181  SEMLKCGLATHFVFSKDIKSLEAELSKTAHDDVSTIPSTLEKFIHKSNLEQDSAWTRLDI  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I++CFS++++E+I+ +LE+E     D W+++AI S+K+AS
Sbjct  241  INKCFSKKSVEDILTSLETEVVRCGDKWMANAINSMKRAS  280



>ref|XP_011091890.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 isoform 
X1 [Sesamum indicum]
Length=383

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 193/280 (69%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MAS-LSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MAS LS + D  QVL EE   +R  ILNR +QLN+L+  M+S++       E D  +KLI
Sbjct  1    MASPLSFDRDLSQVLFEENQGLRKVILNRPQQLNSLTLEMISQMKRALEEYEVDDTIKLI  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            +LK  G+AFCAGGDV   V  + +G+W L A +++K+  ++Y+IA Y+KP V ++NG+V 
Sbjct  61   ILKGQGKAFCAGGDVVRFVQLVSEGHWSLAARFYQKQLLLDYLIATYNKPLVVLMNGVVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG S++  FRV TE +VFAMPE ++G FPDVGASYFLSRL G FGEYLGLTG+++ G
Sbjct  121  GGGAGLSMNASFRVVTENTVFAMPEASIGHFPDVGASYFLSRLSGHFGEYLGLTGAKISG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            +EML CGLATHFV S+ +  LE  L      D + I + + +F     L++ S +  L I
Sbjct  181  SEMLKCGLATHFVFSKDIKSLEAELSKTAHDDVSTIPSTLEKFIHKSNLEQDSAWTRLDI  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I++CFS++++E+I+ +LE+E     D W+++AI S+K+AS
Sbjct  241  INKCFSKKSVEDILTSLETEVVRCGDKWMANAINSMKRAS  280



>ref|XP_011091888.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 isoform 
X1 [Sesamum indicum]
Length=382

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/280 (49%), Positives = 190/280 (68%), Gaps = 1/280 (0%)
 Frame = +2

Query  71   MASL-SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MASL S + D +QVL E    +R  +LNR +Q+N+L+  MVS +       E D  +KL+
Sbjct  1    MASLLSFDRDLNQVLFEGKHWLRKVVLNRPEQMNSLTHEMVSEMKRALEDYEVDDTIKLV  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            +L   G+AFCAGGDV   +  +  G+W L A ++RK+  ++Y+IA Y KP V ++NG V 
Sbjct  61   MLTGQGKAFCAGGDVVRSIQLVSIGHWSLTAMFYRKQLLLDYLIATYKKPLVIVMNGAVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG S++  FRV TE +VFAMPE ++GL+PDVGASYFLSRLP  FGEYLGLTGSR+ G
Sbjct  121  GGGAGLSMNASFRVVTENTVFAMPEASIGLYPDVGASYFLSRLPAHFGEYLGLTGSRISG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEML CGLATHFV S+ L  +E+ L      D + I++ + +F+  P LKE S    L I
Sbjct  181  AEMLECGLATHFVFSKDLKSMEDELGEAVYKDVSTIASTLEKFAHKPNLKEDSALTRLDI  240

Query  788  IDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            I++C S++T+E+I+ +LE+E  + KD W+  AI S+K AS
Sbjct  241  INKCLSKKTVEDILSSLETEVESCKDKWMVKAINSIKYAS  280



>ref|XP_010050121.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Eucalyptus 
grandis]
 gb|KCW83007.1| hypothetical protein EUGRSUZ_C04390 [Eucalyptus grandis]
Length=391

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 192/272 (71%), Gaps = 2/272 (1%)
 Frame = +2

Query  98   TDQ-VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            T+Q VL EE   VR  ILNR  +LN+L+  M+S++       + D  V  ++LK +G+AF
Sbjct  15   TEQPVLFEEHSGVRKVILNRPSKLNSLNLEMISQMFSKLKIYKDDPTVNAVILKGNGKAF  74

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV   +  +  G+W  GA +++K+ T++++IA Y KP V + NG+V GGGAG S+H
Sbjct  75   CAGGDVFQSICSMLTGHWSFGASFYKKQLTLDHLIATYKKPLVCLTNGVVMGGGAGLSMH  134

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
              FRV TEK+VFAMPE  LG FPDVGAS+FLS+LPG+FGEYLGLTG+RLDG  MLACGLA
Sbjct  135  ASFRVVTEKTVFAMPEAILGYFPDVGASHFLSKLPGYFGEYLGLTGARLDGETMLACGLA  194

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFV S+ L  LE AL +++SS+ + I ++I+ ++    +KE+ P+  LK I+RCFSR+T
Sbjct  195  THFVFSKDLPLLEHALSSVDSSNASDILSVINNYACKSNMKEEEPHKRLKSINRCFSRQT  254

Query  815  IEEIMVALESEAANYK-DDWISSAIQSLKKAS  907
            +E I+ +LE E  N   + WI+ A+ S+K AS
Sbjct  255  VEGILHSLEEELLNNSAEKWIAEAVNSMKSAS  286



>ref|XP_008354071.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Malus domestica]
Length=265

 Score =   277 bits (708),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 181/258 (70%), Gaps = 19/258 (7%)
 Frame = +2

Query  101  DQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCA  280
            +QVLV+E+  VRT  LNR +QLN LS  M+SRL +LFLA +  SNVKLI+LKS+GRAFCA
Sbjct  5    NQVLVQESLFVRTLTLNRPRQLNTLSLEMLSRLSQLFLAYDNSSNVKLIILKSNGRAFCA  64

Query  281  GGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQ---------VSILNGIVFGG  433
            GGDV+AV     +GN K GA   +K  T+ Y +A  +KPQ         VSILNGI  GG
Sbjct  65   GGDVAAVHRHFLKGNLKFGAITSQKMLTLTYFVATCTKPQECLNFAQCFVSILNGIAMGG  124

Query  434  GAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAE  613
            G G SIH +FRVAT+ SVFAMPETALGLFPDVGASY LSRLPGFFGEYLGLTG+RL+GAE
Sbjct  125  GVGISIHXKFRVATDNSVFAMPETALGLFPDVGASYXLSRLPGFFGEYLGLTGARLNGAE  184

Query  614  MLACGLATHFVPSERLLPLEEALH-NINSSD------PTIISAIISEFS-QVPKLKEKSP  769
            MLACGLATH+VPS +L  LEEAL   + SS        + ISAII E+S + P L EKS 
Sbjct  185  MLACGLATHYVPSAKLSSLEEALKCRVASSTSSSCDLASTISAIIDEYSLKKPALSEKSA  244

Query  770  YNHLK--IIDRCFSRRTI  817
            Y      +I  CF   TI
Sbjct  245  YYKRDKLMILWCFQXLTI  262



>ref|XP_003636506.1| 70 kDa peptidyl-prolyl isomerase [Medicago truncatula]
Length=750

 Score =   289 bits (739),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            D DQVLVE     R   LNR KQLNALS  MVS+LLE+F   E + +VKLIVLK +GRAF
Sbjct  8    DKDQVLVERKSSARVLTLNRPKQLNALSFYMVSKLLEIFHDDEGNPDVKLIVLKGNGRAF  67

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV+AV +D R G+W+ GA +F  E+ MNY++A YSKPQVSILNGIV GGGAGAS+H
Sbjct  68   CAGGDVAAVANDARGGDWRFGAIFFDTEYKMNYLMATYSKPQVSILNGIVMGGGAGASMH  127

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            GRFRV TEK+VFAMPETALGLFPDVGASY+LSRL GFFGEY+GLTG+RLDGAEMLACGLA
Sbjct  128  GRFRVVTEKTVFAMPETALGLFPDVGASYYLSRLAGFFGEYVGLTGARLDGAEMLACGLA  187

Query  635  THFVPS  652
            THFVPS
Sbjct  188  THFVPS  193



>emb|CBI29144.3| unnamed protein product [Vitis vinifera]
Length=263

 Score =   274 bits (701),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 171/229 (75%), Gaps = 0/229 (0%)
 Frame = +2

Query  86   SNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSG  265
            S+ + +QVL EE+ CVR  ILNR  +LN+L+  M+S++L      EKD  VKL++LK  G
Sbjct  33   SHPEPNQVLFEESSCVRKVILNRPHKLNSLTYEMISQILRNLEVYEKDPIVKLLILKGQG  92

Query  266  RAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGA  445
            + FCAGGDV  +V  I +G+W  GA +++K+ T++Y++A  +KP VS++NGI+ GGGAG 
Sbjct  93   KTFCAGGDVVGMVLSINEGHWSFGASFYKKQLTLDYLLATSTKPLVSLINGIIMGGGAGL  152

Query  446  SIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLAC  625
            S++  FRV TE +VFAMPE  +GLFPDVGASYFLSRLPG+FGEYLGLTG+RLDG EMLAC
Sbjct  153  SMNSMFRVVTENTVFAMPEGQIGLFPDVGASYFLSRLPGYFGEYLGLTGARLDGKEMLAC  212

Query  626  GLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPY  772
            GLATHFV S+ LL LE AL  + SSD + IS +IS FS    LK++S Y
Sbjct  213  GLATHFVLSKDLLLLENALSEVASSDASTISRVISGFSSKISLKKESAY  261



>emb|CDY45442.1| BnaA05g12590D [Brassica napus]
Length=331

 Score =   276 bits (707),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 161/199 (81%), Gaps = 3/199 (2%)
 Frame = +2

Query  320  GNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMP  499
            G W+LGA++   ++T+NYV+A YSK Q+SI+NGIV GGGAG SIHGRFR+ATEK+VFAMP
Sbjct  18   GKWRLGADFLSDQYTLNYVMATYSKIQISIMNGIVMGGGAGVSIHGRFRIATEKTVFAMP  77

Query  500  ETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEA  679
            ET LGLFPDVGASYFLSRLPGFFGEY+GLTG+RLDGAEMLACGLATHFVPS RL  LE  
Sbjct  78   ETELGLFPDVGASYFLSRLPGFFGEYVGLTGARLDGAEMLACGLATHFVPSTRLTALEAD  137

Query  680  LHNINSSDP-TIISAIISEFSQVPKLKEKSPYNH--LKIIDRCFSRRTIEEIMVALESEA  850
            L  + S+DP T  S I++ ++Q P LK+ S Y+   L + D+CFSRRT+EEI+ ALE EA
Sbjct  138  LCRVVSNDPDTFSSKILNAYTQHPHLKQHSAYHRHVLDVTDKCFSRRTVEEIISALEREA  197

Query  851  ANYKDDWISSAIQSLKKAS  907
                D+WIS+ +++LKKAS
Sbjct  198  IQEPDEWISATLRALKKAS  216



>ref|XP_004308616.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Fragaria 
vesca subsp. vesca]
Length=404

 Score =   278 bits (712),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 202/286 (71%), Gaps = 18/286 (6%)
 Frame = +2

Query  104  QVLVEE-TGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCA  280
            QVL+++    VRT ILNR + LNALS  M+S+LL+LFLA E D+ VKL++LK +G+AF  
Sbjct  16   QVLIQDFNSYVRTLILNRPRYLNALSGEMLSQLLQLFLADEHDAKVKLVILKGNGKAFSV  75

Query  281  GGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGR  460
            GGD++ V   +  G+W+LG +   +   + Y+IA YSKPQ+SI NG+  G GA   +  R
Sbjct  76   GGDIAEVARLLDSGDWRLGLKATAEVSKLIYLIATYSKPQLSIANGMAMGRGAALYVSSR  135

Query  461  FRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATH  640
            FR+ATE S+F+MPETALG  P+ GASYFLSRLP FFGEYL LTG++LDG+EMLACG+ATH
Sbjct  136  FRMATENSIFSMPETALGAVPETGASYFLSRLPRFFGEYLALTGAQLDGSEMLACGIATH  195

Query  641  FVPSERLLPLEEALHN-----INSSDPTI--ISAIISEFSQVPKLKEK-SPYNHLKIIDR  796
            FVP+ +L+ LE+ L        +S D  +  +S+IIS +S  P LKE+ S ++++ +I++
Sbjct  196  FVPAAKLVLLEQELLASTGALTSSCDDLVSYVSSIISNYSIQPALKERGSAWHNMDVIEK  255

Query  797  CFSRRTIEEIMVALESEAANYKDD---------WISSAIQSLKKAS  907
            CFS+ T++E++ ALE EA +  DD         W++S I+SLKKAS
Sbjct  256  CFSKSTVQEVVSALEKEATDDIDDGHVNGGNNPWLTSTIESLKKAS  301



>ref|XP_010051658.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Eucalyptus 
grandis]
Length=410

 Score =   278 bits (712),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 136/270 (50%), Positives = 190/270 (70%), Gaps = 1/270 (0%)
 Frame = +2

Query  101  DQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCA  280
            + VL +E   VR  ILNR  +LN L+  MVS++       E D  V L++L  +GR+FCA
Sbjct  36   EPVLFDEHSGVRKVILNRPSKLNTLTFEMVSQMFRKLQMYEDDHTVNLVILMGNGRSFCA  95

Query  281  GGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGR  460
            GGDV   V  +  G+W  GA Y++K   ++++IA Y KP V ++NGIV G GAG S+HG 
Sbjct  96   GGDVVGTVRFMLTGHWSFGASYYKKLLNLDHLIATYKKPLVCLINGIVMGSGAGISMHGS  155

Query  461  FRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATH  640
            FRV TEK+VFAMPE  LGLFPD+GAS+FLS+LPG+FGEYLGLTG++LDGA MLACGLATH
Sbjct  156  FRVVTEKTVFAMPEATLGLFPDMGASHFLSKLPGYFGEYLGLTGAQLDGAMMLACGLATH  215

Query  641  FVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIE  820
            FV S+ L  LE AL +++ S+ + IS +I++F+Q    K +  +  LK I++CFSR+T+E
Sbjct  216  FVFSKDLPLLEHALSSVDPSNASEISFVINKFAQKSNTKGEELHKRLKSINKCFSRQTVE  275

Query  821  EIMVALESE-AANYKDDWISSAIQSLKKAS  907
            +I+ ++E E   N  ++WI+ A++ +K AS
Sbjct  276  DILHSIEKELLDNLAENWIAVAVKGMKSAS  305



>ref|XP_010050119.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Eucalyptus 
grandis]
Length=393

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 197/287 (69%), Gaps = 7/287 (2%)
 Frame = +2

Query  68   SMASLSSN-----SDTDQ-VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKD  229
            +M SLSS        T+Q VL EE   VR  ILNR  +LN+L+  M+S++       E D
Sbjct  2    NMQSLSSTELFRRDLTEQPVLFEEHSGVRKVILNRPSKLNSLNLEMISQMFSKLKIYEDD  61

Query  230  SNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSI  409
              V  ++LK +G+AFCAGGDV   +  +  G+W  GA +++K+ T++++IA Y KP V +
Sbjct  62   PTVNAVILKGNGKAFCAGGDVFQNICSMLTGHWSFGASFYKKQLTLDHLIATYKKPLVCL  121

Query  410  LNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLT  589
            +NG+V GGGAG S+H  FRV TEK+VFAMPE  LG+FPDVGAS+FLS+LPG+FGEYLGLT
Sbjct  122  INGVVMGGGAGLSMHASFRVVTEKTVFAMPEAILGIFPDVGASHFLSKLPGYFGEYLGLT  181

Query  590  GSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSP  769
            G+RLDG  MLACGLATHFV S+ L  LE A  +++S + + I ++I+ ++    +KE+  
Sbjct  182  GARLDGETMLACGLATHFVFSKDLPLLEHAFSSVDSLNASDILSVINNYACKSNMKEEEL  241

Query  770  YNHLKIIDRCFSRRTIEEIMVALESE-AANYKDDWISSAIQSLKKAS  907
            +  LK I+RCFSR+T+E I+ +LE E   N  + WI+ A+ S+K AS
Sbjct  242  HKRLKSINRCFSRQTVEGILHSLEEELLNNLAEKWITDAVNSMKSAS  288



>gb|KCW45303.1| hypothetical protein EUGRSUZ_L01029 [Eucalyptus grandis]
Length=310

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 181/250 (72%), Gaps = 0/250 (0%)
 Frame = +2

Query  89   NSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGR  268
            +S    VL EE    R  ILNR  +LN L+  MVS++       E D  V L++LK +G+
Sbjct  13   DSMEQPVLFEEYSGARKVILNRPSKLNTLTLEMVSQMSNKLQIYEGDHTVNLVILKGNGK  72

Query  269  AFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGAS  448
            AFCAGGDV   +  +  G+W  GA +++KE T++++IA Y KP + +++G+V GGGAG S
Sbjct  73   AFCAGGDVIGNMCSVLTGHWSYGASFYKKELTLDHLIATYKKPLICLIDGVVMGGGAGIS  132

Query  449  IHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACG  628
            +HG FRV TEK+V AMPE ++GLFPDVGASYFLS+LPG+FGEYLGLTG+R+DGA MLACG
Sbjct  133  MHGSFRVVTEKTVLAMPEASIGLFPDVGASYFLSQLPGYFGEYLGLTGARIDGATMLACG  192

Query  629  LATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSR  808
            LATHFV S+ L PLE AL ++ SS+ + I ++IS+++    LKE+  +  LK I++CFSR
Sbjct  193  LATHFVFSKDLPPLEHALSSVESSNASEILSVISKYTHKSNLKEEEFHKRLKSINKCFSR  252

Query  809  RTIEEIMVAL  838
            +T+E+I+ +L
Sbjct  253  QTVEDILHSL  262



>gb|KCW45305.1| hypothetical protein EUGRSUZ_L01034 [Eucalyptus grandis]
Length=284

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/244 (52%), Positives = 179/244 (73%), Gaps = 0/244 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            VL EE    R  ILNR  +LN L+  MVS++       E D  V L++LK +G+AFCAGG
Sbjct  19   VLFEEYSGTRKVILNRPSKLNTLTLEMVSQMSNKLQIYEGDHTVNLVILKGNGKAFCAGG  78

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV   +  +  G+W  GA +++K+ T++++IA Y KP + +++G+V GGGAG S+HG FR
Sbjct  79   DVIGNMCSMLTGHWSYGASFYKKQLTLDHLIATYKKPLICLIDGVVMGGGAGISMHGSFR  138

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            V TEK+VFAMPE ++GLFPD GASYFLS+LPG+FGEYLGLTG+R+DGA MLACGLATHFV
Sbjct  139  VVTEKTVFAMPEASIGLFPDAGASYFLSKLPGYFGEYLGLTGARMDGATMLACGLATHFV  198

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
             S+ L PLE AL ++ SS+ + I ++IS+++    +KE+  +  LK I++CFSR+T+++I
Sbjct  199  FSKDLPPLEHALSSVESSNASEILSVISKYTHKSNVKEEEFHKRLKSINKCFSRQTVDDI  258

Query  827  MVAL  838
            + +L
Sbjct  259  LHSL  262



>ref|XP_007052212.1| ATP-dependent caseinolytic protease/crotonase family protein 
isoform 2 [Theobroma cacao]
 gb|EOX96369.1| ATP-dependent caseinolytic protease/crotonase family protein 
isoform 2 [Theobroma cacao]
Length=388

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 193/286 (67%), Gaps = 4/286 (1%)
 Frame = +2

Query  62   NRSMASLSSNSDTD----QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKD  229
             RS++SL  NS  D    +VLVE     R  ILNR   LNALS+ + + L +L+ + E D
Sbjct  20   KRSLSSLPINSSADDLQHEVLVEGRASSRIAILNRPSSLNALSTNIGAGLHKLYASWEDD  79

Query  230  SNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSI  409
              +  +VLK SGRAFCAGGD+ ++ H I +G  +   E+FR  ++  Y++  Y KP V+I
Sbjct  80   PEIGFVVLKGSGRAFCAGGDIVSLYHLINEGKIEEAKEFFRTVYSFIYLVGTYLKPHVAI  139

Query  410  LNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLT  589
            L+GI  GGGAG SI G FR+AT ++VFA PET +G  PD GAS++L RLPG  GEYLGLT
Sbjct  140  LDGITMGGGAGVSIPGTFRLATGRTVFATPETQIGFHPDAGASFYLPRLPGHLGEYLGLT  199

Query  590  GSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSP  769
            G +L GAEM++CGLATH+  +E+L  +++ L  + + DP++I + + ++S VP  ++ S 
Sbjct  200  GEKLSGAEMISCGLATHYSHTEKLPLIDDELGKLVTDDPSVIESSLEKYSDVPYPEKISA  259

Query  770  YNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
             + ++++D+CF+  T+EEIM ALESEA+   D W +S ++ LK+AS
Sbjct  260  LHRIEVLDKCFAHDTVEEIMDALESEASATNDAWCNSTLRKLKEAS  305



>ref|XP_006354674.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like [Solanum 
tuberosum]
Length=281

 Score =   267 bits (682),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = +2

Query  386  YSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGF  565
            +S+ +VSIL+GIV GGG G S HGRFRVATEK+V AMPE ALG+FPDVGASYF SRLPGF
Sbjct  5    FSRAEVSILHGIVMGGGLGVSAHGRFRVATEKTVCAMPEAALGVFPDVGASYFYSRLPGF  64

Query  566  FGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQV  745
            FGEY GLTG+RLDGA+MLACGLATHFVPSERL  LE+ L  IN+SDP +ISAIIS FS +
Sbjct  65   FGEYAGLTGARLDGADMLACGLATHFVPSERLPFLEQELVKINTSDPDVISAIISHFSNI  124

Query  746  PKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            PKLK +SPYN ++IID CFSRRT+EEI+ +L +EA N KDDWISS IQS+KKAS
Sbjct  125  PKLKAESPYNKMRIIDCCFSRRTVEEIISSLGNEALNNKDDWISSTIQSMKKAS  178



>gb|KCW83005.1| hypothetical protein EUGRSUZ_C04388 [Eucalyptus grandis]
Length=405

 Score =   271 bits (692),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 137/284 (48%), Positives = 192/284 (68%), Gaps = 14/284 (5%)
 Frame = +2

Query  98   TDQ-VLVEETGCVRTFILNRQKQLNALS------------SAMVSRLLELFLACEKDSNV  238
            T+Q VL EE   VR  ILNR  +LN+L+            SA +S++       E D  V
Sbjct  17   TEQPVLFEEHSGVRKVILNRPSKLNSLNLEMVHYSSASPLSAQISQMFSKLKIYEDDPTV  76

Query  239  KLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNG  418
              ++LK +G+AFCAGGDV   +  +  G+W  GA +++K+ T++++IA Y KP V ++NG
Sbjct  77   NAVILKGNGKAFCAGGDVFQNICSMLTGHWSFGASFYKKQLTLDHLIATYKKPLVCLING  136

Query  419  IVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSR  598
            +V GGGAG S+H  FRV TEK+VFAMPE  LG+FPDVGAS+FLS+LPG+FGEYLGLTG+R
Sbjct  137  VVMGGGAGLSMHASFRVVTEKTVFAMPEAILGIFPDVGASHFLSKLPGYFGEYLGLTGAR  196

Query  599  LDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH  778
            LDG  MLACGLATHFV S+ L  LE A  +++S + + I ++I+ ++    +KE+  +  
Sbjct  197  LDGETMLACGLATHFVFSKDLPLLEHAFSSVDSLNASDILSVINNYACKSNMKEEELHKR  256

Query  779  LKIIDRCFSRRTIEEIMVALESE-AANYKDDWISSAIQSLKKAS  907
            LK I+RCFSR+T+E I+ +LE E   N  + WI+ A+ S+K AS
Sbjct  257  LKSINRCFSRQTVEGILHSLEEELLNNLAEKWITDAVNSMKSAS  300



>emb|CDP02987.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   271 bits (693),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 138/270 (51%), Positives = 182/270 (67%), Gaps = 3/270 (1%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            VL E+       ILNR KQLN L+  M  ++L+     E+D N +L++LK +GRAFCAGG
Sbjct  29   VLFEDKKGELKVILNRPKQLNCLTYEMFCQMLKKLGDYEEDPNARLVILKGNGRAFCAGG  88

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            DV +V+  +  G+W  GA ++RK+  ++Y I  Y KP VSI++GIV GGGAG S++  FR
Sbjct  89   DVKSVLSFMTTGHWSFGASFYRKQLNLDYKIGTYKKPVVSIIDGIVMGGGAGLSLNSTFR  148

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            + TE +VFAMPE A+GLFPD  AS+FLSRLPGF GEYLGLTGSRLDGAEM+  GLATHFV
Sbjct  149  IVTENTVFAMPEAAIGLFPDCSASHFLSRLPGFLGEYLGLTGSRLDGAEMVKYGLATHFV  208

Query  647  PSERLLPLEEALHNINSS---DPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTI  817
             S+ L  +E AL ++ +S   D + IS  I +F   P LK+ S Y  L  I+ CFS+ T 
Sbjct  209  LSKDLASMENALDSLAASGSVDLSSISKTIHKFVHGPHLKKDSVYKRLDAINECFSKDTA  268

Query  818  EEIMVALESEAANYKDDWISSAIQSLKKAS  907
            EEI+ +LE  AA  ++ WI  AI+S+   S
Sbjct  269  EEILSSLEELAAKNEEKWIVHAIKSMTSVS  298



>ref|XP_007052211.1| ATP-dependent caseinolytic (Clp) protease/crotonase family protein 
isoform 1 [Theobroma cacao]
 gb|EOX96368.1| ATP-dependent caseinolytic (Clp) protease/crotonase family protein 
isoform 1 [Theobroma cacao]
Length=402

 Score =   270 bits (691),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 193/286 (67%), Gaps = 4/286 (1%)
 Frame = +2

Query  62   NRSMASLSSNSDTD----QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKD  229
             RS++SL  NS  D    +VLVE     R  ILNR   LNALS+ + + L +L+ + E D
Sbjct  20   KRSLSSLPINSSADDLQHEVLVEGRASSRIAILNRPSSLNALSTNIGAGLHKLYASWEDD  79

Query  230  SNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSI  409
              +  +VLK SGRAFCAGGD+ ++ H I +G  +   E+FR  ++  Y++  Y KP V+I
Sbjct  80   PEIGFVVLKGSGRAFCAGGDIVSLYHLINEGKIEEAKEFFRTVYSFIYLVGTYLKPHVAI  139

Query  410  LNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLT  589
            L+GI  GGGAG SI G FR+AT ++VFA PET +G  PD GAS++L RLPG  GEYLGLT
Sbjct  140  LDGITMGGGAGVSIPGTFRLATGRTVFATPETQIGFHPDAGASFYLPRLPGHLGEYLGLT  199

Query  590  GSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSP  769
            G +L GAEM++CGLATH+  +E+L  +++ L  + + DP++I + + ++S VP  ++ S 
Sbjct  200  GEKLSGAEMISCGLATHYSHTEKLPLIDDELGKLVTDDPSVIESSLEKYSDVPYPEKISA  259

Query  770  YNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
             + ++++D+CF+  T+EEIM ALESEA+   D W +S ++ LK+AS
Sbjct  260  LHRIEVLDKCFAHDTVEEIMDALESEASATNDAWCNSTLRKLKEAS  305



>ref|XP_008670925.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X5 
[Zea mays]
Length=255

 Score =   265 bits (678),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = +2

Query  74   ASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVL  253
            A  +   +++Q+LVE  G  RT ILNR KQLNALS AM+ RLL  F A  KD  VKL+++
Sbjct  3    AGGAVGGNSEQLLVEAHGNTRTLILNRPKQLNALSYAMIKRLLRCFTAYVKDDGVKLLII  62

Query  254  KSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGG  433
            K SGRAFCAGGDV A V  I    WK G ++FR ++ +NY+IA   KPQ+S+L GIV GG
Sbjct  63   KGSGRAFCAGGDVVACVQSINNDGWKWGDDFFRDQYFLNYIIATCIKPQISLLTGIVMGG  122

Query  434  GAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAE  613
            GAG S+HGRFRVAT+ +VFAMPET LG FPDVGASYFLSRLPGF+GEY+ LTG+RLDGAE
Sbjct  123  GAGVSLHGRFRVATDNTVFAMPETFLGHFPDVGASYFLSRLPGFYGEYVALTGARLDGAE  182

Query  614  MLACGLATHFVPSE  655
            MLACGLATHFVPS 
Sbjct  183  MLACGLATHFVPSN  196



>ref|XP_008670923.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 isoform 
X3 [Zea mays]
Length=322

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            +++Q+LVE  G  RT ILNR KQLNALS AM+ RLL  F A  KD  VKL+++K SGRAF
Sbjct  10   NSEQLLVEAHGNTRTLILNRPKQLNALSYAMIKRLLRCFTAYVKDDGVKLLIIKGSGRAF  69

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV A V  I    WK G ++FR ++ +NY+IA   KPQ+S+L GIV GGGAG S+H
Sbjct  70   CAGGDVVACVQSINNDGWKWGDDFFRDQYFLNYIIATCIKPQISLLTGIVMGGGAGVSLH  129

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            GRFRVAT+ +VFAMPET LG FPDVGASYFLSRLPGF+GEY+ LTG+RLDGAEMLACGLA
Sbjct  130  GRFRVATDNTVFAMPETFLGHFPDVGASYFLSRLPGFYGEYVALTGARLDGAEMLACGLA  189

Query  635  THFVPS  652
            THFVPS
Sbjct  190  THFVPS  195



>ref|XP_006346689.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3-like 
isoform X1 [Solanum tuberosum]
Length=383

 Score =   268 bits (685),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/277 (47%), Positives = 188/277 (68%), Gaps = 7/277 (3%)
 Frame = +2

Query  98   TDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFC  277
             +++L E T CV+   LNR  QLN L+  M+  LL  F   E+D  V+ +++K  G+ FC
Sbjct  6    NNEILFEATSCVQKVTLNRPTQLNCLTFEMIGELLRTFEEYEEDPQVRAVIVKGKGKVFC  65

Query  278  AGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHG  457
            AGGDV  V+  + QG+     E+++ + T++Y++A Y KP V ++NG V GGGAG S++ 
Sbjct  66   AGGDVVRVIQFMLQGDLYCVKEFYKNQLTLDYLVATYKKPVVFLINGAVMGGGAGLSMNA  125

Query  458  RFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLAT  637
            +FR+ TE +VFAMPE + G +PDVGASYFLSRLPG FGEYLGLTG++++G+EM+A GLAT
Sbjct  126  KFRIVTENTVFAMPEASFGHYPDVGASYFLSRLPGHFGEYLGLTGAKINGSEMIASGLAT  185

Query  638  HFVPSERLLPLEEAL---HNINSSDPTI----ISAIISEFSQVPKLKEKSPYNHLKIIDR  796
            HFV S+ +  +E AL    ++N+S  ++    +S II EF + P LKE S +  L +I+ 
Sbjct  186  HFVYSKDIESMENALCQALSLNTSSKSVHESDVSRIIKEFVRNPVLKEGSIFKRLDVING  245

Query  797  CFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            CF + T+EEI+ ALE E     D WI++AI+S+K AS
Sbjct  246  CFGKDTVEEILFALEKENTAMNDKWITNAIKSMKLAS  282



>gb|KCW73142.1| hypothetical protein EUGRSUZ_E01595 [Eucalyptus grandis]
Length=345

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 184/268 (69%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVE +G  RT ILNR   LNA S+AM ++L +L+   E D ++  +++K SGRAFCAG
Sbjct  55   QVLVEGSGSSRTAILNRPSVLNAFSTAMGAKLQKLYKNWEDDPDIGFVMMKGSGRAFCAG  114

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GD+ ++ H I +G  +   ++FR  ++  Y +  Y KP V++LNGI  GGGAG SI G F
Sbjct  115  GDIVSLYHLINRGKIEDCKDFFRTIYSFIYFVGTYLKPHVALLNGITMGGGAGVSIPGTF  174

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            RVAT+K+VFA PET +G  PD GAS++LS LPG  GEYLGLTG +L GAEM+ACGLATH+
Sbjct  175  RVATDKTVFATPETLIGFHPDAGASFYLSHLPGHLGEYLGLTGEKLTGAEMIACGLATHY  234

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
                +L  +EE L  + + DP++I +++ ++  +    + S  + ++++D+CF   T+EE
Sbjct  235  TLDAKLPLIEEQLGKLVTDDPSVIESMLEKYGDLVCPDKMSVVHKIELVDKCFGHETVEE  294

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALES+ A  KD W +SA++ LK+AS
Sbjct  295  IIDALESQTAGLKDSWCNSALRRLKEAS  322



>gb|AFW56432.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_518323 [Zea 
mays]
Length=203

 Score =   259 bits (663),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 153/193 (79%), Gaps = 1/193 (1%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            ++ +D+DQ+LVE  G  RT ILNR KQLNALSS M+  LL  F A EKD  V+L+++K +
Sbjct  9    AAAADSDQLLVEAHGSTRTLILNRPKQLNALSSEMIKGLLWYFTAFEKDDGVRLLIMKGN  68

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
             R FC+GGD++     +  GNWK   ++F+ E+ +NY+IA Y KPQVSIL+GIV GGGAG
Sbjct  69   RRVFCSGGDIAQCARCLYNGNWKWVDDFFQNEYLLNYIIATYIKPQVSILSGIVMGGGAG  128

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
             SIHGRFRVAT+ ++FAMPETALGLFPDVGASYFLSRLPGF+GEY+GLTG+RLDGAEMLA
Sbjct  129  VSIHGRFRVATDNTIFAMPETALGLFPDVGASYFLSRLPGFYGEYVGLTGARLDGAEMLA  188

Query  623  CGLATHFVPSERL  661
            CGLAT F P + +
Sbjct  189  CGLAT-FCPVKEV  200



>gb|KCW73141.1| hypothetical protein EUGRSUZ_E01595 [Eucalyptus grandis]
Length=378

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 184/268 (69%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVE +G  RT ILNR   LNA S+AM ++L +L+   E D ++  +++K SGRAFCAG
Sbjct  55   QVLVEGSGSSRTAILNRPSVLNAFSTAMGAKLQKLYKNWEDDPDIGFVMMKGSGRAFCAG  114

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GD+ ++ H I +G  +   ++FR  ++  Y +  Y KP V++LNGI  GGGAG SI G F
Sbjct  115  GDIVSLYHLINRGKIEDCKDFFRTIYSFIYFVGTYLKPHVALLNGITMGGGAGVSIPGTF  174

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            RVAT+K+VFA PET +G  PD GAS++LS LPG  GEYLGLTG +L GAEM+ACGLATH+
Sbjct  175  RVATDKTVFATPETLIGFHPDAGASFYLSHLPGHLGEYLGLTGEKLTGAEMIACGLATHY  234

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
                +L  +EE L  + + DP++I +++ ++  +    + S  + ++++D+CF   T+EE
Sbjct  235  TLDAKLPLIEEQLGKLVTDDPSVIESMLEKYGDLVCPDKMSVVHKIELVDKCFGHETVEE  294

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALES+ A  KD W +SA++ LK+AS
Sbjct  295  IIDALESQTAGLKDSWCNSALRRLKEAS  322



>ref|XP_010070260.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Eucalyptus 
grandis]
Length=391

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 191/272 (70%), Gaps = 1/272 (0%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            D   VL EE+   R  +LNR  +LN+++  M S+++      E D    L++LK +G+AF
Sbjct  15   DEPPVLFEESLGARKVVLNRPSRLNSITFEMASQMIRKLRIYEDDHTANLVILKGNGQAF  74

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            C+GGD+ + +  +  G+W  GA  ++K  T+ Y+IA+Y KP V +++GIV G GAG S++
Sbjct  75   CSGGDLISNMCFMLTGHWSFGAIAYKKLLTLTYLIASYKKPLVCLIDGIVMGSGAGISMY  134

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            G FRV T+ +VFAMPE ++GLFPDVGAS+FLS+LPG+FGEY+GLTG+RL+GA MLACGLA
Sbjct  135  GSFRVVTDNTVFAMPEASIGLFPDVGASHFLSKLPGYFGEYVGLTGARLNGATMLACGLA  194

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFV S+ L  LE AL +++SS+ + I ++I +F+Q    KE+  +  LK I++CFSR+T
Sbjct  195  THFVFSKDLPSLEHALSSVDSSNASEILSVIDKFAQKTNTKEEDFHKRLKSINKCFSRQT  254

Query  815  IEEIMVALESE-AANYKDDWISSAIQSLKKAS  907
            +E I+ +LE E   N  + WI+ A+ ++K AS
Sbjct  255  VEGILHSLEKELEDNLTEKWIADAVNNMKSAS  286



>ref|XP_010264357.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, 
mitochondrial isoform X2 [Nelumbo nucifera]
Length=392

 Score =   265 bits (678),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 129/282 (46%), Positives = 191/282 (68%), Gaps = 0/282 (0%)
 Frame = +2

Query  62   NRSMASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVK  241
            ++S A + ++S  +QVLVE     RT ILNR   LNAL+++M +RL +L+ + E++S++ 
Sbjct  27   SQSSAVVDNDSTENQVLVEGKASSRTAILNRPSALNALNTSMGARLKKLYESWEENSDIG  86

Query  242  LIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGI  421
             +V+K SGRAF AGGD++ +   I +G      E+F   ++  Y++  Y KP V+ILNGI
Sbjct  87   FVVMKGSGRAFSAGGDIATLYRLINEGKMAECKEFFGTLYSFIYLLGTYLKPHVAILNGI  146

Query  422  VFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRL  601
              GGGAG SI G FRVAT+K+VFA PET +G  PD GAS++LS LPG+ GEYL LTG R 
Sbjct  147  TMGGGAGVSIPGTFRVATDKTVFATPETQIGFHPDAGASFYLSHLPGYLGEYLALTGERF  206

Query  602  DGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHL  781
            +G EM+ACGLATH+  S RL  LEE L  + + DP++I A + ++  +    ++S  + +
Sbjct  207  NGPEMIACGLATHYSLSARLPLLEERLGTLVTDDPSVIEASLEQYGDLAYPDKRSVIHSI  266

Query  782  KIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            + +D+CF+  T+EEI+ ALE+EA    D+W +S ++ LK+AS
Sbjct  267  ETVDKCFAHDTVEEIIGALENEATRSYDEWCTSTLRKLKEAS  308



>ref|XP_011008669.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Populus 
euphratica]
Length=344

 Score =   263 bits (673),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 126/241 (52%), Positives = 172/241 (71%), Gaps = 0/241 (0%)
 Frame = +2

Query  185  MVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFT  364
            M+S + +   A E D  VK++VLK +G+AFCAGGDV A    +  G+W  GA  ++K+  
Sbjct  1    MISEMTKKLKAYEIDPEVKVVVLKGNGKAFCAGGDVVASYISMVAGHWSHGAHTYKKKLI  60

Query  365  MNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYF  544
            + +V+A Y KP V++++GIV G GAG S++G F++ TE +VFAMPET +G F DVGASYF
Sbjct  61   LYFVVATYGKPVVALIDGIVMGAGAGLSMNGAFKIVTENTVFAMPETVIGHFVDVGASYF  120

Query  545  LSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAI  724
            LSRLPGF GEYLGL G+R+ G +M+ACGLATHFV S+ L  +E AL  + SSD   IS I
Sbjct  121  LSRLPGFLGEYLGLPGTRIRGEDMVACGLATHFVLSKDLHLVESALDEVTSSDTNKISKI  180

Query  725  ISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKA  904
            IS+F   P +K+   Y+ L+II++CFSR+T+EEI+ +LE EA N  D W+  AI+S+K A
Sbjct  181  ISKFEHKPNVKQDGVYSRLEIINKCFSRKTVEEILSSLEIEAGNRADKWVLEAIKSMKAA  240

Query  905  S  907
            S
Sbjct  241  S  241



>ref|XP_010056417.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, 
mitochondrial [Eucalyptus grandis]
 gb|KCW73140.1| hypothetical protein EUGRSUZ_E01595 [Eucalyptus grandis]
Length=419

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 184/268 (69%), Gaps = 0/268 (0%)
 Frame = +2

Query  104  QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAG  283
            QVLVE +G  RT ILNR   LNA S+AM ++L +L+   E D ++  +++K SGRAFCAG
Sbjct  55   QVLVEGSGSSRTAILNRPSVLNAFSTAMGAKLQKLYKNWEDDPDIGFVMMKGSGRAFCAG  114

Query  284  GDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRF  463
            GD+ ++ H I +G  +   ++FR  ++  Y +  Y KP V++LNGI  GGGAG SI G F
Sbjct  115  GDIVSLYHLINRGKIEDCKDFFRTIYSFIYFVGTYLKPHVALLNGITMGGGAGVSIPGTF  174

Query  464  RVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHF  643
            RVAT+K+VFA PET +G  PD GAS++LS LPG  GEYLGLTG +L GAEM+ACGLATH+
Sbjct  175  RVATDKTVFATPETLIGFHPDAGASFYLSHLPGHLGEYLGLTGEKLTGAEMIACGLATHY  234

Query  644  VPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEE  823
                +L  +EE L  + + DP++I +++ ++  +    + S  + ++++D+CF   T+EE
Sbjct  235  TLDAKLPLIEEQLGKLVTDDPSVIESMLEKYGDLVCPDKMSVVHKIELVDKCFGHETVEE  294

Query  824  IMVALESEAANYKDDWISSAIQSLKKAS  907
            I+ ALES+ A  KD W +SA++ LK+AS
Sbjct  295  IIDALESQTAGLKDSWCNSALRRLKEAS  322



>ref|XP_011008676.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase 1-like isoform X2 
[Populus euphratica]
Length=377

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/271 (48%), Positives = 183/271 (68%), Gaps = 7/271 (3%)
 Frame = +2

Query  95   DTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAF  274
            D +QVL E    V+  ILNR ++LN ++  M+S + +   A E D  VK++VLK +G+AF
Sbjct  11   DVNQVLFEGNSYVKKIILNRPQKLNCINHHMISEMTKKLKAYEIDPEVKVVVLKGNGKAF  70

Query  275  CAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIH  454
            CAGGDV A    +  G+W  G   ++K   + +V+A Y KP V++++GIV G GAG S++
Sbjct  71   CAGGDVVASYISMVAGHWSHGGHTYKKNLILYFVVATYGKPVVALIDGIVMGAGAGLSMN  130

Query  455  GRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLA  634
            G F++ TE +VFAMPET +G F DVGAS+FLSRLPGFF       G+R+ G +M+ACGLA
Sbjct  131  GAFKIVTENTVFAMPETIIGHFVDVGASHFLSRLPGFF-------GTRIRGEDMVACGLA  183

Query  635  THFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRT  814
            THFV S+ L  +E AL  + SSD   IS IIS+F   P +K+   ++ L+II++CFSR+T
Sbjct  184  THFVLSKDLHLVESALDEVTSSDTNKISEIISKFEHKPNVKQDGVFSRLEIINKCFSRKT  243

Query  815  IEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            +EEI+ +LE EA N  D W+  AI+S+K AS
Sbjct  244  VEEILSSLEIEAGNRADKWVLEAIKSMKAAS  274



>emb|CBI29135.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/241 (53%), Positives = 172/241 (71%), Gaps = 1/241 (0%)
 Frame = +2

Query  185  MVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFT  364
            +++++L      E D  VKL++LK  G+ FC+GGDV A+V  I  G+W  G  ++RK+ T
Sbjct  8    LITQILRKLEVYENDPTVKLLILKGQGKVFCSGGDVVAMVLSIYGGHWSFGESFYRKQIT  67

Query  365  MNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYF  544
            ++Y+ A   K  VS++NGIV GGG G S++ RFRV TE +VFAMPE  +G FPDVG SYF
Sbjct  68   LDYLFATSEKTLVSLINGIVMGGGVGLSMNSRFRVVTENTVFAMPEAQMGHFPDVGVSYF  127

Query  545  LSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAI  724
            LSRLPGFFGEYLGLTG++L+G EMLACGLATHFV S+ LL LE AL    +SD + I  +
Sbjct  128  LSRLPGFFGEYLGLTGAQLNGTEMLACGLATHFVLSKDLLLLETALSE-AASDTSTIPKV  186

Query  725  ISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKA  904
            I+ F++   LK+ S +  L+II++CFS +T+EEI++ L++E AN  D WI  AI S+K A
Sbjct  187  INRFARKTFLKQDSAFMRLEIINKCFSAKTVEEILLLLQNEVANGSDAWIIEAISSMKSA  246

Query  905  S  907
            S
Sbjct  247  S  247



>ref|XP_010264353.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, 
mitochondrial isoform X1 [Nelumbo nucifera]
 ref|XP_010264354.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, 
mitochondrial isoform X1 [Nelumbo nucifera]
 ref|XP_010264355.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, 
mitochondrial isoform X1 [Nelumbo nucifera]
 ref|XP_010264356.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, 
mitochondrial isoform X1 [Nelumbo nucifera]
Length=405

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/282 (46%), Positives = 191/282 (68%), Gaps = 0/282 (0%)
 Frame = +2

Query  62   NRSMASLSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVK  241
            ++S A + ++S  +QVLVE     RT ILNR   LNAL+++M +RL +L+ + E++S++ 
Sbjct  27   SQSSAVVDNDSTENQVLVEGKASSRTAILNRPSALNALNTSMGARLKKLYESWEENSDIG  86

Query  242  LIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGI  421
             +V+K SGRAF AGGD++ +   I +G      E+F   ++  Y++  Y KP V+ILNGI
Sbjct  87   FVVMKGSGRAFSAGGDIATLYRLINEGKMAECKEFFGTLYSFIYLLGTYLKPHVAILNGI  146

Query  422  VFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRL  601
              GGGAG SI G FRVAT+K+VFA PET +G  PD GAS++LS LPG+ GEYL LTG R 
Sbjct  147  TMGGGAGVSIPGTFRVATDKTVFATPETQIGFHPDAGASFYLSHLPGYLGEYLALTGERF  206

Query  602  DGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHL  781
            +G EM+ACGLATH+  S RL  LEE L  + + DP++I A + ++  +    ++S  + +
Sbjct  207  NGPEMIACGLATHYSLSARLPLLEERLGTLVTDDPSVIEASLEQYGDLAYPDKRSVIHSI  266

Query  782  KIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            + +D+CF+  T+EEI+ ALE+EA    D+W +S ++ LK+AS
Sbjct  267  ETVDKCFAHDTVEEIIGALENEATRSYDEWCTSTLRKLKEAS  308



>ref|XP_010321273.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 [Solanum 
lycopersicum]
Length=383

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/277 (47%), Positives = 185/277 (67%), Gaps = 7/277 (3%)
 Frame = +2

Query  98   TDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFC  277
            T+++L E T CV+   LNR  +LN L+  M+  LL  F   EKD  V+ +++K  G+AFC
Sbjct  6    TNEILFEATSCVQKVTLNRPTKLNCLTFEMIGELLRTFEEYEKDPQVRAVIVKGKGKAFC  65

Query  278  AGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHG  457
            AGGDV  V+  +  G+     E+++ + T++ ++A Y KP V ++NG V GGGAG S++ 
Sbjct  66   AGGDVVRVIQFMLHGDLYCVKEFYKNQLTLDNLVATYKKPVVFLINGAVMGGGAGLSMNA  125

Query  458  RFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLAT  637
            +FR+ TE +VFAMPE + G +PDVGASYFLSRLPG FGEYLGLTG +++G+EM+A GLAT
Sbjct  126  KFRIVTENTVFAMPEASFGHYPDVGASYFLSRLPGHFGEYLGLTGKKINGSEMIASGLAT  185

Query  638  HFVPSERLLPLEEALHNI---NSSDPTI----ISAIISEFSQVPKLKEKSPYNHLKIIDR  796
            HFV S+ +  +E  L  +   N+S  ++    I  II+EF + P LKE S    L  I+R
Sbjct  186  HFVYSKDIESMENELCQVLSQNASSKSVHESDILRIINEFVRNPLLKEGSILKRLDAINR  245

Query  797  CFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            CF + T+EEI+ ALE EA    D W+S+AI+S+K AS
Sbjct  246  CFGKDTVEEILFALEKEAITIDDKWMSNAIKSMKLAS  282



>ref|XP_011093291.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, 
mitochondrial [Sesamum indicum]
Length=406

 Score =   263 bits (673),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 130/285 (46%), Positives = 192/285 (67%), Gaps = 4/285 (1%)
 Frame = +2

Query  65   RSMASLSSN---SDTDQVL-VEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDS  232
            R + SLS+N    D+D ++ VE TG  RT IL+R   LNA++  MVS+L  L+   E D 
Sbjct  26   RRLISLSANPLVDDSDNIVDVEGTGSSRTAILSRPSSLNAINIPMVSQLQMLYKNWEDDP  85

Query  233  NVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSIL  412
            ++  ++LK  GRAFCAGGD+ ++ + +++GN +   + FRK +++ Y I  Y KP V+IL
Sbjct  86   DIGFVILKGRGRAFCAGGDIVSLYNLMKEGNLEECKQLFRKAYSLMYFIGTYLKPHVAIL  145

Query  413  NGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTG  592
            NGI  GGGAG SI G FRVAT+K++FA PET +GL PD GAS++LS LPG+ GEYLGLTG
Sbjct  146  NGITMGGGAGISIPGTFRVATDKTIFATPETLIGLHPDAGASFYLSHLPGYLGEYLGLTG  205

Query  593  SRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPY  772
             +L+GAEM++CGLAT++    +L  +E  L N+ + DP++I   +       +L   S  
Sbjct  206  EKLNGAEMISCGLATNYSLFTKLPLVERQLRNLVTGDPSVIETCLGSLGDPVQLDPTSVV  265

Query  773  NHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            + ++ +++CFSR T+EEI+ +LE+EAA   D W  S ++ LK+A+
Sbjct  266  HRIQTLNKCFSRDTVEEIIESLENEAARTNDAWCVSTVKKLKEAA  310



>ref|XP_006402575.1| hypothetical protein EUTSA_v10006020mg [Eutrema salsugineum]
 gb|ESQ44028.1| hypothetical protein EUTSA_v10006020mg [Eutrema salsugineum]
Length=401

 Score =   263 bits (673),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/283 (46%), Positives = 188/283 (66%), Gaps = 2/283 (1%)
 Frame = +2

Query  65   RSMASLSSNSDT--DQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNV  238
            RS  S+   ++   +QVLVE +GC RT ILNR   LNALS+ M  RL +L+   E+D N+
Sbjct  23   RSFCSVKVTTEDLDNQVLVEGSGCCRTAILNRPPALNALSTHMGVRLQKLYKNWEEDPNI  82

Query  239  KLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNG  418
             L+++K SGRAFCAGGD+ ++ H  ++G+     E+F   +   YV+  Y KP V+ILNG
Sbjct  83   GLVMMKGSGRAFCAGGDIVSLYHLRKRGSPDAIREFFWTLYNFIYVLGTYLKPHVAILNG  142

Query  419  IVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSR  598
            +  GGGAG SI G FRVAT++++FA PET +G  PD GAS+ LS LPG  GEYLGLTG +
Sbjct  143  VTMGGGAGVSIPGTFRVATDRTIFATPETVIGFHPDAGASFNLSHLPGRLGEYLGLTGLK  202

Query  599  LDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNH  778
            L GAEMLACGLATH++ SE +  LEE L  + + DP+++   + + ++V   ++      
Sbjct  203  LSGAEMLACGLATHYISSEEVPVLEEQLKKLLTDDPSVVETCLEKCAEVAHPEKTGVIRR  262

Query  779  LKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            + ++++CF   T+EEI+ +LE+EA   KD W ++ ++ LK+ S
Sbjct  263  IDLLEKCFCHDTVEEIIDSLETEAGRTKDIWCTTTLRRLKETS  305



>ref|XP_011091889.1| PREDICTED: probable 3-hydroxyisobutyryl-CoA hydrolase 3 isoform 
X2 [Sesamum indicum]
Length=349

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 176/261 (67%), Gaps = 1/261 (0%)
 Frame = +2

Query  71   MASL-SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLI  247
            MASL S + D +QVL E    +R  +LNR +Q+N+L+  MVS +       E D  +KL+
Sbjct  1    MASLLSFDRDLNQVLFEGKHWLRKVVLNRPEQMNSLTHEMVSEMKRALEDYEVDDTIKLV  60

Query  248  VLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVF  427
            +L   G+AFCAGGDV   +  +  G+W L A ++RK+  ++Y+IA Y KP V ++NG V 
Sbjct  61   MLTGQGKAFCAGGDVVRSIQLVSIGHWSLTAMFYRKQLLLDYLIATYKKPLVIVMNGAVM  120

Query  428  GGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDG  607
            GGGAG S++  FRV TE +VFAMPE ++GL+PDVGASYFLSRLP  FGEYLGLTGSR+ G
Sbjct  121  GGGAGLSMNASFRVVTENTVFAMPEASIGLYPDVGASYFLSRLPAHFGEYLGLTGSRISG  180

Query  608  AEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKI  787
            AEML CGLATHFV S+ L  +E+ L      D + I++ + +F+  P LKE S    L I
Sbjct  181  AEMLECGLATHFVFSKDLKSMEDELGEAVYKDVSTIASTLEKFAHKPNLKEDSALTRLDI  240

Query  788  IDRCFSRRTIEEIMVALESEA  850
            I++C S++T+E+I+ +L  E 
Sbjct  241  INKCLSKKTVEDILSSLIREG  261



>ref|XP_002511633.1| catalytic, putative [Ricinus communis]
 gb|EEF50302.1| catalytic, putative [Ricinus communis]
Length=415

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 196/296 (66%), Gaps = 6/296 (2%)
 Frame = +2

Query  38   SSFHAE*TNRSMASLSSNSDTD------QVLVEETGCVRTFILNRQKQLNALSSAMVSRL  199
            + F A   N++++S+ +++ TD      QVLVE     RT ILNR   LNAL++ M +RL
Sbjct  20   ARFIAHSHNKNLSSIPNSNSTDDDDLDKQVLVESKAYSRTAILNRPSALNALNTNMGARL  79

Query  200  LELFLACEKDSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVI  379
            L+L+ + E++ +V  +++K SGRAFCAGGD+  + + +++G  +   E+FR  +T  Y++
Sbjct  80   LKLYKSWEENPDVGFVMMKGSGRAFCAGGDIVTLYNLVKKGKLEDCKEFFRTLYTFIYIL  139

Query  380  AAYSKPQVSILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLP  559
              Y KP V+IL+GI  GGGAG SI G FR+AT+K+VFA PET +G  PD GAS+ LS LP
Sbjct  140  GTYLKPHVAILDGITMGGGAGVSIPGTFRIATDKTVFATPETLIGFHPDAGASFHLSHLP  199

Query  560  GFFGEYLGLTGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFS  739
            G  GEYL LTG  L+G EM+ACGLATH+  SERL  +++ L  + + DP++I A + ++ 
Sbjct  200  GHLGEYLALTGETLNGVEMIACGLATHYSYSERLQLIDQQLGQLVTDDPSVIEATLEKYG  259

Query  740  QVPKLKEKSPYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
             +    + S  + ++ +DRCF   T+EEI  ALESEA+   D + +S ++ LK+AS
Sbjct  260  DLVHPDKMSALHRIETVDRCFGYDTVEEIFEALESEASGTNDAFCNSTLRRLKEAS  315



>ref|XP_006576746.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, 
mitochondrial-like isoform X4 [Glycine max]
Length=410

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/287 (44%), Positives = 187/287 (65%), Gaps = 4/287 (1%)
 Frame = +2

Query  59   TNRSMAS----LSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEK  226
            T+R+++S    +  N + +QVLVE  G  R  ILNR   LNAL++ M + L +L+ + E+
Sbjct  24   TDRNLSSSQHLILDNPNLNQVLVEGNGFSRMAILNRPSALNALNTNMAATLHKLYRSWEE  83

Query  227  DSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVS  406
            D ++  ++LK SGRAF AGGD+ A+ H I +GN +   E+FR  ++  Y+I  Y KP V+
Sbjct  84   DPDIGFVMLKGSGRAFAAGGDIVALYHLINKGNLEACKEFFRTAYSFMYLIGTYLKPHVA  143

Query  407  ILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGL  586
            +LNGI  GGGAG SI G FRVAT+K++FA PE  +G  PD  AS++LS LPG  GEYL L
Sbjct  144  LLNGITMGGGAGISIPGTFRVATDKTIFATPEVLIGFHPDAAASFYLSHLPGQLGEYLAL  203

Query  587  TGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKS  766
            TG +L+G EM+ACGLATH+  S RL  +EE L  + + DP++I   + ++ ++  L   S
Sbjct  204  TGEKLNGVEMVACGLATHYSSSARLPLIEEQLGKLVTDDPSVIETTLEQYGEIVHLDSSS  263

Query  767  PYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
                ++++D+CF   T+EEI+ A+E+ A+   D W  S +  LK+AS
Sbjct  264  VLQRIEVLDKCFCHDTVEEIVDAMENAASETNDAWCISTLNKLKEAS  310



>emb|CDP09492.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 180/267 (67%), Gaps = 0/267 (0%)
 Frame = +2

Query  107  VLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSSGRAFCAGG  286
            VLVE  G  RT ILNR   LNAL++++ +RL +L+ + E D ++ ++ LK  GRAFCAGG
Sbjct  46   VLVEGNGASRTAILNRPSVLNALNTSIGARLQKLYSSWEDDPDIGIVQLKGRGRAFCAGG  105

Query  287  DVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAGASIHGRFR  466
            D+ A+ + IRQGN + G E+F   +   Y++  Y KP V++L+GI  GGGAG SI G FR
Sbjct  106  DIVALYNVIRQGNIEQGKEFFWTIYNFIYMLGTYLKPHVALLHGITMGGGAGVSIPGTFR  165

Query  467  VATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLACGLATHFV  646
            VAT+K+VFA PET +G  PD GAS++LS LPG+ GEYL LTG +L+G EML+CGLATH+ 
Sbjct  166  VATDKTVFATPETLIGFHPDAGASFYLSHLPGYLGEYLALTGDKLNGVEMLSCGLATHYS  225

Query  647  PSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCFSRRTIEEI  826
             + +L  +EE L ++ + DP++I   +  F  +      S  + ++ +D+CF   T+EEI
Sbjct  226  LAAKLPLIEEQLGSLTTDDPSVIEGSLQNFGDLVHPDPTSVVHWIETLDKCFGHDTVEEI  285

Query  827  MVALESEAANYKDDWISSAIQSLKKAS  907
            + ALESEA+  KD W +S ++ LK  S
Sbjct  286  IDALESEASRTKDVWSTSTLKKLKDTS  312



>ref|XP_010661350.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, 
mitochondrial isoform X2 [Vitis vinifera]
Length=400

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 185/275 (67%), Gaps = 0/275 (0%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            ++N    +VLVE  GC RT ILNR   LNAL+++M +RL  L+ + E++ ++  +V+K S
Sbjct  34   AANDFDSEVLVEGEGCSRTAILNRPHVLNALNTSMGARLQNLYKSWEENPDIGFVVMKGS  93

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGGD+  + + I +G  +   E+F   ++  Y++  Y KP V+IL+GI  GGGAG
Sbjct  94   GRAFCAGGDIVGLYNLINKGRIEDCKEFFGTVYSFIYLVGTYLKPNVAILDGITMGGGAG  153

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
             SI G FRVAT+++VFA PET +G   D GAS+ LS LPG++GEYL LTG +L+G EM+A
Sbjct  154  VSIPGMFRVATDRTVFATPETLIGFHTDAGASFHLSHLPGYWGEYLALTGEKLNGPEMIA  213

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATH+ PS +L  +EE L  + + DP++I A + ++  +     +     ++ +D+CF
Sbjct  214  CGLATHYAPSAKLPLIEEGLGKLVTDDPSVIEASLEQYGSLISPDNRGLLQRIETLDKCF  273

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            S  T+EEI+ ALESE A  +D W SS ++ LK+AS
Sbjct  274  SHGTVEEIIDALESETARTQDPWCSSTLKRLKEAS  308



>ref|XP_002274299.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, 
mitochondrial isoform X1 [Vitis vinifera]
 emb|CBI16620.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 185/275 (67%), Gaps = 0/275 (0%)
 Frame = +2

Query  83   SSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKDSNVKLIVLKSS  262
            ++N    +VLVE  GC RT ILNR   LNAL+++M +RL  L+ + E++ ++  +V+K S
Sbjct  34   AANDFDSEVLVEGEGCSRTAILNRPHVLNALNTSMGARLQNLYKSWEENPDIGFVVMKGS  93

Query  263  GRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSILNGIVFGGGAG  442
            GRAFCAGGD+  + + I +G  +   E+F   ++  Y++  Y KP V+IL+GI  GGGAG
Sbjct  94   GRAFCAGGDIVGLYNLINKGRIEDCKEFFGTVYSFIYLVGTYLKPNVAILDGITMGGGAG  153

Query  443  ASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLTGSRLDGAEMLA  622
             SI G FRVAT+++VFA PET +G   D GAS+ LS LPG++GEYL LTG +L+G EM+A
Sbjct  154  VSIPGMFRVATDRTVFATPETLIGFHTDAGASFHLSHLPGYWGEYLALTGEKLNGPEMIA  213

Query  623  CGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSPYNHLKIIDRCF  802
            CGLATH+ PS +L  +EE L  + + DP++I A + ++  +     +     ++ +D+CF
Sbjct  214  CGLATHYAPSAKLPLIEEGLGKLVTDDPSVIEASLEQYGSLISPDNRGLLQRIETLDKCF  273

Query  803  SRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
            S  T+EEI+ ALESE A  +D W SS ++ LK+AS
Sbjct  274  SHGTVEEIIDALESETARTQDPWCSSTLKRLKEAS  308



>ref|XP_003521086.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, 
mitochondrial-like isoform X1 [Glycine max]
 gb|KHN01960.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial 
[Glycine soja]
Length=407

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/287 (44%), Positives = 187/287 (65%), Gaps = 4/287 (1%)
 Frame = +2

Query  59   TNRSMAS----LSSNSDTDQVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEK  226
            T+R+++S    +  N + +QVLVE  G  R  ILNR   LNAL++ M + L +L+ + E+
Sbjct  24   TDRNLSSSQHLILDNPNLNQVLVEGNGFSRMAILNRPSALNALNTNMAATLHKLYRSWEE  83

Query  227  DSNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVS  406
            D ++  ++LK SGRAF AGGD+ A+ H I +GN +   E+FR  ++  Y+I  Y KP V+
Sbjct  84   DPDIGFVMLKGSGRAFAAGGDIVALYHLINKGNLEACKEFFRTAYSFMYLIGTYLKPHVA  143

Query  407  ILNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGL  586
            +LNGI  GGGAG SI G FRVAT+K++FA PE  +G  PD  AS++LS LPG  GEYL L
Sbjct  144  LLNGITMGGGAGISIPGTFRVATDKTIFATPEVLIGFHPDAAASFYLSHLPGQLGEYLAL  203

Query  587  TGSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKS  766
            TG +L+G EM+ACGLATH+  S RL  +EE L  + + DP++I   + ++ ++  L   S
Sbjct  204  TGEKLNGVEMVACGLATHYSSSARLPLIEEQLGKLVTDDPSVIETTLEQYGEIVHLDSSS  263

Query  767  PYNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
                ++++D+CF   T+EEI+ A+E+ A+   D W  S +  LK+AS
Sbjct  264  VLQRIEVLDKCFCHDTVEEIVDAMENAASETNDAWCISTLNKLKEAS  310



>ref|XP_010524414.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, 
mitochondrial [Tarenaya hassleriana]
Length=403

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/286 (48%), Positives = 191/286 (67%), Gaps = 4/286 (1%)
 Frame = +2

Query  62   NRSMASLSSNS---DTD-QVLVEETGCVRTFILNRQKQLNALSSAMVSRLLELFLACEKD  229
             RS  SL  NS   D D QVLVE +GC RT ILNR   LNAL++ M  RL +L+   E D
Sbjct  22   ERSFCSLPINSMAEDLDNQVLVEGSGCSRTAILNRPPALNALTTHMGFRLGKLYKNWEDD  81

Query  230  SNVKLIVLKSSGRAFCAGGDVSAVVHDIRQGNWKLGAEYFRKEFTMNYVIAAYSKPQVSI  409
             N+  + +K SGRAFCAGGD+ ++ H I++G      E+FR  +   Y++  Y KP V+I
Sbjct  82   PNIGFVTMKGSGRAFCAGGDIVSLYHLIKEGRRDAMKEFFRALYNFIYLLGTYLKPHVAI  141

Query  410  LNGIVFGGGAGASIHGRFRVATEKSVFAMPETALGLFPDVGASYFLSRLPGFFGEYLGLT  589
            L+GI  GGG G SI G FRVATE+++FA PET +G  PD GAS++LS LPG+ GEYLGLT
Sbjct  142  LDGITMGGGGGVSIPGTFRVATERTIFATPETIIGFHPDAGASFYLSHLPGYLGEYLGLT  201

Query  590  GSRLDGAEMLACGLATHFVPSERLLPLEEALHNINSSDPTIISAIISEFSQVPKLKEKSP  769
            G +L GAEMLACGLATH++ SER+  +EE L  + + DP++I + +   S +   ++ S 
Sbjct  202  GEKLSGAEMLACGLATHYINSERVPVMEEELKKLATDDPSVIESSLERCSGLVYPEKTSV  261

Query  770  YNHLKIIDRCFSRRTIEEIMVALESEAANYKDDWISSAIQSLKKAS  907
             + ++ +++CFS  T+EEI+ +LESE++  K+ W  SA+  LK+ S
Sbjct  262  LHRIESLNKCFSHDTVEEIIDSLESESSRTKEAWCISALSRLKEVS  307



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2205876588188