BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24046_g2_i1 len=242 path=[6732:0-40 4777:41-76 4978:77-241]

Length=242
                                                                      Score     E

dbj|BAD29959.1|  cysteine protease                                    80.5    5e-16   Daucus carota [carrots]
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg              78.2    3e-15   
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg              78.2    3e-15   
emb|CAN62838.1|  hypothetical protein VITISV_003391                   77.4    4e-15   Vitis vinifera
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg           76.6    1e-14   
emb|CBI21972.3|  unnamed protein product                              75.9    1e-14   
ref|XP_007214697.1|  hypothetical protein PRUPE_ppa026948mg           76.3    1e-14   
ref|XP_002280246.1|  PREDICTED: senescence-specific cysteine prot...  76.3    1e-14   Vitis vinifera
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                      76.3    1e-14   
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                      76.3    1e-14   
emb|CBI21973.3|  unnamed protein product                              75.9    2e-14   
ref|XP_002280204.1|  PREDICTED: senescence-specific cysteine prot...  75.9    2e-14   Vitis vinifera
emb|CAN70559.1|  hypothetical protein VITISV_032465                   75.5    2e-14   Vitis vinifera
ref|XP_008244477.1|  PREDICTED: zingipain-2-like                      75.5    2e-14   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...  75.5    3e-14   
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...  75.1    4e-14   
ref|XP_002280263.1|  PREDICTED: senescence-specific cysteine prot...  74.7    6e-14   Vitis vinifera
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                      74.3    6e-14   
ref|XP_007214465.1|  hypothetical protein PRUPE_ppa023848mg           74.3    7e-14   
emb|CBI21976.3|  unnamed protein product                              73.9    8e-14   
ref|XP_002280230.2|  PREDICTED: LOW QUALITY PROTEIN: senescence-s...  73.9    1e-13   Vitis vinifera
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...  73.6    1e-13   
emb|CBI30671.3|  unnamed protein product                              72.8    2e-13   
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg              72.8    2e-13   
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...  72.8    3e-13   Vitis vinifera
ref|XP_008225268.1|  PREDICTED: zingipain-2-like                      72.8    3e-13   
ref|XP_008228971.1|  PREDICTED: zingipain-2-like                      72.4    3e-13   
ref|XP_002280215.1|  PREDICTED: senescence-specific cysteine prot...  72.4    3e-13   Vitis vinifera
ref|XP_009774375.1|  PREDICTED: fruit bromelain-like                  71.2    3e-13   
ref|XP_008225270.1|  PREDICTED: zingipain-2-like                      72.4    4e-13   
ref|XP_003539989.1|  PREDICTED: vignain-like                          72.4    4e-13   
ref|XP_003539970.1|  PREDICTED: vignain-like                          72.4    4e-13   
emb|CDP05747.1|  unnamed protein product                              72.0    6e-13   
ref|XP_007048792.1|  Senescence-associated gene 12                    72.0    6e-13   
emb|CBI21975.3|  unnamed protein product                              70.9    6e-13   
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g           71.2    9e-13   Populus trichocarpa [western balsam poplar]
ref|XP_008225326.1|  PREDICTED: actinidain-like                       70.5    9e-13   
ref|XP_006467666.1|  PREDICTED: vignain-like                          71.2    1e-12   
ref|XP_009359967.1|  PREDICTED: vignain-like                          71.2    1e-12   
ref|XP_008225219.1|  PREDICTED: ervatamin-C-like                      70.9    1e-12   
ref|XP_006362426.1|  PREDICTED: vignain-like                          70.9    1e-12   
ref|XP_006360708.1|  PREDICTED: vignain-like                          70.9    1e-12   
gb|AFV30165.1|  cysteine proteinase                                   70.9    2e-12   
ref|XP_007048796.1|  Senescence-associated gene 12                    70.9    2e-12   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1          70.5    2e-12   
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g           70.1    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g           70.1    3e-12   
ref|XP_002523447.1|  cysteine protease, putative                      70.1    3e-12   Ricinus communis
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...  70.1    3e-12   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1          70.1    3e-12   
ref|XP_002523448.1|  cysteine protease, putative                      69.7    3e-12   Ricinus communis
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g           69.7    4e-12   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g           69.7    4e-12   
ref|XP_004297571.1|  PREDICTED: vignain-like                          69.3    5e-12   
ref|XP_004290089.1|  PREDICTED: vignain-like                          69.3    6e-12   
ref|XP_007132882.1|  hypothetical protein PHAVU_011G1328001g          67.0    6e-12   
ref|XP_007211535.1|  hypothetical protein PRUPE_ppa008267mg           68.9    6e-12   
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...  68.9    7e-12   
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg           68.9    7e-12   
ref|XP_007132861.1|  hypothetical protein PHAVU_011G130900g           68.9    7e-12   
ref|XP_002525124.1|  cysteine protease, putative                      68.9    7e-12   Ricinus communis
ref|XP_009361500.1|  PREDICTED: vignain-like                          68.9    8e-12   
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg           68.9    8e-12   
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...  68.9    8e-12   
emb|CAN64655.1|  hypothetical protein VITISV_005140                   68.6    9e-12   Vitis vinifera
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...  68.6    9e-12   
ref|XP_011038210.1|  PREDICTED: senescence-specific cysteine prot...  68.6    1e-11   
ref|XP_007048673.1|  Senescence-associated gene 12, putative          68.2    1e-11   
ref|XP_006360707.1|  PREDICTED: vignain-like                          68.6    1e-11   
ref|XP_002522559.1|  cysteine protease, putative                      68.6    1e-11   Ricinus communis
ref|XP_004301219.1|  PREDICTED: fruit bromelain-like                  66.2    1e-11   
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg              68.2    1e-11   
ref|XP_011038211.1|  PREDICTED: senescence-specific cysteine prot...  68.2    1e-11   
ref|XP_006380495.1|  hypothetical protein POPTR_0007s07290g           67.8    1e-11   
ref|XP_008368206.1|  PREDICTED: zingipain-2-like                      68.2    2e-11   
ref|XP_007132865.1|  hypothetical protein PHAVU_011G131200g           67.8    2e-11   
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg           67.8    2e-11   
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...  67.8    2e-11   
ref|XP_008391525.1|  PREDICTED: fruit bromelain-like                  65.5    2e-11   
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                      67.4    2e-11   
ref|XP_004297572.1|  PREDICTED: vignain-like                          67.4    2e-11   
ref|XP_007132887.1|  hypothetical protein PHAVU_011G133200g           67.4    3e-11   
dbj|BAA22544.1|  FBSB precursor                                       67.4    3e-11   Ananas comosus
gb|KDP40484.1|  hypothetical protein JCGZ_24483                       67.4    3e-11   
ref|XP_011009181.1|  PREDICTED: senescence-specific cysteine prot...  66.2    3e-11   
dbj|BAF56427.1|  cysteine proteinase                                  67.0    3e-11   Lotus japonicus
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                      67.0    3e-11   
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...  67.0    4e-11   
ref|XP_010091715.1|  hypothetical protein L484_001478                 66.6    5e-11   
ref|XP_003612210.1|  Cysteine proteinase                              66.6    5e-11   
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2           66.6    5e-11   
ref|XP_004305438.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  66.6    6e-11   
ref|XP_008340275.1|  PREDICTED: fruit bromelain-like                  67.8    6e-11   
ref|XP_010091714.1|  Fruit bromelain                                  67.4    6e-11   
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg           66.2    6e-11   
ref|XP_007132895.1|  hypothetical protein PHAVU_011G134000g           66.2    6e-11   
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...  66.6    6e-11   
emb|CDP06286.1|  unnamed protein product                              65.9    7e-11   
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                      66.2    7e-11   
ref|XP_006376349.1|  hypothetical protein POPTR_0013s12260g           66.2    7e-11   
emb|CAA08860.1|  cysteine proteinase precursor, AN8                   66.2    8e-11   Ananas comosus
ref|XP_009352952.1|  PREDICTED: fruit bromelain-like                  65.9    8e-11   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...  65.9    9e-11   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741  67.0    1e-10   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...  65.9    1e-10   
ref|XP_009352792.1|  PREDICTED: zingipain-1-like                      65.9    1e-10   
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1           65.9    1e-10   
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                      65.5    1e-10   
ref|XP_007132868.1|  hypothetical protein PHAVU_011G1314000g          64.3    1e-10   
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...  65.5    1e-10   
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                      65.5    1e-10   
ref|XP_009352948.1|  PREDICTED: ervatamin-B-like                      65.5    1e-10   
ref|XP_009352795.1|  PREDICTED: ervatamin-B-like                      65.5    1e-10   
ref|XP_003527350.1|  PREDICTED: vignain-like                          65.5    1e-10   
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg           65.5    1e-10   
gb|KDP23191.1|  hypothetical protein JCGZ_00324                       64.7    1e-10   
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                      65.1    1e-10   
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...  65.1    2e-10   
ref|XP_006469011.1|  PREDICTED: vignain-like                          65.1    2e-10   
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                      65.1    2e-10   
ref|XP_007132888.1|  hypothetical protein PHAVU_011G133300g           65.1    2e-10   
ref|XP_009616844.1|  PREDICTED: zingipain-1-like                      64.7    2e-10   
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg           64.7    2e-10   
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                      64.7    2e-10   
dbj|BAB13759.1|  cysteine proteinase                                  64.7    2e-10   Astragalus sinicus
ref|XP_009352793.1|  PREDICTED: zingipain-2-like                      64.7    2e-10   
ref|XP_002522571.1|  cysteine protease, putative                      64.7    2e-10   Ricinus communis
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...  64.7    2e-10   
ref|XP_004303175.1|  PREDICTED: vignain-like                          64.7    2e-10   
ref|XP_008345990.1|  PREDICTED: zingipain-2-like                      64.7    3e-10   
sp|P80884.2|ANAN_ANACO  RecName: Full=Ananain; Flags: Precursor       64.7    3e-10   Ananas comosus
ref|XP_004293931.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  64.3    3e-10   
ref|XP_006362428.1|  PREDICTED: vignain-like                          64.3    3e-10   
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                      64.3    3e-10   
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g           64.7    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...  64.3    4e-10   
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                      63.9    4e-10   
emb|CAL64936.1|  putative cysteine protease 8                         63.9    5e-10   Trifolium pratense [peavine clover]
gb|ADY68475.1|  stem bromelain                                        63.2    5e-10   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...  63.9    5e-10   
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                      63.9    5e-10   
ref|XP_007132874.1|  hypothetical protein PHAVU_011G132000g           63.5    5e-10   
ref|XP_002531151.1|  cysteine protease, putative                      63.9    5e-10   Ricinus communis
ref|XP_004306851.1|  PREDICTED: vignain-like                          63.5    6e-10   
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                      63.5    6e-10   
ref|XP_007217611.1|  hypothetical protein PRUPE_ppa016402mg           61.6    6e-10   
ref|XP_009352794.1|  PREDICTED: fruit bromelain                       61.2    6e-10   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                      63.5    6e-10   
ref|XP_008383642.1|  PREDICTED: zingipain-1-like                      63.5    6e-10   
ref|XP_007025398.1|  Senescence-associated gene 12                    63.5    7e-10   
ref|XP_006469012.1|  PREDICTED: vignain-like                          63.5    7e-10   
dbj|BAA22545.1|  FB22 precursor                                       63.2    8e-10   Ananas comosus
ref|XP_011047550.1|  PREDICTED: senescence-specific cysteine prot...  61.6    8e-10   
dbj|BAA21848.1|  bromelain                                            63.2    8e-10   Ananas comosus
gb|AEH26024.1|  cysteine peptidase                                    63.2    8e-10   
ref|XP_006449485.1|  hypothetical protein CICLE_v10017834mg           63.5    9e-10   
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                      63.2    9e-10   
gb|AGS78388.1|  bromelain                                             63.2    9e-10   
emb|CAA08861.1|  cysteine proteinase precursor, AN11                  63.2    9e-10   Ananas comosus
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                      63.2    9e-10   
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                      63.2    9e-10   
ref|XP_009349242.1|  PREDICTED: vignain-like                          63.5    1e-09   
ref|XP_003526232.1|  PREDICTED: vignain-like                          63.2    1e-09   
ref|XP_003527349.1|  PREDICTED: vignain-like                          62.8    1e-09   
ref|XP_006367780.1|  PREDICTED: ananain-like                          62.8    1e-09   
ref|XP_006592467.1|  PREDICTED: vignain-like                          62.8    1e-09   
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                      62.8    1e-09   
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                      62.8    1e-09   
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg              62.4    1e-09   
ref|XP_003527388.1|  PREDICTED: vignain-like                          62.8    1e-09   
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                      62.4    1e-09   
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                      62.4    1e-09   
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg           62.4    2e-09   
ref|XP_008811650.1|  PREDICTED: vignain-like                          62.0    2e-09   
emb|CDP18639.1|  unnamed protein product                              62.4    2e-09   
ref|XP_008353751.1|  PREDICTED: actinidain-like                       60.8    2e-09   
ref|XP_003539770.1|  PREDICTED: vignain-like                          62.4    2e-09   
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                      62.4    2e-09   
emb|CDP20741.1|  unnamed protein product                              60.5    2e-09   
ref|XP_006592465.1|  PREDICTED: vignain-like                          62.4    2e-09   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...  62.4    2e-09   
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                      62.4    2e-09   
ref|XP_008340724.1|  PREDICTED: vignain-like                          62.0    2e-09   
ref|XP_003557016.1|  PREDICTED: vignain-like                          62.4    2e-09   
emb|CDP18638.1|  unnamed protein product                              62.0    2e-09   
gb|KDP45578.1|  hypothetical protein JCGZ_17185                       62.0    2e-09   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                      62.0    2e-09   
ref|XP_002519955.1|  cysteine protease, putative                      62.0    2e-09   Ricinus communis
ref|XP_004489011.1|  PREDICTED: vignain-like                          62.0    2e-09   
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1          62.0    2e-09   
ref|XP_004505498.1|  PREDICTED: vignain-like                          62.0    2e-09   
ref|XP_009365508.1|  PREDICTED: vignain-like                          62.8    2e-09   
ref|XP_009797968.1|  PREDICTED: vignain-like                          62.0    2e-09   
ref|XP_009354265.1|  PREDICTED: ervatamin-B-like                      62.0    2e-09   
ref|XP_008246197.1|  PREDICTED: vignain-like                          61.2    3e-09   
ref|XP_008368631.1|  PREDICTED: ervatamin-B-like                      62.0    3e-09   
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                      61.6    3e-09   
ref|XP_007132860.1|  hypothetical protein PHAVU_011G130800g           61.6    3e-09   
ref|XP_006376351.1|  hypothetical protein POPTR_0013s12280g           61.6    3e-09   
ref|XP_006490014.1|  PREDICTED: xylem cysteine proteinase 1-like      61.6    4e-09   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...  61.6    4e-09   
ref|XP_006432601.1|  hypothetical protein CICLE_v10001718mg           61.6    4e-09   
sp|O23791.1|BROM1_ANACO  RecName: Full=Fruit bromelain; AltName: ...  61.6    4e-09   Ananas comosus
ref|XP_006432617.1|  hypothetical protein CICLE_v10001723mg           61.6    4e-09   
ref|XP_006432594.1|  hypothetical protein CICLE_v10001719mg           61.2    4e-09   
gb|AHA62778.1|  RCR3-like cysteine protease                           61.6    4e-09   
ref|XP_007048674.1|  Senescence-associated gene 12                    61.2    4e-09   
ref|XP_003556992.1|  PREDICTED: vignain-like                          61.2    5e-09   
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                      61.2    5e-09   
ref|XP_008228922.1|  PREDICTED: vignain-like                          60.8    5e-09   
ref|XP_010094328.1|  Fruit bromelain                                  61.2    5e-09   
ref|XP_006582263.1|  PREDICTED: vignain-like                          60.8    5e-09   
ref|XP_006582264.1|  PREDICTED: vignain-like                          60.8    5e-09   
gb|KHN08873.1|  Vignain                                               60.8    5e-09   
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...  60.8    6e-09   
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg           60.8    6e-09   
gb|KDO77830.1|  hypothetical protein CISIN_1g043883mg                 60.8    7e-09   
ref|XP_010035848.1|  PREDICTED: zingipain-2-like                      60.8    7e-09   
ref|XP_003540013.1|  PREDICTED: vignain-like                          60.8    7e-09   
ref|XP_002531152.1|  cysteine protease, putative                      60.8    7e-09   Ricinus communis
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                      60.8    7e-09   
ref|XP_010091035.1|  KDEL-tailed cysteine endopeptidase CEP1          60.5    8e-09   
gb|AAP32196.1|  cysteine protease 8                                   60.5    8e-09   Trifolium repens [creeping white clover]
ref|XP_006468204.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  60.8    8e-09   
ref|XP_010279091.1|  PREDICTED: ervatamin-B                           60.5    8e-09   
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2           60.5    9e-09   
ref|XP_002513120.1|  cysteine protease, putative                      60.5    9e-09   Ricinus communis
ref|XP_008349211.1|  PREDICTED: zingipain-2-like                      60.5    9e-09   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                      60.5    1e-08   
emb|CDP18641.1|  unnamed protein product                              60.1    1e-08   
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1           60.5    1e-08   
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                   60.1    1e-08   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                       60.1    1e-08   
ref|XP_004306597.1|  PREDICTED: vignain-like                          60.1    1e-08   
ref|XP_002522572.1|  cysteine protease, putative                      60.1    1e-08   Ricinus communis
ref|XP_007213224.1|  hypothetical protein PRUPE_ppb014952mg           58.9    1e-08   
emb|CDO96765.1|  unnamed protein product                              59.7    1e-08   
gb|KCW74661.1|  hypothetical protein EUGRSUZ_E03389                   60.1    1e-08   
gb|AAR92154.1|  putative cysteine protease 1                          60.1    1e-08   Iris x hollandica [Dutch iris]
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3           59.7    2e-08   
ref|XP_008354173.1|  PREDICTED: actinidain-like                       58.2    2e-08   
ref|XP_010059344.1|  PREDICTED: zingipain-2-like                      59.7    2e-08   
ref|XP_010061449.1|  PREDICTED: zingipain-1-like                      59.7    2e-08   
gb|KCW76121.1|  hypothetical protein EUGRSUZ_D00498                   58.5    2e-08   
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                      59.3    2e-08   
emb|CDP18644.1|  unnamed protein product                              59.3    2e-08   
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                      59.3    2e-08   
ref|XP_010059331.1|  PREDICTED: zingipain-2-like                      58.9    3e-08   
gb|AAP32195.1|  cysteine protease 5                                   58.9    3e-08   Trifolium repens [creeping white clover]
ref|XP_006421532.1|  hypothetical protein CICLE_v10005342mg           58.9    3e-08   
gb|AAP32198.1|  cysteine protease 12                                  58.9    3e-08   Trifolium repens [creeping white clover]
ref|XP_006421530.1|  hypothetical protein CICLE_v10005334mg           58.9    3e-08   
ref|XP_004306836.1|  PREDICTED: vignain-like                          58.9    3e-08   
ref|XP_003527331.1|  PREDICTED: vignain-like                          58.9    3e-08   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                      58.5    3e-08   
ref|XP_007132814.1|  hypothetical protein PHAVU_011G126700g           58.5    4e-08   
gb|KCW76123.1|  hypothetical protein EUGRSUZ_D00500                   58.5    4e-08   
ref|XP_010052199.1|  PREDICTED: ervatamin-B-like                      58.5    4e-08   
ref|XP_003527330.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  58.5    4e-08   
ref|XP_006421528.1|  hypothetical protein CICLE_v10006884mg           58.5    4e-08   
ref|XP_003526217.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  58.5    4e-08   
gb|AFW76902.1|  hypothetical protein ZEAMMB73_056195                  58.5    4e-08   
ref|XP_002522560.1|  cysteine protease, putative                      56.6    4e-08   Ricinus communis
ref|XP_006376431.1|  hypothetical protein POPTR_0013s12980g           58.5    5e-08   
gb|AHA62776.1|  papain-like cysteine protease                         58.5    5e-08   
ref|XP_002525123.1|  cysteine protease, putative                      58.5    5e-08   Ricinus communis
ref|NP_001233949.1|  phytophthora-inhibited protease 1                58.5    5e-08   
ref|XP_006468205.1|  PREDICTED: actinidain-like                       58.2    5e-08   
ref|XP_010042857.1|  PREDICTED: actinidain-like                       56.2    5e-08   
emb|CDP14567.1|  unnamed protein product                              58.2    5e-08   
ref|NP_001275606.1|  fruit bromelain-like precursor                   58.2    5e-08   
ref|XP_004308524.1|  PREDICTED: vignain-like                          58.2    5e-08   
ref|XP_009354321.1|  PREDICTED: ervatamin-B-like                      58.5    5e-08   
gb|KHN08187.1|  Thiol protease SEN102                                 58.2    6e-08   
gb|KHN13721.1|  Vignain                                               58.2    6e-08   
ref|XP_006362429.1|  PREDICTED: fruit bromelain-like                  58.2    6e-08   
gb|AFW76903.1|  hypothetical protein ZEAMMB73_202256                  56.2    6e-08   
ref|XP_010052198.1|  PREDICTED: ervatamin-B-like                      58.2    6e-08   
ref|XP_003540991.1|  PREDICTED: vignain-like                          57.8    7e-08   
ref|XP_010054319.1|  PREDICTED: zingipain-2-like                      57.8    7e-08   
ref|XP_006469128.1|  PREDICTED: vignain-like                          57.8    7e-08   
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...  57.8    7e-08   
ref|XP_007132817.1|  hypothetical protein PHAVU_011G127000g           57.8    7e-08   
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                      57.8    7e-08   
ref|XP_010054322.1|  PREDICTED: ervatamin-B-like                      57.8    7e-08   
gb|ADV74756.1|  cysteine protease                                     57.8    7e-08   
ref|XP_006582267.1|  PREDICTED: thiol protease SEN102-like            57.8    7e-08   
ref|XP_011037399.1|  PREDICTED: senescence-specific cysteine prot...  57.8    8e-08   
ref|XP_010054320.1|  PREDICTED: ervatamin-B-like                      57.8    8e-08   
gb|AAA50755.1|  cysteine proteinase                                   57.8    8e-08   
gb|KHN32069.1|  Vignain                                               57.8    8e-08   
gb|KHN28095.1|  Thiol protease                                        57.8    9e-08   
ref|XP_003526207.1|  PREDICTED: thiol protease SEN102-like            57.8    9e-08   
ref|XP_009609440.1|  PREDICTED: ananain-like                          55.5    9e-08   
gb|EMT04560.1|  Vignain                                               56.6    1e-07   
ref|XP_009798360.1|  PREDICTED: zingipain-2-like                      57.4    1e-07   
ref|XP_003607571.1|  Cysteine proteinase EP-B                         57.4    1e-07   
ref|XP_006582266.1|  PREDICTED: thiol protease SEN102-like            57.4    1e-07   
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g           57.4    1e-07   
ref|XP_009606934.1|  PREDICTED: zingipain-2                           57.0    1e-07   
ref|XP_002446131.1|  hypothetical protein SORBIDRAFT_06g002140        57.0    1e-07   
gb|AHA62772.1|  papain-like cysteine protease                         57.0    1e-07   
ref|XP_006446763.1|  hypothetical protein CICLE_v10017432mg           57.0    1e-07   
ref|XP_010054318.1|  PREDICTED: ervatamin-B-like                      57.0    1e-07   
ref|XP_003526209.1|  PREDICTED: thiol protease SEN102-like            57.0    1e-07   
ref|XP_004974538.1|  PREDICTED: thiol protease SEN102-like            57.0    1e-07   
ref|XP_010099370.1|  hypothetical protein L484_004796                 54.3    2e-07   
ref|XP_002436841.1|  hypothetical protein SORBIDRAFT_10g009840        56.6    2e-07   
ref|XP_002436840.1|  hypothetical protein SORBIDRAFT_10g009830        56.6    2e-07   
gb|EMS66468.1|  Ananain                                               55.5    2e-07   
gb|KDO77829.1|  hypothetical protein CISIN_1g037516mg                 56.6    2e-07   
ref|XP_010059348.1|  PREDICTED: zingipain-2-like                      57.0    2e-07   
gb|AAK27968.1|AF242372_1  cysteine protease                           56.6    2e-07   
ref|XP_003526212.1|  PREDICTED: thiol protease SEN102-like            56.6    2e-07   
gb|KHN12137.1|  Thiol protease                                        56.6    2e-07   
ref|XP_004234254.1|  PREDICTED: zingipain-2-like                      56.6    2e-07   
ref|XP_002450443.1|  hypothetical protein SORBIDRAFT_05g005530        56.6    2e-07   
ref|XP_011078435.1|  PREDICTED: senescence-specific cysteine prot...  56.6    2e-07   
ref|XP_006582265.1|  PREDICTED: thiol protease SEN102-like            56.6    2e-07   
ref|XP_006592475.1|  PREDICTED: vignain-like                          56.6    2e-07   
ref|XP_008659445.1|  PREDICTED: ervatamin-B-like                      56.2    2e-07   
ref|XP_009793843.1|  PREDICTED: zingipain-2-like                      56.6    2e-07   
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                      56.2    2e-07   
ref|XP_004975182.1|  PREDICTED: vignain-like                          56.2    3e-07   
ref|XP_004294729.1|  PREDICTED: vignain-like                          56.2    3e-07   
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                      56.2    3e-07   
ref|XP_004505461.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  56.2    3e-07   
ref|XP_009617814.1|  PREDICTED: zingipain-2-like                      56.2    3e-07   
ref|XP_004975183.1|  PREDICTED: vignain-like                          56.2    3e-07   
gb|AFP73348.1|  cysteine protease                                     56.2    3e-07   
gb|KHN27797.1|  Thiol protease SEN102                                 56.2    3e-07   
ref|XP_008659446.1|  PREDICTED: ervatamin-B-like                      56.2    3e-07   
ref|XP_004306813.1|  PREDICTED: vignain-like                          55.8    3e-07   
ref|XP_002446135.1|  hypothetical protein SORBIDRAFT_06g002170        55.8    3e-07   
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g           55.8    3e-07   
gb|EYU43350.1|  hypothetical protein MIMGU_mgv1a021555mg              55.8    3e-07   
emb|CAE03344.2|  OSJNBb0005B05.11                                     55.8    4e-07   
ref|XP_006471123.1|  PREDICTED: xylem cysteine proteinase 1-like      53.9    4e-07   
gb|AAS75836.1|  fastuosain precursor                                  55.8    4e-07   
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...  55.8    4e-07   
ref|XP_011005486.1|  PREDICTED: senescence-specific cysteine prot...  55.5    4e-07   
ref|XP_004505458.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  55.8    4e-07   
ref|XP_010045989.1|  PREDICTED: vignain-like                          55.1    4e-07   
emb|CAH66275.1|  OSIGBa0147O06.5                                      55.8    4e-07   
gb|KDP21086.1|  hypothetical protein JCGZ_21557                       53.9    4e-07   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...  55.8    4e-07   
ref|XP_003578808.1|  PREDICTED: senescence-specific cysteine prot...  55.5    4e-07   
ref|XP_010917956.1|  PREDICTED: ervatamin-B-like                      55.8    4e-07   
gb|ABF70145.1|  cysteine protease, putative                           55.8    4e-07   
ref|XP_010059083.1|  PREDICTED: zingipain-2-like                      55.5    4e-07   
ref|XP_009775922.1|  PREDICTED: zingipain-2                           55.5    5e-07   
ref|XP_006362435.1|  PREDICTED: fruit bromelain-like                  55.5    5e-07   
ref|NP_001052232.2|  Os04g0203500                                     55.5    5e-07   
dbj|BAA22546.1|  FB1035 precursor                                     55.1    6e-07   
ref|XP_006470294.1|  PREDICTED: xylem cysteine proteinase 1-like ...  55.1    6e-07   
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                 55.1    6e-07   
ref|XP_004308225.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  55.5    6e-07   
dbj|BAF46311.1|  cysteine proteinase precursor                        55.1    6e-07   
ref|XP_006470293.1|  PREDICTED: xylem cysteine proteinase 1-like ...  55.1    6e-07   
gb|AFW86317.1|  hypothetical protein ZEAMMB73_339067                  55.5    6e-07   
ref|XP_004973089.1|  PREDICTED: thiol protease SEN102-like            55.1    7e-07   
ref|XP_004975180.1|  PREDICTED: thiol protease SEN102-like            55.1    7e-07   
gb|EEC84514.1|  hypothetical protein OsI_31214                        55.1    7e-07   
ref|XP_003596314.1|  Cysteine proteinase                              55.1    7e-07   
ref|XP_006470291.1|  PREDICTED: xylem cysteine proteinase 1-like ...  55.1    7e-07   
ref|XP_004974540.1|  PREDICTED: thiol protease SEN102-like            55.1    7e-07   
ref|XP_006470296.1|  PREDICTED: xylem cysteine proteinase 1-like      55.1    7e-07   
ref|XP_006470292.1|  PREDICTED: xylem cysteine proteinase 1-like ...  55.1    7e-07   
dbj|BAD29955.1|  cysteine protease                                    55.1    8e-07   
ref|XP_006449484.1|  hypothetical protein CICLE_v10017947mg           54.7    9e-07   
gb|KCW74260.1|  hypothetical protein EUGRSUZ_E02907                   55.1    9e-07   
sp|A2XQE8.1|SAG39_ORYSI  RecName: Full=Senescence-specific cystei...  54.7    9e-07   
gb|EMT29822.1|  Vignain                                               54.7    9e-07   
sp|Q7XWK5.2|SAG39_ORYSJ  RecName: Full=Senescence-specific cystei...  54.7    9e-07   
gb|KDO55227.1|  hypothetical protein CISIN_1g019112mg                 54.7    1e-06   
ref|XP_007021896.1|  Cysteine proteinases superfamily protein, pu...  54.7    1e-06   
ref|XP_003599735.1|  Cysteine proteinase                              54.3    1e-06   
gb|AAL14199.1|  cysteine proteinase precursor                         54.3    1e-06   
gb|KCW76139.1|  hypothetical protein EUGRSUZ_D00515                   54.3    1e-06   
gb|KFK29351.1|  cysteine proteinase-like protein                      54.3    1e-06   
ref|XP_003609015.1|  Cysteine proteinase                              54.3    1e-06   
gb|AHA62774.1|  papain-like cysteine protease                         54.3    1e-06   
gb|KCW76125.1|  hypothetical protein EUGRSUZ_D00501                   54.7    1e-06   
dbj|BAF56430.1|  cysteine proteinase                                  54.3    1e-06   
ref|XP_006446541.1|  hypothetical protein CICLE_v10015814mg           54.3    1e-06   
gb|AHA62773.1|  papain-like cysteine protease                         54.3    1e-06   
ref|XP_010686289.1|  PREDICTED: senescence-specific cysteine prot...  54.3    1e-06   
ref|XP_006652104.1|  PREDICTED: vignain-like                          54.3    1e-06   
ref|XP_009594088.1|  PREDICTED: zingipain-2-like                      54.3    1e-06   
gb|KCW76118.1|  hypothetical protein EUGRSUZ_D00495                   54.3    1e-06   
ref|XP_002449458.1|  hypothetical protein SORBIDRAFT_05g013840        54.3    1e-06   
ref|XP_009407029.1|  PREDICTED: ervatamin-B-like                      53.9    2e-06   
ref|XP_003578813.1|  PREDICTED: senescence-specific cysteine prot...  53.9    2e-06   
gb|AFP73358.1|  cysteine protease                                     53.9    2e-06   
ref|XP_002446133.1|  hypothetical protein SORBIDRAFT_06g002160        53.9    2e-06   
gb|EMT14655.1|  hypothetical protein F775_52509                       53.5    2e-06   
gb|AFP73357.1|  cysteine protease                                     53.9    2e-06   
ref|XP_002446132.1|  hypothetical protein SORBIDRAFT_06g002150        53.5    2e-06   
gb|AFP73326.1|  cysteine protease                                     53.5    2e-06   
gb|AFP73317.1|  cysteine protease                                     53.5    2e-06   
ref|NP_565780.1|  cysteine proteinase-like protein                    53.5    2e-06   
gb|AFP73334.1|  cysteine protease                                     53.5    2e-06   
ref|XP_003578807.1|  PREDICTED: senescence-specific cysteine prot...  53.5    2e-06   
ref|XP_010103037.1|  Fruit bromelain                                  51.2    2e-06   
gb|AFP73318.1|  cysteine protease                                     53.5    2e-06   
ref|XP_009397226.1|  PREDICTED: zingipain-2-like                      53.5    3e-06   
dbj|BAF00646.1|  putative cysteine proteinase                         53.5    3e-06   
ref|XP_010058970.1|  PREDICTED: zingipain-2-like                      53.5    3e-06   
ref|XP_010692582.1|  PREDICTED: ervatamin-C-like                      53.5    3e-06   
dbj|BAF56428.1|  cysteine proteinase                                  53.5    3e-06   
ref|XP_010913142.1|  PREDICTED: ervatamin-B-like                      53.5    3e-06   
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g           53.1    3e-06   
ref|XP_007132818.1|  hypothetical protein PHAVU_011G127100g           53.1    3e-06   
gb|AFP73362.1|  cysteine protease                                     53.1    3e-06   
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                      53.1    3e-06   
gb|KFK36314.1|  hypothetical protein AALP_AA4G106300                  53.1    3e-06   
gb|AFP73327.1|  cysteine protease                                     53.1    3e-06   
gb|AFP73359.1|  cysteine protease                                     53.1    3e-06   
emb|CAD40112.2|  OSJNBa0035O13.5                                      53.1    3e-06   
ref|XP_007132821.1|  hypothetical protein PHAVU_011G127300g           53.1    3e-06   
ref|XP_010052201.1|  PREDICTED: ervatamin-B-like                      53.1    3e-06   
ref|XP_007132871.1|  hypothetical protein PHAVU_011G131700g           52.8    3e-06   
gb|EMS56453.1|  KDEL-tailed cysteine endopeptidase CEP1               53.1    3e-06   
emb|CAH66233.1|  H0825G02.10                                          53.1    3e-06   
dbj|BAF56429.1|  cysteine proteinase                                  53.1    3e-06   
gb|EAY93078.1|  hypothetical protein OsI_14879                        53.1    3e-06   
ref|XP_007132822.1|  hypothetical protein PHAVU_011G127400g           53.1    4e-06   
ref|XP_006306520.1|  hypothetical protein CARUB_v10012525mg           53.1    4e-06   
ref|XP_003607647.1|  Cysteine proteinase                              52.8    4e-06   
ref|XP_010052196.1|  PREDICTED: zingipain-2-like                      52.8    4e-06   
gb|KCW74081.1|  hypothetical protein EUGRSUZ_E02719                   50.8    4e-06   
gb|AFP73361.1|  cysteine protease                                     52.8    4e-06   
gb|AFK44139.1|  unknown                                               52.8    4e-06   
gb|KCW76116.1|  hypothetical protein EUGRSUZ_D00493                   52.8    4e-06   
ref|XP_008663073.1|  PREDICTED: ervatamin-B-like                      52.8    4e-06   
ref|XP_007025397.1|  Senescence-associated gene 12, putative          52.8    4e-06   
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g           52.8    4e-06   
ref|XP_004974539.1|  PREDICTED: thiol protease SEN102-like            52.8    4e-06   
gb|AFP73355.1|  cysteine protease                                     52.8    4e-06   
emb|CDP18645.1|  unnamed protein product                              52.8    4e-06   
ref|XP_003596711.1|  Cysteine proteinase                              52.8    5e-06   
ref|XP_006306115.1|  hypothetical protein CARUB_v10011567mg           52.8    5e-06   
ref|XP_004974541.1|  PREDICTED: thiol protease SEN102-like            52.8    5e-06   
gb|KCW74259.1|  hypothetical protein EUGRSUZ_E02906                   52.8    5e-06   
gb|AFW80235.1|  hypothetical protein ZEAMMB73_542371                  52.0    5e-06   
ref|XP_008669668.1|  PREDICTED: ervatamin-B-like                      52.8    5e-06   
ref|XP_010059005.1|  PREDICTED: fruit bromelain-like                  51.6    5e-06   
ref|NP_001140922.1|  hypothetical protein                             52.8    5e-06   
ref|NP_001130503.1|  cysteine protease 1                              52.8    5e-06   
gb|AFW57869.1|  hypothetical protein ZEAMMB73_830006                  52.8    5e-06   
ref|XP_010059082.1|  PREDICTED: xylem cysteine proteinase 2-like      52.4    5e-06   
ref|XP_010914490.1|  PREDICTED: senescence-specific cysteine prot...  52.8    6e-06   
ref|XP_004979242.1|  PREDICTED: oryzain beta chain-like               52.4    6e-06   
gb|KCW76128.1|  hypothetical protein EUGRSUZ_D00504                   52.4    6e-06   
gb|AFP73356.1|  cysteine protease                                     52.4    6e-06   
gb|AAM19208.1|AF493233_1  cysteine protease                           52.4    6e-06   
ref|XP_002446222.1|  hypothetical protein SORBIDRAFT_06g005410        52.4    6e-06   
gb|EMT12294.1|  Vignain                                               52.4    6e-06   
ref|XP_010911312.1|  PREDICTED: senescence-specific cysteine prot...  50.8    7e-06   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                      52.4    7e-06   
ref|XP_010054324.1|  PREDICTED: ervatamin-B-like                      52.4    7e-06   
gb|AGT16936.1|  vignain-like protein                                  52.4    7e-06   
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                      52.4    7e-06   
ref|XP_003578815.1|  PREDICTED: senescence-specific cysteine prot...  52.0    7e-06   
gb|EMT20796.1|  Vignain                                               52.4    7e-06   
ref|XP_002881320.1|  hypothetical protein ARALYDRAFT_321132           52.0    7e-06   
gb|AFP73363.1|  cysteine protease                                     52.0    7e-06   
ref|XP_006849385.1|  hypothetical protein AMTR_s01332p00008900        52.0    8e-06   
gb|AFP73352.1|  cysteine protease                                     52.0    8e-06   
ref|XP_002436842.1|  hypothetical protein SORBIDRAFT_10g009850        52.0    8e-06   
ref|XP_010052203.1|  PREDICTED: ervatamin-B-like                      52.0    8e-06   
gb|AFP73316.1|  cysteine protease                                     52.0    8e-06   
gb|AFP73368.1|  cysteine protease                                     52.0    8e-06   
gb|AFP73347.1|  cysteine protease                                     52.0    8e-06   
ref|XP_006415613.1|  hypothetical protein EUTSA_v10009660mg           52.0    9e-06   
gb|AFP73370.1|  cysteine protease                                     52.0    9e-06   
ref|XP_004506025.1|  PREDICTED: vignain-like                          52.0    9e-06   
ref|XP_010686292.1|  PREDICTED: zingipain-2-like                      52.0    9e-06   
ref|XP_003578721.1|  PREDICTED: senescence-specific cysteine prot...  52.0    1e-05   
ref|XP_010239696.1|  PREDICTED: senescence-specific cysteine prot...  51.6    1e-05   
ref|XP_003526208.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  51.6    1e-05   
gb|KHG19386.1|  KDEL-tailed cysteine endopeptidase CEP2 -like pro...  51.2    1e-05   
gb|AFP73351.1|  cysteine protease                                     51.6    1e-05   
gb|AFP73311.1|  cysteine protease                                     51.6    1e-05   
ref|XP_003526215.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...  51.6    1e-05   
gb|AFP73349.1|  cysteine protease                                     51.6    1e-05   
gb|AFP73330.1|  cysteine protease                                     51.6    1e-05   
gb|AFP73365.1|  cysteine protease                                     51.6    1e-05   
gb|AFP73315.1|  cysteine protease                                     51.6    1e-05   
ref|XP_006492717.1|  PREDICTED: xylem cysteine proteinase 1-like      51.6    1e-05   
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...  51.6    1e-05   
ref|XP_006447756.1|  hypothetical protein CICLE_v10018235mg           51.6    1e-05   
gb|AFP73312.1|  cysteine protease                                     51.6    1e-05   
ref|XP_006362436.1|  PREDICTED: vignain-like                          51.6    1e-05   
gb|AFP73338.1|  cysteine protease                                     51.6    1e-05   
gb|AFP73319.1|  cysteine protease                                     51.6    1e-05   
gb|AFP73329.1|  cysteine protease                                     51.6    1e-05   
gb|AFP73324.1|  cysteine protease                                     51.6    1e-05   
gb|AAM19207.1|AF493232_1  cysteine protease                           51.6    1e-05   
gb|AFP73321.1|  cysteine protease                                     51.6    1e-05   



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -1

Query  185  MAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIF  9
            MA    ++AAL LLG WA QAT+ T  E SM +RHE+WM++YGR YKD AEK+ RFQIF
Sbjct  23   MAFKHFMIAALILLGAWACQATSRTLPEASMFERHEQWMIQYGRVYKDEAEKSVRFQIF  81



>gb|EYU25672.1| hypothetical protein MIMGU_mgv1a018700mg [Erythranthe guttata]
Length=343

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  167  ILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ILA + +L  WASQAT  T    SM++RHE+WMV+YGR+YK++AEKAKR+ IFK
Sbjct  11   ILAVVLVLQMWASQATARTLPNASMVERHEQWMVQYGRTYKNDAEKAKRYNIFK  64



>gb|EYU25679.1| hypothetical protein MIMGU_mgv1a023356mg, partial [Erythranthe 
guttata]
Length=347

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  167  ILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ILAA+ +L  W SQAT  T  + S+++RHE+WMV+YGR+YK++AEKAKRF IFK
Sbjct  15   ILAAVLVLQMWVSQATARTLPDASIVERHEQWMVQYGRTYKNDAEKAKRFNIFK  68



>emb|CAN62838.1| hypothetical protein VITISV_003391 [Vitis vinifera]
Length=298

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            V +A LF+L  WASQAT+ +  E SM +RHE+WM RYGR YKD  EK KRF+IFK
Sbjct  10   VSMALLFILAAWASQATSRSLHEASMYERHEDWMARYGRMYKDANEKEKRFKIFK  64



>ref|XP_007213386.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
 gb|EMJ14585.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
Length=345

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -1

Query  185  MAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +  F   LA + +LG W+S+AT+ + ++ SM  RHE+WM RYGR Y DN EK KRF+IFK
Sbjct  8    LCKFCTCLALIIMLGAWSSEATSRSLQDASMYGRHEQWMTRYGRVYTDNEEKEKRFKIFK  67

Query  5    K  3
            +
Sbjct  68   E  68



>emb|CBI21972.3| unnamed protein product [Vitis vinifera]
Length=320

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            + LA LF+L  WASQAT  +  E SM +RHE+WMV+YGR YKD  EK+KR++IFK
Sbjct  10   ICLALLFVLAAWASQATARSLHEASMYERHEDWMVQYGREYKDADEKSKRYKIFK  64



>ref|XP_007214697.1| hypothetical protein PRUPE_ppa026948mg [Prunus persica]
 gb|EMJ15896.1| hypothetical protein PRUPE_ppa026948mg [Prunus persica]
Length=340

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V L  + +LGTW+S+AT+H  ++ SM +R+E+WMV YGR Y D  EK KRF+IFKK
Sbjct  11   VCLVLILMLGTWSSEATSHNLQDASMYERYEQWMVHYGREYDDVNEKQKRFEIFKK  66



>ref|XP_002280246.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            + LA LF+L  WASQAT  +  E SM +RHE+WMV+YGR YKD  EK+KR++IFK
Sbjct  10   ICLALLFVLAAWASQATARSLHEASMYERHEDWMVQYGREYKDADEKSKRYKIFK  64



>ref|XP_008244499.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            LA + +LG W+S+AT+ + ++ SM  RHE+WMVRYGR Y DN EK KRF+IFK+
Sbjct  15   LALIIMLGAWSSKATSRSLQDASMYGRHEQWMVRYGRVYTDNEEKEKRFKIFKE  68



>ref|XP_008244498.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            LA + +LG W+S+AT+ + ++ SM  RHE+WMVRYGR Y DN EK KRF+IFK+
Sbjct  15   LALIIMLGAWSSKATSRSLQDASMYGRHEQWMVRYGRVYTDNEEKEKRFKIFKE  68



>emb|CBI21973.3| unnamed protein product [Vitis vinifera]
Length=320

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            + LA LF+L  WASQAT     E SM +RHE+WMV+YGR YKD  EK+KR++IFK
Sbjct  10   ICLALLFVLAAWASQATARNLHEASMYERHEDWMVQYGREYKDADEKSKRYKIFK  64



>ref|XP_002280204.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            + LA LF+L  WASQAT     E SM +RHE+WMV+YGR YKD  EK+KR++IFK
Sbjct  10   ICLALLFVLAAWASQATARNLHEASMYERHEDWMVQYGREYKDADEKSKRYKIFK  64



>emb|CAN70559.1| hypothetical protein VITISV_032465 [Vitis vinifera]
Length=341

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            + LA LF+L  WASQAT     E SM +RHE+WMV+YGR YKD  EK+KR++IFK
Sbjct  10   ICLALLFVLAAWASQATARXLHEASMYERHEDWMVQYGREYKDADEKSKRYKIFK  64



>ref|XP_008244477.1| PREDICTED: zingipain-2-like [Prunus mume]
Length=340

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V L  + +LGTW+S+AT+   ++ SM +R+E+WMVRYGR Y D  EK KRF+IFKK
Sbjct  11   VCLVLILMLGTWSSEATSRNLQDASMYERYEQWMVRYGREYDDVNEKQKRFEIFKK  66



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIF  9
            L  ++ ++ AAL +L  W SQAT  T  + +M+++HE+WM ++GR YKD+AEK+KRF+IF
Sbjct  3    LTPNWKLVFAALLVLEMWGSQATARTLPDAAMIEKHEQWMAQFGRVYKDDAEKSKRFRIF  62

Query  8    KK  3
            K+
Sbjct  63   KE  64



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIF  9
            L  ++ + LAAL +L  W SQAT  T  + SM+++HE+W+ ++GR YKD+AEKAKRF IF
Sbjct  3    LRPNWILFLAALVVLEIWGSQATARTLPDASMVEKHEQWIAQFGRVYKDDAEKAKRFNIF  62

Query  8    KK  3
            K+
Sbjct  63   KE  64



>ref|XP_002280263.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=339

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            V +A LF+L  WASQAT+ +  E SM +RHE+WM RYGR YKD  EK KRF+IFK
Sbjct  10   VSMALLFILAAWASQATSRSLHEASMYERHEDWMARYGRMYKDANEKEKRFKIFK  64



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIF  9
            L+ ++ +   AL +LG WASQ T+    E SM+++HE WM R+GR Y+D+AEKAKR +IF
Sbjct  3    LICNWKLAFVALLVLGMWASQTTSRDLNEASMVQKHEYWMARFGRVYRDDAEKAKRLKIF  62

Query  8    K  6
            K
Sbjct  63   K  63



>ref|XP_007214465.1| hypothetical protein PRUPE_ppa023848mg [Prunus persica]
 gb|EMJ15664.1| hypothetical protein PRUPE_ppa023848mg [Prunus persica]
Length=340

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V L  + +LGTW+S+AT+   ++ SM +R+E+WMVRYGR Y D  EK KRF+IFKK
Sbjct  11   VCLVLILMLGTWSSEATSRNLQDASMYERYEQWMVRYGREYNDVNEKQKRFEIFKK  66



>emb|CBI21976.3| unnamed protein product [Vitis vinifera]
Length=322

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            + LA LF+L  WASQAT     E SM +RHE+WM +YGR YKD  EK+KR++IFK
Sbjct  10   ICLALLFVLAAWASQATARNLHEASMYERHEDWMAQYGRVYKDADEKSKRYKIFK  64



>ref|XP_002280230.2| PREDICTED: LOW QUALITY PROTEIN: senescence-specific cysteine 
protease SAG39 [Vitis vinifera]
Length=341

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            + LA LF+L  WASQAT     E SM +RHE+WM +YGR YKD  EK+KR++IFK
Sbjct  10   ICLALLFVLAAWASQATARNLHEASMYERHEDWMAQYGRVYKDADEKSKRYKIFK  64



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIF  9
            L  ++ +I A L +L  W  QAT  +  + SM++RHEEWM ++GR+YKD+ EKAKRF+IF
Sbjct  3    LSTNWRLIFAVLLVLEMWTYQATARSLPDASMIERHEEWMAQHGRAYKDDVEKAKRFKIF  62

Query  8    KK  3
            K+
Sbjct  63   KE  64



>emb|CBI30671.3| unnamed protein product [Vitis vinifera]
Length=320

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            +I   L ++G WASQA + T  E SM +RHE+WM  YGR+YKD AEK +RF+IFK+
Sbjct  7    IICITLLIMGVWASQALSRTLHEVSMSERHEDWMGLYGRTYKDIAEKERRFKIFKE  62



>gb|EYU25680.1| hypothetical protein MIMGU_mgv1a019612mg [Erythranthe guttata]
Length=328

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  149  LLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +L  WASQAT  T  + SM++RHE+WMV+YGR+YK++AEKA RF IFK
Sbjct  2    VLQIWASQATARTLPDTSMVERHEQWMVQYGRTYKNDAEKANRFNIFK  49



>ref|XP_002274223.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Vitis 
vinifera]
Length=340

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            +I   L ++G WASQA + T  E SM +RHE+WM  YGR+YKD AEK +RF+IFK+
Sbjct  7    IICITLLIMGVWASQALSRTLHEVSMSERHEDWMGLYGRTYKDIAEKERRFKIFKE  62



>ref|XP_008225268.1| PREDICTED: zingipain-2-like [Prunus mume]
Length=341

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V+LA   +LGT ASQAT+ T  E S   +HE+WM +Y R Y+DNAEK +RF IFKK
Sbjct  8    VVLALFIVLGTLASQATSRTLSEASFAAKHEQWMTKYDRVYEDNAEKERRFAIFKK  63



>ref|XP_008228971.1| PREDICTED: zingipain-2-like [Prunus mume]
Length=340

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V L  + +LGTW+S+AT+   ++ SM  R E+WMVRYGR Y D  EK KRF+IFKK
Sbjct  11   VCLVLILMLGTWSSEATSRNLQDASMYGRDEQWMVRYGREYNDVNEKHKRFEIFKK  66



>ref|XP_002280215.1| PREDICTED: senescence-specific cysteine protease SAG39 [Vitis 
vinifera]
Length=341

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            + LA LF L  WASQAT     E SM +RHE+WM +YGR YKD  EK+KR++IFK
Sbjct  10   ICLALLFFLAAWASQATARNLLEASMYERHEDWMAQYGRVYKDADEKSKRYKIFK  64



>ref|XP_009774375.1| PREDICTED: fruit bromelain-like, partial [Nicotiana sylvestris]
Length=201

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -1

Query  179  HFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++ +   AL +LG WASQ T+    E SM+++HE WM R+GR Y+D+AEKAKR +IFK
Sbjct  60   NWKLAFVALLVLGMWASQTTSRDLNEASMVQKHEYWMARFGRVYRDDAEKAKRLKIFK  117


 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKR  21
            L++++ +   AL +LG WASQ T+    E SM+++HE WM R+GR Y+D+AEK+ R
Sbjct  3    LISNWKLAFVALLVLGMWASQTTSRDLNEASMVQKHEYWMARFGRVYRDDAEKSTR  58



>ref|XP_008225270.1| PREDICTED: zingipain-2-like [Prunus mume]
Length=341

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V+LA   +LGT ASQAT+ T  E S   +HE+WM +Y R Y+DNAEK +RF IFKK
Sbjct  8    VVLALFIVLGTLASQATSRTLSEASFAAKHEQWMTKYDRVYEDNAEKERRFAIFKK  63



>ref|XP_003539989.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + LA LF LG WA Q T+ T ++ SM +RHEEWM RY + YKD  E+ KRF+IFK+
Sbjct  8    YHISLALLFCLGFWAFQVTSRTLQDASMYERHEEWMARYAKVYKDPEEREKRFKIFKE  65



>ref|XP_003539970.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + LA LF LG WA Q T+ T ++ SM +RHEEWM RY + YKD  E+ KRF+IFK+
Sbjct  8    YHISLALLFCLGFWAFQVTSRTLQDASMYERHEEWMARYAKVYKDPEEREKRFKIFKE  65



>emb|CDP05747.1| unnamed protein product [Coffea canephora]
Length=340

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 3/58 (5%)
 Frame = -1

Query  167  ILAALFLLGTWASQATT---HTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            IL + F+L   ASQAT+   H  +E +M++ HE+WM  YGR YKD+AEKAKRFQIFKK
Sbjct  10   ILVSFFVLVIGASQATSRLLHENDEAAMVEEHEKWMATYGRVYKDDAEKAKRFQIFKK  67



>ref|XP_007048792.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIF  9
            L  H  + LA +F++G    +AT+ T ++ SM +RHE+WM RYGR Y+DN E+ +RF IF
Sbjct  6    LQLHQCICLAFIFIVGALVCEATSRTLQDASMYERHEQWMARYGRVYQDNNEREQRFNIF  65

Query  8    KK  3
            K+
Sbjct  66   KE  67



>emb|CBI21975.3| unnamed protein product [Vitis vinifera]
Length=286

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            + LA LF L  WASQAT     E SM +RHE+WM +YGR YKD  EK+KR++IFK
Sbjct  10   ICLALLFFLAAWASQATARNLLEASMYERHEDWMAQYGRVYKDADEKSKRYKIFK  64



>ref|XP_002306369.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
 gb|EEE93365.1| hypothetical protein POPTR_0005s09080g [Populus trichocarpa]
Length=340

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA LF+LG W S++   T ++ SM +RHE+WM +YGR YKD+AEK  R+ IFK+
Sbjct  10   ICLALLFVLGAWPSKSAARTLQDVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKE  65



>ref|XP_008225326.1| PREDICTED: actinidain-like [Prunus mume]
Length=290

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V+LA   +LGT ASQAT+ T  E S   +HE+WM +Y R Y+DNAEK +RF IFKK
Sbjct  8    VVLALFIVLGTLASQATSRTLSEASFAAKHEQWMTKYDRVYEDNAEKERRFAIFKK  63



>ref|XP_006467666.1| PREDICTED: vignain-like [Citrus sinensis]
 gb|KDO77831.1| hypothetical protein CISIN_1g042468mg [Citrus sinensis]
Length=346

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            ++LAA+ +LG WA Q+ + T  + +M +RHE WM +YGR Y+DNAEK  RF+IFK+
Sbjct  10   LVLAAILVLGVWAPQSWSRTLNDATMNERHEMWMAQYGRVYRDNAEKEMRFKIFKE  65



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            +ILA +F+LG  +SQAT+ T ++ SM  R+E+WM RYGR Y D  EK KRF IFK+
Sbjct  12   IILALIFMLGALSSQATSRTLQDASMYGRYEQWMARYGRVYSDINEKEKRFNIFKE  67



>ref|XP_008225219.1| PREDICTED: ervatamin-C-like [Prunus mume]
Length=341

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V++A   +LGT ASQAT+ T  E S   +H++WM +YGR Y DNAEK +R  IFKK
Sbjct  8    VVVAIFIVLGTLASQATSRTLSEASFAAKHDQWMTKYGRVYADNAEKERRLSIFKK  63



>ref|XP_006362426.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  158  ALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            AL +LG WA++AT+    E SM+++HE+WM  +GR Y+D+ EKAKRF IFK
Sbjct  13   ALLVLGMWANEATSRDLNEASMVQKHEKWMAHFGRVYRDDTEKAKRFNIFK  63



>ref|XP_006360708.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  179  HFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++ +   AL +LG  ASQAT+    E S++K+HE+WM R+GR YKD+ EKAKRF+IFK
Sbjct  6    NWKLAFVALLVLGMQASQATSRGLYETSIVKKHEQWMARFGRVYKDDVEKAKRFKIFK  63



>gb|AFV30165.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + V  A +  LG WA Q ++ T ++ SM +RHE+WM RYGR YKD  EK KRF IFK+
Sbjct  8    YQVSFALVLCLGLWAFQVSSRTLQDASMQERHEQWMARYGRVYKDLQEKEKRFSIFKE  65



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIF  9
            L  H  + LA +F++G    +AT+ T ++ SM +RHE+WM RYGR Y DN E+ +RF IF
Sbjct  6    LQLHQCICLAFIFIVGALVCEATSRTLQDASMYERHEQWMARYGRVYHDNNEREQRFNIF  65

Query  8    KK  3
            K+
Sbjct  66   KE  67



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = -1

Query  173  TVILAALFLLGTWASQATTHTCEEP--SMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            T I  +L +LG WA+ A      E   SM +RHE+WM RYGR+YKD++EK KRFQIFK
Sbjct  8    TSIFVSLLVLGMWAALANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKRFQIFK  65



>ref|XP_002310053.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 ref|XP_006380490.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
 gb|EEE90503.1| hypothetical protein POPTR_0007s07200g [Populus trichocarpa]
 gb|ERP58287.1| hypothetical protein POPTR_0007s07190g [Populus trichocarpa]
Length=340

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V LA LF+LG W S++T  T  +  M +RHE+WM +YGR YKD+ E+A R+ IFK+
Sbjct  10   VCLALLFILGAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKE  65



>ref|XP_006380488.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
 gb|ERP58285.1| hypothetical protein POPTR_0007s07170g [Populus trichocarpa]
Length=340

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V LA LF+LG W S++T  T  +  M +RHE+WM +YGR YKD+ E+A R+ IFK+
Sbjct  10   VCLALLFILGAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKE  65



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++  AL ++G WASQA + +  + +M +RHE WM +YGR YKDN+EK +RF+IF+
Sbjct  9    LMFVALLVVGLWASQAWSRSLHDAAMNERHEMWMAKYGRVYKDNSEKERRFEIFR  63



>ref|XP_011021998.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=339

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            + LA LF+L  W S++   T ++ SM +RHE+WM +YGR YKDNAEK  R+ IFK
Sbjct  9    ICLALLFVLVAWPSKSVARTLQDVSMYERHEQWMAQYGRVYKDNAEKETRYNIFK  63



>ref|XP_010103045.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB94643.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=359

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = -1

Query  173  TVILAALFLLGTWASQATTHTCEEP--SMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            T I  +L +LG WA+ A      E   SM +RHE+WM RYGR+YKD++EK KRFQIFK
Sbjct  8    TSIFVSLLVLGMWAALANGRALHEDANSMSERHEQWMARYGRTYKDDSEKEKRFQIFK  65



>ref|XP_002523448.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38907.1| cysteine protease, putative [Ricinus communis]
Length=341

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++  AL ++G W SQA + +  + +M +RHE WMV+YGR YKDN+EK +RF+IF+
Sbjct  9    LMFVALLVVGLWVSQAWSRSLHDAAMNERHEMWMVKYGRVYKDNSEKERRFEIFR  63



>ref|XP_007132875.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
 gb|ESW04869.1| hypothetical protein PHAVU_011G132100g [Phaseolus vulgaris]
Length=343

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA LF +  WA Q T+ T ++ S+ +RHEEWM RY R YKD  EK KRF+IFK+
Sbjct  10   ISLAMLFCMAFWALQVTSRTLQDASIYERHEEWMARYSRVYKDPQEKEKRFRIFKQ  65



>ref|XP_006380493.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
 gb|ERP58290.1| hypothetical protein POPTR_0007s07240g [Populus trichocarpa]
Length=340

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            LA LF+LG W S++T  T  +  M +RHE+WM +YGR YKD+ E+A R+ IFK+
Sbjct  12   LALLFILGAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDTERATRYSIFKE  65



>ref|XP_004297571.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -1

Query  155  LFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            L + G W+S+AT+ T ++ SM  R+E+WM RYGR Y D  EK KRFQIFK
Sbjct  16   LLMFGAWSSEATSRTLQDASMYGRYEQWMARYGRVYNDINEKEKRFQIFK  65



>ref|XP_004290089.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA + +LG W+S+AT+ + ++  M  R+E+WM+RYGR Y D  EK KRF+IFK+
Sbjct  10   ICLALILILGAWSSEATSRSLQDALMYGRYEQWMIRYGRIYSDTDEKEKRFKIFKE  65



>ref|XP_007132882.1| hypothetical protein PHAVU_011G1328001g, partial [Phaseolus vulgaris]
 gb|ESW04876.1| hypothetical protein PHAVU_011G1328001g, partial [Phaseolus vulgaris]
Length=146

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA LF +  WA Q T+ T ++ S+ +RHEEWM RY R YKD  EK KRF+IFK+
Sbjct  10   ISLAMLFCMAFWALQVTSRTLQDASIYERHEEWMARYSRVYKDPQEKEKRFRIFKQ  65



>ref|XP_007211535.1| hypothetical protein PRUPE_ppa008267mg [Prunus persica]
 gb|EMJ12734.1| hypothetical protein PRUPE_ppa008267mg [Prunus persica]
Length=339

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V++A   +LGT ASQAT+ T  E S   +H++WM ++GR Y+ NAEK +RF IFKK
Sbjct  8    VVIAIFIVLGTLASQATSRTLSEASFAAKHDQWMAKFGRVYESNAEKERRFAIFKK  63



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            +++AAL +L  W+SQ T  T  + + ++ HE+WM ++GR YKD AEK+KRF+IFK+
Sbjct  9    LVIAALLVLEMWSSQGTARTLPDAATVQEHEQWMAQFGRVYKDEAEKSKRFRIFKE  64



>ref|XP_007227669.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
 gb|EMJ28868.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
Length=342

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA +F+LG W+SQAT+   ++ SM  ++E+WM RYGR Y D  EK  RF+IFK+
Sbjct  12   ICLALIFMLGAWSSQATSRNLQDASMYGKYEQWMARYGRVYTDIQEKEMRFKIFKE  67



>ref|XP_007132861.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
 gb|ESW04855.1| hypothetical protein PHAVU_011G130900g [Phaseolus vulgaris]
Length=343

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + L  LF +  WA Q T+ T ++ SM +RHEEWM RYGR YKD  E+ KR +IFK+
Sbjct  8    YHISLTLLFCMAIWAFQVTSRTLQDASMNERHEEWMTRYGRVYKDPQEREKRLRIFKE  65



>ref|XP_002525124.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37251.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +++A  F+L  WA QA+T    E +M++RHE+WM ++G+ YKD+ EK +RFQIFK
Sbjct  10   LLIALFFVLAMWADQASTRELHESTMVERHEKWMAKHGKVYKDDEEKLRRFQIFK  64



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            +ILA +F+LG  +SQAT+ T ++ SM  R+E+WM  YGR Y D  EK KRF IFK+
Sbjct  12   IILALIFMLGALSSQATSRTLQDASMYGRYEQWMAHYGRVYSDINEKEKRFNIFKE  67



>ref|XP_007226492.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
 gb|EMJ27691.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
Length=342

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA +F+LG W+SQAT+   ++ SM  ++E+WM RYGR Y D  EK  RF+IFK+
Sbjct  12   ICLALIFMLGAWSSQATSRNLQDASMYGKYEQWMARYGRVYTDIQEKEMRFKIFKE  67



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            +++AAL +L  W+SQ T  T  + + ++ HE+WM ++GR YKD AEK+KRF+IFK+
Sbjct  9    LVIAALLVLEMWSSQGTARTLPDAATVQEHEQWMAQFGRVYKDEAEKSKRFRIFKE  64



>emb|CAN64655.1| hypothetical protein VITISV_005140 [Vitis vinifera]
Length=341

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            + LA LF+L  WAS A      E SM +RHE+WM +YGR YKD  EK+KR++IFK
Sbjct  10   ICLALLFVLAAWASHAKARNLHEASMYERHEDWMAQYGRVYKDAGEKSKRYKIFK  64



>ref|XP_006367781.1| PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed cysteine endopeptidase 
CEP1-like [Solanum tuberosum]
Length=339

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -1

Query  185  MAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            M + + I A L +L  W  QAT+ T  E SM+++H+EWM +Y R YKD  EKA+RF++FK
Sbjct  4    MFNCSYIFATLLVLNLWIIQATSRTLYESSMVEKHDEWMAKYEREYKDEIEKAERFKVFK  63

Query  5    K  3
            +
Sbjct  64   Q  64



>ref|XP_011038210.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
             A   +LGTWA Q T    +EPSM  RHE+WM  +G+ Y D AEK +RF+IFK
Sbjct  11   FAIFLILGTWACQVTPRELQEPSMSARHEQWMATFGKVYADAAEKERRFEIFK  63



>ref|XP_007048673.1| Senescence-associated gene 12, putative [Theobroma cacao]
 gb|EOX92830.1| Senescence-associated gene 12, putative [Theobroma cacao]
Length=304

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIF  9
            +M  F +I    F+L +W SQA +   ++  M  RHE WM +YGR YKDN EK KRF+IF
Sbjct  9    VMVSFVLI----FILVSWVSQAMSRALQDEPMYDRHERWMAQYGRVYKDNYEKEKRFKIF  64

Query  8    KK  3
            K+
Sbjct  65   KE  66



>ref|XP_006360707.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  179  HFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++ +   AL +LG  ASQAT+    E SM+++HE+WM  +GR YKD+ EKAKRF IFK
Sbjct  6    NWKLAFVALLVLGMQASQATSRGLYETSMVQKHEQWMTHFGRVYKDDVEKAKRFNIFK  63



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIF  9
            L+ H  ++L A+ L+  WASQ+ + +  E SM  RH+ WM +YGR YK N EK KRF+IF
Sbjct  3    LLLHNKLVLMAMLLVTLWASQSWSRSLHEASMELRHKTWMTQYGRVYKGNVEKEKRFKIF  62

Query  8    KK  3
            K+
Sbjct  63   KE  64



>ref|XP_004301219.1| PREDICTED: fruit bromelain-like [Fragaria vesca subsp. vesca]
Length=152

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = -1

Query  173  TVILAALFLLGTWASQATTHTCEEPS---MLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            T++L  L + G WASQA   T  +     M+KRH++WM  +GR+YKD+AEK KRF+IFK
Sbjct  9    TILLQVLLIFGIWASQAYCRTFPDADVNVMVKRHDQWMASHGRAYKDHAEKKKRFKIFK  67



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  WASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            WASQ+T  T    SM+++HE+WM++YGR+YKD+AEKA R++IFK+
Sbjct  2    WASQSTARTLPHKSMIEKHEQWMLQYGRTYKDDAEKAFRYKIFKQ  46



>ref|XP_011038211.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=342

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  167  ILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            I+A + +LGTWA +  +   +EPSM  RHE+WM  +G+ Y D AEK +RF+IFK
Sbjct  10   IIAFILILGTWAYEVASRELQEPSMSARHEQWMATFGKVYADAAEKERRFEIFK  63



>ref|XP_006380495.1| hypothetical protein POPTR_0007s07290g [Populus trichocarpa]
 gb|ERP58292.1| hypothetical protein POPTR_0007s07290g [Populus trichocarpa]
Length=321

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V LA LF+ G W S++T  T  +  M +RHE+WM +YGR YKD+ E+A R+ IFK+
Sbjct  10   VCLALLFISGAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDTERATRYSIFKE  65



>ref|XP_008368206.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=344

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +I+A L  LGT ASQAT+ T  E S+  +HE+WM ++GR Y+D+AEK +RF IFK
Sbjct  8    LIVAILITLGTLASQATSRTLYEASIAAKHEQWMEKFGRVYQDSAEKERRFHIFK  62



>ref|XP_007132865.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
 gb|ESW04859.1| hypothetical protein PHAVU_011G131200g [Phaseolus vulgaris]
Length=344

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEP-SMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + LA LF +G W  Q T  T ++  SM +RHEEWM RYG  YKD  E+ KRF+IFKK
Sbjct  8    YHISLALLFCMGFWGFQVTCRTLQDDVSMYERHEEWMTRYGSVYKDPEEREKRFRIFKK  66



>ref|XP_006446793.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
 gb|ESR60033.1| hypothetical protein CICLE_v10018274mg [Citrus clementina]
Length=341

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -1

Query  158  ALFLLGTWASQA-TTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            AL LLG W+ QA ++ T ++ +M +R+E+W  RYGR Y+DNAEK KRF IFK+
Sbjct  13   ALILLGAWSPQAMSSRTLQDAAMYERYEQWTARYGRVYRDNAEKEKRFTIFKQ  65



>ref|XP_011022002.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=365

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA LF+L  W S++   T ++ SM +RHE+WM +YGR YKD+AEK  R+ IFK+
Sbjct  35   ICLALLFVLVAWPSKSVARTLQDVSMYERHEQWMAQYGRVYKDDAEKETRYNIFKE  90



>ref|XP_008391525.1| PREDICTED: fruit bromelain-like [Malus domestica]
Length=147

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +I+A L  LGT ASQAT+ T  E S+  +HE+WM  +GR Y+D+AEK +RF IFK
Sbjct  8    LIVAILITLGTLASQATSRTLYEXSIAAKHEQWMEEFGRVYQDSAEKERRFHIFK  62



>ref|XP_010045985.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84687.1| hypothetical protein EUGRSUZ_B01504 [Eucalyptus grandis]
Length=342

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++L  + +LG WASQA +    E +M +RH++WM R+GR Y+D+AEK +RF IFK
Sbjct  9    LVLVMVAVLGLWASQARSRELHEATMRERHDQWMARHGRVYQDDAEKERRFSIFK  63



>ref|XP_004297572.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -1

Query  155  LFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L + G W S+AT+ T ++ SM  R+E+WM RYGR Y D  EK KRFQIFK+
Sbjct  16   LMMFGGWYSEATSRTLQDASMYGRYEQWMARYGRVYNDINEKEKRFQIFKE  66



>ref|XP_007132887.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
 gb|ESW04881.1| hypothetical protein PHAVU_011G133200g [Phaseolus vulgaris]
Length=343

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + L  LF +  W  Q T+ T ++ SM +RHEEWM RYGR YKD  E+ KR +IFK+
Sbjct  8    YHISLTLLFCMAIWTFQVTSRTLQDASMNERHEEWMTRYGRVYKDPPEREKRLRIFKE  65



>dbj|BAA22544.1| FBSB precursor [Ananas comosus]
Length=356

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 39/57 (68%), Gaps = 3/57 (5%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPS--MLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            V+   LFL   WAS +   + +EPS  M+KR EEWMV YGR YKDN EK +RFQIFK
Sbjct  7    VVFLFLFLCVMWASPSAA-SADEPSDPMMKRFEEWMVEYGRVYKDNDEKMRRFQIFK  62



>gb|KDP40484.1| hypothetical protein JCGZ_24483 [Jatropha curcas]
Length=339

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -1

Query  155  LFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            LF+LG W  ++   T  +P M ++HE+WM RYGR YKD+ EK  R++IFK+
Sbjct  15   LFILGAWTCESMARTVHKPPMYRKHEQWMTRYGRVYKDDNEKEMRYKIFKE  65



>ref|XP_011009181.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=276

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V LA LF+ G W S++T  T  +  M +RHE+WM +YGR YKD+ E+A R+ IFK+
Sbjct  30   VCLALLFISGAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKE  85



>dbj|BAF56427.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + +  A +  LG WA Q ++ T ++ SM +RHE+WM RYG+ YKD  EK KRF IF++
Sbjct  8    YQISFALVLCLGLWAFQVSSRTLQDASMHERHEQWMARYGKVYKDLQEKEKRFNIFQE  65



>ref|XP_008779585.1| PREDICTED: zingipain-2-like [Phoenix dactylifera]
Length=326

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -1

Query  149  LLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +LG W S AT H   +  M +RHE+WMV+YGR Y D AEK +RFQIF+
Sbjct  2    VLGVWVSGATAHGIADEPMSRRHEQWMVQYGRVYMDAAEKERRFQIFR  49



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V LA LF+ G W S++T  T  +  M +RHE+WM +YGR YKD+ E+A R+ IFK+
Sbjct  10   VCLALLFISGAWPSKSTARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKE  65



>ref|XP_010091715.1| hypothetical protein L484_001478 [Morus notabilis]
 gb|EXB44999.1| hypothetical protein L484_001478 [Morus notabilis]
Length=353

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -1

Query  173  TVILAALFLLGTWASQATTHTC-EEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            T+ LA   +LG WASQA      EE S+ + HE+WM R+GR+YKDNAEK +R +I+K+
Sbjct  9    TIFLALNLVLGLWASQAECRKPPEEASLRESHEQWMARHGRTYKDNAEKEQRLKIYKE  66



>ref|XP_003612210.1| Cysteine proteinase [Medicago truncatula]
 gb|AES95168.1| papain family cysteine protease [Medicago truncatula]
Length=344

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + LA +F LG WA Q T+ T ++ SM +RHE WM  YG+ YKD+ E+ KRF+IF +
Sbjct  8    YHISLALVFCLGLWAIQVTSRTLQDGSMHERHERWMNHYGKVYKDHQEREKRFKIFTE  65



>ref|XP_009601307.1| PREDICTED: ervatamin-B-like isoform X2 [Nicotiana tomentosiformis]
Length=331

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            +A L +LG  AS+A++    E SM+++H +WM R+GR+YKD+AEKAKR +IFK+
Sbjct  1    MAPLLVLGMHASRASSRGLYEASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKE  54



>ref|XP_004305438.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Fragaria 
vesca subsp. vesca]
Length=337

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -1

Query  173  TVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            ++ L  + + G W+S+AT+   ++ SM +R+E+WM RYGR Y +  EK  RF IFKK
Sbjct  5    SICLCLILMFGAWSSEATSRNVQDASMYERYEQWMARYGRQYSNMNEKETRFNIFKK  61



>ref|XP_008340275.1| PREDICTED: fruit bromelain-like [Malus domestica]
Length=660

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +I+A L  LGT ASQAT+ T  E S+  +HE+WM ++GR Y+D+AEK +RF IFK
Sbjct  8    LIVAILITLGTLASQATSRTLYEASIAAKHEQWMEKFGRVYQDSAEKERRFHIFK  62


 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 6/53 (11%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            LA +  LGT ASQAT       S+  +HE+WM ++GR Y+D+AEK +RF IFK
Sbjct  335  LAMVITLGTLASQATF------SIAAKHEQWMEKFGRVYQDSAEKERRFHIFK  381



>ref|XP_010091714.1| Fruit bromelain [Morus notabilis]
 gb|EXB44998.1| Fruit bromelain [Morus notabilis]
Length=621

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  173  TVILAALFLLGTWASQATTH-TCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            T I  AL +LG WASQA      +E S+  +HE+WM R+GR YKDNAEK +R +IFK+
Sbjct  8    TTIFLALLVLGIWASQADCRRPLDEASIRAKHEQWMARHGRVYKDNAEKEERLKIFKE  65


 Score = 47.0 bits (110),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = -1

Query  143  GTWASQATTHTC--EEPSMLKRHEEWMVRYGRSYKDNAEK  30
            GTW SQAT+ T   E  ++   HEEWM  YGRSY D+ EK
Sbjct  333  GTWLSQATSRTLHDELAAVETLHEEWMANYGRSYADDEEK  372



>ref|XP_007212585.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
 gb|EMJ13784.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
Length=339

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  155  LFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            LF+LG W+ +AT+ + ++ SM  R+E+WM RYGR Y D  EK  RF+IFK+
Sbjct  12   LFMLGAWSCEATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKE  62



>ref|XP_007132895.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
 gb|ESW04889.1| hypothetical protein PHAVU_011G134000g [Phaseolus vulgaris]
Length=343

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + L  LF +  WA Q T+ T ++ SM +RH EWM RYGR YKD  E+ KR +IFK+
Sbjct  8    YHISLTLLFCMAIWAFQVTSRTLQDTSMNERHAEWMTRYGRVYKDPQEREKRLRIFKE  65



>ref|XP_011014442.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=360

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V LA LF++G W S++   T  +  M +RHE+WM +YGR YKD+ E+A R+ IFK+
Sbjct  30   VCLALLFIVGAWPSKSIARTLLDAPMYERHEQWMTQYGRVYKDDNERATRYSIFKE  85



>emb|CDP06286.1| unnamed protein product [Coffea canephora]
Length=300

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L A  +L   ASQAT+ +  E SM ++HE+WM ++GR YKD+AEKA R++IFK+
Sbjct  11   LTAFLMLAMMASQATSRSLNEGSMTEKHEQWMAQHGRVYKDDAEKADRYKIFKE  64



>ref|XP_009359979.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA +F+LG  +SQAT+ T ++ SM  ++E+WM  YGR+Y D  EK KRF IFK+
Sbjct  12   ICLAFIFILGALSSQATSRTLQDASMYAKYEQWMASYGRAYADINEKEKRFNIFKE  67



>ref|XP_006376349.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
 gb|ERP54146.1| hypothetical protein POPTR_0013s12260g [Populus trichocarpa]
Length=342

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
             A + +LGTWA +  +   +EPSM  RHE+WM  YG+ Y D AEK +RF+IFK
Sbjct  11   FAFILILGTWAYEVASRELQEPSMSARHEQWMETYGKVYADAAEKERRFEIFK  63



>emb|CAA08860.1| cysteine proteinase precursor, AN8 [Ananas comosus]
Length=356

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 3/57 (5%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPS--MLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++   LFL   WAS +   + +EPS  M+KR EEWMV YGR YKDN EK +RFQIFK
Sbjct  7    LVFLFLFLCVMWASPSAA-SADEPSDPMMKRFEEWMVEYGRVYKDNDEKMRRFQIFK  62



>ref|XP_009352952.1| PREDICTED: fruit bromelain-like [Pyrus x bretschneideri]
Length=315

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +I+  L  LGT AS+AT+ T  + S+  +HE+WM ++GR Y+D+AEK +RFQIFK
Sbjct  8    LIVTILITLGTLASEATSRTLYQASIAAKHEQWMKKHGRVYQDSAEKERRFQIFK  62



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -1

Query  134  ASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            A QAT+    E S++KRHE+WM R+GR YKD+AEKAKRF+IFK
Sbjct  3    AYQATSRDLYEASIVKRHEQWMARFGRVYKDDAEKAKRFKIFK  45



>ref|XP_010317330.1| PREDICTED: uncharacterized protein LOC101251741 [Solanum lycopersicum]
Length=802

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  158  ALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            AL +L  W  + T+    E SM+++HE+WM R+GR Y+D+AEKAKRF IFK
Sbjct  475  ALAVLTMWTIEVTSRELNEASMVQKHEKWMARFGRVYRDDAEKAKRFNIFK  525



>ref|XP_004252607.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=340

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  158  ALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            AL +L   ASQAT+    E SM+++H++WM R+GR YKD+ EKAKRF+IFK
Sbjct  13   ALLVLVMQASQATSRGLYETSMVQKHDQWMTRFGRVYKDDVEKAKRFKIFK  63



>ref|XP_009352792.1| PREDICTED: zingipain-1-like [Pyrus x bretschneideri]
Length=344

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +I+  L  LGT AS+AT+ T  + S+  +HE+WM ++GR Y+D+AEK +RFQIFK
Sbjct  8    LIVTILITLGTLASEATSRTLYQASIATKHEQWMKKHGRVYQDSAEKERRFQIFK  62



>ref|XP_009601306.1| PREDICTED: ervatamin-B-like isoform X1 [Nicotiana tomentosiformis]
Length=341

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIF  9
            L  ++ +  AAL +LG  AS+A++    E SM+++H +WM R+GR+YKD+AEKAKR +IF
Sbjct  3    LTFNWKLAFAALLVLGMHASRASSRGLYEASMVQKHAQWMARFGRAYKDDAEKAKRLKIF  62

Query  8    KK  3
            K+
Sbjct  63   KE  64



>ref|XP_010912725.1| PREDICTED: zingipain-2-like [Elaeis guineensis]
Length=337

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = -1

Query  185  MAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            MAH   +LA L +LG W   A      +  M  RHE+WM +YGR YKD AEK +RFQIFK
Sbjct  1    MAHRCFVLA-LIVLGVWVFGAMARGIADVPMSTRHEQWMAQYGRVYKDAAEKERRFQIFK  59



>ref|XP_007132868.1| hypothetical protein PHAVU_011G1314000g, partial [Phaseolus vulgaris]
 gb|ESW04862.1| hypothetical protein PHAVU_011G1314000g, partial [Phaseolus vulgaris]
Length=256

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA LF +   A Q T+ T ++ S+ +RHEEWM RY R YKD  EK KRF+IFK+
Sbjct  10   ISLAMLFCMAFCALQVTSRTLQDASIYERHEEWMARYSRVYKDPQEKEKRFKIFKQ  65



>ref|XP_008228868.1| PREDICTED: LOW QUALITY PROTEIN: zingipain-2-like [Prunus mume]
Length=345

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  155  LFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L +LG  +S+AT+ + ++ SM  RHE+WM RYGR+Y D  EK KRF IFK+
Sbjct  19   LIMLGACSSEATSRSLQDASMYGRHEQWMARYGRTYNDIREKEKRFNIFKE  69



>ref|XP_008223851.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA +F+LG W+SQAT+   ++ SM  ++E+WM RY R Y D  EK  RF+IFK+
Sbjct  12   ICLALIFMLGAWSSQATSRNLQDASMYGKYEQWMARYERVYMDIQEKEMRFKIFKE  67



>ref|XP_009352948.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=364

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +I+  L  LGT AS+AT+ T  + S+  +HE+WM ++GR Y+D+AEK +RFQIFK
Sbjct  8    LIVTILVTLGTLASEATSRTLYQASIAAKHEQWMKKHGRVYQDSAEKDRRFQIFK  62



>ref|XP_009352795.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +I+  L  LGT AS+AT+ T  + S+  +HE+WM ++GR Y+D+AEK +RFQIFK
Sbjct  8    LIVTILVTLGTLASEATSRTLYQASIAAKHEQWMKKHGRVYQDSAEKDRRFQIFK  62



>ref|XP_003527350.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003556993.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA  F LG  A Q  + T ++ SM +RHE+WM RYG+ YKD  EK KRF++FK+
Sbjct  10   ISLALFFCLGFLAFQVASRTLQDASMYERHEQWMARYGKVYKDPEEKEKRFRVFKE  65



>ref|XP_007213554.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
 gb|EMJ14753.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
Length=343

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = -1

Query  167  ILAALFLLGTWASQATTHTC--EEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            IL  L +LG WASQA   T      SML RHE+WM RY   YKD+ E+ KRFQIFK
Sbjct  11   ILLTLLVLGVWASQANCRTLLDAHTSMLDRHEQWMARYVPIYKDDEEREKRFQIFK  66



>gb|KDP23191.1| hypothetical protein JCGZ_00324 [Jatropha curcas]
Length=287

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -1

Query  155  LFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            + +LG +ASQA     ++ +M +RHE WM +YGR YKDNAEK KRF IFK
Sbjct  63   VLVLGLFASQALARPLQDETMKERHEMWMAKYGRVYKDNAEKEKRFNIFK  112



>ref|XP_008779806.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=326

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -1

Query  149  LLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +LG W S A      +  ML+RHE+WM +YGR YKD AEK +RFQIF+
Sbjct  2    VLGVWVSGAMARGIADEPMLRRHEQWMAQYGRVYKDAAEKERRFQIFR  49



>ref|XP_011045912.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=362

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 9/69 (13%)
 Frame = -1

Query  185  MAHFT---------VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAE  33
            +AHF+         +I A + LLG W S   + +  E SM++RHE WM +YGR+YKD  E
Sbjct  18   LAHFSRMAFIPENKLIFAVVLLLGLWTSHVWSRSLYEASMMERHETWMAQYGRAYKDRVE  77

Query  32   KAKRFQIFK  6
            K +R   FK
Sbjct  78   KERRLNTFK  86



>ref|XP_006469011.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -1

Query  158  ALFLLGTWASQA-TTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            AL LLG W  QA ++ T ++ +M +R+E+W  RYGR Y+DN EK KRF IFK+
Sbjct  13   ALILLGAWIPQAMSSRTLQDAAMYERYEQWTARYGRVYRDNVEKEKRFTIFKQ  65



>ref|XP_009354268.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L  + +LG W+SQAT+ + ++ SM  R+E+W+ RYGR Y D  EK  RF+IFK+
Sbjct  14   LGLILMLGAWSSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKE  67



>ref|XP_007132888.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
 gb|ESW04882.1| hypothetical protein PHAVU_011G133300g [Phaseolus vulgaris]
Length=343

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + LA LF +G  A Q +  T ++ SM +RHE+WM RY R YKD  EK KRF+IFK+
Sbjct  8    YHISLALLFCIGFLAFQVSCRTLQDASMHERHEQWMTRYSRVYKDPEEKEKRFRIFKE  65



>ref|XP_009616844.1| PREDICTED: zingipain-1-like [Nicotiana tomentosiformis]
Length=341

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  167  ILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            ++A L ++G +  QAT+   +  SML+RHE+WM  +GR YKD+ EKAKRF IFK+
Sbjct  10   LVAILLVVGIFGFQATSRDLQVYSMLERHEKWMSNHGRVYKDDVEKAKRFNIFKE  64



>ref|XP_006446792.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
 gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina]
Length=341

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -1

Query  158  ALFLLGTWASQA-TTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            AL LLG W  QA ++   ++ +M +R+E+W  RYGR Y+DNAEK KRF IFK+
Sbjct  13   ALILLGAWIPQALSSRALQDAAMYERYEQWTARYGRVYRDNAEKEKRFTIFKQ  65



>ref|XP_008223852.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA +F+LG W+SQAT+   ++ SM  ++E+WM RYGR +    EK  RF+IFK+
Sbjct  12   ICLALIFMLGAWSSQATSRNLQDASMYGKYEQWMTRYGRVFTGVQEKEMRFKIFKE  67



>dbj|BAB13759.1| cysteine proteinase [Astragalus sinicus]
Length=343

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + LA L  LG WA Q T+ T ++ SM +RH++WM +Y + Y D+ E  KRFQIFK+
Sbjct  8    YYISLALLMCLGLWAVQVTSRTLQDASMYERHQQWMGQYAKIYNDHQEWEKRFQIFKE  65



>ref|XP_009352793.1| PREDICTED: zingipain-2-like [Pyrus x bretschneideri]
Length=344

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +I+  L  LGT AS+AT+ T  + S+  +HE+WM ++GR Y+D+AEK +RFQIFK
Sbjct  8    LIVTILVTLGTLASEATSRTLYQASIAAKHEQWMKKHGRVYQDSAEKDRRFQIFK  62



>ref|XP_002522571.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39871.1| cysteine protease, putative [Ricinus communis]
Length=343

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTC-EEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +++  L +LGTW SQA         ++ ++HE+WM R+GR+Y DNAEK +RFQIFK
Sbjct  10   LVITLLMILGTWVSQAMPRPLLNAEAIAEKHEQWMARHGRTYHDNAEKERRFQIFK  65



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +AAL + G    QAT+    E SM+++HE+WM R+GR YK++ EKAKRF+IFK
Sbjct  12   VAALLVFGMQDFQATSRGLYETSMVQKHEQWMTRFGRVYKNDVEKAKRFKIFK  64



>ref|XP_004303175.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA + +LG W+S+AT+ + ++  M  R+E+WM RY R Y D  EK KRFQIFK+
Sbjct  10   IYLALIIMLGAWSSEATSRSLQDVIMYGRYEQWMARYERVYSDFDEKEKRFQIFKE  65



>ref|XP_008345990.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=341

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +I+A L  LGT ASQAT+ T  E S+  +HE+WM  +GR Y+D+AE  +RF IFK
Sbjct  8    LIVAILITLGTLASQATSRTLYEXSIAAKHEQWMEEFGRVYQDSAEXERRFHIFK  62



>sp|P80884.2|ANAN_ANACO RecName: Full=Ananain; Flags: Precursor [Ananas comosus]
 emb|CAA05487.1| Ananain precursor [Ananas comosus]
Length=345

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATTHTCEEPS--MLKRHEEWMVRYGRSYKDNAEKAKRFQ  15
            + +   ++   LFL   WAS +   +C+EPS  M+K+ EEWM  YGR YKDN EK  RFQ
Sbjct  1    MTSKVQLVFLFLFLCVMWASPSAA-SCDEPSDPMMKQFEEWMAEYGRVYKDNDEKMLRFQ  59

Query  14   IFK  6
            IFK
Sbjct  60   IFK  62



>ref|XP_004293931.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP1-like [Fragaria 
vesca subsp. vesca]
Length=345

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            VILA     GT ASQATTH   E S+ ++HE+WM ++GR Y D++EK +R  IF K
Sbjct  8    VILAIFISFGTLASQATTHALYEASIAQKHEQWMAKHGRVYPDSSEKERRLAIFTK  63



>ref|XP_006362428.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=341

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = -1

Query  158  ALFLLGT-WASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            AL ++G  WA++AT+    E SM++++E+WM R+GR Y+D+ EKAKRF IFK
Sbjct  13   ALLVIGILWANEATSRDLNEASMVQKNEKWMARFGRVYRDDTEKAKRFNIFK  64



>ref|XP_010052206.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  167  ILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            IL A  +LG +ASQA      E SM +RHE+WM R+GR YK + EK +RF IFK
Sbjct  10   ILVAAMVLGLYASQAWARELRELSMRERHEQWMARHGRVYKADGEKERRFMIFK  63



>ref|XP_002316833.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
 gb|EEE97445.2| hypothetical protein POPTR_0011s07520g [Populus trichocarpa]
Length=362

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 9/69 (13%)
 Frame = -1

Query  185  MAHFT---------VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAE  33
            +AHF+         +I A + LLG W S   + +  E SM++RHE WM +YGR+YK + E
Sbjct  18   LAHFSRMAFIPENKLIFAVVLLLGLWTSHVWSRSLYEASMMERHETWMAQYGRAYKGHVE  77

Query  32   KAKRFQIFK  6
            K +R  IFK
Sbjct  78   KERRLNIFK  86



>ref|XP_010939512.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  155  LFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            L +LG W S AT     +  +  RHE+WM RYGR YKD  EK +RFQIFK
Sbjct  12   LIVLGVWVSAATARGIADVPISTRHEQWMARYGRVYKDAVEKERRFQIFK  61



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L+ + +LG W+S AT+ T ++ SM  R+E+W+ RYGR Y D  EK  RF+IFK+
Sbjct  14   LSLILMLGAWSSGATSRTLQDASMYGRYEQWLTRYGRVYNDVNEKETRFKIFKE  67



>emb|CAL64936.1| putative cysteine protease 8 [Trifolium pratense]
Length=344

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + LA LF LG +A Q T+ T ++ SM +RH +WM +YG+ YKD+ E+  RF+IFK+
Sbjct  8    YHISLALLFCLGLFAIQVTSRTLQDDSMYERHGQWMSQYGKIYKDHQERETRFKIFKE  65



>gb|ADY68475.1| stem bromelain [Ananas comosus]
Length=291

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPS--MLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++   LFL   WAS +     +EPS  M+KR EEWM  YGR YKDN EK +RFQIFK
Sbjct  7    LVFLFLFLCVMWASPSAASR-DEPSDPMMKRFEEWMAEYGRVYKDNDEKMRRFQIFK  62



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -1

Query  155  LFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            L +LG W S AT     +  M  RHE+WM +YGR YKD  EK +RFQIFK
Sbjct  12   LIVLGVWVSGATARGIADVPMSTRHEQWMAQYGRVYKDAVEKERRFQIFK  61



>ref|XP_008353750.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  155  LFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + +LG W+SQAT+ + ++ SM  R+E+W+ RYGR Y D  EK  RF+IFK+
Sbjct  17   ILMLGAWSSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKE  67



>ref|XP_007132874.1| hypothetical protein PHAVU_011G132000g [Phaseolus vulgaris]
 gb|ESW04868.1| hypothetical protein PHAVU_011G132000g [Phaseolus vulgaris]
Length=329

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEP-SMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + LA LF +G W  Q T  T ++  SM +RHEEWM RYG  Y D  E+ KRF+I KK
Sbjct  8    YHISLALLFCMGFWGFQVTCRTLQDDVSMYERHEEWMTRYGSVYNDPEEREKRFRILKK  66



>ref|XP_002531151.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31236.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA +FLLG   SQA   T ++ SM ++HEEWM R+GR Y D  EK  R++IFK+
Sbjct  10   ISLALIFLLGALVSQAMARTLQDASMHEKHEEWMSRFGRVYNDGNEKEIRYKIFKE  65



>ref|XP_004306851.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            LA + +LG W+S+AT+ + ++     R+E+WM RYGR Y D  EK +RF+IFK
Sbjct  12   LALVLMLGAWSSEATSRSLQDALAYGRYEQWMARYGRVYNDATEKEERFKIFK  64



>ref|XP_009344439.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
 ref|XP_009344444.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L+ + +LGTW+S AT+ T ++  M  R+E+W+ RYGR Y D  EK  RF+IFK+
Sbjct  3    LSLILMLGTWSSGATSRTLQDAPMYGRYEQWLTRYGRVYNDVNEKETRFKIFKE  56



>ref|XP_007217611.1| hypothetical protein PRUPE_ppa016402mg [Prunus persica]
 gb|EMJ18810.1| hypothetical protein PRUPE_ppa016402mg [Prunus persica]
Length=131

 Score = 61.6 bits (148),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  149  LLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            +L TW+S+AT+ + ++ SM  RHE+WM RY R+Y D  EK KRF IFK+
Sbjct  1    MLRTWSSEATSRSLQDASMYGRHEQWMARYARTYNDIREKEKRFNIFKE  49



>ref|XP_009352794.1| PREDICTED: fruit bromelain [Pyrus x bretschneideri]
Length=116

 Score = 61.2 bits (147),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            +I+  L  LGT AS+AT+ T  + S+  +HE+WM ++G  Y+D+AEK +RFQIFK 
Sbjct  8    LIVTILITLGTLASEATSRTLYQASIAAKHEQWMKKHGHVYQDSAEKERRFQIFKN  63



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATTHTC-EEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQI  12
            L  ++ +  AAL +L ++ASQAT+    E  SM+++HE+WM  +GR YKD+ EKAKRF+I
Sbjct  4    LTFNWNLAFAALLVLVSFASQATSRDLYEAASMVQKHEQWMSHFGRVYKDDVEKAKRFKI  63

Query  11   FK  6
            F+
Sbjct  64   FQ  65



>ref|XP_008383642.1| PREDICTED: zingipain-1-like [Malus domestica]
Length=341

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +I+  L  LGT AS+AT+ T  + S+  +HE+WM ++GR Y+D+AEK +RF IFK
Sbjct  8    LIVTILITLGTLASEATSRTLYQASIAAKHEQWMKKHGRVYQDSAEKERRFHIFK  62



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = -1

Query  185  MAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            MA  +  LA LF++G WA QA++ +  E SM  R E+W+   GR Y+D +EK KR QIFK
Sbjct  1    MASTSRSLALLFIVGIWACQASSRSVPEVSMSDRFEQWLASCGRVYQDASEKEKRLQIFK  60

Query  5    K  3
            +
Sbjct  61   E  61



>ref|XP_006469012.1| PREDICTED: vignain-like [Citrus sinensis]
Length=341

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -1

Query  158  ALFLLGTWASQA-TTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            AL LLG W  QA ++   ++ +M +R+E+W  RYGR Y+DN EK KRF IFK+
Sbjct  13   ALILLGAWIPQALSSRALQDAAMYERYEQWTARYGRVYRDNVEKEKRFTIFKR  65



>dbj|BAA22545.1| FB22 precursor [Ananas comosus]
Length=340

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPS--MLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++   LFL   WAS +     +EPS  M+KR EEWM  YGR YKDN EK +RFQIFK
Sbjct  7    LVFLFLFLCVMWASPSAASR-DEPSDPMMKRFEEWMAEYGRVYKDNDEKMRRFQIFK  62



>ref|XP_011047550.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=194

 Score = 61.6 bits (148),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V LA LF+LG W  ++   T ++  M +RHE+WM +Y R YKD++E+A R+ IF +
Sbjct  30   VCLALLFILGAWPYKSIARTLQDAPMYERHEQWMTQYVRVYKDDSERATRYSIFNE  85



>dbj|BAA21848.1| bromelain [Ananas comosus]
 dbj|BAA22543.1| FB31 precursor [Ananas comosus]
Length=352

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPS--MLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++   LFL   WAS +     +EPS  M+KR EEWM  YGR YKDN EK +RFQIFK
Sbjct  7    LVFLFLFLCVMWASPSAASR-DEPSDPMMKRFEEWMAEYGRVYKDNDEKMRRFQIFK  62



>gb|AEH26024.1| cysteine peptidase [Ananas comosus]
Length=352

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPS--MLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++   LFL   WAS +     +EPS  M+KR EEWM  YGR YKDN EK +RFQIFK
Sbjct  7    LVFLFLFLCVMWASPSAASR-DEPSDPMMKRFEEWMAEYGRVYKDNDEKMRRFQIFK  62



>ref|XP_006449485.1| hypothetical protein CICLE_v10017834mg [Citrus clementina]
 gb|ESR62725.1| hypothetical protein CICLE_v10017834mg [Citrus clementina]
Length=368

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  143  GTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            G+WASQAT  T +E S+ ++ E+W  +YGR+YK++AE +KRF+IFK
Sbjct  4    GSWASQATYRTFDEGSIAEKFEQWKAQYGRTYKESAENSKRFEIFK  49



>ref|XP_008342777.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L  + +LG W+S+AT+ + ++ SM  R+++W+ RYGR Y D  EK  RF+IFK+
Sbjct  3    LGLILMLGAWSSEATSRSLQDASMYGRYKQWLARYGRIYNDTNEKETRFKIFKE  56



>gb|AGS78388.1| bromelain [Ananas comosus]
Length=355

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPS--MLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++   LFL   WAS +     +EPS  M+KR EEWM  YGR YKDN EK +RFQIFK
Sbjct  7    LVFLFLFLCVMWASPSAASR-DEPSDPMMKRFEEWMAEYGRVYKDNDEKMRRFQIFK  62



>emb|CAA08861.1| cysteine proteinase precursor, AN11 [Ananas comosus]
Length=357

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPS--MLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++   LFL   WAS +     +EPS  M+KR EEWM  YGR YKDN EK +RFQIFK
Sbjct  7    LVFLFLFLCVMWASPSAASR-DEPSDPMMKRFEEWMAEYGRVYKDNDEKMRRFQIFK  62



>ref|XP_009354269.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L  + +LG W+SQAT+ + ++ S+  R+E+W+ RYGR Y D  EK  RF+IFK+
Sbjct  3    LGLILMLGAWSSQATSRSLQDASIYARYEQWLARYGRVYNDVDEKEIRFKIFKE  56



>ref|XP_008342782.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L  + +LG W+S+AT+ + ++ SM  R+++W+ RYGR Y D  EK  RF+IFK+
Sbjct  3    LGLILMLGAWSSEATSRSLQDASMYGRYKQWLARYGRIYNDTNEKETRFKIFKE  56



>ref|XP_009349242.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=484

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            LA +F+LG  +SQAT+ T ++ SM  ++E+WM RYGR+Y +  EK K F IFK+
Sbjct  156  LAFIFILGALSSQATSRTLQDASMYAKYEQWMARYGRAYAEINEKEKHFNIFKE  209



>ref|XP_003526232.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = -1

Query  179  HFTVILAALFLLGTW-ASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            HF  I  A+ L  T+ A Q T  T ++ SM +RHE+WM RYG+ YKD  E+ KRF++FK+
Sbjct  6    HFNHISLAMLLCMTFLAFQVTCRTLQDASMYERHEQWMTRYGKVYKDPQEREKRFRVFKE  65



>ref|XP_003527349.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + LA LF  G  A Q T  T ++ SM +RHEEWM RY + YKD  E+ +RF+IFK+
Sbjct  8    YQISLALLFCSGFLAFQVTCRTLQDASMYERHEEWMGRYAKVYKDPQERERRFKIFKE  65



>ref|XP_006367780.1| PREDICTED: ananain-like [Solanum tuberosum]
Length=348

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 4/60 (7%)
 Frame = -1

Query  179  HFTVILAALFLLGTWASQATTHTCEEPS-MLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
             FT++     + G +ASQ T    ++PS ML++HE WM R+GR+Y+++ EKAKR  IFKK
Sbjct  10   QFTLLFV---IFGMYASQVTCRNLQDPSSMLEKHESWMARHGRAYENDIEKAKRLNIFKK  66



>ref|XP_006592467.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = -1

Query  179  HFTVI-LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            HF  I LA L  +   A Q T  T ++ SM +RHE+WM RYG+ YKD  E+ KRF+IFK+
Sbjct  6    HFYHISLAMLLCMAFLAFQVTCRTLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKE  65



>ref|XP_008342776.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L  + +L  W+SQAT+ + ++ SM  R+E+W+ RYGR Y D  EK  RF+IFK+
Sbjct  3    LGLILMLXAWSSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKE  56



>ref|XP_009359957.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA +F+LG  +SQAT+   ++ SM  ++E+WM RYGR Y    EK KRF IFK+
Sbjct  12   ICLALIFMLGDLSSQATSRALQDASMYGKYEQWMARYGRVYTGINEKEKRFNIFKE  67



>gb|EYU19037.1| hypothetical protein MIMGU_mgv1a018631mg [Erythranthe guttata]
Length=325

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  137  WASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            +ASQ+T  T    SM+++HE+WMV+ GR+YKD+AEKA R++IFK+
Sbjct  2    YASQSTARTLPNKSMIEKHEQWMVQCGRTYKDDAEKAFRYKIFKQ  46



>ref|XP_003527388.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + LA LF +G  A Q T  T ++ SM +RH +WM RY + YKD  E+ KRF+IFK+
Sbjct  8    YHISLALLFCMGFLAFQVTCRTLQDASMYERHAQWMARYAKVYKDPQEREKRFRIFKE  65



>ref|XP_008342781.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L  + +L  W+SQAT+ + ++ SM  R+E+W+ RYGR Y D  EK  RF+IFK+
Sbjct  3    LGLILMLXAWSSQATSRSLQDASMYGRYEQWLARYGRVYNDVDEKETRFKIFKE  56



>ref|XP_009767421.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=334

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 43/59 (73%), Gaps = 4/59 (7%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHT-CEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            F ++L A+  LG WAS+ T  T  +EP MLK +E+WM++YGR YK+NAEK   F+IFKK
Sbjct  3    FLILLFAI--LGIWASKTTARTLVDEPLMLK-YEQWMIQYGRVYKNNAEKDSHFKIFKK  58



>ref|XP_007212667.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
 gb|EMJ13866.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
Length=326

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -1

Query  149  LLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            +LG W+ +AT+ + ++ SM  R+E+WM RYGR Y D  EK  RF+IFK+
Sbjct  1    MLGAWSCEATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKE  49



>ref|XP_008811650.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=302

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  158  ALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++ LL   AS AT  T  E +M +RHE+WM + GR+Y+D+AEK +R+QIFK
Sbjct  14   SVLLLCACASHATARTLSEMTMAERHEQWMAQQGRAYRDSAEKERRYQIFK  64



>emb|CDP18639.1| unnamed protein product [Coffea canephora]
Length=337

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  SQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            SQAT  +  E S+ ++HE+WMV +GR YKD AEKAKRF+IFK+
Sbjct  22   SQATARSLYEASLTEKHEQWMVEHGRVYKDEAEKAKRFKIFKE  64



>ref|XP_008353751.1| PREDICTED: actinidain-like [Malus domestica]
Length=227

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L  + +LG W+SQAT+ + ++ SM  R+E+W+ RYGR + D  EK  RF+IFK+
Sbjct  14   LGLILVLGAWSSQATSRSLQDASMYGRYEQWLARYGRVHNDINEKETRFKIFKE  67



>ref|XP_003539770.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            LA L L G WA  A T T E+ SM +RHE+WM ++G+ YKD+ EK  R++IF++
Sbjct  12   LALLLLFGFWAFSANTRTLEDASMHERHEQWMAQHGKVYKDHHEKELRYKIFQQ  65



>ref|XP_009357171.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L+ + +LG W+S AT+ T ++ S+  R+E+W+ RYGR Y D  EK  RF+IFK+
Sbjct  14   LSLILMLGAWSSGATSRTLQDASIYGRYEQWLTRYGRVYNDVNEKETRFKIFKE  67



>emb|CDP20741.1| unnamed protein product, partial [Coffea canephora]
Length=165

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L A+ +L   ASQAT+ +  E  M ++HE+WM ++GR YKD+AEKA R++ FK+
Sbjct  11   LTAVLMLAMMASQATSRSLNEAPMTEKHEQWMAQHGRVYKDDAEKADRYKTFKE  64



>ref|XP_006592465.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_006607017.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = -1

Query  179  HFTVI-LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            HF  I LA L  +   A Q T  + ++ SM +RHE+WM RYG+ YKD  E+ KRF+IFK+
Sbjct  6    HFCHISLAMLLCMAFLAFQVTCRSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKE  65



>ref|XP_010906194.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X1 [Elaeis guineensis]
Length=343

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 6/60 (10%)
 Frame = -1

Query  185  MAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            MA F ++L A       AS AT  T  E +M +RHE+WMVR+GR YK++AEK +RFQIFK
Sbjct  11   MALFVLVLCAC------ASHATARTLTEMTMAERHEQWMVRHGRVYKESAEKERRFQIFK  64



>ref|XP_010045986.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW84688.1| hypothetical protein EUGRSUZ_B01505 [Eucalyptus grandis]
Length=342

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++L  + +LG WASQ  +    + +M +RHE+WM R+G  Y+D+AEK +RF IFK
Sbjct  9    LVLVMVAILGLWASQVRSRELHKATMRQRHEQWMARHGWVYQDDAEKERRFSIFK  63



>ref|XP_008340724.1| PREDICTED: vignain-like [Malus domestica]
Length=338

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
             A +F+LG  +S AT+ T ++PSM  ++E+WM  YGR Y +  EK KRF IFK
Sbjct  10   FALIFMLGALSSHATSRTLQDPSMYGKYEQWMAHYGRVYTNINEKEKRFNIFK  62



>ref|XP_003557016.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = -1

Query  179  HFTVI-LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            HF  I LA L  +   A Q T  + ++ SM +RHE+WM RYG+ YKD  E+ KRF+IFK+
Sbjct  6    HFCHISLAMLLCMAFLAFQVTCRSLQDASMYERHEQWMTRYGKVYKDPQEREKRFRIFKE  65



>emb|CDP18638.1| unnamed protein product [Coffea canephora]
Length=337

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  131  SQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            SQAT  +  E S+ ++HE+WMV +GR YKD AEKAKRF+IFK+
Sbjct  22   SQATARSLYEASLTEKHEQWMVEHGRVYKDEAEKAKRFKIFKE  64



>gb|KDP45578.1| hypothetical protein JCGZ_17185 [Jatropha curcas]
Length=340

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -1

Query  179  HFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            H  + LA +F+L   ASQA   + ++ SM +RHE+WM + GR YKD  EK  R++IFK+
Sbjct  7    HQCIFLALIFILAALASQAIARSLQDASMYERHEDWMAQNGRVYKDANEKEIRYKIFKE  65



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIF  9
            L  ++ V   AL +L  + SQAT+    E S+ ++H++WM  +GR YKD+ EKAKRF+IF
Sbjct  4    LTFNWKVAFGALLVLEMFVSQATSRDLYEASIFQKHKQWMSLFGRVYKDDIEKAKRFKIF  63

Query  8    K  6
            K
Sbjct  64   K  64



>ref|XP_002519955.1| cysteine protease, putative [Ricinus communis]
 gb|EEF42559.1| cysteine protease, putative [Ricinus communis]
Length=321

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -1

Query  164  LAALFLLGTWASQATT-HTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +A L +  TWASQA       E +++++HE+WM R+GR+Y+D+ EK +RFQIFK
Sbjct  11   IALLVVFSTWASQAMARQLINEDALVEKHEQWMARHGRTYQDSEEKERRFQIFK  64



>ref|XP_004489011.1| PREDICTED: vignain-like [Cicer arietinum]
Length=343

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 4/58 (7%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            FT +L     LG WA QAT+   ++ SM +RHE+WM +YG+ YK+  E+ KRF IFK+
Sbjct  12   FTFVLC----LGLWAFQATSRNLQDDSMHERHEQWMGQYGKVYKNAKEREKRFGIFKE  65



>ref|XP_010099379.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB78104.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=348

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 4/60 (7%)
 Frame = -1

Query  170  VILAALFLLGTWAS---QATTHTCEEPSMLK-RHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            V LA +  LGTWA    +AT+ + ++ S LK RHEEWM R+G  YKD  EKAKRF+IFK+
Sbjct  10   VYLALVISLGTWAKYNVEATSRSLQDASTLKIRHEEWMSRHGIVYKDADEKAKRFEIFKE  69



>ref|XP_004505498.1| PREDICTED: vignain-like [Cicer arietinum]
Length=344

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + LA    LG WA Q T+ T ++ SM + HE+WM  YG+ YKD+ EK KR +IF +
Sbjct  8    YYISLALFLCLGLWAIQGTSRTLQDDSMYESHEQWMRHYGKVYKDSQEKEKRSKIFTQ  65



>ref|XP_009365508.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=542

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
             A +F+LG  +S AT+ T ++ SM  ++E+WM RYGR Y D  EK KRF IFK
Sbjct  214  FALIFMLGALSSHATSRTLQDASMYGKYEQWMARYGRVYTDINEKEKRFNIFK  266



>ref|XP_009797968.1| PREDICTED: vignain-like [Nicotiana sylvestris]
Length=340

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIF  9
            L  ++ +  AAL +LG  AS+A++    E SM+++HE+WM R+ R YKD+AEK KR +IF
Sbjct  3    LTFNWKLAFAALLVLGMQASRASSRGFYEGSMVQKHEQWMDRFRRVYKDDAEKEKRLKIF  62

Query  8    KK  3
            K+
Sbjct  63   KE  64



>ref|XP_009354265.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L  + +LG W+SQAT+ + ++ +M  RHE+W+ RYGR Y +  EK  RF+I K+
Sbjct  14   LGLILMLGAWSSQATSRSLQDAAMYGRHEQWLARYGRVYNNVNEKETRFKILKE  67



>ref|XP_008246197.1| PREDICTED: vignain-like, partial [Prunus mume]
Length=286

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -1

Query  149  LLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + G W+ +AT+ + ++ SM  R+E+WM RYGR Y D  EK  RF+IFK+
Sbjct  1    MFGAWSCEATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKE  49



>ref|XP_008368631.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L  + +LG W+SQAT+ + ++ SM  R+E+W+ RYGR Y D  E   RF+IFK+
Sbjct  14   LGLILMLGAWSSQATSRSLKDASMYGRYEQWLARYGRVYNDINEMETRFKIFKE  67



>ref|XP_009357172.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=343

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L+ + +LG W+S AT+ T ++  M  R+E+W+ RYGR Y D  EK  RF+IFK+
Sbjct  14   LSLILMLGAWSSGATSRTLQDARMYGRYEQWLTRYGRIYNDVNEKETRFKIFKE  67



>ref|XP_007132860.1| hypothetical protein PHAVU_011G130800g [Phaseolus vulgaris]
 gb|ESW04854.1| hypothetical protein PHAVU_011G130800g [Phaseolus vulgaris]
Length=343

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + LA LF +G  A Q +  T ++ SM + HE+WM RY R YKD  E+ KRF+IFK+
Sbjct  8    YHISLALLFCIGFLAFQVSCRTLQDASMHETHEQWMTRYSRVYKDPEEREKRFRIFKE  65



>ref|XP_006376351.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
 gb|ERP54148.1| hypothetical protein POPTR_0013s12280g [Populus trichocarpa]
Length=342

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
             A + +LG WA +  +   +EPSM  RHE+WM  +G+ Y D AE  +RF+IFK
Sbjct  11   FAFILILGMWAYEVASRELQEPSMSARHEQWMATFGKVYADAAETERRFEIFK  63



>ref|XP_006490014.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 ref|XP_006495221.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
Length=344

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATT---HTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            F +I  ++ +L T++S+  +    +  EPS++++HE+WM  +GR+YKD+ EK KRF+IFK
Sbjct  5    FDIIALSMIILVTYSSKMVSVAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEKRFKIFK  64

Query  5    K  3
            +
Sbjct  65   E  65



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  158  ALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++ LL   AS AT  T  E +M +RHE+WM + GR+Y+D+AEK +R+QIFK
Sbjct  14   SVLLLCACASHATARTLSEMTMAERHEQWMAQQGRAYRDSAEKERRYQIFK  64



>ref|XP_006432601.1| hypothetical protein CICLE_v10001718mg [Citrus clementina]
 gb|ESR45841.1| hypothetical protein CICLE_v10001718mg [Citrus clementina]
Length=344

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATT---HTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            F +I  ++ +L T++S+  +    +  EPS++++HE+WM  +GR+YKD+ EK KRF+IFK
Sbjct  5    FDIIALSMIILVTYSSKMVSVAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEKRFKIFK  64

Query  5    K  3
            +
Sbjct  65   E  65



>sp|O23791.1|BROM1_ANACO RecName: Full=Fruit bromelain; AltName: Allergen=Ana c 2; Flags: 
Precursor [Ananas comosus]
 dbj|BAA21849.1| bromelain [Ananas comosus]
Length=351

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPS--MLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++   LFL   WAS +     +EP+  M+KR EEWM  YGR YKD+ EK +RFQIFK
Sbjct  7    LVFLFLFLCAMWASPSAASR-DEPNDPMMKRFEEWMAEYGRVYKDDDEKMRRFQIFK  62



>ref|XP_006432617.1| hypothetical protein CICLE_v10001723mg [Citrus clementina]
 ref|XP_006494213.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 ref|XP_006495364.1| PREDICTED: xylem cysteine proteinase 1-like [Citrus sinensis]
 gb|ESR45857.1| hypothetical protein CICLE_v10001723mg [Citrus clementina]
Length=344

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATT---HTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            F +I  ++ +L T++S+  +    +  EPS++++HE+WM  +GR+YKD+ EK KRF+IFK
Sbjct  5    FDIIALSMIILVTYSSKMVSVAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEKRFKIFK  64

Query  5    K  3
            +
Sbjct  65   E  65



>ref|XP_006432594.1| hypothetical protein CICLE_v10001719mg [Citrus clementina]
 gb|ESR45834.1| hypothetical protein CICLE_v10001719mg [Citrus clementina]
Length=344

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATT---HTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            F +I  ++ +L T++S+  +    +  EPS++++HE+WM  +GR+YKD+ EK KRF+IFK
Sbjct  5    FDIIALSMIILVTYSSKMVSVAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEKRFKIFK  64

Query  5    K  3
            +
Sbjct  65   E  65



>gb|AHA62778.1| RCR3-like cysteine protease [Mirabilis jalapa]
Length=348

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = -1

Query  143  GTWASQATTHTC---EEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            G WA QA++      E+ SM +RHE+WM R+GR YKD+ EK KRFQIFK+
Sbjct  20   GHWAFQASSARPLDHEQVSMRERHEQWMARHGREYKDDIEKEKRFQIFKE  69



>ref|XP_007048674.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92831.1| Senescence-associated gene 12 [Theobroma cacao]
Length=344

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = -1

Query  179  HFTVILAALFLLGT-WASQATTHT--CEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIF  9
            H  + LA +F+ GT    QAT+ T   ++ +M +RHE+WM +YGR YKD+ +K KRF+IF
Sbjct  7    HGCLCLALIFIFGTNLVFQATSRTLPIQDSAMYERHEQWMAQYGRVYKDSNDKEKRFKIF  66

Query  8    KK  3
            K+
Sbjct  67   KE  68



>ref|XP_003556992.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + LA LF  G    Q T  T ++ SM +RHEEWM RY + YKD  E+ +RF+IFK+
Sbjct  8    YQISLALLFCSGFLTFQVTCRTLQDASMYERHEEWMGRYAKVYKDPQERERRFKIFKE  65



>ref|XP_010045988.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ++L  + +LG WASQA +      +M +RHE+ M R+GR Y+D+AEK +RF IFK
Sbjct  9    LVLVMVAILGLWASQARSRELHGATMWERHEQRMARHGRVYQDDAEKERRFSIFK  63



>ref|XP_008228922.1| PREDICTED: vignain-like [Prunus mume]
Length=326

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -1

Query  149  LLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + G W+ +AT+ + ++ SM  R+E+WM RYGR Y D  EK  RF+IFK+
Sbjct  1    MFGAWSCEATSRSLQDASMYGRYEQWMTRYGRVYNDVNEKENRFKIFKE  49



>ref|XP_010094328.1| Fruit bromelain [Morus notabilis]
 gb|EXB55748.1| Fruit bromelain [Morus notabilis]
Length=339

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = -1

Query  173  TVILAALFLLGTWASQATTHTCEEP-SMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            T ++  L +LG W SQ  + +  +  ++ +RHE+W++R+GRSY+++AEK KRF+IFK
Sbjct  3    TFLIIVLSILGIWTSQTMSRSLHKAVTLTERHEQWILRHGRSYENDAEKKKRFKIFK  59



>ref|XP_006582263.1| PREDICTED: vignain-like [Glycine max]
Length=338

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  167  ILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ILA + LL    SQ  +    E SM +RHE+WM +YG+ YKD AEK KR  IFK
Sbjct  10   ILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLLIFK  63



>ref|XP_006582264.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN33267.1| Vignain [Glycine soja]
Length=338

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  167  ILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ILA + LL    SQ  +    E SM +RHE+WM +YG+ YKD AEK KR  IFK
Sbjct  10   ILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLLIFK  63



>gb|KHN08873.1| Vignain [Glycine soja]
Length=335

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  167  ILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ILA + LL    SQ  +    E SM +RHE+WM +YG+ YKD AEK KR  IFK
Sbjct  7    ILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLLIFK  60



>ref|XP_010906196.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=342

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = -1

Query  158  ALF--LLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ALF  LL T+AS AT     E +M +RHE+WM ++GR Y D+AEK +RFQIFK
Sbjct  12   ALFVLLLCTFASHATARMLSEMTMHERHEQWMSQHGRVYGDSAEKERRFQIFK  64



>ref|XP_007214432.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
 gb|EMJ15631.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
Length=339

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  155  LFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + G W  +AT+ + ++ SM  R+E+WM RYGR Y D  EK  RF+IFK+
Sbjct  12   ILMFGAWCCEATSRSLQDASMYGRYEQWMTRYGRIYNDVNEKENRFKIFKE  62



>gb|KDO77830.1| hypothetical protein CISIN_1g043883mg, partial [Citrus sinensis]
Length=348

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -1

Query  185  MAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            MA + +I+  L + G+ ASQAT  T +E S+ ++ E+W  +YGR+YK++AE +KRF+IFK
Sbjct  1    MAKYFLIVV-LIISGSCASQATYRTFDEGSIAEKFEQWKAQYGRTYKESAENSKRFEIFK  59



>ref|XP_010035848.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW47319.1| hypothetical protein EUGRSUZ_K01106 [Eucalyptus grandis]
Length=336

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -1

Query  179  HFTVILAALFLLGTWASQATTHTCE-EPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
             + +++  +FLLG WA QA   T + +  M + H +WM RYGR YKD  EK  RF+IFK
Sbjct  7    QYFILVPLVFLLGAWAHQAAGRTLQRDDPMYEMHGQWMARYGRVYKDVEEKQSRFEIFK  65



>ref|XP_003540013.1| PREDICTED: vignain-like [Glycine max]
 ref|XP_003540014.1| PREDICTED: vignain-like [Glycine max]
 gb|KHN27798.1| Vignain [Glycine soja]
 gb|KHN27800.1| Vignain [Glycine soja]
Length=337

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  167  ILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            ILA + LL    SQ  +    E SM +RHE+WM +YG+ YKD AEK KR  IFK
Sbjct  10   ILALVLLLSICTSQVMSRNLHEASMSERHEQWMKKYGKVYKDAAEKQKRLLIFK  63



>ref|XP_002531152.1| cysteine protease, putative [Ricinus communis]
 gb|EEF31237.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -1

Query  179  HFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            H  + LA +F LG  ASQA   T ++ S+ ++HEEWM R+ R Y D  EK  R++IFK+
Sbjct  7    HGCISLALIFFLGALASQAIARTLQDASIHEKHEEWMTRFKRVYSDAKEKEIRYKIFKE  65



>ref|XP_008348586.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L+ + +LG W+  AT+ T ++ S+  R+E+W+ RYGR Y D  EK  RF+IFK+
Sbjct  14   LSLILMLGAWSXGATSRTLQDASIYGRYEQWLTRYGRVYNDVNEKETRFKIFKE  67



>ref|XP_010091035.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010105801.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC06208.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36679.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=350

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 45/61 (74%), Gaps = 3/61 (5%)
 Frame = -1

Query  182  AHFTVILAALFL-LGTWASQATTHTCEE-PS-MLKRHEEWMVRYGRSYKDNAEKAKRFQI  12
            +  + ++A LFL LGTWASQ  + +  E PS M ++ E+WM++Y R+Y+++AEK KRF+I
Sbjct  7    SEISTLVAVLFLILGTWASQTMSRSLHEAPSLMTEKFEQWMLQYVRTYENDAEKEKRFKI  66

Query  11   F  9
            F
Sbjct  67   F  67



>gb|AAP32196.1| cysteine protease 8 [Trifolium repens]
Length=343

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + LA +F LG +A Q T+ T ++ SM +RH +WM +YG+ YKD+ E+  RF+IF +
Sbjct  8    YHISLALVFCLGLFAIQVTSRTLQDDSMYERHGQWMSQYGKIYKDHQERETRFKIFTE  65



>ref|XP_006468204.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like [Citrus 
sinensis]
Length=384

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -1

Query  185  MAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            MA + +I+  L + G+ ASQAT  T +E S+ ++ E+W  +YGR+YK++AE +KRF+IFK
Sbjct  1    MAKYFLIVV-LIISGSCASQATYRTFDEGSIAEKFEQWKAQYGRTYKESAENSKRFEIFK  59



>ref|XP_010279091.1| PREDICTED: ervatamin-B [Nelumbo nucifera]
Length=345

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -1

Query  155  LFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            LF+L  WA QAT+   +E S+ K++EEW+  +GR Y + AEK KRF+IF+
Sbjct  14   LFILSVWAPQATSRRLQETSIAKKYEEWVNNHGRVYNNVAEKEKRFKIFR  63



>ref|XP_008810168.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
 ref|XP_008810169.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
Length=336

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = -1

Query  185  MAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            MAH    LA L +LG W S AT     +  M  +HE+WM + GR Y D AEK +RFQIF+
Sbjct  1    MAHQCFELA-LMVLGVWVSGATARGIADEPMRTKHEQWMAQNGRVYTDAAEKERRFQIFR  59



>ref|XP_002513120.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49623.1| cysteine protease, putative [Ricinus communis]
Length=362

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -1

Query  179  HFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            +  +  A  F +G W SQ    T +E SM +RHE+WM  Y R YKD  EK  R++IFK+
Sbjct  7    YICITFALFFSIGAWTSQCMARTLQEASMYERHEQWMASYARVYKDANEKQMRYKIFKE  65



>ref|XP_008349211.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=345

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +I+  L  LGT AS+AT+ T  + S+  +HE+WM ++GR Y+D+AEK +RF I K
Sbjct  8    LIVTILITLGTLASEATSRTLYQASIAAKHEQWMKKHGRVYQDSAEKERRFXIXK  62



>ref|XP_008244476.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=339

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  155  LFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + + G W+ +AT+ + ++ SM  ++E+WM RYGR Y D  EK  RF+IFK+
Sbjct  12   ILMFGAWSCEATSRSLQDASMYGKYEQWMTRYGRVYNDVNEKENRFKIFKE  62



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  185  MAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +A   +I  A  +L   ASQA      E SM+++HE+WM + GR YK+ AEK  R++IFK
Sbjct  4    IATSKLIFTAFLMLTVLASQAVCRNLNEASMIEKHEQWMAQNGRVYKNEAEKGNRYKIFK  63

Query  5    K  3
            +
Sbjct  64   E  64



>ref|XP_008810167.1| PREDICTED: ervatamin-B-like isoform X1 [Phoenix dactylifera]
Length=362

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = -1

Query  185  MAHFTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            MAH    LA L +LG W S AT     +  M  +HE+WM + GR Y D AEK +RFQIF+
Sbjct  27   MAHQCFELA-LMVLGVWVSGATARGIADEPMRTKHEQWMAQNGRVYTDAAEKERRFQIFR  85



>gb|KCW76137.1| hypothetical protein EUGRSUZ_D00513 [Eucalyptus grandis]
Length=328

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -1

Query  149  LLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            +LG +ASQA      E SM +RHE+WM R+GR YK + EK +RF IFK
Sbjct  2    VLGLYASQAWARELRELSMRERHEQWMARHGRVYKADGEKERRFMIFK  49



>gb|KDP23983.1| hypothetical protein JCGZ_25371 [Jatropha curcas]
Length=340

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA +F+LG  ASQA   + ++ S+ +RHE+WM +YG+ YKD  EK  R +IFK+
Sbjct  10   ISLALIFILGALASQAIARSLQDASINERHEKWMAQYGKVYKDANEKVIRRKIFKR  65



>ref|XP_004306597.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + LA + +LG W+S+AT+ T ++ +M  R+E+WM R+GR +    EK  RF+IFK+
Sbjct  10   ISLALILMLGAWSSEATSRTLQDVTMYGRYEQWMARHGRVFSSIDEKESRFKIFKE  65



>ref|XP_002522572.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39872.1| cysteine protease, putative [Ricinus communis]
Length=340

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  173  TVILAALFLLGTWASQATTHT-CEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            T +   L +L TW SQA      +E ++ ++HE+WM R+GR+Y+D+ EK +RF IFKK
Sbjct  7    TKLAIVLMILVTWVSQAMPRPLIDEDAVAEKHEQWMARHGRTYQDDEEKERRFHIFKK  64



>ref|XP_007213224.1| hypothetical protein PRUPE_ppb014952mg [Prunus persica]
 gb|EMJ14423.1| hypothetical protein PRUPE_ppb014952mg [Prunus persica]
Length=251

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -1

Query  167  ILAALFLL--GTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            ++ ++F++  GTW S+A + T  E SM  +HE WM +Y R Y DNAEK +RF+IFK+
Sbjct  9    LMISMFIVVSGTWESKAASTTLHEGSMAIKHELWMAKYARIYVDNAEKERRFKIFKE  65



>emb|CDO96765.1| unnamed protein product [Coffea canephora]
Length=295

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -1

Query  155  LFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            L ++ +W  QA +    + SM++RHE+WM  YGR YKD AEK +R+ IF+
Sbjct  14   LIIIISWEPQALSRMIPDVSMIERHEDWMSSYGRQYKDAAEKERRYNIFR  63



>gb|KCW74661.1| hypothetical protein EUGRSUZ_E03389 [Eucalyptus grandis]
Length=340

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATT-HTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQI  12
            L + F V LA   +L  WA  AT+  T  E ++ ++HE+WM +YGR+YKD  EK KR  I
Sbjct  5    LKSEFIVALA--LILNAWAWHATSVRTLHESNIAEQHEQWMAKYGRTYKDQGEKEKRRAI  62

Query  11   FKK  3
            FKK
Sbjct  63   FKK  65



>gb|AAR92154.1| putative cysteine protease 1 [Iris x hollandica]
Length=340

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = -1

Query  158  ALFLLGTWASQ--ATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            AL ++  WASQ  A     E  SML+RHE+WM ++GR YK+ AEKA RF+IF+
Sbjct  14   ALLIVAIWASQGEAGRSLGENKSMLERHEQWMAQHGRVYKNAAEKAHRFEIFR  66



>ref|XP_009601308.1| PREDICTED: ervatamin-B-like isoform X3 [Nicotiana tomentosiformis]
Length=323

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  134  ASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            AS+A++    E SM+++H +WM R+GR+YKD+AEKAKR +IFK+
Sbjct  3    ASRASSRGLYEASMVQKHAQWMARFGRAYKDDAEKAKRLKIFKE  46



>ref|XP_008354173.1| PREDICTED: actinidain-like [Malus domestica]
Length=227

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L  + +LG W+SQAT+ + ++ SM   +E+W+ RYGR + D  EK  RF+IFK+
Sbjct  14   LGLILVLGAWSSQATSRSLQDASMYGXYEQWLARYGRVHNDINEKETRFKIFKE  67



>ref|XP_010059344.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW74668.1| hypothetical protein EUGRSUZ_E03399 [Eucalyptus grandis]
Length=340

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATT-HTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQI  12
            L + F V LA   +L  WA  AT+  T  E ++ ++HE+WM +YGR+YKD  EK KR  I
Sbjct  5    LKSEFIVALA--LILNAWAWHATSVRTLHESNIAEQHEQWMAQYGRTYKDQGEKEKRRAI  62

Query  11   FKK  3
            FKK
Sbjct  63   FKK  65



>ref|XP_010061449.1| PREDICTED: zingipain-1-like [Eucalyptus grandis]
 gb|KCW68390.1| hypothetical protein EUGRSUZ_F02043 [Eucalyptus grandis]
Length=340

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = -1

Query  167  ILAALFLLGTWA-SQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            I+A + +L TWA   A+  T  E ++ ++HE+WM +YGR+YKD  EK KR  IFKK
Sbjct  10   IVAFVLILNTWAWHAASVRTLHESNIAEQHEQWMAQYGRTYKDQEEKEKRRAIFKK  65



>gb|KCW76121.1| hypothetical protein EUGRSUZ_D00498 [Eucalyptus grandis]
Length=249

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  161  AALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            AAL ++    S+      EE  +LK+HEEWM  +GR YKD+ EKAKR++IFK+
Sbjct  13   AALLVIIVSVSKTLCRPLEEEQLLKQHEEWMAIHGRVYKDSVEKAKRYEIFKE  65



>ref|XP_009357173.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  164  LAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            L+ + ++G W+S AT+ T ++ SM  R+E+W+ RYGR Y +  EK  RF+IF +
Sbjct  14   LSLILMMGAWSSGATSRTLQDASMYGRYEQWLTRYGRVYNNVNEKETRFKIFNE  67



>emb|CDP18644.1| unnamed protein product [Coffea canephora]
Length=336

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  170  VILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            V++   FLLG  A Q       + +M++R+E+WM  +GR YKD+AEK +RF+IFK
Sbjct  3    VVIGFFFLLGLLAIQGAARNLNDEAMVERYEQWMSLHGRVYKDSAEKERRFKIFK  57



>ref|XP_010038688.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW47321.1| hypothetical protein EUGRSUZ_K01109 [Eucalyptus grandis]
Length=340

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -1

Query  179  HFTVILAALFLLGTWASQATTHTCE-EPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
             + +++  +FLLG WA QA   T + +  M + H +WM RYGR YKD  E+  RF+IFK
Sbjct  7    QYFILVPLVFLLGAWAHQAAGRTFQRDDPMYEMHGQWMARYGRVYKDVEERQSRFEIFK  65



>ref|XP_010059331.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW74654.1| hypothetical protein EUGRSUZ_E03378 [Eucalyptus grandis]
Length=340

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -1

Query  188  LMAHFTVILAALFLLGTWASQATT-HTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQI  12
            L + F V LA   +L  WA  AT+  T  E ++ ++HE+WM +YGR+YKD  EK KR  I
Sbjct  5    LKSEFIVALA--LILNAWAWHATSVRTLHESNIAEQHEQWMAKYGRTYKDQEEKEKRRAI  62

Query  11   FKK  3
            FKK
Sbjct  63   FKK  65



>gb|AAP32195.1| cysteine protease 5 [Trifolium repens]
Length=343

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATTHTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFKK  3
            + V LA  F LG  A Q T+ T ++ S+ +RHE+WM  YG+ YK+  E+ KR +IF +
Sbjct  8    YHVSLALFFCLGLLAIQVTSRTLQDDSIFERHEQWMTHYGKVYKNPQEREKRLRIFTE  65



>ref|XP_006421532.1| hypothetical protein CICLE_v10005342mg [Citrus clementina]
 gb|ESR34772.1| hypothetical protein CICLE_v10005342mg [Citrus clementina]
Length=343

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = -1

Query  176  FTVILAALFLLGTWASQATT---HTCEEPSMLKRHEEWMVRYGRSYKDNAEKAKRFQIFK  6
            F +I  ++ +L T++S+  +    +  EPS++++HE+WM  +GR+YKD+ EK  RF+IFK
Sbjct  5    FDIIALSMIILVTYSSKMVSVAGRSLHEPSIVEKHEKWMAEHGRTYKDDLEKEMRFKIFK  64

Query  5    K  3
            +
Sbjct  65   E  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 528788483009