BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24046_g1_i1 len=429 path=[5285:0-428]

Length=429
                                                                      Score     E

ref|XP_009616844.1|  PREDICTED: zingipain-1-like                        146   2e-39   
ref|XP_006362436.1|  PREDICTED: vignain-like                            138   2e-36   
ref|XP_004232961.1|  PREDICTED: zingipain-2-like                        136   1e-35   
ref|XP_002889596.1|  hypothetical protein ARALYDRAFT_887827             136   2e-35   
ref|XP_006417940.1|  hypothetical protein EUTSA_v10008102mg             135   3e-35   
ref|NP_563764.1|  Cysteine proteinases superfamily protein              135   4e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501342.1|  PREDICTED: ervatamin-B-like                        134   6e-35   
ref|XP_011014387.1|  PREDICTED: senescence-specific cysteine prot...    130   1e-34   
ref|XP_010475355.1|  PREDICTED: ervatamin-B-like                        133   1e-34   
ref|XP_008780633.1|  PREDICTED: vignain-like                            130   1e-34   
ref|XP_010462580.1|  PREDICTED: ervatamin-B-like                        133   1e-34   
ref|XP_006852525.1|  hypothetical protein AMTR_s00021p00178750          130   2e-34   
ref|XP_009629965.1|  PREDICTED: ervatamin-B-like                        132   4e-34   
ref|XP_008780330.1|  PREDICTED: vignain-like                            128   4e-34   
ref|XP_010054319.1|  PREDICTED: zingipain-2-like                        132   5e-34   
ref|XP_006281607.1|  hypothetical protein CARUB_v10027725mg             132   5e-34   
ref|XP_002524912.1|  cysteine protease, putative                        131   1e-33   Ricinus communis
ref|XP_009775915.1|  PREDICTED: ervatamin-B-like                        131   1e-33   
gb|AAC49135.1|  SAG12 protein                                           131   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010054320.1|  PREDICTED: ervatamin-B-like                        130   1e-33   
gb|KCW76123.1|  hypothetical protein EUGRSUZ_D00500                     130   2e-33   
ref|XP_010052199.1|  PREDICTED: ervatamin-B-like                        130   2e-33   
ref|XP_004252652.2|  PREDICTED: senescence-specific cysteine prot...    130   2e-33   
ref|XP_002523447.1|  cysteine protease, putative                        130   2e-33   Ricinus communis
ref|XP_010906196.1|  PREDICTED: senescence-specific cysteine prot...    130   3e-33   
ref|XP_011005484.1|  PREDICTED: senescence-specific cysteine prot...    126   3e-33   
ref|XP_009623244.1|  PREDICTED: ervatamin-B-like                        130   3e-33   
ref|XP_007048792.1|  Senescence-associated gene 12                      130   3e-33   
ref|XP_002523448.1|  cysteine protease, putative                        130   3e-33   Ricinus communis
ref|XP_009617815.1|  PREDICTED: ervatamin-B-like                        129   4e-33   
ref|XP_011078044.1|  PREDICTED: senescence-specific cysteine prot...    129   4e-33   
ref|XP_009359979.1|  PREDICTED: ervatamin-B-like                        129   5e-33   
ref|XP_004252606.1|  PREDICTED: senescence-specific cysteine prot...    129   5e-33   
ref|XP_007048796.1|  Senescence-associated gene 12                      129   7e-33   
ref|XP_007216164.1|  hypothetical protein PRUPE_ppa015341mg             125   7e-33   
ref|NP_568651.1|  cysteine protease SAG12                               129   8e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006360708.1|  PREDICTED: vignain-like                            129   8e-33   
ref|XP_009349242.1|  PREDICTED: vignain-like                            130   9e-33   
dbj|BAD29955.1|  cysteine protease                                      129   9e-33   Daucus carota [carrots]
ref|XP_009797968.1|  PREDICTED: vignain-like                            128   1e-32   
ref|XP_008800073.1|  PREDICTED: ervatamin-B-like                        128   1e-32   
ref|XP_006362426.1|  PREDICTED: vignain-like                            128   1e-32   
ref|XP_011086004.1|  PREDICTED: senescence-specific cysteine prot...    128   1e-32   
ref|XP_010481519.1|  PREDICTED: senescence-specific cysteine prot...    128   1e-32   
ref|XP_008800071.1|  PREDICTED: ervatamin-B-like                        128   1e-32   
ref|XP_002522559.1|  cysteine protease, putative                        128   2e-32   Ricinus communis
ref|XP_004303175.1|  PREDICTED: vignain-like                            127   2e-32   
ref|XP_007025398.1|  Senescence-associated gene 12                      127   2e-32   
ref|XP_004252607.1|  PREDICTED: senescence-specific cysteine prot...    127   3e-32   
ref|XP_008780365.1|  PREDICTED: vignain-like                            124   3e-32   
dbj|BAM66994.1|  germination-specific cysteine protease 1               125   3e-32   
ref|XP_006360707.1|  PREDICTED: vignain-like                            127   3e-32   
ref|XP_008779806.1|  PREDICTED: ervatamin-B-like                        127   3e-32   
ref|XP_009609383.1|  PREDICTED: ervatamin-B                             126   3e-32   
ref|XP_011086005.1|  PREDICTED: senescence-specific cysteine prot...    127   3e-32   
ref|XP_006306197.1|  hypothetical protein CARUB_v10011832mg             127   4e-32   
ref|XP_009390411.1|  PREDICTED: vignain-like                            124   4e-32   
ref|XP_010441658.1|  PREDICTED: senescence-specific cysteine prot...    127   4e-32   
ref|XP_009798361.1|  PREDICTED: ervatamin-B-like                        127   4e-32   
ref|XP_011078542.1|  PREDICTED: senescence-specific cysteine prot...    127   4e-32   
ref|XP_006398274.1|  hypothetical protein EUTSA_v10000948mg             127   4e-32   
ref|XP_010052197.1|  PREDICTED: ervatamin-B-like                        127   4e-32   
gb|KDP38777.1|  hypothetical protein JCGZ_05113                         124   4e-32   
ref|XP_002865220.1|  senescence-associated gene 12                      127   4e-32   
gb|KDP38773.1|  hypothetical protein JCGZ_05109                         124   5e-32   
ref|XP_009361500.1|  PREDICTED: vignain-like                            126   5e-32   
ref|XP_011086001.1|  PREDICTED: senescence-specific cysteine prot...    126   5e-32   
ref|XP_008810168.1|  PREDICTED: ervatamin-B-like isoform X2             126   6e-32   
gb|KCW76128.1|  hypothetical protein EUGRSUZ_D00504                     126   6e-32   
ref|XP_009359967.1|  PREDICTED: vignain-like                            126   6e-32   
ref|XP_008810167.1|  PREDICTED: ervatamin-B-like isoform X1             126   7e-32   
ref|XP_008228868.1|  PREDICTED: LOW QUALITY PROTEIN: zingipain-2-...    126   7e-32   
gb|EYU19040.1|  hypothetical protein MIMGU_mgv1a026538mg                126   7e-32   
ref|XP_008340724.1|  PREDICTED: vignain-like                            126   7e-32   
ref|XP_004290089.1|  PREDICTED: vignain-like                            126   7e-32   
ref|XP_008246197.1|  PREDICTED: vignain-like                            125   7e-32   
ref|XP_010052200.1|  PREDICTED: ervatamin-B-like                        126   7e-32   
ref|XP_009761201.1|  PREDICTED: ervatamin-B-like                        126   9e-32   
ref|XP_008371737.1|  PREDICTED: vignain-like                            123   1e-31   
gb|KHN38752.1|  Vignain                                                 125   1e-31   
dbj|BAF56430.1|  cysteine proteinase                                    125   1e-31   Lotus japonicus
ref|XP_006663343.1|  PREDICTED: vignain-like                            125   2e-31   
gb|EYU25680.1|  hypothetical protein MIMGU_mgv1a019612mg                125   2e-31   
gb|AAB23155.1|  COT44=cysteine proteinase homolog                       125   2e-31   
sp|P25251.1|CYSP4_BRANA  RecName: Full=Cysteine proteinase COT44;...    125   2e-31   Brassica napus [oilseed rape]
ref|XP_008228922.1|  PREDICTED: vignain-like                            125   2e-31   
ref|XP_010494742.1|  PREDICTED: senescence-specific cysteine prot...    125   2e-31   
ref|XP_009344439.1|  PREDICTED: ervatamin-B-like                        125   2e-31   
ref|XP_004967598.1|  PREDICTED: xylem cysteine proteinase 2-like        125   2e-31   
dbj|BAF56428.1|  cysteine proteinase                                    125   2e-31   Lotus japonicus
ref|XP_009359957.1|  PREDICTED: ervatamin-B-like                        125   2e-31   
ref|XP_010518799.1|  PREDICTED: senescence-specific cysteine prot...    125   2e-31   
ref|XP_008244476.1|  PREDICTED: ervatamin-B-like                        125   2e-31   
ref|XP_008350674.1|  PREDICTED: zingipain-2-like                        124   2e-31   
gb|KFK42951.1|  hypothetical protein AALP_AA1G060200                    125   2e-31   
ref|XP_009137836.1|  PREDICTED: cysteine proteinase COT44               125   2e-31   
emb|CDX69285.1|  BnaC01g01680D                                          125   2e-31   
ref|XP_011100224.1|  PREDICTED: zingipain-2                             125   2e-31   
ref|XP_010054318.1|  PREDICTED: ervatamin-B-like                        125   2e-31   
ref|XP_008223852.1|  PREDICTED: ervatamin-B-like                        125   2e-31   
ref|XP_010317330.1|  PREDICTED: uncharacterized protein LOC101251741    128   2e-31   
emb|CDX75633.1|  BnaA01g00690D                                          125   2e-31   
ref|XP_010906195.1|  PREDICTED: senescence-specific cysteine prot...    122   3e-31   
ref|XP_008805390.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    124   3e-31   
ref|XP_007227669.1|  hypothetical protein PRUPE_ppa025602mg             124   3e-31   
ref|XP_007226492.1|  hypothetical protein PRUPE_ppa026538mg             124   3e-31   
ref|XP_006362428.1|  PREDICTED: vignain-like                            124   3e-31   
ref|XP_008345990.1|  PREDICTED: zingipain-2-like                        124   3e-31   
gb|AAD53011.1|AF089848_1  senescence-specific cysteine protease         124   3e-31   Brassica napus [oilseed rape]
ref|XP_009365508.1|  PREDICTED: vignain-like                            126   3e-31   
emb|CDX86529.1|  BnaC08g01740D                                          125   3e-31   
ref|XP_009110997.1|  PREDICTED: ervatamin-B-like                        124   3e-31   
gb|KCW76118.1|  hypothetical protein EUGRSUZ_D00495                     124   3e-31   
gb|KHN05669.1|  Vignain                                                 124   3e-31   
ref|XP_007214432.1|  hypothetical protein PRUPE_ppa025658mg             124   3e-31   
ref|XP_009357172.1|  PREDICTED: ervatamin-B-like                        124   3e-31   
ref|XP_008382007.1|  PREDICTED: ervatamin-B-like                        124   4e-31   
emb|CDX87758.1|  BnaC02g31910D                                          124   4e-31   
gb|EYU25672.1|  hypothetical protein MIMGU_mgv1a018700mg                124   4e-31   
ref|XP_002525147.1|  cysteine protease, putative                        124   4e-31   Ricinus communis
ref|XP_009128825.1|  PREDICTED: ervatamin-B                             124   4e-31   
gb|AAB41816.1|  NTH1                                                    124   4e-31   Pisum sativum [garden pea]
ref|XP_009119072.1|  PREDICTED: ervatamin-B                             124   4e-31   
ref|XP_008223851.1|  PREDICTED: ervatamin-B-like                        124   4e-31   
gb|EYU19037.1|  hypothetical protein MIMGU_mgv1a018631mg                124   5e-31   
ref|XP_010099379.1|  KDEL-tailed cysteine endopeptidase CEP1            124   5e-31   
ref|XP_006283942.1|  hypothetical protein CARUB_v10005061mg             124   5e-31   
ref|XP_004987388.1|  PREDICTED: xylem cysteine proteinase 2-like        124   6e-31   
ref|XP_011014388.1|  PREDICTED: senescence-specific cysteine prot...    124   6e-31   
ref|XP_004297571.1|  PREDICTED: vignain-like                            124   6e-31   
ref|XP_009109364.1|  PREDICTED: cysteine proteinase COT44-like          124   6e-31   
emb|CDY10188.1|  BnaC05g04310D                                          124   6e-31   
emb|CDY15571.1|  BnaA08g28550D                                          124   6e-31   
ref|XP_010432076.1|  PREDICTED: germination-specific cysteine pro...    124   7e-31   
ref|XP_006469054.1|  PREDICTED: oryzain alpha chain-like                120   7e-31   
ref|XP_004487576.1|  PREDICTED: vignain-like                            123   7e-31   
ref|XP_011008467.1|  PREDICTED: senescence-specific cysteine prot...    123   7e-31   
emb|CDY44047.1|  BnaA08g15590D                                          124   7e-31   
ref|XP_002525123.1|  cysteine protease, putative                        123   8e-31   Ricinus communis
emb|CBI30671.3|  unnamed protein product                                123   8e-31   
gb|EYU25679.1|  hypothetical protein MIMGU_mgv1a023356mg                123   8e-31   
ref|XP_010446685.1|  PREDICTED: germination-specific cysteine pro...    124   8e-31   
ref|XP_007212667.1|  hypothetical protein PRUPE_ppa018342mg             123   8e-31   
gb|KDP38776.1|  hypothetical protein JCGZ_05112                         120   9e-31   
gb|KFK31512.1|  hypothetical protein AALP_AA6G122300                    123   9e-31   
ref|XP_003538185.1|  PREDICTED: vignain-like                            123   1e-30   
dbj|BAD29959.1|  cysteine protease                                      123   1e-30   Daucus carota [carrots]
ref|XP_007132275.1|  hypothetical protein PHAVU_011G081100g             123   1e-30   
gb|AEK97329.1|  chromoplast senescence-associated protein 12            121   1e-30   
ref|XP_010091034.1|  KDEL-tailed cysteine endopeptidase CEP1            123   1e-30   
ref|XP_010437247.1|  PREDICTED: germination-specific cysteine pro...    123   1e-30   
ref|XP_007025397.1|  Senescence-associated gene 12, putative            122   1e-30   
ref|XP_007212585.1|  hypothetical protein PRUPE_ppa015944mg             123   1e-30   
ref|XP_002274223.1|  PREDICTED: senescence-specific cysteine prot...    123   1e-30   Vitis vinifera
gb|AEQ54772.1|  KDEL-tailed cysteine proteinase CP4                     120   1e-30   
ref|XP_004297572.1|  PREDICTED: vignain-like                            123   1e-30   
gb|KCW84689.1|  hypothetical protein EUGRSUZ_B01506                     122   1e-30   
gb|EYU43350.1|  hypothetical protein MIMGU_mgv1a021555mg                122   1e-30   
ref|XP_008225269.1|  PREDICTED: uncharacterized protein LOC103324934    126   1e-30   
ref|XP_010906194.1|  PREDICTED: senescence-specific cysteine prot...    123   1e-30   
ref|XP_010070600.1|  PREDICTED: cysteine proteinase COT44-like          123   1e-30   
ref|XP_010052201.1|  PREDICTED: ervatamin-B-like                        122   1e-30   
ref|XP_010103045.1|  KDEL-tailed cysteine endopeptidase CEP1            123   1e-30   
emb|CDY22445.1|  BnaC03g61580D                                          123   2e-30   
ref|XP_009357173.1|  PREDICTED: ervatamin-B-like                        122   2e-30   
emb|CDP18637.1|  unnamed protein product                                120   2e-30   
gb|KHN05670.1|  Vignain                                                 122   2e-30   
emb|CDP18640.1|  unnamed protein product                                120   2e-30   
ref|XP_010522111.1|  PREDICTED: ervatamin-B                             122   2e-30   
gb|KDP21078.1|  hypothetical protein JCGZ_21549                         122   2e-30   
ref|XP_008779585.1|  PREDICTED: zingipain-2-like                        122   2e-30   
ref|NP_001067630.1|  Os11g0255300                                       122   2e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EAY80530.1|  hypothetical protein OsI_35710                          122   3e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_010045987.1|  PREDICTED: ervatamin-B-like                        122   3e-30   
emb|CDY39574.1|  BnaCnng09430D                                          121   3e-30   
ref|XP_007213554.1|  hypothetical protein PRUPE_ppa018048mg             122   3e-30   
ref|XP_006849385.1|  hypothetical protein AMTR_s01332p00008900          122   3e-30   
emb|CDP15898.1|  unnamed protein product                                122   3e-30   
ref|XP_006388352.1|  hypothetical protein POPTR_0213s00210g             119   3e-30   
ref|XP_004304987.1|  PREDICTED: vignain-like                            122   3e-30   
ref|XP_008244498.1|  PREDICTED: ervatamin-B-like                        122   3e-30   
ref|XP_007213386.1|  hypothetical protein PRUPE_ppa026372mg             122   3e-30   
ref|XP_009597081.1|  PREDICTED: zingipain-2                             122   3e-30   
ref|XP_002312656.2|  hypothetical protein POPTR_0008s18350g             122   4e-30   Populus trichocarpa [western balsam poplar]
gb|KCW76125.1|  hypothetical protein EUGRSUZ_D00501                     122   4e-30   
ref|XP_010912736.1|  PREDICTED: senescence-specific cysteine prot...    121   4e-30   
ref|XP_004306597.1|  PREDICTED: vignain-like                            121   5e-30   
ref|XP_006348972.1|  PREDICTED: oryzain alpha chain-like                120   5e-30   
ref|NP_195406.2|  cysteine proteinase1                                  122   5e-30   Arabidopsis thaliana [mouse-ear cress]
sp|Q94B08.2|GCP1_ARATH  RecName: Full=Germination-specific cystei...    122   5e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009397226.1|  PREDICTED: zingipain-2-like                        121   5e-30   
ref|XP_009357242.1|  PREDICTED: ervatamin-B                             121   5e-30   
ref|XP_006446742.1|  hypothetical protein CICLE_v10015835mg             121   5e-30   
ref|XP_006404274.1|  hypothetical protein EUTSA_v10010486mg             121   5e-30   
emb|CDP13261.1|  unnamed protein product                                121   6e-30   
emb|CDY48168.1|  BnaA06g16650D                                          121   6e-30   
ref|XP_008780645.1|  PREDICTED: vignain-like                            120   6e-30   
ref|XP_009149829.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    121   6e-30   
ref|XP_002988081.1|  hypothetical protein SELMODRAFT_183539             122   6e-30   
gb|EMT08022.1|  Vignain                                                 121   6e-30   
ref|XP_008349211.1|  PREDICTED: zingipain-2-like                        121   7e-30   
ref|XP_006655467.1|  PREDICTED: cysteine proteinase RD21a-like          121   7e-30   
ref|XP_009601308.1|  PREDICTED: ervatamin-B-like isoform X3             120   8e-30   
ref|XP_008348586.1|  PREDICTED: ervatamin-B-like                        120   8e-30   
ref|XP_009601306.1|  PREDICTED: ervatamin-B-like isoform X1             120   8e-30   
gb|AAR92154.1|  putative cysteine protease 1                            120   8e-30   Iris x hollandica [Dutch iris]
ref|XP_009601307.1|  PREDICTED: ervatamin-B-like isoform X2             120   8e-30   
ref|XP_003539770.1|  PREDICTED: vignain-like                            120   9e-30   
ref|XP_011009172.1|  PREDICTED: senescence-specific cysteine prot...    120   9e-30   
gb|KFK34125.1|  hypothetical protein AALP_AA5G104600                    120   9e-30   
emb|CDP18641.1|  unnamed protein product                                120   9e-30   
ref|XP_010682353.1|  PREDICTED: vignain-like                            120   9e-30   
gb|ABF70145.1|  cysteine protease, putative                             121   9e-30   Musa acuminata [banana]
ref|XP_002305072.2|  hypothetical protein POPTR_0004s05520g             120   9e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006830175.1|  hypothetical protein AMTR_s00374p00012080          120   1e-29   
ref|XP_009354269.1|  PREDICTED: ervatamin-B-like                        120   1e-29   
ref|XP_002446128.1|  hypothetical protein SORBIDRAFT_06g002110          117   1e-29   Sorghum bicolor [broomcorn]
gb|EAY98636.1|  hypothetical protein OsI_20560                          121   1e-29   Oryza sativa Indica Group [Indian rice]
ref|NP_001055994.1|  Os05g0508300                                       121   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008362418.1|  PREDICTED: vignain-like                            117   1e-29   
ref|XP_004505522.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    120   1e-29   
ref|XP_008353750.1|  PREDICTED: ervatamin-B-like                        120   1e-29   
ref|XP_009354268.1|  PREDICTED: ervatamin-B-like                        120   1e-29   
ref|XP_006411912.1|  hypothetical protein EUTSA_v10025483mg             120   1e-29   
ref|XP_004291399.1|  PREDICTED: cysteine proteinase RD21a-like          121   1e-29   
ref|XP_008342777.1|  PREDICTED: ervatamin-B-like                        120   1e-29   
ref|XP_004506025.1|  PREDICTED: vignain-like                            120   2e-29   
gb|EYU34557.1|  hypothetical protein MIMGU_mgv1a007408mg                120   2e-29   
ref|XP_008803660.1|  PREDICTED: ervatamin-B-like                        120   2e-29   
ref|XP_008244499.1|  PREDICTED: ervatamin-B-like                        120   2e-29   
ref|XP_011097243.1|  PREDICTED: cysteine proteinase COT44               120   2e-29   
ref|XP_009354321.1|  PREDICTED: ervatamin-B-like                        120   2e-29   
gb|KDP45355.1|  hypothetical protein JCGZ_09604                         119   2e-29   
ref|XP_007048674.1|  Senescence-associated gene 12                      120   2e-29   
ref|XP_009357171.1|  PREDICTED: ervatamin-B-like                        119   2e-29   
ref|XP_008342776.1|  PREDICTED: ervatamin-B-like                        119   2e-29   
ref|XP_008342782.1|  PREDICTED: ervatamin-B-like                        119   2e-29   
ref|XP_009372437.1|  PREDICTED: cysteine proteinase COT44-like          120   2e-29   
gb|AAP32196.1|  cysteine protease 8                                     119   2e-29   Trifolium repens [creeping white clover]
ref|XP_008362421.1|  PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-...    119   2e-29   
ref|XP_004306851.1|  PREDICTED: vignain-like                            119   2e-29   
gb|AAT34987.1|  putative cysteine protease                              119   2e-29   Gossypium hirsutum [American cotton]
ref|XP_010052198.1|  PREDICTED: ervatamin-B-like                        119   2e-29   
ref|XP_010054322.1|  PREDICTED: ervatamin-B-like                        119   2e-29   
ref|XP_010679531.1|  PREDICTED: cysteine proteinase COT44-like          120   2e-29   
ref|XP_008383642.1|  PREDICTED: zingipain-1-like                        119   2e-29   
ref|XP_004308524.1|  PREDICTED: vignain-like                            119   2e-29   
gb|AFR11773.1|  cysteine protease                                       119   2e-29   
ref|XP_010510777.1|  PREDICTED: ervatamin-B-like                        119   2e-29   
dbj|BAF00916.1|  cysteine proteinase                                    120   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006469012.1|  PREDICTED: vignain-like                            119   2e-29   
ref|XP_004238304.1|  PREDICTED: zingipain-2                             120   3e-29   
ref|XP_009591184.1|  PREDICTED: cysteine proteinase RD21a-like          120   3e-29   
gb|AEQ54771.1|  KDDL-tailed cysteine proteinase CP4                     119   3e-29   
ref|XP_011021998.1|  PREDICTED: senescence-specific cysteine prot...    119   3e-29   
ref|XP_004239155.1|  PREDICTED: vignain-like                            119   3e-29   
ref|XP_010474538.1|  PREDICTED: senescence-specific cysteine prot...    119   3e-29   
ref|XP_002515048.1|  cysteine protease, putative                        119   3e-29   Ricinus communis
ref|XP_010279091.1|  PREDICTED: ervatamin-B                             119   3e-29   
ref|XP_006446792.1|  hypothetical protein CICLE_v10018253mg             119   3e-29   
dbj|BAF56427.1|  cysteine proteinase                                    119   3e-29   Lotus japonicus
ref|XP_011022002.1|  PREDICTED: senescence-specific cysteine prot...    119   3e-29   
gb|KHG13330.1|  Vignain                                                 119   3e-29   
ref|XP_006827472.1|  hypothetical protein AMTR_s00009p00129100          119   3e-29   
ref|XP_008338342.1|  PREDICTED: cysteine proteinase COT44-like          119   3e-29   
gb|AFV30165.1|  cysteine proteinase                                     119   3e-29   
ref|XP_010061259.1|  PREDICTED: low-temperature-induced cysteine ...    120   3e-29   
ref|XP_002307151.2|  hypothetical protein POPTR_0005s09140g             118   3e-29   Populus trichocarpa [western balsam poplar]
emb|CAA53377.1|  cysteine protease                                      119   3e-29   Vicia sativa [spring vetch]
gb|ADP02219.1|  Peptidase_C1 domain-containing protein                  119   3e-29   
ref|XP_007048673.1|  Senescence-associated gene 12, putative            118   4e-29   
ref|XP_010052203.1|  PREDICTED: ervatamin-B-like                        119   4e-29   
ref|XP_010277773.1|  PREDICTED: senescence-specific cysteine prot...    119   4e-29   
emb|CAL64936.1|  putative cysteine protease 8                           119   4e-29   Trifolium pratense [peavine clover]
ref|XP_004306836.1|  PREDICTED: vignain-like                            119   4e-29   
ref|XP_008229136.1|  PREDICTED: zingipain-2                             119   4e-29   
ref|XP_010045985.1|  PREDICTED: ervatamin-B-like                        119   4e-29   
ref|XP_006469011.1|  PREDICTED: vignain-like                            119   4e-29   
gb|EMT08019.1|  Vignain                                                 118   4e-29   
gb|ADP02218.1|  Peptidase_C1 domain-containing protein                  119   4e-29   
ref|XP_002305073.2|  hypothetical protein POPTR_0004s05540g             119   4e-29   
ref|XP_008381611.1|  PREDICTED: ervatamin-B                             119   4e-29   
tpg|DAA53037.1|  TPA: hypothetical protein ZEAMMB73_586844              122   4e-29   
gb|KFK23231.1|  hypothetical protein AALP_AAs59427U000100               117   4e-29   
ref|XP_004489011.1|  PREDICTED: vignain-like                            119   4e-29   
ref|XP_010503462.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    119   4e-29   
gb|AAO18731.1|  cysteine protease                                       119   4e-29   
gb|KFK30309.1|  hypothetical protein AALP_AA7G245200                    119   5e-29   
ref|XP_010515152.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    119   5e-29   
emb|CDP05747.1|  unnamed protein product                                119   5e-29   
gb|EPS57605.1|  cysteine proteinase                                     115   5e-29   
ref|XP_010277012.1|  PREDICTED: low-temperature-induced cysteine ...    119   5e-29   
ref|XP_009385160.1|  PREDICTED: vignain-like                            119   5e-29   
ref|XP_008797119.1|  PREDICTED: vignain-like                            117   5e-29   
ref|XP_010045986.1|  PREDICTED: ervatamin-B-like                        118   5e-29   
ref|NP_001176897.1|  Os12g0273900                                       115   5e-29   
emb|CDP15086.1|  unnamed protein product                                119   6e-29   
gb|AGV15821.1|  cysteine protease CP8                                   119   6e-29   
ref|XP_011045912.1|  PREDICTED: senescence-specific cysteine prot...    119   6e-29   
ref|XP_009145796.1|  PREDICTED: probable cysteine proteinase At3g...    119   6e-29   
emb|CDY46179.1|  BnaA05g20660D                                          119   6e-29   
ref|XP_004243398.1|  PREDICTED: ervatamin-B                             118   6e-29   
gb|KHG12401.1|  hypothetical protein F383_03889                         119   6e-29   
ref|XP_004961575.1|  PREDICTED: oryzain alpha chain-like                119   6e-29   
ref|XP_006384060.1|  hypothetical protein POPTR_0004s05510g             118   6e-29   
ref|XP_009352795.1|  PREDICTED: ervatamin-B-like                        118   7e-29   
ref|XP_002868998.1|  cysteine proteinase                                118   7e-29   
dbj|BAC75927.1|  cysteine protease-5                                    118   7e-29   
ref|XP_006494485.1|  PREDICTED: cysteine proteinase RD21a-like          118   7e-29   
ref|XP_009800981.1|  PREDICTED: vignain-like                            118   7e-29   
gb|KDP30997.1|  hypothetical protein JCGZ_11373                         118   7e-29   
ref|XP_004173252.1|  PREDICTED: oryzain alpha chain-like                117   7e-29   
ref|XP_006367781.1|  PREDICTED: LOW QUALITY PROTEIN: KDEL-tailed ...    118   7e-29   
ref|XP_003581047.2|  PREDICTED: senescence-specific cysteine prot...    118   7e-29   
ref|XP_002875897.1|  hypothetical protein ARALYDRAFT_347926             118   8e-29   
ref|XP_010270819.1|  PREDICTED: cysteine proteinase RD21a-like          119   8e-29   
emb|CDX99227.1|  BnaC05g33420D                                          119   8e-29   
ref|XP_006294508.1|  hypothetical protein CARUB_v10023540mg             118   8e-29   
ref|XP_006341791.1|  PREDICTED: vignain-like                            118   8e-29   
ref|XP_006341989.1|  PREDICTED: cysteine proteinase RD21a-like          119   8e-29   
ref|XP_011071164.1|  PREDICTED: vignain-like                            118   9e-29   
dbj|BAH79097.1|  cysteine protease                                      113   9e-29   
ref|XP_010052196.1|  PREDICTED: zingipain-2-like                        118   9e-29   
ref|XP_003607574.1|  Cysteine protease                                  118   9e-29   
ref|XP_009392372.1|  PREDICTED: ervatamin-B-like                        116   9e-29   
gb|KCW76116.1|  hypothetical protein EUGRSUZ_D00493                     118   9e-29   
ref|XP_006343212.1|  PREDICTED: cysteine proteinase RD21a-like          118   9e-29   
ref|XP_010417893.1|  PREDICTED: ervatamin-B-like                        118   1e-28   
ref|XP_004289205.1|  PREDICTED: cysteine proteinase RD21a-like          118   1e-28   
gb|EEE64302.1|  hypothetical protein OsJ_19139                          121   1e-28   
gb|KHN13721.1|  Vignain                                                 117   1e-28   
gb|KDP23983.1|  hypothetical protein JCGZ_25371                         117   1e-28   
ref|NP_566920.1|  putative cysteine proteinase                          117   1e-28   
ref|XP_010045988.1|  PREDICTED: ervatamin-B-like                        117   1e-28   
ref|XP_002316833.2|  hypothetical protein POPTR_0011s07520g             118   1e-28   
ref|XP_007214244.1|  hypothetical protein PRUPE_ppa023515mg             117   1e-28   
ref|XP_002310708.2|  hypothetical protein POPTR_0007s10650g             118   1e-28   
ref|XP_010939512.1|  PREDICTED: senescence-specific cysteine prot...    117   1e-28   
ref|XP_004294729.1|  PREDICTED: vignain-like                            117   1e-28   
emb|CAA40073.1|  endopeptidase (EP-C1)                                  117   1e-28   
ref|XP_008342781.1|  PREDICTED: ervatamin-B-like                        117   1e-28   
ref|XP_003609015.1|  Cysteine proteinase                                117   1e-28   
ref|XP_003557016.1|  PREDICTED: vignain-like                            117   1e-28   
gb|KCW47322.1|  hypothetical protein EUGRSUZ_K01110                     117   1e-28   
sp|P25803.2|CYSEP_PHAVU  RecName: Full=Vignain; AltName: Full=Bea...    117   1e-28   
ref|XP_007137980.1|  hypothetical protein PHAVU_009G170800g             117   1e-28   
ref|XP_010052206.1|  PREDICTED: ervatamin-B-like                        117   1e-28   
ref|XP_010545992.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    117   1e-28   
ref|XP_006446793.1|  hypothetical protein CICLE_v10018274mg             117   1e-28   
ref|XP_002306369.1|  hypothetical protein POPTR_0005s09080g             117   1e-28   
ref|XP_008805113.1|  PREDICTED: vignain-like                            117   1e-28   
ref|XP_002972714.1|  hypothetical protein SELMODRAFT_98707              118   1e-28   
gb|KCW76137.1|  hypothetical protein EUGRSUZ_D00513                     117   1e-28   
ref|XP_004136967.1|  PREDICTED: cysteine proteinase RD21a-like          118   1e-28   
ref|XP_004169046.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    117   2e-28   
gb|KDP23984.1|  hypothetical protein JCGZ_25372                         117   2e-28   
gb|KDP26711.1|  hypothetical protein JCGZ_17869                         116   2e-28   
gb|AAP32198.1|  cysteine protease 12                                    117   2e-28   
ref|XP_006857797.1|  hypothetical protein AMTR_s00061p00215400          117   2e-28   
gb|AAL60578.1|AF454956_1  senescence-associated cysteine protease       118   2e-28   
ref|XP_009420878.1|  PREDICTED: vignain-like                            117   2e-28   
ref|XP_004148072.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    117   2e-28   
gb|AAP32195.1|  cysteine protease 5                                     117   2e-28   
ref|XP_010912725.1|  PREDICTED: zingipain-2-like                        117   2e-28   
gb|EPS62067.1|  cysteine proteinase                                     116   2e-28   
prf||1910332A  Cys endopeptidase                                        117   2e-28
ref|XP_002450949.1|  hypothetical protein SORBIDRAFT_05g021550          117   2e-28   
gb|KGN62053.1|  hypothetical protein Csa_2G292830                       117   2e-28   
ref|XP_011005485.1|  PREDICTED: senescence-specific cysteine prot...    117   2e-28   
ref|XP_003607546.1|  Cysteine proteinase                                117   2e-28   
dbj|BAJ53169.1|  JHL18I08.3                                             117   2e-28   
ref|XP_009150151.1|  PREDICTED: macrodontain-1-like                     117   2e-28   
ref|XP_010093524.1|  Germination-specific cysteine protease 1           117   2e-28   
gb|AGW21712.1|  cysteine protease 2                                     113   2e-28   
ref|XP_004306813.1|  PREDICTED: vignain-like                            117   2e-28   
ref|XP_009103597.1|  PREDICTED: ervatamin-B                             117   2e-28   
ref|NP_001042970.2|  Os01g0347600                                       114   2e-28   
gb|AFW88998.1|  hypothetical protein ZEAMMB73_678859                    120   2e-28   
gb|EAY97106.1|  hypothetical protein OsI_19029                          117   2e-28   
ref|XP_010038689.1|  PREDICTED: ervatamin-B-like                        116   3e-28   
ref|XP_009772520.1|  PREDICTED: cysteine proteinase RD21a-like          117   3e-28   
pdb|1S4V|A  Chain A, The 2.0 A Crystal Structure Of The Kdel-Tail...    114   3e-28   
ref|XP_009767421.1|  PREDICTED: ervatamin-B-like                        116   3e-28   
emb|CDP18644.1|  unnamed protein product                                116   3e-28   
gb|KDP45578.1|  hypothetical protein JCGZ_17185                         116   3e-28   
ref|XP_009786836.1|  PREDICTED: vignain-like                            114   3e-28   
ref|XP_008789986.1|  PREDICTED: low-temperature-induced cysteine ...    117   3e-28   
ref|XP_008800119.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    112   3e-28   
ref|XP_002437490.1|  hypothetical protein SORBIDRAFT_10g028000          117   3e-28   
emb|CDP18639.1|  unnamed protein product                                116   3e-28   
gb|AAK27968.1|AF242372_1  cysteine protease                             116   3e-28   
ref|XP_004230752.1|  PREDICTED: cysteine proteinase RD21a-like          117   3e-28   
ref|XP_007132875.1|  hypothetical protein PHAVU_011G132100g             116   3e-28   
ref|XP_009352793.1|  PREDICTED: zingipain-2-like                        116   3e-28   
ref|XP_004236298.1|  PREDICTED: vignain-like                            116   3e-28   
ref|XP_010426322.1|  PREDICTED: KDEL-tailed cysteine endopeptidas...    116   4e-28   
gb|AAL14199.1|  cysteine proteinase precursor                           116   4e-28   
emb|CDP18645.1|  unnamed protein product                                116   4e-28   
ref|XP_002531152.1|  cysteine protease, putative                        116   4e-28   
sp|P12412.1|CYSEP_VIGMU  RecName: Full=Vignain; AltName: Full=Bea...    116   4e-28   
gb|ABV22590.1|  KDEL-tailed cysteine endopeptidase                      116   4e-28   
ref|XP_010038688.1|  PREDICTED: ervatamin-B-like                        116   4e-28   
ref|XP_003523725.1|  PREDICTED: oryzain alpha chain-like                117   4e-28   
ref|XP_004979206.1|  PREDICTED: vignain-like                            116   4e-28   
ref|XP_009771293.1|  PREDICTED: zingipain-2                             117   4e-28   
ref|XP_003624044.1|  Cysteine protease                                  119   5e-28   
gb|AAA50755.1|  cysteine proteinase                                     115   5e-28   
ref|XP_008340386.1|  PREDICTED: cysteine proteinase COT44-like          116   5e-28   
gb|KEH31479.1|  papain family cysteine protease                         116   5e-28   
ref|XP_011040442.1|  PREDICTED: vignain-like                            116   5e-28   
ref|NP_680113.3|  KDEL-tailed cysteine endopeptidase CEP2               116   5e-28   
gb|KDO63329.1|  hypothetical protein CISIN_1g047793mg                   115   5e-28   
dbj|BAF46311.1|  cysteine proteinase precursor                          115   5e-28   
gb|EAY73926.1|  hypothetical protein OsI_01810                          115   5e-28   
gb|KHN45886.1|  Oryzain alpha chain                                     116   5e-28   
ref|XP_007025364.1|  Xylem bark cysteine peptidase 3 isoform 2          115   5e-28   
gb|EAZ11801.1|  hypothetical protein OsJ_01675                          115   5e-28   
ref|XP_004975184.1|  PREDICTED: vignain-like                            115   6e-28   
ref|XP_003624041.1|  Cysteine proteinase                                115   6e-28   
ref|XP_009412837.1|  PREDICTED: vignain-like                            117   6e-28   
ref|XP_002531151.1|  cysteine protease, putative                        115   6e-28   
ref|XP_007132860.1|  hypothetical protein PHAVU_011G130800g             115   6e-28   
ref|XP_009594088.1|  PREDICTED: zingipain-2-like                        115   6e-28   
gb|KDO79088.1|  hypothetical protein CISIN_1g017419mg                   115   6e-28   
ref|XP_006425969.1|  hypothetical protein CICLE_v10025887mg             115   6e-28   
ref|NP_001149658.1|  cysteine protease 1 precursor                      116   6e-28   
ref|XP_004505498.1|  PREDICTED: vignain-like                            115   6e-28   
gb|AFW59668.1|  LOW QUALITY PROTEIN: cysteine protease 1                116   7e-28   
ref|XP_009367558.1|  PREDICTED: cysteine proteinase COT44-like          115   7e-28   
gb|EAY73929.1|  hypothetical protein OsI_01813                          115   7e-28   
ref|XP_010070267.1|  PREDICTED: zingipain-2                             115   7e-28   
gb|AAP32197.1|  cysteine protease 10                                    114   7e-28   
gb|EMS65496.1|  Cysteine proteinase RD21a                               114   7e-28   
ref|XP_006469128.1|  PREDICTED: vignain-like                            115   7e-28   
ref|XP_003612210.1|  Cysteine proteinase                                115   7e-28   
ref|XP_007044884.1|  Cysteine proteinases superfamily protein           117   7e-28   
ref|XP_009779641.1|  PREDICTED: vignain-like                            113   8e-28   
ref|XP_007047371.1|  Granulin repeat cysteine protease family pro...    115   8e-28   
dbj|BAD53944.1|  putative cysteine protease                             115   8e-28   
ref|XP_006380488.1|  hypothetical protein POPTR_0007s07170g             115   8e-28   
emb|CAB16317.1|  cysteine proteinase precursor                          115   8e-28   
ref|XP_010271530.1|  PREDICTED: low-temperature-induced cysteine ...    115   9e-28   
gb|EYU29820.1|  hypothetical protein MIMGU_mgv1a009422mg                115   9e-28   
ref|XP_009784112.1|  PREDICTED: cysteine proteinase COT44-like          115   9e-28   
ref|XP_002525124.1|  cysteine protease, putative                        115   9e-28   
gb|ABA97421.1|  Vignain precursor, putative                             115   9e-28   
gb|AAK07730.1|  CPR1-like cysteine proteinase                           115   9e-28   
ref|XP_008225221.1|  PREDICTED: vignain-like                            112   1e-27   
gb|KHN33968.1|  Vignain                                                 113   1e-27   
gb|EAY93078.1|  hypothetical protein OsI_14879                          115   1e-27   
ref|XP_008799976.1|  PREDICTED: vignain-like                            113   1e-27   
gb|AJA74411.1|  cysteine protease                                       115   1e-27   
ref|XP_003635767.1|  Cysteine proteinase                                115   1e-27   
ref|XP_002511277.1|  cysteine protease, putative                        115   1e-27   
ref|XP_006388351.1|  hypothetical protein POPTR_0213s00200g             112   1e-27   
ref|XP_009354265.1|  PREDICTED: ervatamin-B-like                        115   1e-27   
ref|XP_006346518.1|  PREDICTED: cysteine proteinase RD21a-like          115   1e-27   
ref|XP_002275891.1|  PREDICTED: zingipain-2                             115   1e-27   
emb|CBI21941.3|  unnamed protein product                                115   1e-27   
dbj|BAF56429.1|  cysteine proteinase                                    115   1e-27   
ref|XP_010061721.1|  PREDICTED: low-temperature-induced cysteine ...    115   1e-27   
gb|KCW68708.1|  hypothetical protein EUGRSUZ_F02310                     115   1e-27   
gb|AFK47737.1|  unknown                                                 115   1e-27   
ref|XP_002310053.1|  hypothetical protein POPTR_0007s07200g             114   1e-27   
ref|XP_006380493.1|  hypothetical protein POPTR_0007s07240g             114   1e-27   
gb|KHN05804.1|  Vignain                                                 114   1e-27   
ref|XP_004485885.1|  PREDICTED: LOW QUALITY PROTEIN: xylem cystei...    114   1e-27   
ref|XP_008238897.1|  PREDICTED: cysteine proteinase COT44               115   1e-27   
ref|XP_007205396.1|  hypothetical protein PRUPE_ppa007467mg             115   1e-27   
ref|XP_008340275.1|  PREDICTED: fruit bromelain-like                    117   1e-27   
ref|XP_010107858.1|  Cysteine proteinase RD21a                          115   1e-27   
ref|XP_010445171.1|  PREDICTED: zingipain-2-like                        114   1e-27   
ref|XP_010686289.1|  PREDICTED: senescence-specific cysteine prot...    114   1e-27   
gb|AAD55362.1|  cysteine protease                                       110   1e-27   
dbj|BAJ90119.1|  predicted protein                                      115   2e-27   
ref|XP_006339859.1|  PREDICTED: cysteine proteinase RD21a-like          114   2e-27   
gb|KHN08187.1|  Thiol protease SEN102                                   114   2e-27   
emb|CAQ00107.1|  papain-like cysteine proteinase                        115   2e-27   
ref|XP_004505502.1|  PREDICTED: vignain-like                            114   2e-27   
dbj|BAB63884.1|  putative cysteine protease                             114   2e-27   
gb|AHA62783.1|  RCR3-like cysteine protease                             114   2e-27   
emb|CBI19479.3|  unnamed protein product                                115   2e-27   
ref|XP_010928804.1|  PREDICTED: xylem cysteine proteinase 1-like        114   2e-27   
ref|XP_008790576.1|  PREDICTED: ervatamin-B-like                        114   2e-27   
gb|ADV41672.1|  cysteine protease                                       114   2e-27   
gb|AHA62780.1|  RCR3-like cysteine protease                             114   2e-27   
ref|XP_002284973.1|  PREDICTED: low-temperature-induced cysteine ...    115   2e-27   
ref|XP_002440039.1|  hypothetical protein SORBIDRAFT_09g024940          115   2e-27   
ref|NP_001237379.1|  cysteine proteinase precursor                      114   2e-27   
ref|XP_006592465.1|  PREDICTED: vignain-like                            114   2e-27   
emb|CDP18638.1|  unnamed protein product                                114   2e-27   
ref|XP_011014442.1|  PREDICTED: senescence-specific cysteine prot...    114   2e-27   
ref|XP_009391873.1|  PREDICTED: xylem cysteine proteinase 1-like        114   2e-27   
ref|XP_006351440.1|  PREDICTED: vignain-like                            114   2e-27   
ref|XP_008811650.1|  PREDICTED: vignain-like                            113   2e-27   
ref|XP_009759551.1|  PREDICTED: zingipain-2-like                        114   2e-27   
ref|XP_009352948.1|  PREDICTED: ervatamin-B-like                        114   2e-27   
ref|XP_008454976.1|  PREDICTED: low-temperature-induced cysteine ...    115   2e-27   
ref|XP_002436840.1|  hypothetical protein SORBIDRAFT_10g009830          114   2e-27   
ref|XP_010915506.1|  PREDICTED: low-temperature-induced cysteine ...    115   2e-27   



>ref|XP_009616844.1| PREDICTED: zingipain-1-like [Nicotiana tomentosiformis]
Length=341

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 98/143 (69%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI +IKTG L+SLSEQQL+DC+  NN GCGGG R EAF++I  +GGL TES+YPY G+  
Sbjct  160  GINQIKTGDLVSLSEQQLLDCENTNNDGCGGGIRTEAFEYIAENGGLTTESNYPYTGIPG  219

Query  251  RCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
             C++Q   +   TI+GY+ V+ASESALL AVANQPVSAGIT      R+        GIF
Sbjct  220  TCDSQKAESSVVTISGYRSVDASESALLQAVANQPVSAGITIGSDEFRFYN-----GGIF  274

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                  G+CG   +HAVT++GYG
Sbjct  275  -----NGKCGMTSRHAVTVVGYG  292



>ref|XP_006362436.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=341

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 95/143 (66%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP-NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            G+ ++KTG LISLSEQQL+DC+  NN GCGGG R EAF +I  +GGL TES+YPY G+  
Sbjct  160  GLNQLKTGNLISLSEQQLLDCESTNNNGCGGGVRNEAFLYIAENGGLTTESNYPYTGIPG  219

Query  251  RCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
             CN++   + A TI+ Y+ V+ SESALL AVA QPVSAGI       R+ +      GIF
Sbjct  220  TCNSKKAESTAVTISSYKTVDPSESALLQAVAIQPVSAGINVGSDKFRFYK-----GGIF  274

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 +GECG    HAVT++GYG
Sbjct  275  -----SGECGESSHHAVTVVGYG  292



>ref|XP_004232961.1| PREDICTED: zingipain-2-like [Solanum lycopersicum]
Length=341

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 94/143 (66%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP-NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            G+ ++KTG LISLSEQQL+DC+  NN GCGGG R EAF +I  +GGL TES+YPY G+  
Sbjct  160  GLNQLKTGNLISLSEQQLLDCESRNNNGCGGGVRNEAFLYIAENGGLTTESNYPYTGIPG  219

Query  251  RCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
             CN++   + A TI+ Y+ V+ SESALL AV  QPVSAG+       R+ +      GIF
Sbjct  220  SCNSKMAESTAVTISSYKTVDPSESALLQAVLIQPVSAGVNIGSDKFRFYK-----GGIF  274

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 +GECG    HAVT++GYG
Sbjct  275  -----SGECGESSHHAVTVVGYG  292



>ref|XP_002889596.1| hypothetical protein ARALYDRAFT_887827 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65855.1| hypothetical protein ARALYDRAFT_887827 [Arabidopsis lyrata subsp. 
lyrata]
Length=343

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 94/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG L+SLSEQQL+DCD    N+GC GG    AF+FIK +GGL TE+DYPY G+E
Sbjct  162  GINKIKTGNLVSLSEQQLIDCDVGTYNKGCSGGLMETAFEFIKSNGGLTTETDYPYTGIE  221

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
              C+ +  +N+  TI GYQ+V  +E++L +A A QPVS GI   G +    Q Y   +G+
Sbjct  222  GTCDQEKAKNKVVTIQGYQKVAQNEASLQIAAAQQPVSVGIDAGGFI---FQLY--SSGV  276

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FT Y     CG+   H VT++GYG
Sbjct  277  FTSY-----CGTNLNHGVTVVGYG  295



>ref|XP_006417940.1| hypothetical protein EUTSA_v10008102mg [Eutrema salsugineum]
 gb|ESQ36293.1| hypothetical protein EUTSA_v10008102mg [Eutrema salsugineum]
Length=344

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 95/144 (66%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI +IKTG+L+SLSEQQL+DCD    N+GC GG    A++FIK +GGL TE+DYPY   E
Sbjct  163  GINQIKTGKLVSLSEQQLIDCDTGTYNKGCSGGLMETAYEFIKTNGGLTTETDYPYTAAE  222

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
              C+ +  +N+  TI GYQ+V  +E++L +A A QPVS GI   G +    Q Y   +G+
Sbjct  223  GTCDQEKAKNKVVTIQGYQKVAQNEASLRIAAAQQPVSVGIDAGGFI---FQLYS--SGV  277

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FTGY     CGS   HAVT++GYG
Sbjct  278  FTGY-----CGSNLNHAVTVVGYG  296



>ref|NP_563764.1| Cysteine proteinases superfamily protein [Arabidopsis thaliana]
 gb|AAF80223.1|AC025290_12 Contains similarity to a cysteine endopeptidase 1 from Phaseolus 
vulgaris gb|U52970 and is a member of the papain cysteine 
protease family PF|00112 [Arabidopsis thaliana]
 gb|AEE27969.1| Cysteine proteinases superfamily protein [Arabidopsis thaliana]
Length=343

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 94/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG L+SLSEQQL+DCD    N+GC GG    AF+FIK +GGL TE+DYPY G+E
Sbjct  162  GINKIKTGNLVSLSEQQLIDCDVGTYNKGCSGGLMETAFEFIKTNGGLATETDYPYTGIE  221

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
              C+ +  +N+  TI GYQ+V  +E++L +A A QPVS GI   G +    Q Y   +G+
Sbjct  222  GTCDQEKSKNKVVTIQGYQKVAQNEASLQIAAAQQPVSVGIDAGGFI---FQLY--SSGV  276

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FT Y     CG+   H VT++GYG
Sbjct  277  FTNY-----CGTNLNHGVTVVGYG  295



>ref|XP_010501342.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=312

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 96/144 (67%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG L+SLSEQQL+DCD    N+GC GG    AF++IK +GGL+TE+DYPY G+E
Sbjct  131  GINKIKTGNLVSLSEQQLIDCDVGTYNKGCSGGLMETAFEYIKTNGGLVTETDYPYTGIE  190

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
              C+ +  +N+  TI G+++V  +E++L +A A QPVS GI   G +    Q Y  G+G+
Sbjct  191  GTCDQEKTKNKVVTIQGFKKVAQNEASLQIAAAQQPVSVGIDAGGFI---FQLY--GSGV  245

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FT Y     CG+   H VT++GYG
Sbjct  246  FTSY-----CGTNLNHGVTVVGYG  264



>ref|XP_011014387.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=197

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 97/143 (68%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI K+KTG+LISLSEQQLVDCD  N+GCGGG    AFQ+I  +GGL +E +YPY+GV+  
Sbjct  16   GIIKLKTGKLISLSEQQLVDCDVGNKGCGGGIMDNAFQYIIRNGGLASEDNYPYQGVDGT  75

Query  248  CNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            CN++   +  A I GY++V + +E+ALL AVA QPVS GI   G+  ++ +     +G+F
Sbjct  76   CNSEKASSIEAEITGYEDVPQNNENALLQAVAKQPVSVGIDGGGQDFQFYK-----SGVF  130

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                  G+CG+   HAVT IGYG
Sbjct  131  -----KGDCGTEQNHAVTAIGYG  148



>ref|XP_010475355.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=312

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 96/144 (67%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG L+SLSEQQL+DCD +  N+GC GG    AF++IK +GGL+TE+DYPY G+E
Sbjct  131  GINKIKTGNLVSLSEQQLIDCDVDTYNKGCSGGLMETAFEYIKTNGGLVTETDYPYTGIE  190

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
              C+ +  +N+  TI G+++V  +E++L +A A QPVS GI   G +    Q Y   +G+
Sbjct  191  GTCDQEKTKNKVVTIQGFKKVAQNEASLQIAAAQQPVSVGIDAGGFI---FQLY--SSGV  245

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FT Y     CG+   H VT++GYG
Sbjct  246  FTSY-----CGTNLNHGVTVVGYG  264



>ref|XP_008780633.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=186

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 95/144 (66%), Gaps = 13/144 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD    ++GCGGG   +AF+FI  +GGL TE++YPYE  +
Sbjct  3    GITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIKNGGLTTEANYPYEATD  62

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT    + AATI GY++V A SE+ALL AVANQPVS  I   G      Q Y   +G
Sbjct  63   GTCNTGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVAIDAGGFA---FQLYS--SG  117

Query  77   IFTGYDNTGECGSGYKHAVTIIGY  6
            +F     TG+CG+   H VT +GY
Sbjct  118  VF-----TGDCGTDLDHGVTAVGY  136



>ref|XP_010462580.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=312

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 95/144 (66%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG L+SLSEQQL+DCD    N+GC GG    AF++IK +GGL+TE+DYPY G+E
Sbjct  131  GINKIKTGNLVSLSEQQLIDCDVGTYNKGCSGGLMETAFEYIKTNGGLVTETDYPYTGIE  190

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
              C+ +  +N+  TI GY++V  +E++L +A A QPVS GI   G +    Q Y   +G+
Sbjct  191  GTCDQEKTKNKVVTIQGYKKVAQNEASLQIAAAQQPVSVGIDAGGFI---FQLY--SSGV  245

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FT Y     CG+   H VT++GYG
Sbjct  246  FTSY-----CGTNLNHGVTVVGYG  264



>ref|XP_006852525.1| hypothetical protein AMTR_s00021p00178750 [Amborella trichopoda]
 gb|ERN13992.1| hypothetical protein AMTR_s00021p00178750 [Amborella trichopoda]
Length=227

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 93/143 (65%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GITKIKTG+L+SLSEQQL+DCD  N GC GG  V AFQ+I+ +GGL TES+YPY+  +  
Sbjct  47   GITKIKTGKLVSLSEQQLIDCDTENDGCMGGYMVTAFQYIRANGGLSTESNYPYQAADGN  106

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            C+T+     AA+I GY+EV A +E+ LL AV  QPVS  I   G    Y   + KG GIF
Sbjct  107  CDTRRASYHAASIRGYREVPANNENELLKAVVQQPVSVAIDASG----YAFQFYKG-GIF  161

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 +G CG+   H VT +GYG
Sbjct  162  -----SGACGTELNHGVTAVGYG  179



>ref|XP_009629965.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=343

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKTG+LISLSEQ+LVDCD  ++ GC GG   +AF+FI  + GL TES+YPYEG  A
Sbjct  160  GINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNNGLTTESNYPYEGTNA  219

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T    N AA I GY++V A SESALL AVANQP+S  I   G   ++        G+
Sbjct  220  TCKTGKESNHAAKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQFY-----STGV  274

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT IGYG
Sbjct  275  F-----TGECGTELDHGVTAIGYG  293



>ref|XP_008780330.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=186

 Score =   128 bits (322),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+KTG LISLSEQ+LVDCD    ++GC GG   +AF+FI  +GGL TE++YPY+G++
Sbjct  3    GITKLKTGNLISLSEQELVDCDVAGEDQGCEGGLMDDAFKFIIRTGGLTTETNYPYKGID  62

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   + AA+I GY++V A SE+ALL AV NQPVS  I   G   ++       +G
Sbjct  63   GTCNNKKSPSHAASIKGYEDVPANSEAALLKAVTNQPVSVAIEASGSSFQFYS-----SG  117

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            IF     TG CG+   H VT +GYG
Sbjct  118  IF-----TGSCGTDLDHGVTAVGYG  137



>ref|XP_010054319.1| PREDICTED: zingipain-2-like [Eucalyptus grandis]
 gb|KCW76119.1| hypothetical protein EUGRSUZ_D00496 [Eucalyptus grandis]
Length=345

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 93/146 (64%), Gaps = 17/146 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GIT IK G+L+ LS Q+LVDCD N+ GCGGG    AF+FI  +GGL TE++YPY+G +  
Sbjct  162  GITMIKKGKLVPLSVQELVDCDDNDEGCGGGLMDSAFKFIVSNGGLTTEANYPYQGDDGT  221

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            CNT    N AA+I GYQ+V A +E ALL AVANQPVS  I    FD       Q Y   +
Sbjct  222  CNTAKTANPAASITGYQDVPANNEKALLQAVANQPVSVAIEGGGFD------FQFY--SS  273

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            G+F     TG CGS   HAVT +GYG
Sbjct  274  GVF-----TGSCGSDIDHAVTAVGYG  294



>ref|XP_006281607.1| hypothetical protein CARUB_v10027725mg [Capsella rubella]
 gb|EOA14505.1| hypothetical protein CARUB_v10027725mg [Capsella rubella]
Length=346

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 94/143 (66%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G  +IK G+LISLSEQQLVDCDPN+ GC GG    AF  IK +GGL TES+YPY+G +A 
Sbjct  165  GAAQIKKGKLISLSEQQLVDCDPNDYGCEGGLMDTAFAHIKATGGLTTESNYPYKGEDAT  224

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            CN++    +A TI GY++V A+ ESAL+ AVA+QPVS  I   G   ++       +G+F
Sbjct  225  CNSKKTSPKATTITGYEDVPANDESALMKAVAHQPVSVAIEGGGFAFQFY-----SSGVF  279

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 +GEC +   HAVT +GYG
Sbjct  280  -----SGECTTNLDHAVTAVGYG  297



>ref|XP_002524912.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37409.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 94/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            G+ KI TG+LISLSEQ+LVDCD + N GC GG    AFQFI  +GG+ T+ DYPY+ V+ 
Sbjct  173  GVNKIVTGELISLSEQELVDCDRSYNAGCNGGLMDNAFQFIINNGGIDTDKDYPYQAVDG  232

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +C+T  ++N+A TI G+++V A  E AL  AVA+QPVS  I   G   ++ Q     +G+
Sbjct  233  KCDTTKVKNKAVTIDGFEDVMAFDEMALQKAVAHQPVSVAIEASGMALQFYQ-----SGV  287

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECGS   H V I+GYG
Sbjct  288  F-----TGECGSALDHGVVIVGYG  306



>ref|XP_009775915.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=340

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKTG+LISLSEQ+LVDCD  ++ GC GG   +AF FI  + GL TES+YPYEG + 
Sbjct  158  GINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFTFIIKNHGLTTESNYPYEGTDG  217

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T+   N  A I GY++V A SESALL AVANQPVS  I   G   ++       +G+
Sbjct  218  TCKTRKESNHVAKITGYEDVPANSESALLSAVANQPVSVAIDASGSDFQFYS-----SGV  272

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT IGYG
Sbjct  273  F-----TGECGTELDHGVTAIGYG  291



>gb|AAC49135.1| SAG12 protein [Arabidopsis thaliana]
Length=346

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 95/146 (65%), Gaps = 17/146 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G T+IK G+LISLSEQQLVDCD N+ GC GG    AF+ IK +GGL TESDYPY+G +A 
Sbjct  165  GATQIKKGKLISLSEQQLVDCDTNDFGCEGGLMDTAFEHIKATGGLTTESDYPYKGEDAT  224

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            CN++    +A +I GY++V  + E AL+ AVA+QPVS GI    FD       Q Y   +
Sbjct  225  CNSKKTNPKATSITGYEDVPVNDEQALMKAVAHQPVSVGIEGGGFD------FQFY--SS  276

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            G+F     TGEC +   HAVT IGYG
Sbjct  277  GVF-----TGECTTYLDHAVTAIGYG  297



>ref|XP_010054320.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76122.1| hypothetical protein EUGRSUZ_D00499 [Eucalyptus grandis]
Length=345

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 93/143 (65%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GIT IK G+L+ LS Q+LVDCD N+ GC GG    AF+FI  +GGL TE++YPY+G++  
Sbjct  162  GITMIKKGKLVPLSVQELVDCDDNDDGCMGGLMDSAFEFIVSNGGLTTEANYPYQGIDGT  221

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            CNT    N+AA+I GYQ+V A +E ALL AVANQPVS  I   G   ++       +G+F
Sbjct  222  CNTAKTANQAASITGYQDVPANNEKALLQAVANQPVSVAIEGGGYNFQFYS-----SGVF  276

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 TG CG+   HAVT +GYG
Sbjct  277  -----TGSCGTDIDHAVTAVGYG  294



>gb|KCW76123.1| hypothetical protein EUGRSUZ_D00500 [Eucalyptus grandis]
Length=345

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 93/143 (65%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GIT IK G+L+ LS Q+LVDCD N+ GC GG    AF+FI  +GGL TE++YPY+G++  
Sbjct  162  GITMIKKGKLVPLSVQELVDCDDNDDGCMGGLMDSAFEFIVSNGGLTTEANYPYQGIDGT  221

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            CNT    N+AA+I GYQ+V A +E ALL AVANQPVS  I   G   ++       +G+F
Sbjct  222  CNTAKTANQAASITGYQDVPANNEKALLQAVANQPVSVSIEGGGYNFQFYS-----SGVF  276

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 TG CG+   HAVT +GYG
Sbjct  277  -----TGSCGTDIDHAVTAVGYG  294



>ref|XP_010052199.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76124.1| hypothetical protein EUGRSUZ_D00500 [Eucalyptus grandis]
Length=345

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 93/143 (65%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GIT IK G+L+ LS Q+LVDCD N+ GC GG    AF+FI  +GGL TE++YPY+G++  
Sbjct  162  GITMIKKGKLVPLSVQELVDCDDNDDGCMGGLMDSAFEFIVSNGGLTTEANYPYQGIDGT  221

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            CNT    N+AA+I GYQ+V A +E ALL AVANQPVS  I   G   ++       +G+F
Sbjct  222  CNTAKTANQAASITGYQDVPANNEKALLQAVANQPVSVSIEGGGYNFQFYS-----SGVF  276

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 TG CG+   HAVT +GYG
Sbjct  277  -----TGSCGTDIDHAVTAVGYG  294



>ref|XP_004252652.2| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=322

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKTG+LISLSEQ+LVDCD  ++ GC GG   +AF+FI  + GL TES+YPYEG ++
Sbjct  140  GINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDS  199

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T    N AA I  Y++V A SESALL AVANQPVS  I   G   ++       +G+
Sbjct  200  TCKTGKESNHAAKITSYEDVPANSESALLKAVANQPVSVAIDASGSDFQFY-----SSGV  254

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT +GYG
Sbjct  255  F-----TGECGTELDHGVTAVGYG  273



>ref|XP_002523447.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38906.1| cysteine protease, putative [Ricinus communis]
Length=342

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD +  ++GC GG   +AF+FIK +GGL TE++YPY+G +
Sbjct  159  GITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFEFIKQNGGLTTEANYPYQGTD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT    N AA I GY++V A SE ALL AVA+QPVS  I   G   ++        G
Sbjct  219  GTCNTNKAGNDAAKITGYEDVPANSEDALLKAVASQPVSVAIDASGSAFQFYS-----GG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG+CG+   H VT +GYG
Sbjct  274  VF-----TGDCGTELDHGVTAVGYG  293



>ref|XP_010906196.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=342

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 98/145 (68%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+KTG+LISLSEQ+LVDCD    ++GC GG   +AF+FI  +GGL TE++YPY+G++
Sbjct  159  GITKLKTGKLISLSEQELVDCDVAGEDQGCEGGLMDDAFEFIIRNGGLTTETNYPYKGID  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA+I GY++V A SE+ALL AV+NQPVS  I   G   ++       +G
Sbjct  219  GTCNTKKSFSHAASIKGYEDVPANSEAALLNAVSNQPVSVAIEASGYSFQFYS-----SG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  274  VF-----TGSCGTDLDHGVTAVGYG  293



>ref|XP_011005484.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=197

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 95/143 (66%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI K+KTG+LISLSEQQLVDCD  N GC GG    AFQ+I  +GGL +E +YPY+GV+  
Sbjct  16   GIIKLKTGKLISLSEQQLVDCDVGNNGCHGGFMDNAFQYIIRNGGLASEDNYPYQGVDGT  75

Query  248  CNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            CN++   +  A I GY++V + +E+ALL AVA QPVS GI   G+  ++ +     +G+F
Sbjct  76   CNSEKASSIEAEITGYEDVPQNNENALLQAVAKQPVSVGIDGGGQDFQFYK-----SGVF  130

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                  G+CG+   HAVT IGYG
Sbjct  131  -----KGDCGTEQNHAVTAIGYG  148



>ref|XP_009623244.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=341

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 94/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP-NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKTG+LISLSEQ+LVDCD  ++ GC GG   +AF+FI  + GL TES+YPYEG +A
Sbjct  159  GINKIKTGKLISLSEQELVDCDTRSDMGCEGGLMDDAFKFIIKNNGLTTESNYPYEGTDA  218

Query  251  RCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T    N AA I GY++V + SESALL AVANQP+S  I   G   ++       +G+
Sbjct  219  TCKTGKESNHAAKITGYEDVPDNSESALLKAVANQPISVAIDASGSDFQFY-----SSGV  273

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   H VT +GYG
Sbjct  274  F-----TGKCGTELDHGVTAVGYG  292



>ref|XP_007048792.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            G+TK+ TG+LISLSEQ+LVDCD   +++GC GG   +AFQFI+ + GL TESDYPY+GV+
Sbjct  160  GVTKLTTGKLISLSEQELVDCDTKGDDQGCQGGLMDDAFQFIQNNKGLTTESDYPYKGVD  219

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
             +CNT    N AA I G+++V A +E AL  AVANQPVS  I   G   ++       +G
Sbjct  220  GKCNTNKEANHAANINGHEDVPANNEEALHKAVANQPVSVAIDAGGYEFQFY-----SSG  274

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG+CG+   H VT +GYG
Sbjct  275  VF-----TGDCGTDLDHGVTAVGYG  294



>ref|XP_002523448.1| cysteine protease, putative [Ricinus communis]
 gb|EEF38907.1| cysteine protease, putative [Ricinus communis]
Length=341

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD +  ++GC GG   +AF+FIK +GGL TE++YPY+G +
Sbjct  159  GITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFEFIKQNGGLTTEANYPYQGTD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT    N AA I GY++V A SE ALL AVA+QPVS  I   G   ++        G
Sbjct  219  GTCNTNKAGNDAAKITGYEDVPANSEDALLKAVASQPVSVAIDASGSAFQFYS-----GG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG+CG+   H VT +GYG
Sbjct  274  VF-----TGDCGTELDHGVTAVGYG  293



>ref|XP_009617815.1| PREDICTED: ervatamin-B-like [Nicotiana tomentosiformis]
Length=339

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 95/144 (66%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKTG+LISLSEQ+LVDCD N N+GC GG   +AF++I  + GL +ES+YPY+G++ 
Sbjct  157  GINKIKTGKLISLSEQELVDCDTNSNQGCEGGLMDDAFKYIIKNHGLTSESNYPYKGIDG  216

Query  251  RCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T+   N  A I+GY++V E SESALL AVANQPVS  I   G   ++       +GI
Sbjct  217  TCKTEKESNHIAKISGYKDVPENSESALLKAVANQPVSVAIDASGSDFQFY-----SSGI  271

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   H V  +GYG
Sbjct  272  F-----TGKCGTELDHGVVAVGYG  290



>ref|XP_011078044.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 95/144 (66%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI ++ TG+LISLSEQ+LVDCD + + GC GG   +AF+FI  +GG+ TES+YPYEGV+ 
Sbjct  159  GINQLTTGKLISLSEQELVDCDTSEDEGCNGGLMDDAFEFIISNGGITTESNYPYEGVDG  218

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN++   + AA I GY++V A SE ALL AVANQPVS  I   G   ++       +G+
Sbjct  219  TCNSKKESSHAAKITGYEDVPANSEPALLKAVANQPVSVAIDASGSDFQFY-----SSGV  273

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT +GYG
Sbjct  274  F-----TGECGTELDHGVTAVGYG  292



>ref|XP_009359979.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD +  ++GCGGG   +AFQFI  + GL TE++YPY GV+
Sbjct  159  GITKLTTGKLISLSEQELVDCDTSGVDQGCGGGLMDDAFQFINKNHGLSTETNYPYTGVD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I GY++V A SE ALL AVANQP+S  I   G   ++       +G
Sbjct  219  GTCNTKKEASHAAKITGYEDVPANSEEALLKAVANQPISVAIDAGGSDFQFYS-----SG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  274  VF-----TGTCGTSLDHGVTAVGYG  293



>ref|XP_004252606.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=341

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKTG+LISLSEQ+LVDCD  ++ GC GG   +AF+FI  + GL TES+YPYEG ++
Sbjct  159  GINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDS  218

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T    N AA I  Y++V A SES+LL AVANQPVS  I   G   ++       +G+
Sbjct  219  TCKTGKESNHAAKITSYEDVPANSESSLLKAVANQPVSVAIDASGSDFQFY-----SSGV  273

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT +GYG
Sbjct  274  F-----TGECGTELDHGVTAVGYG  292



>ref|XP_007048796.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92953.1| Senescence-associated gene 12 [Theobroma cacao]
Length=343

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            G+TK+ TG+LISLSEQ+LVDCD    ++GC GG   +AFQFI+ + GL TESDYPY+GV+
Sbjct  160  GVTKLTTGKLISLSEQELVDCDTKGEDQGCQGGLMDDAFQFIQNNKGLTTESDYPYKGVD  219

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT    N AA I G+++V A SE AL  AVANQPVS  I   G   ++        G
Sbjct  220  GTCNTNKEANHAAKINGFEDVPANSEDALQKAVANQPVSVAIDAGGFKFQFY-----SGG  274

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG+CG+   H VT +GYG
Sbjct  275  VF-----TGDCGTALDHGVTAVGYG  294



>ref|XP_007216164.1| hypothetical protein PRUPE_ppa015341mg, partial [Prunus persica]
 gb|EMJ17363.1| hypothetical protein PRUPE_ppa015341mg, partial [Prunus persica]
Length=196

 Score =   125 bits (315),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD N  ++GC GG   +AFQFI+ + GL TE++YPY GV+
Sbjct  13   GITQLTTGKLISLSEQELVDCDTNGEDQGCEGGLMDDAFQFIQQNHGLGTEANYPYSGVD  72

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I GY++V   SE ALL AVANQPVS  I   G   ++       +G
Sbjct  73   GTCNTKKEASIAAKITGYEDVPTNSEQALLKAVANQPVSVAIDASGSDFQFYS-----SG  127

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  128  VF-----TGTCGTSLDHGVTAVGYG  147



>ref|NP_568651.1| cysteine protease SAG12 [Arabidopsis thaliana]
 sp|Q9FJ47.1|SAG12_ARATH RecName: Full=Senescence-specific cysteine protease SAG12; AltName: 
Full=Cysteine proteinase SAG12; AltName: Full=Protein 
SENESCENCE-ASSOCIATED GENE 12; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK43946.1|AF370131_1 putative senescence-specific cysteine protease SAG12 [Arabidopsis 
thaliana]
 dbj|BAB09317.1| senescence-specific cysteine protease [Arabidopsis thaliana]
 gb|AAK64131.1| putative senescence-specific cysteine protease SAG12 [Arabidopsis 
thaliana]
 gb|AED95312.1| cysteine protease [Arabidopsis thaliana]
Length=346

 Score =   129 bits (323),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 95/146 (65%), Gaps = 17/146 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G T+IK G+LISLSEQQLVDCD N+ GC GG    AF+ IK +GGL TES+YPY+G +A 
Sbjct  165  GATQIKKGKLISLSEQQLVDCDTNDFGCEGGLMDTAFEHIKATGGLTTESNYPYKGEDAT  224

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            CN++    +A +I GY++V  + E AL+ AVA+QPVS GI    FD       Q Y   +
Sbjct  225  CNSKKTNPKATSITGYEDVPVNDEQALMKAVAHQPVSVGIEGGGFD------FQFY--SS  276

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            G+F     TGEC +   HAVT IGYG
Sbjct  277  GVF-----TGECTTYLDHAVTAIGYG  297



>ref|XP_006360708.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   129 bits (323),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKTG+LISLSEQ+LVDCD  ++ GC GG   +AF+FI  + GL TES+YPYEG + 
Sbjct  158  GINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDN  217

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T    N AA I  Y++V A SESALL AVANQPVS  I   G   ++       +G+
Sbjct  218  TCKTGKESNHAAKITSYEDVPANSESALLKAVANQPVSVAIDASGSDFQFY-----SSGV  272

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT +GYG
Sbjct  273  F-----TGECGTELDHGVTAVGYG  291



>ref|XP_009349242.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=484

 Score =   130 bits (327),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 73/145 (50%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD +  ++GCGGG   +AFQFI  + GL TE++YPY GV+
Sbjct  301  GITKLTTGKLISLSEQELVDCDTSGVDQGCGGGLMDDAFQFINKNHGLSTETNYPYTGVD  360

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I GY++V A SE ALL AVANQP+S  I   G   ++       +G
Sbjct  361  GTCNTKKEASHAAQITGYEDVPANSEEALLKAVANQPISVAIDAGGSDFQFYS-----SG  415

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  416  VF-----TGTCGTSLDHGVTAVGYG  435



>dbj|BAD29955.1| cysteine protease [Daucus carota]
Length=365

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++KTG+LISLSEQ+LVDCD N  ++GC GG    AF FI+ + GL TE++YPY G +
Sbjct  158  GITQLKTGKLISLSEQELVDCDTNGEDQGCEGGLMDYAFDFIQQNHGLSTETNYPYSGTD  217

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN     N AATI G+++V A SESALL AVANQP+S  I   G   ++       +G
Sbjct  218  GTCNANKEANHAATITGHEDVPANSESALLKAVANQPISVAIDASGSDFQFY-----SSG  272

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TGECG+   H VT +GYG
Sbjct  273  VF-----TGECGTELDHGVTAVGYG  292



>ref|XP_009797968.1| PREDICTED: vignain-like [Nicotiana sylvestris]
Length=340

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIK G+LISLSEQ+LVDCD + N GC GG    AF+FI  + GL TES+YPYEG++ 
Sbjct  158  GINKIKKGKLISLSEQELVDCDTSWNMGCQGGLMDYAFKFIIKNHGLTTESNYPYEGIDG  217

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T    N AA IAGY++V   SESALL AVA+QPVS  I   G   ++       +G+
Sbjct  218  TCKTGKKSNHAAKIAGYEDVPVNSESALLKAVAHQPVSVAIDASGPDFQFYS-----SGV  272

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT IGYG
Sbjct  273  F-----TGECGTELDHGVTAIGYG  291



>ref|XP_008800073.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 94/144 (65%), Gaps = 13/144 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD    ++GCGGG   +AF+FI  +GGL TE++YPYE  +
Sbjct  159  GITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIKNGGLTTEANYPYEAAD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN     + AATI GY++V A SE+ALL AVANQPVS  I   G      Q Y   +G
Sbjct  219  GTCNAGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVAIDAGGSA---FQLYS--SG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGY  6
            +F     TG+CG+   H VT +GY
Sbjct  274  VF-----TGDCGTDLDHGVTAVGY  292



>ref|XP_006362426.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI +IKTG+LISLSEQ+LVDCD  ++ GC GG   +AF+FI  + GL TES+YPYEG + 
Sbjct  158  GINEIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDG  217

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T    N AA I GY++V A SESALL AVANQPVS  I   G   ++       +G+
Sbjct  218  TCKTGKESNDAAKITGYEDVPANSESALLNAVANQPVSVAIDASGSDFQFYS-----SGV  272

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT +GYG
Sbjct  273  F-----TGECGTELDHGVTAVGYG  291



>ref|XP_011086004.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 94/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI ++ TG+LISLSEQ+LVDCD + + GC GG    AF+FI  +GG+ TES+YPYEGV+ 
Sbjct  159  GINQLTTGKLISLSEQELVDCDTSEDEGCNGGLMDNAFEFIISNGGITTESNYPYEGVDG  218

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CNT+   + AA I GY++V A SE ALL AVANQPVS  I   G   ++       +G+
Sbjct  219  TCNTKKESSSAAKITGYEDVPANSEPALLKAVANQPVSVAIDASGSDFQFYS-----SGV  273

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   H VT +GYG
Sbjct  274  F-----TGDCGTELDHGVTAVGYG  292



>ref|XP_010481519.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Camelina 
sativa]
Length=342

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 95/146 (65%), Gaps = 17/146 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G  +IK G+LISLSEQQLVDCD NN GC GG    AF+ IK +GGL TES+YPY+G +  
Sbjct  161  GAAQIKKGKLISLSEQQLVDCDTNNFGCEGGLMDTAFEHIKATGGLTTESNYPYKGEDGS  220

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            CN++    +A +I GY++V A+ E+AL+ AVA+QPVS GI    FD       Q Y   +
Sbjct  221  CNSKKTNPKATSITGYEDVPANDENALMKAVAHQPVSVGIEGGGFD------FQFY--SS  272

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            G+F     TGEC +   HAVT IGYG
Sbjct  273  GVF-----TGECTTYLDHAVTAIGYG  293



>ref|XP_008800071.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 94/144 (65%), Gaps = 13/144 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD    ++GCGGG   +AF+FI  +GGL TE++YPYE  +
Sbjct  159  GITKLSTGKLISLSEQELVDCDTKGEDQGCGGGLMDDAFKFIIKNGGLTTEANYPYEAAD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN     + AATI GY++V A SE+ALL AVANQPVS  I   G      Q Y   +G
Sbjct  219  GTCNAGKSHSHAATIGGYEDVPANSEAALLKAVANQPVSVAIDAGGSA---FQLYS--SG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGY  6
            +F     TG+CG+   H VT +GY
Sbjct  274  VF-----TGDCGTELDHGVTAVGY  292



>ref|XP_002522559.1| cysteine protease, putative [Ricinus communis]
 gb|EEF39859.1| cysteine protease, putative [Ricinus communis]
Length=344

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG LISLSEQ+LVDCD +  ++GC GG   +AF+FI  + GL TE++YPYEGV+
Sbjct  161  GITKLSTGTLISLSEQELVDCDTSGMDQGCEGGLMDDAFEFIIENNGLTTEANYPYEGVD  220

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   N AA I GY+ V A  E AL  AVANQPVS  I   G  A   Q+Y   +G
Sbjct  221  GSCNTRKAANHAAKITGYENVPAYDEEALRKAVANQPVSVAID-AGESA--FQHY--SSG  275

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            IF     TG+CG+   H VT++GYG
Sbjct  276  IF-----TGDCGTELDHGVTVVGYG  295



>ref|XP_004303175.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD N  ++GC GG   +AFQFI  + GL TE++YPY GV+
Sbjct  157  GITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDDAFQFINQNHGLSTEANYPYTGVD  216

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN Q   + AA+I G+++V A SESALL AVANQP+S  I   G   ++       +G
Sbjct  217  GTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSDFQFY-----SSG  271

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  272  VF-----TGTCGTSLDHGVTAVGYG  291



>ref|XP_007025398.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOY28020.1| Senescence-associated gene 12 [Theobroma cacao]
Length=338

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI ++KTG+LISLSEQ+LVDCD N  ++GC GG    AF+FI  + GL TES+YPYEGV+
Sbjct  155  GINQLKTGKLISLSEQELVDCDINGEDQGCNGGFMDNAFEFIISNKGLTTESNYPYEGVD  214

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   N AA I  +++V + SE+ALL AVANQPVS  I   G      Q+Y   +G
Sbjct  215  GSCNKKKAANHAAQITSFEDVPSNSEAALLKAVANQPVSVAIDAGGSD---FQHYK--SG  269

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            IF     TGEC +   H VT +GYG
Sbjct  270  IF-----TGECSTFLDHGVTAVGYG  289



>ref|XP_004252607.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Solanum 
lycopersicum]
Length=340

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKTG+LISLSEQ+LVDCD  ++ GC GG   +AF+FI  + GL TES+YPYEG ++
Sbjct  158  GINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDS  217

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T    N AA I  Y++V A SES LL AVANQPVS  I      A   Q Y   +G+
Sbjct  218  TCKTGKESNHAAKITSYEDVPANSESDLLKAVANQPVSVAI---DASASDFQFY--SSGV  272

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT +GYG
Sbjct  273  F-----TGECGTELDHGVTAVGYG  291



>ref|XP_008780365.1| PREDICTED: vignain-like [Phoenix dactylifera]
Length=186

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+KTG+LISLSEQ+LVDCD   +++GC GG    AF+FI  + GL TE++YPY+G++
Sbjct  3    GITKLKTGKLISLSEQELVDCDVASDDQGCDGGLMDNAFKFIINNHGLTTETNYPYKGID  62

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN++   + AA+I GY++V A SE+ALL AVANQPVS  I   G   ++       +G
Sbjct  63   GTCNSKKSASHAASIKGYEDVPANSEAALLKAVANQPVSVAIEASGYDFQFYS-----SG  117

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F      G C +   H VT +GYG
Sbjct  118  VF-----NGSCKTYLDHGVTAVGYG  137



>dbj|BAM66994.1| germination-specific cysteine protease 1, partial [Raphanus sativus]
Length=235

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+LISLSEQ+LVDCD + N+GC GG    AFQFI  +GGL TE DYPY G + 
Sbjct  39   GINKIVTGELISLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEQDYPYRGSDG  98

Query  251  RCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    ++  TI GY++V  + E+AL  AV+ QPVS  I   GR+ ++ Q     +GI
Sbjct  99   KCNSLLKNSKVVTIDGYEDVPTNDETALKRAVSYQPVSVAIDAGGRVFQHYQ-----SGI  153

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   HAV  +GYG
Sbjct  154  F-----TGECGTKMDHAVVAVGYG  172



>ref|XP_006360707.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=340

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKTG+LISLSEQ+LVDCD  ++ GC GG   +AF+FI  + GL TES+YPYEG + 
Sbjct  158  GINKIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDG  217

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T    + AA I  Y++V A SESALL AVANQPVS  I   G   ++       +G+
Sbjct  218  TCKTGKESSHAAKITSYEDVPANSESALLKAVANQPVSVAIDASGSDFQFY-----SSGV  272

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT +GYG
Sbjct  273  F-----TGECGTELDHGVTAVGYG  291



>ref|XP_008779806.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=326

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 96/144 (67%), Gaps = 13/144 (9%)
 Frame = -2

Query  425  ITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            IT+IKTG L+SLSEQQLVDCD N  N+GC GG    AFQ++  +GG+ TE +YPY+  + 
Sbjct  144  ITEIKTGNLVSLSEQQLVDCDTNDGNKGCDGGLMTRAFQYVIDNGGITTEDNYPYKAADG  203

Query  251  RCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C+T    + AATI+GY+ V A+ ES+LL AVANQPVS GI  DG    + Q+Y   +GI
Sbjct  204  TCDTNRASSSAATISGYETVPANDESSLLQAVANQPVSVGI--DGSGPDF-QHY--SSGI  258

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG C +   HAVT +GYG
Sbjct  259  F-----TGPCETEMTHAVTAVGYG  277



>ref|XP_009609383.1| PREDICTED: ervatamin-B [Nicotiana tomentosiformis]
Length=309

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG+L+SLSEQQLVDCD   +N+GC GG   +AF FIK +GG+ TE +YPY G +
Sbjct  124  GINKIKTGKLVSLSEQQLVDCDVYSDNQGCNGGFMEKAFAFIKKNGGITTEKNYPYVGKD  183

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             RCNT   +  A TI+GY+ V  +E +L  AV  QP+S  I   G      Q Y    G+
Sbjct  184  QRCNTTKAKQHAVTISGYEMVPKNEESLQAAVTKQPISVAIDASGYD---FQLY--AGGV  238

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            ++G+     CG+   H VT+IGYG
Sbjct  239  YSGF-----CGNSLNHGVTLIGYG  257



>ref|XP_011086005.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 94/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI ++ TG+LISLSEQ+LVDCD + + GC GG    AF+FI  +GG+ TES+YPYE V+ 
Sbjct  159  GINQLTTGKLISLSEQELVDCDTSEDEGCNGGLMDNAFEFIISNGGITTESNYPYEAVDG  218

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN++   + AA I GY++V A SESALL AVANQPVS  I   G   ++       +G+
Sbjct  219  TCNSKKESSHAAKITGYEDVPANSESALLKAVANQPVSVAIDASGSDFQFYT-----SGV  273

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   H VT +GYG
Sbjct  274  F-----TGQCGTELDHGVTAVGYG  292



>ref|XP_006306197.1| hypothetical protein CARUB_v10011832mg [Capsella rubella]
 gb|EOA39095.1| hypothetical protein CARUB_v10011832mg [Capsella rubella]
Length=344

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG L+SLSEQQL+DCD    N+GC GG    AF++IK +GGL+T++DYPY G+E
Sbjct  162  GINKIKTGNLVSLSEQQLIDCDVGTYNKGCSGGLMETAFEYIKTNGGLVTQTDYPYTGIE  221

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
              C+ +  +N+  TI G+ +V  +E +L  A A QPVS GI   G +    Q Y   +G+
Sbjct  222  GTCDQEKTKNKVVTIQGFNKVAQNEGSLQSAAAKQPVSVGIDAGGFI---FQLY--SSGV  276

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FT Y     CG+   H VT++GYG
Sbjct  277  FTSY-----CGTNLNHGVTVVGYG  295



>ref|XP_009390411.1| PREDICTED: vignain-like, partial [Musa acuminata subsp. malaccensis]
Length=197

 Score =   124 bits (310),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 90/143 (63%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GITKIKT +LISLSEQ LVDCD +N  C GG + +AF F+  +GG+ TE++YPY G +  
Sbjct  17   GITKIKTDKLISLSEQALVDCDFSNGACDGGWQDKAFAFVTSTGGITTEANYPYLGYQGI  76

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            CN   L + AA+IAG++ V  + E AL+ AVANQPVS  I   G   +          ++
Sbjct  77   CNITMLSDHAASIAGFEYVPVNDEKALMAAVANQPVSVSIEAKGTDFQ----------LY  126

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
            TG   +G CG+   HAVT +GYG
Sbjct  127  TGGIFSGPCGTDLDHAVTAVGYG  149



>ref|XP_010441658.1| PREDICTED: senescence-specific cysteine protease SAG12 [Camelina 
sativa]
Length=346

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 95/146 (65%), Gaps = 17/146 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G  +IK G+LISLSEQQLVDCD N+ GC GG    AF+ IK +GGL TES+YPY+G +  
Sbjct  165  GAAQIKKGKLISLSEQQLVDCDTNDFGCDGGLMDTAFEHIKATGGLTTESNYPYKGEDGT  224

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            CN++    +A +I GY++V A+ E+AL+ AVA+QPVS GI    FD       Q Y   +
Sbjct  225  CNSKKTNPKATSITGYEDVPANDENALMKAVAHQPVSVGIEGGGFD------FQFY--SS  276

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            G+F     TGEC +   HAVT IGYG
Sbjct  277  GVF-----TGECTTYLDHAVTAIGYG  297



>ref|XP_009798361.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=339

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 94/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKTG+LISLSEQ+LVDCD  +N+GC GG   +AF++I  + GL +ES+YPY+G++ 
Sbjct  157  GINKIKTGKLISLSEQELVDCDTSSNQGCEGGLMDDAFKYIIKNHGLTSESNYPYKGIDG  216

Query  251  RCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T+   N  A I GY++V E SE ALL AVANQPVS  I   G   ++       +GI
Sbjct  217  TCKTEKESNHVAKIRGYKDVPENSELALLKAVANQPVSVAIDASGSDFQFY-----SSGI  271

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   H VT +GYG
Sbjct  272  F-----TGKCGTELDHGVTTVGYG  290



>ref|XP_011078542.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 94/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI ++ T +LISLSEQ+LVDCD + + GC GG   +AF+FI  +GG+ TES+YPYEGV+ 
Sbjct  159  GINQLTTRKLISLSEQELVDCDTSEDEGCNGGLMDDAFEFIISNGGITTESNYPYEGVDG  218

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN++   + AA I GY++V A SE ALL AVANQPVS  I   G   ++       +G+
Sbjct  219  TCNSKKESSHAAKITGYEDVPANSEPALLKAVANQPVSVAIDASGSDFQFY-----SSGV  273

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT +GYG
Sbjct  274  F-----TGECGTELDHGVTAVGYG  292



>ref|XP_006398274.1| hypothetical protein EUTSA_v10000948mg [Eutrema salsugineum]
 dbj|BAJ33714.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ39727.1| hypothetical protein EUTSA_v10000948mg [Eutrema salsugineum]
Length=347

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 93/146 (64%), Gaps = 17/146 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G TKIK G+LISLSEQQLVDCD N+ GC GG    AF+ I  +GGL TES+YPY+G +A 
Sbjct  166  GATKIKKGKLISLSEQQLVDCDTNDFGCSGGLMDTAFEHIMATGGLTTESNYPYKGKDAT  225

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            C  +  +  A +I GY++V  + E AL+ AVA+QPVS GI    FD       Q Y  G+
Sbjct  226  CKIKNTKPTATSITGYEDVPVNDEKALMKAVAHQPVSIGIEGGGFD------FQFY--GS  277

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            G+F     TGEC +   HAVT +GYG
Sbjct  278  GVF-----TGECTTYLDHAVTAVGYG  298



>ref|XP_010052197.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76117.1| hypothetical protein EUGRSUZ_D00494 [Eucalyptus grandis]
Length=369

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 90/145 (62%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT +K G+L+SLSEQ+LVDCD N  N GC GG    AFQFIK  GGL +E++YPY+G +
Sbjct  186  GITMLKKGKLVSLSEQELVDCDVNGVNEGCEGGLMDSAFQFIKSKGGLTSEANYPYQGND  245

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              C T    N  A+I GYQ+V A +E ALL AVANQPVS  I   G   ++        G
Sbjct  246  GTCRTAKAANIVASITGYQDVPANNEKALLQAVANQPVSVAIEGSGFSFQFY-----SGG  300

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   HAVT +GYG
Sbjct  301  VF-----TGSCGTSLDHAVTAVGYG  320



>gb|KDP38777.1| hypothetical protein JCGZ_05113 [Jatropha curcas]
Length=222

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD +  ++GC GG   +AF FIK +GGL TE++YPY+G +
Sbjct  39   GITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFGFIKKNGGLTTEANYPYQGTD  98

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   ++AA I GY++V A SE ALL AVANQPVS  I   G   ++        G
Sbjct  99   DTCNTKKAADKAAKINGYEDVPANSEQALLKAVANQPVSVAIDASGSAFQFYS-----GG  153

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG+CG+   H VT +GYG
Sbjct  154  VF-----TGDCGTELDHGVTAVGYG  173



>ref|XP_002865220.1| senescence-associated gene 12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41479.1| senescence-associated gene 12 [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 94/146 (64%), Gaps = 17/146 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G T+IK G+LISLSEQQLVDCD N+ GC GG    AF+ I  +GGL TES+YPY+G +A 
Sbjct  165  GATQIKKGKLISLSEQQLVDCDTNDFGCEGGLMDTAFEHIMATGGLTTESNYPYKGEDAT  224

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            CN++    +A +I GY++V  + E AL+ AVA+QPVS GI    FD       Q Y   +
Sbjct  225  CNSKKTNPKATSITGYEDVPVNDEQALMKAVAHQPVSVGIEGGGFD------FQFY--SS  276

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            G+F     TGEC +   HAVT IGYG
Sbjct  277  GVF-----TGECTTYLDHAVTAIGYG  297



>gb|KDP38773.1| hypothetical protein JCGZ_05109 [Jatropha curcas]
Length=215

 Score =   124 bits (311),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD +  ++GC GG   +AF FIK +GGL TE++YPY+G +
Sbjct  32   GITKLSTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFGFIKKNGGLTTEANYPYQGTD  91

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   ++AA I GY++V A SE ALL AVANQPVS  I   G   ++        G
Sbjct  92   DTCNTKKAADKAAKITGYEDVAANSEQALLKAVANQPVSVTIDASGSAFQFYS-----GG  146

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG+CG+   H VT +GYG
Sbjct  147  VF-----TGDCGTELDHGVTAVGYG  166



>ref|XP_009361500.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD +  ++GC GG   +AFQFI  + GL TE++YPY GV+
Sbjct  159  GITKLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFINQNHGLSTETNYPYTGVD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   N AA I G+++V A SE ALL AVANQP+S  I   G   ++       +G
Sbjct  219  GTCNTKKEANHAAKITGHEDVPANSEEALLKAVANQPISVAIDAGGSDFQFY-----SSG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  274  VF-----TGTCGTSLDHGVTAVGYG  293



>ref|XP_011086001.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Sesamum 
indicum]
Length=341

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI ++ TG LISLSEQ+LVDCD + + GC GG    AF+FI  +GG+ TES+YPYEGV+ 
Sbjct  159  GINQLTTGNLISLSEQELVDCDTSEDEGCNGGLMDNAFEFIISNGGITTESNYPYEGVDG  218

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN++   +  A I GY++V A SESALL AVANQPVS  I   G   ++       +G+
Sbjct  219  TCNSKKESSHVAKITGYEDVPANSESALLKAVANQPVSVAIDASGSDFQFYT-----SGV  273

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   H VT +GYG
Sbjct  274  F-----TGQCGTELDHGVTAVGYG  292



>ref|XP_008810168.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
 ref|XP_008810169.1| PREDICTED: ervatamin-B-like isoform X2 [Phoenix dactylifera]
Length=336

 Score =   126 bits (317),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
             IT+IKTG L+SLSEQQLVDCD N  N+GC GG    AFQ++  +GG+ TE +YPY    
Sbjct  153  AITQIKTGNLVSLSEQQLVDCDVNDGNQGCDGGLMTRAFQYVIDNGGITTEDNYPYMAAN  212

Query  254  ARCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              C+T    + AATI+GY+ V A+ ES+LL AVANQPVS GI   G+  R+       +G
Sbjct  213  GTCDTNKTSSSAATISGYESVPANDESSLLQAVANQPVSVGIDGSGQDFRHYS-----SG  267

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            IF     TG C +   HAVT +GYG
Sbjct  268  IF-----TGPCETQMTHAVTAVGYG  287



>gb|KCW76128.1| hypothetical protein EUGRSUZ_D00504 [Eucalyptus grandis]
Length=318

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 90/143 (63%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GIT IK G+L+ LS Q+LVDCD ++ GC GG    AF+FIK  GGL TE++YPY+     
Sbjct  137  GITMIKKGKLMPLSVQELVDCDVDDNGCHGGLMDRAFKFIKSKGGLSTEANYPYQANNGT  196

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            CNT  + N AA+I GYQ+V A +E ALL AVANQPVS  I   G   ++       +G+F
Sbjct  197  CNTAKMANPAASITGYQDVPANNEKALLQAVANQPVSVAIEGSGFNFQFYS-----SGVF  251

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 +G CG+   HAVT +GYG
Sbjct  252  -----SGSCGTSIDHAVTAVGYG  269



>ref|XP_009359967.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=342

 Score =   126 bits (317),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD +  ++GC GG   +AFQFI  + GL TE++YPY GV+
Sbjct  159  GITKLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFINQNHGLSTETNYPYTGVD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   N AA I G+++V A SE ALL AVANQP+S  I   G   ++       +G
Sbjct  219  GTCNTKKEANHAAKITGHEDVPANSEEALLKAVANQPISVAIDAGGSDFQFY-----SSG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  274  VF-----TGTCGTSLDHGVTAVGYG  293



>ref|XP_008810167.1| PREDICTED: ervatamin-B-like isoform X1 [Phoenix dactylifera]
Length=362

 Score =   126 bits (317),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
             IT+IKTG L+SLSEQQLVDCD N  N+GC GG    AFQ++  +GG+ TE +YPY    
Sbjct  179  AITQIKTGNLVSLSEQQLVDCDVNDGNQGCDGGLMTRAFQYVIDNGGITTEDNYPYMAAN  238

Query  254  ARCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              C+T    + AATI+GY+ V A+ ES+LL AVANQPVS GI   G+  R+       +G
Sbjct  239  GTCDTNKTSSSAATISGYESVPANDESSLLQAVANQPVSVGIDGSGQDFRHY-----SSG  293

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            IF     TG C +   HAVT +GYG
Sbjct  294  IF-----TGPCETQMTHAVTAVGYG  313



>ref|XP_008228868.1| PREDICTED: LOW QUALITY PROTEIN: zingipain-2-like [Prunus mume]
Length=345

 Score =   126 bits (317),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD N  ++GC GG   +AFQFI+ + GL TE++YPY GV+
Sbjct  162  GITQLTTGKLISLSEQELVDCDTNGEDQGCEGGLMDDAFQFIQQNHGLSTEANYPYSGVD  221

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I GY++V   SE ALL AVANQPVS  I   G   ++       +G
Sbjct  222  GTCNTKKEASIAAKITGYEDVPTNSEQALLKAVANQPVSVAIDASGSDFQFY-----SSG  276

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  277  VF-----TGTCGTSLDHGVTAVGYG  296



>gb|EYU19040.1| hypothetical protein MIMGU_mgv1a026538mg [Erythranthe guttata]
Length=325

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 94/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            G+ ++KTG+LISLSEQ+LVDCD + ++GC GG    AF+FI  + GL TES+YPYEGV+ 
Sbjct  143  GLNQLKTGKLISLSEQELVDCDTSEDQGCNGGLMDNAFEFIISNNGLTTESNYPYEGVDG  202

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN++   +  A I GY++V A SESALL AVANQP+S  I   G   ++        G+
Sbjct  203  TCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQFY-----SGGV  257

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     +G+CG+   H VT +GYG
Sbjct  258  F-----SGQCGTELDHGVTAVGYG  276



>ref|XP_008340724.1| PREDICTED: vignain-like [Malus domestica]
Length=338

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD +  ++GC GG   +AFQFI  + GL TE++YPY GV+
Sbjct  155  GITKLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFITQNHGLSTETNYPYTGVD  214

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AATI G+++V A SE+ALL AVANQP+S  I   G   ++       +G
Sbjct  215  GTCNTKKEASHAATITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQFY-----SSG  269

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +G+G
Sbjct  270  VF-----TGTCGTSLDHGVTAVGFG  289



>ref|XP_004290089.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD N  ++GC GG   +AF+FI  + GL TE++YPY GV+
Sbjct  157  GITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDDAFEFINQNHGLSTEANYPYTGVD  216

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN Q   + AA+I G+++V A SESALL AVANQP+S  I   G   ++       +G
Sbjct  217  GTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSDFQFY-----SSG  271

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  272  VF-----TGACGTSLDHGVTAVGYG  291



>ref|XP_008246197.1| PREDICTED: vignain-like, partial [Prunus mume]
Length=286

 Score =   125 bits (314),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD +  ++GC GG   +AFQFI+ + GL TE++YPY GV+
Sbjct  143  GITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVD  202

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I GY++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  203  GSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQFYS-----SG  257

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  258  VF-----TGSCGTSLDHGVTAVGYG  277



>ref|XP_010052200.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=342

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 90/143 (63%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GIT IK G+L+ LS Q+LVDCD ++ GC GG    AF+FIK  GGL TE++YPY+     
Sbjct  161  GITMIKKGKLMPLSVQELVDCDVDDNGCHGGLMDRAFKFIKSKGGLSTEANYPYQANNGT  220

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            CNT  + N AA+I GYQ+V A +E ALL AVANQPVS  I   G   ++       +G+F
Sbjct  221  CNTAKMANPAASITGYQDVPANNEKALLQAVANQPVSVAIEGSGFNFQFY-----SSGVF  275

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 +G CG+   HAVT +GYG
Sbjct  276  -----SGSCGTSIDHAVTAVGYG  293



>ref|XP_009761201.1| PREDICTED: ervatamin-B-like [Nicotiana sylvestris]
Length=344

 Score =   126 bits (316),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG+L+SLSEQ+LVDCD N  N+GC GG   +AF FIK +GG+ TE +YPY G +
Sbjct  158  GINKIKTGKLVSLSEQELVDCDVNSDNQGCNGGFMEKAFSFIKKNGGITTEKNYPYVGKD  217

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             +CNT   +  A TI+GY+ V  +E +L  AV  QP+S  I   G      Q Y    G+
Sbjct  218  QKCNTTKAKQHAVTISGYEMVAKNEESLQAAVTKQPISVAIDASGYD---FQLY--AGGV  272

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            ++G+     CG+   H VT+IGYG
Sbjct  273  YSGF-----CGNSLNHGVTLIGYG  291



>ref|XP_008371737.1| PREDICTED: vignain-like [Malus domestica]
Length=222

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 89/143 (62%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GITKIKTGQLISLSEQQLVDCD +N GC GG+  +AF +I+ +GG+ +E +YPY+G +  
Sbjct  41   GITKIKTGQLISLSEQQLVDCDTSNSGCQGGDMAKAFAYIQQNGGIASEENYPYQGSDGT  100

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            C+T      AA I  Y  V   SE+ LL AV+ QPVS  I        Y        G+F
Sbjct  101  CDTNLANEAAAKITNYARVTPNSETDLLKAVSVQPVSVAIAASQAFQLY------SGGLF  154

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
            T  D++  CG+   HAVTIIGYG
Sbjct  155  T--DDS--CGTELNHAVTIIGYG  173



>gb|KHN38752.1| Vignain [Glycine soja]
Length=308

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD    ++GC GG   +AF+FI  + GL  E+ YPYEGV+
Sbjct  125  GITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKGLAAEAIYPYEGVD  184

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   N AA+I GY++V A SESALL AVANQPVS  I   G   ++        G
Sbjct  185  GTCNAKAEGNHAASIKGYEDVPANSESALLKAVANQPVSVAIEASGFEFQFYS-----GG  239

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  240  VF-----TGSCGTNLDHGVTAVGYG  259



>dbj|BAF56430.1| cysteine proteinase [Lotus japonicus]
Length=341

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD    ++GC GG   +AF+FI  + GL TE+ YPY+GV+
Sbjct  159  GITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIMQNKGLNTEAKYPYQGVD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
            A CN       AA+I G+++V A SESALL AVANQP+S  I   G   ++       +G
Sbjct  219  ATCNANAEAKDAASIKGFEDVPANSESALLKAVANQPISVAIDASGSEFQFY-----SSG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  274  VF-----TGSCGTELDHGVTAVGYG  293



>ref|XP_006663343.1| PREDICTED: vignain-like [Oryza brachyantha]
Length=325

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP-NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            G+ KI TG+L+SLSEQ+LVDCD  +N+GC GG    AFQFIK +GG+ TES+YPY  V+ 
Sbjct  118  GVNKISTGKLVSLSEQELVDCDAGDNQGCNGGLMDYAFQFIKKNGGITTESNYPYRAVQG  177

Query  251  RCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            RCN     +   TI GY++V A+ ESAL  AVANQPV+  I   G+  ++        G+
Sbjct  178  RCNRAKASSHDVTIDGYEDVPANDESALQKAVANQPVAVAIEASGQDFQFY-----SEGV  232

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H V  +GYG
Sbjct  233  F-----TGECGTDLDHGVAAVGYG  251



>gb|EYU25680.1| hypothetical protein MIMGU_mgv1a019612mg [Erythranthe guttata]
Length=328

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI ++ TG L+SLSEQ+LVDCD + ++GC GG    AF+FI  + GL TES+YPYEGV+ 
Sbjct  146  GINQLTTGNLVSLSEQELVDCDTSEDQGCNGGLMDNAFEFIISNNGLTTESNYPYEGVDG  205

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN++   + AA I GY++V + SESALL AVANQP+S  I   G   ++        G+
Sbjct  206  TCNSKKESSHAARITGYEDVPSNSESALLKAVANQPISVAIDASGPDIQFY-----STGV  260

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   H VT +GYG
Sbjct  261  F-----TGQCGTELDHGVTAVGYG  279



>gb|AAB23155.1| COT44=cysteine proteinase homolog [Brassica napus, seedling, 
rapid cycling base population CrGC5, Peptide, 328 aa]
Length=328

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+L+SLSEQ+LVDCD + N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  135  GINKIVTGELVSLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPYHGTNG  194

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    +R  TI GY++V +  E+AL  AV+ QPVS  I   GR  ++ Q     +GI
Sbjct  195  KCNSLLKNSRVVTIDGYEDVPSKDETALKRAVSYQPVSVAIDAGGRAFQHYQ-----SGI  249

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   HAV  +GYG
Sbjct  250  F-----TGKCGTNMDHAVVAVGYG  268



>sp|P25251.1|CYSP4_BRANA RecName: Full=Cysteine proteinase COT44; Flags: Precursor, partial 
[Brassica napus]
Length=328

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+L+SLSEQ+LVDCD + N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  135  GINKIVTGELVSLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPYHGTNG  194

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    +R  TI GY++V +  E+AL  AV+ QPVS  I   GR  ++ Q     +GI
Sbjct  195  KCNSLLKNSRVVTIDGYEDVPSKDETALKRAVSYQPVSVAIDAGGRAFQHYQ-----SGI  249

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   HAV  +GYG
Sbjct  250  F-----TGKCGTNMDHAVVAVGYG  268



>ref|XP_008228922.1| PREDICTED: vignain-like [Prunus mume]
Length=326

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD +  ++GC GG   +AFQFI+ + GL TE++YPY GV+
Sbjct  143  GITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVD  202

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I GY++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  203  GSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQFYS-----SG  257

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  258  VF-----TGSCGTSLDHGVTAVGYG  277



>ref|XP_010494742.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Camelina 
sativa]
Length=346

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 95/146 (65%), Gaps = 17/146 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G  +IK G+LISLSEQQLVDCD N+ GC GG    AF+ IK +GGL TES+YPY+G +  
Sbjct  165  GAAQIKKGKLISLSEQQLVDCDTNDFGCEGGLMDTAFEHIKVTGGLTTESNYPYKGEDGT  224

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            CN++    +A +I GY++V A+ E+AL+ AVA+QPVS GI    FD       Q Y   +
Sbjct  225  CNSKKTNPKATSITGYEDVPANDENALMKAVAHQPVSVGIEGGGFD------FQFY--SS  276

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            G+F     TGEC +   HAVT IGYG
Sbjct  277  GVF-----TGECTTYLDHAVTAIGYG  297



>ref|XP_009344439.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
 ref|XP_009344444.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+L+SLSEQ+LVDCD    ++GC GG   +AFQFI+ + G+ TE++YPYEGV+
Sbjct  150  GITQLTTGKLMSLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTEANYPYEGVD  209

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I G+++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  210  GTCNTKKETSHAAKITGFEDVPANSEKALLAAVAHQPVSVAIDASGSDFQFY-----SSG  264

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  265  VF-----TGTCGTSLDHGVTAVGYG  284



>ref|XP_004967598.1| PREDICTED: xylem cysteine proteinase 2-like [Setaria italica]
Length=371

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 91/143 (64%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI KI+TG+L+SLSEQ+LVDCD  ++GC GG    A Q+I  +GG+ TE DYPY+  + +
Sbjct  188  GINKIRTGKLLSLSEQELVDCDTLDKGCKGGMHYRALQWITKNGGITTEKDYPYKARQGK  247

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            C+   L+NRAATI+G++ V   SE++L  AVA QPV  GI   G   R+ +      GI+
Sbjct  248  CDRSKLKNRAATISGFRRVATRSEASLQNAVAMQPVCVGIDAGGSNFRHYK-----KGIY  302

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                  G CG+   HAVT +GYG
Sbjct  303  -----NGPCGTKLNHAVTAVGYG  320



>dbj|BAF56428.1| cysteine proteinase [Lotus japonicus]
Length=342

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD    ++GC GG   +AF+FI  + GL TE+ YPY+GV+
Sbjct  159  GITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIMQNKGLNTEAKYPYQGVD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
            A CN       AA+I G+++V A SESALL AVANQP+S  I   G   ++       +G
Sbjct  219  ATCNANAEAKDAASIKGFEDVPANSESALLKAVANQPISVAIDASGSEFQFY-----SSG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  274  LF-----TGSCGTELDHGVTAVGYG  293



>ref|XP_009359957.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=342

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD +  ++GC GG   +AFQFI  + GL TE++YPY GV+
Sbjct  159  GITKLTTGKLISLSEQELVDCDTSGVDQGCQGGLMDDAFQFINQNHGLSTEANYPYTGVD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   N AA I G+++V A+ E AL+ AVANQP+S  I   G   ++       +G
Sbjct  219  GTCNTKKEANHAAKITGHEDVPANREDALMKAVANQPISVAIDASGSDFQFY-----SSG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  274  VF-----TGTCGTSLDHGVTAVGYG  293



>ref|XP_010518799.1| PREDICTED: senescence-specific cysteine protease SAG12 [Tarenaya 
hassleriana]
Length=348

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 91/143 (64%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G TKIK G+LISLSEQQLVDCD  + GC GG    AF+ IK S GL TE++YPY G +  
Sbjct  167  GATKIKKGKLISLSEQQLVDCDKYDYGCEGGLLDTAFEHIKESHGLTTEANYPYNGEDGT  226

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            CN++    +AATI GY++V A+ E AL+ AV NQPVS  I   G   ++       +G+F
Sbjct  227  CNSKKASAKAATITGYEDVPANDEKALMKAVTNQPVSVAIEGGGFEFQFY-----SSGVF  281

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 TG+CG+   HAV ++GYG
Sbjct  282  -----TGQCGTDLDHAVAVVGYG  299



>ref|XP_008244476.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=339

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD +  ++GC GG   +AFQFI+ + GL TE++YPY GV+
Sbjct  156  GITQLTTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVD  215

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I GY++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  216  GSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQFYS-----SG  270

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  271  VF-----TGSCGTSLDHGVTAVGYG  290



>ref|XP_008350674.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=313

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 89/143 (62%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GITKIKTGQLISLSEQQLVDCD +N GC GG+  +AF +I+ +GG+ +E +YPY+G +  
Sbjct  132  GITKIKTGQLISLSEQQLVDCDTSNXGCQGGDMAKAFAYIQQNGGIASEENYPYQGSDGT  191

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            C+T      AA I  Y  V   SE+ LL AV+ QPVS  I        Y        G+F
Sbjct  192  CDTXLXNEAAAKITNYARVTPNSETDLLKAVSXQPVSVAIAASQAFXLY------SGGLF  245

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
            T  D++  CG+   HAVTIIGYG
Sbjct  246  T--DDS--CGTELNHAVTIIGYG  264



>gb|KFK42951.1| hypothetical protein AALP_AA1G060200 [Arabis alpina]
Length=343

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG L++LSEQQL+DCD    N+GC GG    A+++IK +GGL T +DYPY   +
Sbjct  162  GINKIKTGNLVTLSEQQLIDCDTGTYNKGCSGGLMETAYEWIKTNGGLTTGTDYPYTATD  221

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
              C+ +  +N+  TI G+Q+V   E++L +A A QPVS GI   G +    Q Y   +G+
Sbjct  222  GTCDQEKAKNKVVTITGHQKVAQDETSLQIATAQQPVSVGIDAGGFI---FQLYS--SGV  276

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FTGY     CG+   H VT++GYG
Sbjct  277  FTGY-----CGANLNHGVTVVGYG  295



>ref|XP_009137836.1| PREDICTED: cysteine proteinase COT44 [Brassica rapa]
Length=374

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+LISLSEQ+LVDCD + N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  181  GINKIVTGELISLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEQDYPYHGTNG  240

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    +R  TI GY++V +  E+AL  AV+ QPVS  I   GR  ++ Q     +GI
Sbjct  241  KCNSLLKNSRVVTIDGYEDVPSKDETALKRAVSYQPVSVAIDAGGRAFQHYQ-----SGI  295

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   HAV  +GYG
Sbjct  296  F-----TGKCGTTMDHAVVAVGYG  314



>emb|CDX69285.1| BnaC01g01680D [Brassica napus]
Length=374

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+L+SLSEQ+LVDCD + N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  181  GINKIVTGELVSLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPYHGTNG  240

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    +R  TI GY++V +  E+AL  AV+ QPVS  I   GR  ++ Q     +GI
Sbjct  241  KCNSLLKNSRVVTIDGYEDVPSKDETALKRAVSYQPVSVAIDAGGRAFQHYQ-----SGI  295

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   HAV  +GYG
Sbjct  296  F-----TGKCGTNMDHAVVAVGYG  314



>ref|XP_011100224.1| PREDICTED: zingipain-2 [Sesamum indicum]
Length=348

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 90/145 (62%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITKIKTG+L+SLSEQ+LVDCD  P+N+GC GG   +AFQFI  + G+ TE  YPY+G E
Sbjct  162  GITKIKTGKLVSLSEQELVDCDSTPDNQGCRGGYMEKAFQFIIKNHGITTEKRYPYQGKE  221

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT   + +AA I GY  + A  E  +  AVA QPVS GI   G   ++       +G
Sbjct  222  GMCNTTKEKMKAAKITGYVAIPARDEKRIQAAVAKQPVSVGIDAGGYDFQFY-----SSG  276

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F GY     CG+   H VTI+GYG
Sbjct  277  VFAGY-----CGNNLNHGVTIVGYG  296



>ref|XP_010054318.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=343

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 88/146 (60%), Gaps = 17/146 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G+T IK  +L+ LS Q+LVDCD N  GC GG+   AF+FI G GGL TE DYPY+ ++  
Sbjct  162  GLTMIKKEKLVPLSVQELVDCDDNEDGCWGGHVDSAFEFIIGKGGLTTEEDYPYQAIDGT  221

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            CNT    N  A+I GYQ+V A +E ALL AVANQPVS  I    FD       Q Y   N
Sbjct  222  CNTAKTVNPVASITGYQDVPADNERALLQAVANQPVSVAIEGGGFD------FQFY--SN  273

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            G+F     +G CG+     VT+IGYG
Sbjct  274  GVF-----SGSCGTDIDQEVTVIGYG  294



>ref|XP_008223852.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG LISLSEQ+LVDCD    ++GC GG   +AFQFI  + GL TE++YPY GV+
Sbjct  159  GITKLSTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLSTETNYPYTGVD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I G+++V A SE+ALL AVANQPVS  I   G   ++       +G
Sbjct  219  GTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPVSVAIDAGGSDFQFYS-----SG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  274  VF-----TGACGTSLDHGVTAVGYG  293



>ref|XP_010317330.1| PREDICTED: uncharacterized protein LOC101251741 [Solanum lycopersicum]
Length=802

 Score =   128 bits (322),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 74/144 (51%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI +IKTG+LISLSEQ+LVDCD  ++ GC GG   +AF+FI  + GL TES+YPYEG + 
Sbjct  620  GINEIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDG  679

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T    N AA I GY++V A SES+LL AVANQPVS  I   G   ++       +G+
Sbjct  680  TCKTGKKSNGAAKITGYEDVPANSESSLLSAVANQPVSVAIDASGSDFQFYS-----SGV  734

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT +GYG
Sbjct  735  F-----TGECGTELDHGVTAVGYG  753



>emb|CDX75633.1| BnaA01g00690D [Brassica napus]
Length=374

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+LISLSEQ+LVDCD + N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  181  GINKIVTGELISLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEQDYPYHGTNG  240

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    +R  TI GY++V +  E+AL  AV+ QPVS  I   GR  ++ Q     +GI
Sbjct  241  KCNSLLKNSRVVTIDGYEDVPSKDETALKRAVSYQPVSVAIDAGGRAFQHYQ-----SGI  295

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   HAV  +GYG
Sbjct  296  F-----TGKCGTTMDHAVVAVGYG  314



>ref|XP_010906195.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X2 [Elaeis guineensis]
Length=246

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 95/145 (66%), Gaps = 12/145 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+KT +LISLSEQ+LV+CD    + GC GG    A +FI  +GGL TE++YPY+G++
Sbjct  62   GITKLKTHKLISLSEQELVECDVGGEDEGCNGGLPDAALEFIIKNGGLATETNYPYKGMD  121

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA+I GY++V A SE+ALL AVANQPVS  I   G   ++       +G
Sbjct  122  GTCNTKKSASHAASIKGYEQVPANSEAALLKAVANQPVSVNIDSGGSSFQFY-----ASG  176

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +FTG    G C +   H+VT +GYG
Sbjct  177  VFTG----GSCETDLDHSVTAVGYG  197



>ref|XP_008805390.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Phoenix dactylifera]
Length=342

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+KTG+L+SLSEQ+LVDCD   +++GC GG    AF+FI  + GL TE++YPY+G++
Sbjct  159  GITKLKTGKLMSLSEQELVDCDVASDDQGCDGGLMDNAFKFIINNRGLTTETNYPYKGID  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN++   +  A+I GY++V A SE+ALL AVANQPVS  I       ++       +G
Sbjct  219  GTCNSKKSASHVASIKGYEDVPANSEAALLKAVANQPVSVAIEASSGSFQFY-----SSG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            IF     TG CG+   H VT +GYG
Sbjct  274  IF-----TGSCGTDLDHGVTTVGYG  293



>ref|XP_007227669.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
 gb|EMJ28868.1| hypothetical protein PRUPE_ppa025602mg [Prunus persica]
Length=342

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG LISLSEQ+LVDCD    ++GC GG   +AFQFI  + GL TE++YPY GV+
Sbjct  159  GITKLTTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLSTETNYPYTGVD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I G+++V A SE+ALL AVANQP+S  I   G   ++       +G
Sbjct  219  GTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQFY-----SSG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  274  VF-----TGSCGTSLDHGVTAVGYG  293



>ref|XP_007226492.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
 gb|EMJ27691.1| hypothetical protein PRUPE_ppa026538mg [Prunus persica]
Length=342

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG LISLSEQ+LVDCD    ++GC GG   +AFQFI  + GL TE++YPY GV+
Sbjct  159  GITKLTTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFISQNHGLRTETNYPYTGVD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I G+++V A SE+ALL AVANQP+S  I   G   ++       +G
Sbjct  219  GTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQFY-----SSG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  274  VF-----TGSCGTSLDHGVTAVGYG  293



>ref|XP_006362428.1| PREDICTED: vignain-like [Solanum tuberosum]
Length=341

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI +IKTG+LISLSEQ+LVDCD  ++ GC GG   +AF+FI  + GL TES+YPYEG + 
Sbjct  159  GINEIKTGKLISLSEQELVDCDTSSDMGCEGGLMDDAFKFIIKNHGLTTESNYPYEGTDG  218

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T    N AA I GY++V A SESALL AVANQPVS  I   G   ++       +G+
Sbjct  219  TCKTGKESNDAAKITGYEDVPANSESALLNAVANQPVSVAIDASGSDFQFYS-----SGV  273

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGE G+   H VT +GYG
Sbjct  274  F-----TGEYGTDLDHGVTAVGYG  292



>ref|XP_008345990.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=341

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 89/143 (62%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GITKIKTGQLISLSEQQLVDCD +N GC GG+  +AF +I+ +GG+ +E +YPY+G +  
Sbjct  160  GITKIKTGQLISLSEQQLVDCDTSNXGCQGGDMAKAFAYIQQNGGIASEENYPYQGSDGT  219

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            C+T      AA I  Y  V   SE+ LL AV+ QPVS  I        Y        G+F
Sbjct  220  CDTXLXNEAAAKITNYARVTPNSETDLLKAVSXQPVSVAIAASQAFXLY------SGGLF  273

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
            T  D++  CG+   HAVTIIGYG
Sbjct  274  T--DDS--CGTELNHAVTIIGYG  292



>gb|AAD53011.1|AF089848_1 senescence-specific cysteine protease [Brassica napus]
Length=346

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 94/145 (65%), Gaps = 17/145 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G T+IK G+LISLSEQQLVDCD N+ GC GG    AF+ I  +GGL TES+YPY+G +A 
Sbjct  165  GATQIKKGKLISLSEQQLVDCDTNDFGCSGGLMDTAFEHIMATGGLTTESNYPYKGEDAN  224

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            C  ++ +  AA+I GY++V  + E+AL+ AVA+QPVS GI    FD       Q Y   +
Sbjct  225  CKIKSTKPSAASITGYEDVPVNDENALMKAVAHQPVSVGIEGGGFD------FQFY--SS  276

Query  80   GIFTGYDNTGECGSGYKHAVTIIGY  6
            G+F     TGEC +   HAVT +GY
Sbjct  277  GVF-----TGECTTYLDHAVTAVGY  296



>ref|XP_009365508.1| PREDICTED: vignain-like [Pyrus x bretschneideri]
Length=542

 Score =   126 bits (316),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 71/145 (49%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD +  ++GC GG   +AFQFI  + GL TE++YPY GV+
Sbjct  359  GITKLTTGKLISLSEQELVDCDTSSVDQGCEGGLMDDAFQFITQNHGLSTETNYPYTGVD  418

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AATI G+++V A SE+ALL AVANQP+S  I   G   ++       +G
Sbjct  419  GTCNTKNEASHAATITGHEDVPANSEAALLKAVANQPISVVIDAGGSDFQFYS-----SG  473

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +G+G
Sbjct  474  VF-----TGTCGTSLDHGVTAVGFG  493



>emb|CDX86529.1| BnaC08g01740D [Brassica napus]
Length=410

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG L+SLSEQQL+DCD    N+GC GG    A++++  +GGL+TE+DYPY  ++
Sbjct  162  GINKIKTGNLVSLSEQQLIDCDVGAFNKGCSGGLMTTAYEYLIANGGLVTEADYPYTAIQ  221

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
              C+ +  +N+  T+ GY +VE +E++L  A A QPVS GI   G +    Q Y   +G+
Sbjct  222  GSCDQEKSQNKVVTVQGYTKVEQNEASLQAATAQQPVSVGIDAGGFI---FQLYS--SGV  276

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FTG+     CG+   H VT++GYG
Sbjct  277  FTGF-----CGNHLNHGVTVVGYG  295



>ref|XP_009110997.1| PREDICTED: ervatamin-B-like [Brassica rapa]
Length=343

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG L+SLSEQQL+DCD +  N+GC GG    A++++  +GGL+TE+DYPY  ++
Sbjct  162  GINKIKTGNLVSLSEQQLIDCDVSAFNKGCSGGLLTTAYEYLIPNGGLVTEADYPYTAIQ  221

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
              C+ +  +N+  TI GY +VE +E +L  A A QPVS GI   G +    Q Y   +G+
Sbjct  222  GTCDQEKSQNKVVTIQGYTKVEQNEESLQAATAQQPVSVGIDAGGFI---FQLY--SSGV  276

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FTG+     CG+   H VT++GYG
Sbjct  277  FTGF-----CGNHLNHGVTVVGYG  295



>gb|KCW76118.1| hypothetical protein EUGRSUZ_D00495 [Eucalyptus grandis]
Length=355

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 88/146 (60%), Gaps = 17/146 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G+T IK  +L+ LS Q+LVDCD N  GC GG+   AF+FI G GGL TE DYPY+ ++  
Sbjct  174  GLTMIKKEKLVPLSVQELVDCDDNEDGCWGGHVDSAFEFIIGKGGLTTEEDYPYQAIDGT  233

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            CNT    N  A+I GYQ+V A +E ALL AVANQPVS  I    FD       Q Y   N
Sbjct  234  CNTAKTVNPVASITGYQDVPADNERALLQAVANQPVSVAIEGGGFD------FQFY--SN  285

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            G+F     +G CG+     VT+IGYG
Sbjct  286  GVF-----SGSCGTDIDQEVTVIGYG  306



>gb|KHN05669.1| Vignain [Glycine soja]
Length=315

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK++TG+LISLSEQ+LVDCD    ++GC GG   +AF+FI  + GL TE+ YPYEG +
Sbjct  132  GITKLRTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKGLATEAIYPYEGFD  191

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   N A +I GY++V A SESALL AVANQPVS  I   G   ++        G
Sbjct  192  GTCNAKADGNHAGSIKGYEDVPANSESALLKAVANQPVSVAIEASGFKFQFYS-----GG  246

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  247  VF-----TGSCGTNLDHGVTSVGYG  266



>ref|XP_007214432.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
 gb|EMJ15631.1| hypothetical protein PRUPE_ppa025658mg [Prunus persica]
Length=339

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD +  ++GC GG   +AFQFI+ + GL TE++YPY GV+
Sbjct  156  GITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVD  215

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I GY++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  216  GSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQFYS-----SG  270

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  271  VF-----TGACGTSLDHGVTAVGYG  290



>ref|XP_009357172.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=343

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD    ++GC GG   +AFQFI+ + G+ TE++YPY+GV+
Sbjct  160  GITQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNRGISTEANYPYDGVD  219

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   +RAA I G+++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  220  GTCNAKKEASRAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYS-----SG  274

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  275  VF-----TGTCGTSLDHGVTAVGYG  294



>ref|XP_008382007.1| PREDICTED: ervatamin-B-like [Malus domestica]
 ref|XP_008365747.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=343

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD    ++GC GG   +AFQFI+ + G+ TE++YPY+GV+
Sbjct  160  GITQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNRGISTEANYPYDGVD  219

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   +RAA I G+++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  220  GTCNAKKEASRAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYS-----SG  274

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  275  VF-----TGTCGTSLDHGVTAVGYG  294



>emb|CDX87758.1| BnaC02g31910D [Brassica napus]
Length=346

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 94/145 (65%), Gaps = 17/145 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G T+IK G+LISLSEQQLVDCD N+ GC GG    AF+ I  +GGL TES+YPY+G +A 
Sbjct  165  GATQIKKGKLISLSEQQLVDCDTNDFGCSGGLMDTAFEHIMATGGLTTESNYPYKGEDAN  224

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            C  ++ +  AA+I GY++V  + E+AL+ AVA+QPVS GI    FD       Q Y   +
Sbjct  225  CKIKSTKPSAASITGYEDVPVNDENALMKAVAHQPVSVGIEGGGFD------FQFY--SS  276

Query  80   GIFTGYDNTGECGSGYKHAVTIIGY  6
            G+F     TGEC +   HAVT +GY
Sbjct  277  GVF-----TGECTTYLDHAVTAVGY  296



>gb|EYU25672.1| hypothetical protein MIMGU_mgv1a018700mg [Erythranthe guttata]
Length=343

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI ++ TG L+SLSEQ+LVDCD + ++GC GG    AF+FI  + GL TES+YPYEGV+ 
Sbjct  161  GINQLTTGNLVSLSEQELVDCDTSEDQGCNGGLMDNAFEFIISNNGLTTESNYPYEGVDG  220

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN++   + AA I GY++V + SESALL AVANQP+S  I   G   ++        G+
Sbjct  221  TCNSKKESSHAARITGYEDVPSNSESALLKAVANQPISVAIDASGSDFQFY-----SGGV  275

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   H VT +GYG
Sbjct  276  F-----TGQCGTELDHGVTAVGYG  294



>ref|XP_002525147.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37274.1| cysteine protease, putative [Ricinus communis]
Length=347

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 89/145 (61%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG L+SLSEQ+LVDCD N  N+GC GG   +AF FIK  GGL TE+DYPY+G +
Sbjct  164  GINKIKTGNLVSLSEQELVDCDVNGDNKGCNGGFMEKAFTFIKSIGGLTTENDYPYKGTD  223

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              C      N A  I GY+ V A +E++L VAV+ QPVS  I   G      Q Y +  G
Sbjct  224  GSCEKAKTDNHAVIIGGYETVPANNENSLKVAVSKQPVSVAIDASGYE---FQLYSE--G  278

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F+GY     CG    H VTI+GYG
Sbjct  279  VFSGY-----CGIQLNHGVTIVGYG  298



>ref|XP_009128825.1| PREDICTED: ervatamin-B [Brassica rapa]
 emb|CDY50483.1| BnaA02g24130D [Brassica napus]
Length=346

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 94/145 (65%), Gaps = 17/145 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G T+IK G+LISLSEQQLVDCD N+ GC GG    AF+ I  +GGL TES+YPY+G +A 
Sbjct  165  GATQIKKGKLISLSEQQLVDCDTNDFGCSGGLMDTAFEHIMATGGLTTESNYPYKGEDAT  224

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            C  ++ +  AA+I GY++V  + E+AL+ AVA+QPVS GI    FD       Q Y   +
Sbjct  225  CKIKSTKPSAASITGYEDVPVNDENALMKAVAHQPVSVGIEGGGFD------FQFY--SS  276

Query  80   GIFTGYDNTGECGSGYKHAVTIIGY  6
            G+F     TGEC +   HAVT +GY
Sbjct  277  GVF-----TGECTTYLDHAVTAVGY  296



>gb|AAB41816.1| NTH1 [Pisum sativum]
Length=367

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
             I KI TG L+SLSEQ+LVDCD   N+GC GGN+V A++FI  +GGL ++ DYPY G ++
Sbjct  156  AINKIVTGSLVSLSEQELVDCDRTKNKGCNGGNQVNAYRFIVENGGLDSQIDYPYLGRQS  215

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN      +  +I GY+ V+  SESAL+ AVANQPVS GI   G+  +  Q     +G+
Sbjct  216  TCNQAKKNTKVVSINGYKNVQRNSESALMEAVANQPVSVGIEAYGKDFQLYQ-----SGV  270

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG CG+   HAV ++GYG
Sbjct  271  F-----TGSCGTSLDHAVVVVGYG  289



>ref|XP_009119072.1| PREDICTED: ervatamin-B [Brassica rapa]
 emb|CDY57814.1| BnaA10g28030D [Brassica napus]
Length=344

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITKIKTG LI LSEQQL+DCD    N+GC GG    A++++  +GGL+   DYPY   +
Sbjct  162  GITKIKTGNLIPLSEQQLIDCDTGSYNKGCSGGLMETAYEYLIANGGLVALDDYPYTATD  221

Query  254  AR-CNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
               C+ +  +N+  TI GY++V  +E++L VA A QPVS GI  DG + ++       +G
Sbjct  222  GTGCDQEKSQNKIVTITGYEKVAPNEASLEVAAAQQPVSVGIDADGFIFQFYS-----SG  276

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +FTGY     CGS   HAVT++GYG
Sbjct  277  VFTGY-----CGSSLNHAVTVVGYG  296



>ref|XP_008223851.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=342

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG LISLSEQ+LVDCD    ++GC GG   +AFQFI  + GL TE++YPY GV+
Sbjct  159  GITKLTTGNLISLSEQELVDCDTKGVDQGCEGGLMDDAFQFINQNHGLSTETNYPYTGVD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I G+++V A SE+ALL AVANQP+S  I   G   ++       +G
Sbjct  219  GTCNTKKEASHAAKITGHEDVPANSEAALLKAVANQPISVAIDAGGSDFQFY-----SSG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  274  VF-----TGACGTSLDHGVTAVGYG  293



>gb|EYU19037.1| hypothetical protein MIMGU_mgv1a018631mg [Erythranthe guttata]
Length=325

 Score =   124 bits (310),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            G+ +IKTG LISLSEQ+LVDCD + ++GC  G    AF+FI  + GL TES+YPYEGV+ 
Sbjct  143  GLNQIKTGNLISLSEQELVDCDTSEDQGCNDGLMDNAFEFIISNNGLTTESNYPYEGVDG  202

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN++   +  A I GY++V A SESALL AVANQP+S  I   G   ++        G+
Sbjct  203  TCNSKKESSHVAKITGYEDVPANSESALLKAVANQPISVAIDASGSDFQFY-----SGGV  257

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     +G+CG+   H VT +GYG
Sbjct  258  F-----SGQCGTELDHGVTAVGYG  276



>ref|XP_010099379.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB78104.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=348

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 91/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+L+SLSEQ+LVDCD    ++GC GG   EAF+FI+ +GGL TE++YPYEGV+
Sbjct  165  GITKLSTGKLLSLSEQELVDCDVKGEDQGCNGGLMDEAFKFIQHNGGLTTEANYPYEGVD  224

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +     AA I GY++V A SE  LL AV +QPVS  I   G   ++        G
Sbjct  225  GTCNAKKEATHAAKITGYEDVPANSEKDLLKAVTHQPVSVAIDASGFEFQFYS-----GG  279

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  280  VF-----TGACGTNLDHGVTAVGYG  299



>ref|XP_006283942.1| hypothetical protein CARUB_v10005061mg [Capsella rubella]
 gb|EOA16840.1| hypothetical protein CARUB_v10005061mg [Capsella rubella]
Length=376

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+L+SLSEQ+LVDCD   N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  180  GINKIVTGELVSLSEQELVDCDKAYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPYRGSNG  239

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    +R  +I GY++V    E+AL  A+++QPVS  I   GR+ ++ Q     +GI
Sbjct  240  KCNSFLKNSRVVSIDGYEDVPTKDEAALKKAISHQPVSVAIEAGGRIFQHYQ-----SGI  294

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   HAV  +GYG
Sbjct  295  F-----TGECGTNLDHAVVAVGYG  313



>ref|XP_004987388.1| PREDICTED: xylem cysteine proteinase 2-like [Setaria italica]
Length=371

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 92/143 (64%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI KI+TG+L+SLSEQ+LVDCD  ++GC GG    A Q+I  +GG+ TE DYPY+  + +
Sbjct  188  GINKIRTGKLLSLSEQELVDCDTLDKGCKGGMHYRALQWITKNGGITTEKDYPYKARQGK  247

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            C+   L++RAATI+G++ V   SE++L  AVA QPV   I   G      Q+Y K  GI+
Sbjct  248  CDRSKLKHRAATISGFRRVATRSEASLQNAVAMQPVCVSIEAGGSN---FQHYKK--GIY  302

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                  G CG+   HAVT++GYG
Sbjct  303  -----NGPCGTKLNHAVTVVGYG  320



>ref|XP_011014388.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=340

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 95/143 (66%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI K+KTG+LISLSEQQLVDC+  N+GC GG    AFQ+I   GGL +E +YPY+GV+  
Sbjct  159  GIIKLKTGKLISLSEQQLVDCNAGNKGCQGGFMDTAFQYIIRKGGLTSEENYPYQGVDGT  218

Query  248  CNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            CN++   +  A I GY++V + +E+ALL AVA QPVS GI   G+  ++ +     +G+F
Sbjct  219  CNSEKAASIEAEITGYEDVPQNNENALLQAVAKQPVSVGIDGGGQDFQFYK-----SGVF  273

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                  G+CG+   HAVT IG+G
Sbjct  274  -----KGDCGAEQNHAVTAIGFG  291



>ref|XP_004297571.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD N  ++GC GG    AF FI  + GL TE++YPY GV+
Sbjct  158  GITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDNAFDFINQNHGLSTEANYPYTGVD  217

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN Q   + AA+I G+++V A SESALL AVANQP+S  I   G      Q Y   +G
Sbjct  218  GTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSD---FQLY--SSG  272

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  273  VF-----TGTCGTSLDHGVTAVGYG  292



>ref|XP_009109364.1| PREDICTED: cysteine proteinase COT44-like [Brassica rapa]
Length=374

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+LISLSEQ+LVDCD + N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  180  GINKIVTGELISLSEQELVDCDRSYNQGCNGGLMDYAFQFIMKNGGLNTEQDYPYRGSNG  239

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    +R  TI GY++V    E+AL  AV+ QPVS  I   GR+ ++ Q     +GI
Sbjct  240  KCNSLLKNSRVVTIDGYEDVPTEDETALKRAVSYQPVSVAIEAGGRVFQHYQ-----SGI  294

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   HAV  +GYG
Sbjct  295  F-----TGKCGTNLDHAVVAVGYG  313



>emb|CDY10188.1| BnaC05g04310D [Brassica napus]
Length=343

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 91/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITKIKTG LI LSEQQL+DCD    N+GC GG    A++++  +GGL    DYPY   +
Sbjct  161  GITKIKTGNLIPLSEQQLIDCDTGSYNKGCSGGLMETAYEYLIANGGLAALDDYPYTATD  220

Query  254  AR-CNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
               C+ +  +N+  TI GY++V  +E++L VA A QPVS GI  DG + ++       +G
Sbjct  221  GTGCDQEKSQNKVVTITGYEKVAPNEASLEVAAAQQPVSVGIDADGFIFQFYS-----SG  275

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +FTGY     CGS   HAVT++GYG
Sbjct  276  VFTGY-----CGSSLNHAVTVVGYG  295



>emb|CDY15571.1| BnaA08g28550D [Brassica napus]
Length=343

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG L+SLSEQQL+DCD +  N+GC GG    A++++  +GGL+TE+DYPY  ++
Sbjct  162  GINKIKTGNLVSLSEQQLIDCDVSAFNKGCSGGLLTTAYEYLIPNGGLVTEADYPYTAIQ  221

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
              C+ +  +N+  TI GY +VE +E +L  A A QPVS GI   G +    Q Y   +G+
Sbjct  222  GTCDQEKSQNKVFTIQGYTKVEQNEESLQAATAQQPVSVGIDAGGFI---FQLY--SSGV  276

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FTG+     CG+   H VT++GYG
Sbjct  277  FTGF-----CGNHLNHGVTVVGYG  295



>ref|XP_010432076.1| PREDICTED: germination-specific cysteine protease 1 [Camelina 
sativa]
Length=375

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+LISLSEQ+LVDCD   N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  179  GINKIVTGELISLSEQELVDCDKAYNQGCNGGLMDYAFQFIMKNGGLNTEQDYPYHGSSG  238

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    +R  +I GY++V    E+AL  A+++QPVS  I   GR+ ++ Q     +GI
Sbjct  239  KCNSFLKNSRVVSIDGYEDVPTKDETALKKAISHQPVSVAIEAGGRIFQHYQ-----SGI  293

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   HAV  +GYG
Sbjct  294  F-----TGKCGTNLDHAVVAVGYG  312



>ref|XP_006469054.1| PREDICTED: oryzain alpha chain-like [Citrus sinensis]
Length=212

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 86/144 (60%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI K+KTG+L+SLSEQ+LVDCD N  N+GC GG   +AF+FI   GG+ TE DYPY G  
Sbjct  28   GINKLKTGKLVSLSEQELVDCDVNSENQGCNGGYMEKAFEFITKIGGVTTEDDYPYRGKN  87

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             RC T   ++ A TI GY+ + ASE+ L   V+ QPVS  I   G      Q Y   +G+
Sbjct  88   DRCQTDKTKHHAVTITGYEAIPASENNLQAKVSLQPVSVAIDAGGYA---FQLYS--HGV  142

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F  Y     CG    H VT++GYG
Sbjct  143  FDEY-----CGHQLNHGVTVVGYG  161



>ref|XP_004487576.1| PREDICTED: vignain-like [Cicer arietinum]
Length=338

 Score =   123 bits (309),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 96/144 (67%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP-NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKTG+L+SLSEQ+L+DC   N+ GC GG   +A++FI  +GG+ +ES YPY+GVE 
Sbjct  156  GIHKIKTGKLVSLSEQELIDCVKGNSYGCNGGYTEDAYEFIAKNGGITSESKYPYKGVEK  215

Query  251  RCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN +      A I GY++V + +E+A+L AVANQP+   I +     R  Q Y   +GI
Sbjct  216  KCNMKKGAYSVAKIKGYEKVPKNNENAILKAVANQPI---IVYIEATQRAFQFY--SSGI  270

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+ + HAVTIIGYG
Sbjct  271  F-----TGKCGTDFDHAVTIIGYG  289



>ref|XP_011008467.1| PREDICTED: senescence-specific cysteine protease SAG12-like [Populus 
euphratica]
Length=305

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 94/143 (66%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI K+KTG+LISLSEQQLVDCD  N GC GG    AFQ+I  +GGL +E +YPY+GV+  
Sbjct  124  GIIKLKTGKLISLSEQQLVDCDVGNNGCHGGFMDNAFQYIIRNGGLASEDNYPYQGVDGT  183

Query  248  CNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            CN++   +  A I GY++V + +E+ALL AVA QPVS  +   G+  ++ +     +G+F
Sbjct  184  CNSEKASSIEAEITGYEDVPQNNENALLQAVAKQPVSVVVDGGGQDFQFYK-----SGVF  238

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                  G+CG+   HAVT IGYG
Sbjct  239  -----KGDCGTEQNHAVTAIGYG  256



>emb|CDY44047.1| BnaA08g15590D [Brassica napus]
Length=384

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+LISLSEQ+LVDCD + N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  190  GINKIVTGELISLSEQELVDCDRSYNQGCNGGLMDYAFQFIMKNGGLNTEQDYPYRGSNG  249

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    +R  TI GY++V    E+AL  AV+ QPVS  I   GR+ ++ Q     +GI
Sbjct  250  KCNSLLKNSRVVTIDGYEDVPTEDETALKRAVSYQPVSVAIEAGGRVFQHYQ-----SGI  304

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   HAV  +GYG
Sbjct  305  F-----TGKCGTNLDHAVVAVGYG  323



>ref|XP_002525123.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37250.1| cysteine protease, putative [Ricinus communis]
Length=349

 Score =   123 bits (309),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI K++TG+L+SLSEQ+LVDCD    ++GC GG  V+AF+FIK  GG+ +E++YPY+G +
Sbjct  159  GIHKLRTGKLVSLSEQELVDCDVKGQDKGCQGGLMVDAFKFIKRHGGMTSEANYPYQGRD  218

Query  254  ARCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
             +C+T+   +RA  I GYQ V + SE+ALL AVANQPVS  I       ++ +     +G
Sbjct  219  GKCDTKKEASRAVKITGYQAVPKNSEAALLKAVANQPVSVAIDAGSLSFQFYR-----SG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            IFTG      CG    H V  +GYG
Sbjct  274  IFTGI-----CGKDINHGVAAVGYG  293



>emb|CBI30671.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 97/145 (67%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            G+T++KTG+LISLSEQ+LVDCD +  ++GCGGG    AF+FI G+GGL TE++YPY+GV+
Sbjct  137  GVTQLKTGELISLSEQELVDCDTSGEDQGCGGGLMDSAFEFIIGNGGLTTEANYPYKGVD  196

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
            A CN +   + AA I  Y++V A SE+ALL AVA  PVS  I   G   ++       +G
Sbjct  197  ATCNKKKAASSAAKIKNYEDVPANSEAALLKAVAQHPVSVAIDAGGSDFQFYS-----SG  251

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG+CG+   H VT +GYG
Sbjct  252  VF-----TGQCGTELDHGVTAVGYG  271



>gb|EYU25679.1| hypothetical protein MIMGU_mgv1a023356mg, partial [Erythranthe 
guttata]
Length=347

 Score =   123 bits (309),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI ++ TG L+SLSEQ+LVDCD + ++GC GG    AF+FI  + GL TES+YPYEGV+ 
Sbjct  165  GINQLTTGNLVSLSEQELVDCDTSEDQGCNGGLMDYAFEFIISNNGLTTESNYPYEGVDG  224

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN++   +  A I GY++V + SESALL AV NQP+S  I   G   ++       +G+
Sbjct  225  TCNSKKESSHVAKITGYEDVPSNSESALLKAVVNQPISVAIDASGSDFQFY-----SSGV  279

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   H VT++GYG
Sbjct  280  F-----TGQCGTELDHGVTVVGYG  298



>ref|XP_010446685.1| PREDICTED: germination-specific cysteine protease 1-like [Camelina 
sativa]
Length=378

 Score =   124 bits (310),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+LISLSEQ+LVDCD   N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  182  GINKIVTGELISLSEQELVDCDKAYNQGCNGGLMDYAFQFIMKNGGLNTEQDYPYHGSSG  241

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    +R  +I GY++V    E+AL  A+++QPVS  I   GR+ ++ Q     +GI
Sbjct  242  KCNSFLKNSRVVSIDGYEDVPTKDEAALKKAISHQPVSVAIEAGGRIFQHYQ-----SGI  296

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   HAV  +GYG
Sbjct  297  F-----TGKCGTNLDHAVVAVGYG  315



>ref|XP_007212667.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
 gb|EMJ13866.1| hypothetical protein PRUPE_ppa018342mg [Prunus persica]
Length=326

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD +  ++GC GG   +AFQFI+ + GL  E++YPY GV+
Sbjct  143  GITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFQFIQQNHGLSAEANYPYNGVD  202

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I GY++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  203  GSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQFYS-----SG  257

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  258  VF-----TGSCGTSLDHGVTAVGYG  277



>gb|KDP38776.1| hypothetical protein JCGZ_05112 [Jatropha curcas]
Length=222

 Score =   120 bits (302),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD +  ++GC GG   +AF FIK +GGL TE++YPY+G +
Sbjct  39   GITKLSTGKLISLSEQELVDCDTSGEDQGCEGGFMDDAFGFIKKNGGLTTEANYPYQGTD  98

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   ++AA I GY++V A SE ALL AVANQPVS  I   G   ++        G
Sbjct  99   DPCNAKKAADKAAKITGYEDVAANSEQALLKAVANQPVSVTIDASGSAFQFYS-----GG  153

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG+CG+   H VT +GYG
Sbjct  154  VF-----TGDCGTELDHGVTAVGYG  173



>gb|KFK31512.1| hypothetical protein AALP_AA6G122300 [Arabis alpina]
Length=342

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 92/146 (63%), Gaps = 17/146 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G T+IK G+LISLSEQQLVDCD N+ GC GG    AF+ I  +GGL TES+YPY+G +  
Sbjct  161  GATQIKKGKLISLSEQQLVDCDINDYGCRGGLMDTAFEHIIATGGLTTESNYPYKGEDGT  220

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            CN++    +A +I+GY++V  + E AL+ AVA QPVS GI    FD       Q Y    
Sbjct  221  CNSKKTNPKATSISGYEDVPVNDEKALMKAVAYQPVSVGIEGGGFD------FQFY--ST  272

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            G+F     TGEC +   HAVT +GYG
Sbjct  273  GVF-----TGECTTSLDHAVTAVGYG  293



>ref|XP_003538185.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 91/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+LVDCD    ++GC GG   +AF+FI  + GL  E+ YPYEGV+
Sbjct  160  GITKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFILQNKGLAAEAIYPYEGVD  219

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   N A +I GY++V A SESALL AVANQPVS  I   G   ++        G
Sbjct  220  GTCNAKAEGNHATSIKGYEDVPANSESALLKAVANQPVSVAIEASGFEFQFY-----SGG  274

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  275  VF-----TGSCGTNLDHGVTAVGYG  294



>dbj|BAD29959.1| cysteine protease [Daucus carota]
Length=361

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+KTG+LISLSEQ+LVDCD    ++GC GG   + F+FI  + G+  E+ YPY   +
Sbjct  178  GITKLKTGKLISLSEQELVDCDKTGEDQGCEGGYMEDGFEFIVKNKGIALEASYPYTAAD  237

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN++   +RAA I+GY++V A SE+ALL AVANQPVS  I   G   ++       +G
Sbjct  238  GTCNSKEEASRAAKISGYEKVPANSETALLKAVANQPVSVSIDASGVAFQFY-----SSG  292

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TGECG+   H VT +GYG
Sbjct  293  VF-----TGECGTDLDHGVTAVGYG  312



>ref|XP_007132275.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
 gb|ESW04269.1| hypothetical protein PHAVU_011G081100g [Phaseolus vulgaris]
Length=341

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 91/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+L+DCD    ++GC GG   +AF+FI  + GL TE+ YPYEG++
Sbjct  158  GITKLSTGKLISLSEQELIDCDTKGEDQGCEGGLMDDAFKFILNNKGLTTEATYPYEGID  217

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   + AA+I GY++V A SESALL AVANQPVS  I   G   ++        G
Sbjct  218  GTCNAKAESSHAASIKGYEDVPANSESALLKAVANQPVSVAIDASGYEFQFY-----AGG  272

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F      G C +   H VT +GYG
Sbjct  273  VF-----NGSCDTNLDHGVTAVGYG  292



>gb|AEK97329.1| chromoplast senescence-associated protein 12 [Brassica rapa var. 
parachinensis]
Length=260

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 93/145 (64%), Gaps = 17/145 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            G T+IK G+LISLSEQQLVDCD N+ GC GG    AF+ I  +GGL TES+YPY+G +A 
Sbjct  79   GATQIKKGKLISLSEQQLVDCDTNDFGCSGGLIDTAFEHIMATGGLTTESNYPYKGEDAT  138

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            C  ++    AA+I GY++V  + E+AL+ AVA+QPVS GI    FD       Q Y   +
Sbjct  139  CKIKSTXPSAASITGYEDVPVNDENALMKAVAHQPVSVGIEGGGFD------FQFY--SS  190

Query  80   GIFTGYDNTGECGSGYKHAVTIIGY  6
            G+F     TGEC +   HAVT +GY
Sbjct  191  GVF-----TGECTTYLDHAVTAVGY  210



>ref|XP_010091034.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 ref|XP_010091036.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36678.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXC36680.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=343

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD +  ++GC GG   +AF FI G+ GL TES YPY+GV+
Sbjct  160  GITQLTTGKLISLSEQELVDCDTSGTDQGCEGGLMDDAFDFILGNEGLTTESKYPYKGVD  219

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   + AA+I G+++V A SE AL  AVANQPVS  I   G      Q Y   +G
Sbjct  220  ETCNKKKASSHAASITGHEDVPANSEKALQKAVANQPVSVAIDAGGSD---FQLY--SSG  274

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TGECG+   H VT +GYG
Sbjct  275  VF-----TGECGTELDHGVTAVGYG  294



>ref|XP_010437247.1| PREDICTED: germination-specific cysteine protease 1-like [Camelina 
sativa]
Length=375

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+LISLSEQ+LVDCD   N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  179  GINKIVTGELISLSEQELVDCDKAYNQGCNGGLMDYAFQFIVKNGGLNTEQDYPYHGSSG  238

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    +R  +I GY++V    E+AL  A+++QPVS  I   GR+ ++ Q     +GI
Sbjct  239  KCNSFLKNSRVVSIDGYEDVPTKDETALKKAISHQPVSVAIEAGGRIFQHYQ-----SGI  293

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   HAV  +GYG
Sbjct  294  F-----TGKCGTNLDHAVVAVGYG  312



>ref|XP_007025397.1| Senescence-associated gene 12, putative [Theobroma cacao]
 gb|EOY28019.1| Senescence-associated gene 12, putative [Theobroma cacao]
Length=322

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 93/145 (64%), Gaps = 14/145 (10%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            G+T++K G+LISLSEQQLVDCD    + GC GG    AFQFIK + GL TE++YPY G E
Sbjct  140  GLTQLKKGKLISLSEQQLVDCDIKGEDEGCEGGLMDNAFQFIKTNRGLTTEANYPYRGSE  199

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              C  +     AATIAGY++V A +E ALL AVANQPVS  I   G   ++ +     +G
Sbjct  200  GECKNKH-ATPAATIAGYEDVPANNEKALLQAVANQPVSVAIEGSGWAFQFYE-----SG  253

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     +GECG+   HAVT IGYG
Sbjct  254  VF-----SGECGTYLDHAVTAIGYG  273



>ref|XP_007212585.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
 gb|EMJ13784.1| hypothetical protein PRUPE_ppa015944mg [Prunus persica]
Length=339

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD +  ++GC GG   +AFQFI+ + GL  E++YPY GV+
Sbjct  156  GITQLTTGKLISLSEQELVDCDTSGEDQGCEGGLMDDAFQFIQQNHGLSAEANYPYNGVD  215

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA I GY++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  216  GSCNTKKAASIAAKITGYEDVPANSEKALLTAVAHQPVSVAIDAGGSDFQFYS-----SG  270

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  271  VF-----TGSCGTSLDHGVTAVGYG  290



>ref|XP_002274223.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Vitis 
vinifera]
Length=340

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 97/145 (67%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            G+T++KTG+LISLSEQ+LVDCD +  ++GCGGG    AF+FI G+GGL TE++YPY+GV+
Sbjct  157  GVTQLKTGELISLSEQELVDCDTSGEDQGCGGGLMDSAFEFIIGNGGLTTEANYPYKGVD  216

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
            A CN +   + AA I  Y++V A SE+ALL AVA  PVS  I   G   ++       +G
Sbjct  217  ATCNKKKAASSAAKIKNYEDVPANSEAALLKAVAQHPVSVAIDAGGSDFQFYS-----SG  271

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG+CG+   H VT +GYG
Sbjct  272  VF-----TGQCGTELDHGVTAVGYG  291



>gb|AEQ54772.1| KDEL-tailed cysteine proteinase CP4, partial [Coffea canephora]
Length=215

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI KIKTGQL+SLSEQ+LVDC+ +N GC GG    A++FIK SGG+ TE  YPY+  +  
Sbjct  17   GINKIKTGQLVSLSEQELVDCETDNEGCNGGLMENAYEFIKKSGGITTERLYPYKARDGS  76

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            C++  +   A TI G++ V A+ E+AL+ AVANQPVS  I   G   ++        G++
Sbjct  77   CDSSKMNAPAVTIDGHEMVPANDENALMKAVANQPVSVAIDASGSDMQFYS-----EGVY  131

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
            TG      CG+   H V ++GYG
Sbjct  132  TG----DSCGNELDHGVAVVGYG  150



>ref|XP_004297572.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD N  ++GC GG    AF FI  + GL TE+ YPY GV+
Sbjct  158  GITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDNAFDFINQNHGLSTEAHYPYTGVD  217

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN Q   + AA+I G+++V A SESALL AVANQP+S  I   G      Q Y   +G
Sbjct  218  GTCNAQKEASHAASITGHEDVPANSESALLKAVANQPISVAIDASGSD---FQLY--SSG  272

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  273  VF-----TGTCGTSLDHGVTAVGYG  292



>gb|KCW84689.1| hypothetical protein EUGRSUZ_B01506, partial [Eucalyptus grandis]
Length=295

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+L SLSEQ+LVDCD +  ++GCGGG   +AFQFI  + GL TE++YPY+ V+
Sbjct  126  GITQLTTGKLTSLSEQELVDCDRSGEDQGCGGGLMDDAFQFIISNHGLTTEANYPYQAVD  185

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   + AA I+GY++V + SESALL AVA+QPVS  I  D     + Q Y    G
Sbjct  186  NTCNARKAASTAAKISGYEDVPSNSESALLKAVAHQPVSVAI--DAGETDF-QFY--STG  240

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            IF     TGECG+   H VT +GYG
Sbjct  241  IF-----TGECGTDLDHGVTAVGYG  260



>gb|EYU43350.1| hypothetical protein MIMGU_mgv1a021555mg [Erythranthe guttata]
Length=325

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI ++ TG LISLSEQ+LVDCD + ++GC GG    AF+FI  + GL TES+YPYEGV+ 
Sbjct  143  GINQLTTGNLISLSEQELVDCDTSEDQGCNGGLMDNAFEFIISNNGLTTESNYPYEGVDG  202

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN++   +  A I GY++V A SESALL AVA QP+S  I   G   ++        G+
Sbjct  203  TCNSKKESSHVAKITGYEDVPANSESALLKAVAKQPISVAIDASGSDFQFYS-----GGV  257

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   H VT +GYG
Sbjct  258  F-----TGQCGTELDHGVTAVGYG  276



>ref|XP_008225269.1| PREDICTED: uncharacterized protein LOC103324934 [Prunus mume]
Length=768

 Score =   126 bits (316),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 70/144 (49%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            G TK+K+G+L+SLSEQ+LVDCD    NRGC GG   +AF+F+  + GL  E+ YPY GV+
Sbjct  586  GTTKLKSGKLVSLSEQELVDCDTQGENRGCEGGLMDDAFKFVMRNKGLAAEASYPYRGVD  645

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
              CN   +   AA I GY++V A+E ALL AVANQPVS  I   G      Q Y +  GI
Sbjct  646  GICNKNKVAYHAAKITGYEDVPANELALLKAVANQPVSVAIDAGGYE---FQFYSR--GI  700

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
                  TG+CG+   H VT++GYG
Sbjct  701  L-----TGDCGTHLNHGVTVVGYG  719



>ref|XP_010906194.1| PREDICTED: senescence-specific cysteine protease SAG39-like isoform 
X1 [Elaeis guineensis]
Length=343

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 95/145 (66%), Gaps = 12/145 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+KT +LISLSEQ+LV+CD    + GC GG    A +FI  +GGL TE++YPY+G++
Sbjct  159  GITKLKTHKLISLSEQELVECDVGGEDEGCNGGLPDAALEFIIKNGGLATETNYPYKGMD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA+I GY++V A SE+ALL AVANQPVS  I   G   ++       +G
Sbjct  219  GTCNTKKSASHAASIKGYEQVPANSEAALLKAVANQPVSVNIDSGGSSFQFY-----ASG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +FTG    G C +   H+VT +GYG
Sbjct  274  VFTG----GSCETDLDHSVTAVGYG  294



>ref|XP_010070600.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW59473.1| hypothetical protein EUGRSUZ_H02220 [Eucalyptus grandis]
Length=386

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 89/143 (62%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI +I TG+LISLSEQ+LVDCD  +N GC GG    AF+FI  +GG+ TE DYPY G+  
Sbjct  177  GINQIVTGELISLSEQELVDCDRKHNSGCNGGLMDYAFEFIIKNGGMDTEQDYPYNGIGG  236

Query  251  RCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            +C+   + ++  TI GY++V   ESAL  AVA+QPVS  I   GR  +  Q     +G+F
Sbjct  237  KCDASRVNSKVVTIDGYEDVPPYESALKKAVAHQPVSIAIEASGRAFQLYQ-----SGVF  291

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 TGECG    H V ++GYG
Sbjct  292  -----TGECGISLDHGVIVVGYG  309



>ref|XP_010052201.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76129.1| hypothetical protein EUGRSUZ_D00505 [Eucalyptus grandis]
Length=345

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 90/145 (62%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT +K G+L+SLS Q+LVDCD N  N GC GG    AF+FI   GGL TE++YPY G E
Sbjct  162  GITMLKKGKLLSLSVQELVDCDVNGKNSGCKGGYMDSAFEFIISKGGLTTEANYPYRGNE  221

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT      AA+I GY++V A +E ALL AVANQPVS  +   G   ++       +G
Sbjct  222  RTCNTAKTGYHAASITGYEDVPANNEKALLQAVANQPVSVAVEAGGYDFQFYS-----SG  276

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   HAVT++GYG
Sbjct  277  VF-----TGSCGTSVDHAVTVVGYG  296



>ref|XP_010103045.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
 gb|EXB94643.1| KDEL-tailed cysteine endopeptidase CEP1 [Morus notabilis]
Length=359

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD +  ++GC GG   +AF FI G+ GL TES YPY+GV+
Sbjct  176  GITQLTTGKLISLSEQELVDCDTSGTDQGCEGGLMDDAFDFILGNEGLTTESKYPYKGVD  235

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   + AA+I G+++V A SE AL  AVANQPVS  I   G      Q Y   +G
Sbjct  236  ETCNKKKASSHAASITGHEDVPANSEKALQKAVANQPVSVAIDAGGSD---FQLY--SSG  290

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TGECG+   H VT +GYG
Sbjct  291  VF-----TGECGTELDHGVTAVGYG  310



>emb|CDY22445.1| BnaC03g61580D [Brassica napus]
Length=374

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+LISLSEQ+LVDCD + N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  180  GINKIVTGELISLSEQELVDCDRSYNQGCNGGLMDYAFQFIMKNGGLNTEQDYPYRGSNG  239

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    ++  TI GY++V    E+AL  AV+ QPVS  I   GR+ ++ Q     +GI
Sbjct  240  KCNSLLKNSKVVTIDGYEDVPTEDETALKRAVSYQPVSVAIEAGGRVFQHYQ-----SGI  294

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   HAV  +GYG
Sbjct  295  F-----TGKCGTNLDHAVVAVGYG  313



>ref|XP_009357173.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD    ++GC GG   +AFQFI+ + G+ TE++YPY+GV+
Sbjct  161  GITQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTEANYPYDGVD  220

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   + AA I G+++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  221  GACNAKKEASHAAKITGFEDVPANSEKALLAAVAHQPVSVAIDASGSDFQFY-----SSG  275

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  276  VF-----TGTCGTSLDHGVTAVGYG  295



>emb|CDP18637.1| unnamed protein product [Coffea canephora]
Length=243

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 91/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI ++KTG+LISLSEQ+LVDCD    + GC GG   +AF FI  + GL TE++YPY+ V+
Sbjct  60   GIHQLKTGKLISLSEQELVDCDTAGEDEGCNGGLMDDAFTFIINNNGLTTEANYPYQAVD  119

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN+    N AA I GY++V A +E+ALL AVANQPVS  I   G   ++       +G
Sbjct  120  GTCNSNKEANHAAKITGYEDVPANNEAALLKAVANQPVSVAIDASGNGFQFYS-----SG  174

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F      G+CG+   H VT +GYG
Sbjct  175  VF-----AGDCGTELDHGVTAVGYG  194



>gb|KHN05670.1| Vignain [Glycine soja]
Length=301

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+L+DCD N  N GC  G   EAF+FI  + GL TE+ YPY+ V+
Sbjct  118  GITKLTTGELISLSEQELIDCDTNGDNGGCKWGIIQEAFKFIVQNKGLATEASYPYQAVD  177

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +      A+I GY++V A +E+ALL AVANQPVSA +       R+       +G
Sbjct  178  GTCNAKVESKHVASIKGYEDVPANNETALLNAVANQPVSALVDSSDYDFRFY-----SSG  232

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +      +G CG+ + HAVT++GYG
Sbjct  233  VL-----SGSCGTTFDHAVTVVGYG  252



>emb|CDP18640.1| unnamed protein product [Coffea canephora]
Length=254

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 92/143 (64%), Gaps = 13/143 (9%)
 Frame = -2

Query  422  TKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            +++KTG+LISLSEQ+LVDCD    ++GC GG   +AF FI  + GL TE++YPY+ V+  
Sbjct  75   SRLKTGKLISLSEQELVDCDAAGEDQGCNGGLMDDAFTFIIKNNGLTTEANYPYQAVDGT  134

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            CNT    + AA I GY++V A +E+ALL AVANQPVS  I   G   ++       +G+F
Sbjct  135  CNTNKEASSAAKITGYEDVPANNEAALLKAVANQPVSVAIDASGSAFQFYS-----SGVF  189

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 TG+CG+   H VT +GYG
Sbjct  190  -----TGDCGTELDHGVTAVGYG  207



>ref|XP_010522111.1| PREDICTED: ervatamin-B [Tarenaya hassleriana]
Length=344

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG+LISLSEQ+L+DCD   +N+GC GG    AF FIK +GG+ TES+YPY+  +
Sbjct  163  GINKIKTGKLISLSEQELIDCDTGKDNQGCNGGLMETAFAFIKSNGGITTESNYPYKARD  222

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
              C+    +N A TI+GY +V  +E +L  A A+QP+S GI   G      Q Y   +G+
Sbjct  223  NTCDKSKAKNHAVTISGYGKVRTNEKSLQAAAASQPISVGIDAGGYA---FQLY--SSGV  277

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F  Y     CG+   H VT++GYG
Sbjct  278  FNSY-----CGTQLNHGVTVVGYG  296



>gb|KDP21078.1| hypothetical protein JCGZ_21549 [Jatropha curcas]
Length=326

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ T +LISLSEQ+L+DCD +  ++GC GG   +AF+FI  + GL TE++YPY+  +
Sbjct  143  GITKLSTEKLISLSEQELIDCDTSGIDQGCEGGLMDDAFEFIIQNNGLTTEANYPYQAED  202

Query  254  ARCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   N AATI  Y++V E +E AL +AVANQPVS  I   G  A   Q+Y   +G
Sbjct  203  GTCNTEKAANHAATITSYEDVPENNEEALRMAVANQPVSVAIDA-GESA--FQHY--SSG  257

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            IF     TG+CG+   H VT++GYG
Sbjct  258  IF-----TGDCGTELDHGVTVVGYG  277



>ref|XP_008779585.1| PREDICTED: zingipain-2-like [Phoenix dactylifera]
Length=326

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 90/144 (63%), Gaps = 13/144 (9%)
 Frame = -2

Query  425  ITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            IT+IKTG L+ LSEQQLVDCD N  N GC GG    AFQ++  +GG+ TE++YPY   + 
Sbjct  144  ITQIKTGNLVYLSEQQLVDCDANDGNHGCHGGFMTGAFQYVINNGGITTENNYPYRANDG  203

Query  251  RCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C+T    + AATI GY+ V A+ ES+LL AV NQPVS GI   G+  R+ +      GI
Sbjct  204  TCDTNRASSSAATIGGYESVPANDESSLLQAVTNQPVSVGIDGSGQDFRHYK-----GGI  258

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG C +   HAVT +GYG
Sbjct  259  F-----TGACETNMNHAVTAVGYG  277



>ref|NP_001067630.1| Os11g0255300 [Oryza sativa Japonica Group]
 emb|CAA56844.1| cysteine protease [Oryza sativa Japonica Group]
 dbj|BAA83472.1| cysteine endopeptidase [Oryza sativa Japonica Group]
 gb|AAX94791.1| cysteine proteinase (EC 3.4.22.-) - rice [Oryza sativa Japonica 
Group]
 gb|AAX94792.1| cysteine proteinase (EC 3.4.22.-) - rice [Oryza sativa Japonica 
Group]
 gb|AAX94793.1| cysteine proteinase (EC 3.4.22.-) - rice [Oryza sativa Japonica 
Group]
 gb|ABA92412.1| Thiol protease SEN102 precursor, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABA92413.1| Thiol protease SEN102 precursor, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABA92414.1| Thiol protease SEN102 precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27993.1| Os11g0255300 [Oryza sativa Japonica Group]
 gb|EAZ18011.1| hypothetical protein OsJ_33558 [Oryza sativa Japonica Group]
 dbj|BAG92522.1| unnamed protein product [Oryza sativa Japonica Group]
Length=378

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP-NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            G+ KIKTG+L++LSEQ+LVDCD  +N+GC GG    AFQFIK +GG+ TES+YPY   + 
Sbjct  178  GVNKIKTGRLVTLSEQELVDCDTGDNQGCDGGLMDYAFQFIKRNGGITTESNYPYRAEQG  237

Query  251  RCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            RCN     +   TI GY++V A+ ESAL  AVANQPV+  +   G+  ++        G+
Sbjct  238  RCNKAKASSHDVTIDGYEDVPANDESALQKAVANQPVAVAVEASGQDFQFYS-----EGV  292

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H V  +GYG
Sbjct  293  F-----TGECGTDLDHGVAAVGYG  311



>gb|EAY80530.1| hypothetical protein OsI_35710 [Oryza sativa Indica Group]
Length=378

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP-NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            G+ KIKTG+L++LSEQ+LVDCD  +N+GC GG    AFQFIK +GG+ TES+YPY   + 
Sbjct  178  GVNKIKTGRLVTLSEQELVDCDTGDNQGCDGGLMDYAFQFIKRNGGITTESNYPYRAEQG  237

Query  251  RCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            RCN     +   TI GY++V A+ ESAL  AVANQPV+  +   G+  ++        G+
Sbjct  238  RCNKAKASSHDVTIDGYEDVPANDESALQKAVANQPVAVAVEASGQDFQFYS-----EGV  292

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H V  +GYG
Sbjct  293  F-----TGECGTDLDHGVAAVGYG  311



>ref|XP_010045987.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
Length=364

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+L SLSEQ+LVDCD +  ++GCGGG   +AFQFI  + GL TE++YPY+ V+
Sbjct  181  GITQLTTGKLTSLSEQELVDCDRSGEDQGCGGGLMDDAFQFIISNHGLTTEANYPYQAVD  240

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   + AA I+GY++V + SESALL AVA+QPVS  I  D     + Q Y    G
Sbjct  241  NTCNARKAASTAAKISGYEDVPSNSESALLKAVAHQPVSVAI--DAGETDF-QFY--STG  295

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            IF     TGECG+   H VT +GYG
Sbjct  296  IF-----TGECGTDLDHGVTAVGYG  315



>emb|CDY39574.1| BnaCnng09430D [Brassica napus]
Length=294

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI +IKT +L+SLSEQ+LVDCD   N+GC GG    AF+FIK +GG+ TE +YPYEG++ 
Sbjct  96   GINQIKTNKLVSLSEQELVDCDTKQNQGCNGGLMDIAFEFIKKNGGITTEDNYPYEGIDG  155

Query  251  RCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +C+         TI G+++V E  E ALL AVANQPVS  I  D   + + Q Y K  G+
Sbjct  156  KCDASKDNGEIVTIDGHEDVPENDEDALLKAVANQPVSVAI--DAGSSNF-QFYSK--GV  210

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FTGY     CG+   H V  +GYG
Sbjct  211  FTGY-----CGTELNHGVAAVGYG  229



>ref|XP_007213554.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
 gb|EMJ14753.1| hypothetical protein PRUPE_ppa018048mg [Prunus persica]
Length=343

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            G TK+K+G+L+SLSEQ+LVDCD    N+GC GG   +AF+F+  + GL  E++YPY G++
Sbjct  161  GTTKLKSGKLVSLSEQELVDCDTQGENQGCEGGLMDDAFKFVMRNKGLAAEANYPYRGID  220

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
              CN   +   AA I GY++V A+E ALL AVANQPVS  I   G      Q Y +  GI
Sbjct  221  GICNKNKVAYHAAKITGYEDVPANELALLKAVANQPVSVAIDAGGYE---FQFYSR--GI  275

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
                  TG+CG+   H VT++GYG
Sbjct  276  L-----TGDCGTHLNHGVTVVGYG  294



>ref|XP_006849385.1| hypothetical protein AMTR_s01332p00008900 [Amborella trichopoda]
 gb|ERN10966.1| hypothetical protein AMTR_s01332p00008900 [Amborella trichopoda]
Length=349

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 91/144 (63%), Gaps = 13/144 (9%)
 Frame = -2

Query  425  ITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            ITKIKTG  +SLSEQ+LVDC     +RGC GG   EAFQFI  +GGL +E+DYPY+ ++ 
Sbjct  171  ITKIKTGNSVSLSEQELVDCVTGGTSRGCQGGLMDEAFQFIINNGGLASEADYPYQAMDG  230

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C+ Q   ++ +TI GYQ + +  E +LL AVANQPVS G+   G   ++        G+
Sbjct  231  ACDAQKSSSKTSTITGYQNIPSGDEDSLLRAVANQPVSVGVDGSGFEFKHY-----SEGV  285

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   HAVT IGYG
Sbjct  286  F-----TGDCGTEMSHAVTAIGYG  304



>emb|CDP15898.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 91/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG+L+SLSEQ+LVDCD   NN GC GG   +AF+FIK +GG+ TESDYPY+G +
Sbjct  172  GINKIKTGKLVSLSEQELVDCDYNRNNEGCNGGFMDKAFEFIKTNGGITTESDYPYKGKK  231

Query  254  ARCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
             +CN    ++ A TI GY ++ +++E AL  A A QPVS  I   G      Q Y K  G
Sbjct  232  DKCNRAKEKDHAVTITGYGKIPKSNELALQTAAAKQPVSVAIDASGFN---FQLYSK--G  286

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +++GY     C     H V +IGYG
Sbjct  287  VYSGY-----CDKNLNHGVAVIGYG  306



>ref|XP_006388352.1| hypothetical protein POPTR_0213s00210g, partial [Populus trichocarpa]
 gb|ERP47266.1| hypothetical protein POPTR_0213s00210g, partial [Populus trichocarpa]
Length=194

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 91/143 (64%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI K++TG LISLSEQQLVDC   N+GC GG    AFQ+I  +GGL +E +YPY+GV+  
Sbjct  13   GIIKLQTGNLISLSEQQLVDCTAGNKGCQGGLMDTAFQYIIRNGGLTSEDNYPYQGVDGT  72

Query  248  CNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            C+++   +  A I GY++V + +E+ALL AVA QPVS  +   G   R+ +     +G+F
Sbjct  73   CSSEKAASTEAQITGYEDVPQNNENALLQAVAKQPVSVAVDGGGNDFRFYK-----SGVF  127

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                  G+CG+   H VT IGYG
Sbjct  128  -----EGDCGTNLNHGVTAIGYG  145



>ref|XP_004304987.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=368

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDC--DPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITKIK+ +LISLSEQQLVDC  D  NRGC GG+  +AF++I+ +GG+ TE +Y Y+G +
Sbjct  175  GITKIKSDKLISLSEQQLVDCNRDQINRGCRGGDMEDAFKYIEENGGITTEENYQYKGTD  234

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              C+T      AA I GY+ V   SE+ LL AVA QPVS GI  +G   R        +G
Sbjct  235  ETCDTTKTNEYAAKITGYEMVPPNSENDLLKAVAMQPVSVGIDANGEEFR-----AYASG  289

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     +G CG+   HAVTI+GYG
Sbjct  290  VF-----SGNCGTNLNHAVTIVGYG  309



>ref|XP_008244498.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+L+SLSEQ+LVDCD    ++GC GG   +AFQFI+ + GL TE++YPY GV+
Sbjct  162  GITQLTTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVD  221

Query  254  ARCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   N AA I G+++V A+ E ALL AVA+QPVS  I   G   ++       +G
Sbjct  222  GTCNTKKEANIAAKITGHEDVPANDEKALLNAVAHQPVSVAIDASGSDFQFY-----SSG  276

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  277  VF-----TGTCGTSLDHGVTAVGYG  296



>ref|XP_007213386.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
 gb|EMJ14585.1| hypothetical protein PRUPE_ppa026372mg [Prunus persica]
Length=345

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 94/145 (65%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+L+SLSEQ+LVDCD    ++GC GG   +AFQFI+ + GL TE++YPY GV+
Sbjct  162  GITQLTTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVD  221

Query  254  ARCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   N AA I G+++V A+ E ALL AVA+QPVS  I   G   ++       +G
Sbjct  222  GTCNTKKEANIAAKITGHEDVPANDEKALLNAVAHQPVSVAIDASGSDFQFY-----SSG  276

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  277  VF-----TGTCGTSLDHGVTAVGYG  296



>ref|XP_009597081.1| PREDICTED: zingipain-2 [Nicotiana tomentosiformis]
Length=439

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 88/144 (61%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG L+SLSEQ+L+DCD + N GCGGG    AF+F+K +GG+ TE DYP+   E 
Sbjct  156  GINKIVTGSLVSLSEQELIDCDKSYNDGCGGGLMDYAFEFVKKNGGIDTEEDYPFNEREG  215

Query  251  RCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN   L+ R  TI GY +V +  E  LL AVANQPVS GI       R  Q+Y K  GI
Sbjct  216  TCNKNKLQRRVVTIDGYTDVPQYDEDKLLKAVANQPVSVGIC---GSERAFQSYSK--GI  270

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG C +   HAV I+GYG
Sbjct  271  F-----TGPCSTVLDHAVLIVGYG  289



>ref|XP_002312656.2| hypothetical protein POPTR_0008s18350g [Populus trichocarpa]
 gb|EEE90023.2| hypothetical protein POPTR_0008s18350g [Populus trichocarpa]
Length=358

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 89/143 (62%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI KIKTG+LISLSEQ+LVDCD +N GC GG   +AF FIK  GGL +E+ YPY   E  
Sbjct  162  GINKIKTGELISLSEQELVDCDSDNHGCNGGLMEDAFNFIKQIGGLTSENTYPYRAKEEP  221

Query  248  CNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            C++  + +    I GY+ V E  E+AL+ AVANQPV+  +   G+    LQ Y +   IF
Sbjct  222  CDSNKMNSPVVNIDGYEMVPENDENALMKAVANQPVAIAMDAGGKD---LQFYSE--AIF  276

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 TG+CG+   H V ++GYG
Sbjct  277  -----TGDCGTELNHGVALVGYG  294



>gb|KCW76125.1| hypothetical protein EUGRSUZ_D00501 [Eucalyptus grandis]
Length=415

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 90/146 (62%), Gaps = 17/146 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GIT IK  +L+ LS Q+LVDCD N+ G GGG    AF+FI  +GGL TE++YPY+G +  
Sbjct  232  GITMIKKRKLVPLSVQELVDCDDNDEGFGGGLVDSAFKFIVSNGGLTTEANYPYQGNKGT  291

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            CNT    N AA+I GYQ+V A +E ALL AVANQPVS  I    FD       Q Y    
Sbjct  292  CNTAKAANPAASITGYQDVPANNEKALLQAVANQPVSVAIEGGGFD------FQFY--ST  343

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            G+F     TG CG+   HAVT +GYG
Sbjct  344  GVF-----TGSCGTDIDHAVTAVGYG  364



>ref|XP_010912736.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Elaeis 
guineensis]
Length=339

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT+I TG L+SLSEQQLVDCD    N GC GG    AFQ++  +GG+ TE++YPY   +
Sbjct  156  GITQINTGNLVSLSEQQLVDCDVKDGNNGCNGGLMTRAFQYVIDNGGITTENNYPYMAAD  215

Query  254  ARCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              C+T    + AATI+GY+ V  + ES+LL AV+NQPVS GI   G+     Q+Y   +G
Sbjct  216  GTCDTDRASSSAATISGYENVPVNDESSLLQAVSNQPVSVGIDGGGQD---FQHY--SSG  270

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            IF     TG C +   HAVT IGYG
Sbjct  271  IF-----TGPCKTNMDHAVTAIGYG  290



>ref|XP_004306597.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 95/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++  G+LISLSEQ+LVDCD +  ++GC GG   +AF+FI  + GL TE++YPY GV+
Sbjct  157  GITQLTMGKLISLSEQELVDCDKSGEDQGCEGGLMDDAFEFINQNHGLSTEANYPYTGVD  216

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
             +CN +   + AA+I G+++V A SESALL AVA+QP+S  I   G   ++       +G
Sbjct  217  GKCNARKEASHAASITGHEDVPANSESALLKAVASQPISVAIDASGSDFQFY-----SSG  271

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  272  VF-----TGTCGTSLDHGVTAVGYG  291



>ref|XP_006348972.1| PREDICTED: oryzain alpha chain-like [Solanum tuberosum]
Length=288

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 88/143 (62%), Gaps = 12/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG+L+SLSEQQL+DCD   +N+GC GG    AF +I  +GG+ T  +YPY G E
Sbjct  101  GINKIKTGKLVSLSEQQLMDCDVYSDNQGCKGGFMESAFDYIMENGGITTSKNYPYIGKE  160

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             +CNT+  +    TI+ Y++V  +E +L VA+  QP+S  I   G      Q Y    GI
Sbjct  161  QKCNTKKAKQHEVTISNYEKVPPNEESLQVAINKQPISVAIDASGYS---FQLY--SGGI  215

Query  74   FTGYDNTGECGSGYKHAVTIIGY  6
            F+GY     CG+   HAVT+IGY
Sbjct  216  FSGY-----CGNSLNHAVTLIGY  233



>ref|NP_195406.2| cysteine proteinase1 [Arabidopsis thaliana]
 gb|AAK92229.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AEE86713.1| cysteine proteinase1 [Arabidopsis thaliana]
Length=376

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+LISLSEQ+LVDCD + N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  180  GINKIVTGELISLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPYRGFGG  239

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    +R  +I GY++V    E+AL  A++ QPVS  I   GR+ ++ Q     +GI
Sbjct  240  KCNSFLKNSRVVSIDGYEDVPTKDETALKKAISYQPVSVAIEAGGRIFQHYQ-----SGI  294

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG CG+   HAV  +GYG
Sbjct  295  F-----TGSCGTNLDHAVVAVGYG  313



>sp|Q94B08.2|GCP1_ARATH RecName: Full=Germination-specific cysteine protease 1; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB16767.1| cysteine proteinase [Arabidopsis thaliana]
 emb|CAB80354.1| cysteine proteinase [Arabidopsis thaliana]
Length=376

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+LISLSEQ+LVDCD + N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  180  GINKIVTGELISLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPYRGFGG  239

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    +R  +I GY++V    E+AL  A++ QPVS  I   GR+ ++ Q     +GI
Sbjct  240  KCNSFLKNSRVVSIDGYEDVPTKDETALKKAISYQPVSVAIEAGGRIFQHYQ-----SGI  294

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG CG+   HAV  +GYG
Sbjct  295  F-----TGSCGTNLDHAVVAVGYG  313



>ref|XP_009397226.1| PREDICTED: zingipain-2-like [Musa acuminata subsp. malaccensis]
Length=365

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 93/145 (64%), Gaps = 12/145 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITKI TG+LISLSEQQLVDCD +  ++GC GG+   AF+FI  +GG+ +E++YPYE V+
Sbjct  147  GITKIATGKLISLSEQQLVDCDVHGKDQGCQGGDMDAAFEFIVNNGGITSEANYPYEEVQ  206

Query  254  ARCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN        ATI  +++V  + E AL  AVANQPVS GI  D   +   Q Y    G
Sbjct  207  RLCNAHNASFVVATIESHEDVPTNDEKALRKAVANQPVSVGI--DAGSSLDFQFY--SGG  262

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     +GECG+   HAVT++GYG
Sbjct  263  VF-----SGECGTDLDHAVTVVGYG  282



>ref|XP_009357242.1| PREDICTED: ervatamin-B [Pyrus x bretschneideri]
Length=339

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 88/146 (60%), Gaps = 16/146 (11%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG L+SLSEQ+LVDCD N  N GC GG   +AF FIK   GL TE DYPYEG++
Sbjct  157  GINKIKTGNLVSLSEQELVDCDVNSGNEGCSGGFMEKAFSFIK-DNGLSTEDDYPYEGLQ  215

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARY-LQNYPKGN  81
              C+   L+ RA  I+GY+ +   +E +L  AVA+QPVS  I        Y  Q Y   +
Sbjct  216  GTCDEDKLKRRAVNISGYERIPVNNEKSLQAAVAHQPVSVAID----AGSYGFQLY--SS  269

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            GIFTGY     CG    H VT +GYG
Sbjct  270  GIFTGY-----CGKNLNHGVTAVGYG  290



>ref|XP_006446742.1| hypothetical protein CICLE_v10015835mg [Citrus clementina]
 gb|ESR59982.1| hypothetical protein CICLE_v10015835mg [Citrus clementina]
Length=341

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 86/144 (60%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI K+KTG+L+SLSEQ+LVDCD N  N+GC GG   +AF+FI   GG+ TE DYPY G  
Sbjct  157  GINKLKTGKLVSLSEQELVDCDVNSENQGCNGGYMEKAFEFITKIGGVTTEDDYPYRGKN  216

Query  254  ARCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             RC T   ++ A TI GY+ + ASE+ L   V+ QPVS  I   G      Q Y   +G+
Sbjct  217  DRCQTDKTKHHAVTITGYEAIPASENNLQAKVSLQPVSVAIDAGGYA---FQLY--SHGV  271

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F  Y     CG    H VT++GYG
Sbjct  272  FDEY-----CGHQLNHGVTVVGYG  290



>ref|XP_006404274.1| hypothetical protein EUTSA_v10010486mg [Eutrema salsugineum]
 gb|ESQ45727.1| hypothetical protein EUTSA_v10010486mg [Eutrema salsugineum]
Length=361

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP-NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKT +L+SLSEQ+LVDCD   N GC GG    AF+FIK +GG+ TE +YPYEG++ 
Sbjct  161  GINKIKTNKLVSLSEQELVDCDTYQNEGCNGGLMEIAFEFIKKNGGITTEDNYPYEGIDG  220

Query  251  RCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +C+         TI G++ V E  E ALL AVANQPVS  I  D   + + Q Y +  G+
Sbjct  221  KCDASKDNGEVVTIDGHENVPENDEDALLKAVANQPVSVAI--DAGSSNF-QFYSE--GV  275

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FTGY     CG+   H V ++GYG
Sbjct  276  FTGY-----CGTELNHGVAVVGYG  294



>emb|CDP13261.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI KIKTGQL+SLSEQ+LVDC+ +N GC GG    A++FIK SGG+ TE  YPY+  +  
Sbjct  161  GINKIKTGQLVSLSEQELVDCETDNEGCNGGLMENAYEFIKKSGGITTERLYPYKARDGS  220

Query  248  CNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            C++  +   A TI G++ V A+ E+AL+ AVANQPVS  I   G   ++        G++
Sbjct  221  CDSSKMNAPAVTIDGHEMVPANDENALMKAVANQPVSVAIDASGSDMQFYS-----EGVY  275

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
            TG      CG+   H V ++GYG
Sbjct  276  TG----DSCGNELDHGVAVVGYG  294



>emb|CDY48168.1| BnaA06g16650D [Brassica napus]
Length=359

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI +IKT +L+SLSEQ+LVDCD   N+GC GG    AF+FIK +GG+ TE +YPYEG++ 
Sbjct  161  GINQIKTNKLVSLSEQELVDCDTKQNQGCNGGLMDIAFEFIKKNGGITTEDNYPYEGIDG  220

Query  251  RCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +C+         TI G+++V E  E ALL AVANQPVS  I  D   + + Q Y K  G+
Sbjct  221  KCDASKDNGEIVTIDGHEDVPENDEDALLKAVANQPVSVAI--DAGSSNF-QFYSK--GV  275

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FTGY     CG+   H V  +GYG
Sbjct  276  FTGY-----CGTELNHGVAAVGYG  294



>ref|XP_008780645.1| PREDICTED: vignain-like, partial [Phoenix dactylifera]
Length=286

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 89/143 (62%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI +I TG+L SLSEQQLVDCD  N GC GG   +AF+FI  + G+ TE++YPY   +  
Sbjct  105  GIAQISTGKLTSLSEQQLVDCDKKNGGCDGGIMDDAFKFIISNKGITTEANYPYMAKDGT  164

Query  248  CNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            C+T    + AATI+GY++V   SES+LL AVA QPVS  I   G+  ++        G+F
Sbjct  165  CDTNKSSSVAATISGYEDVPRNSESSLLQAVAKQPVSVAIEGSGKDFQFYS-----GGVF  219

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                  G CG+   HAVT++GYG
Sbjct  220  -----MGNCGTDLDHAVTVVGYG  237



>ref|XP_009149829.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2 [Brassica 
rapa]
Length=359

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD-PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI +IKT +L+SLSEQ+LVDCD   N+GC GG    AF+FIK +GG+ TE +YPYEG++ 
Sbjct  161  GINQIKTNKLVSLSEQELVDCDTKQNQGCNGGLMDIAFEFIKKNGGITTEDNYPYEGIDG  220

Query  251  RCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +C+         TI G+++V E  E ALL AVANQPVS  I  D   + + Q Y K  G+
Sbjct  221  KCDASKDNGEIVTIDGHEDVPENDEDALLKAVANQPVSVAI--DAGSSNF-QFYSK--GV  275

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FTGY     CG+   H V  +GYG
Sbjct  276  FTGY-----CGTELNHGVAAVGYG  294



>ref|XP_002988081.1| hypothetical protein SELMODRAFT_183539 [Selaginella moellendorffii]
 gb|EFJ10873.1| hypothetical protein SELMODRAFT_183539 [Selaginella moellendorffii]
Length=425

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI +I TGQL+SLSEQ+L+DCD   ++GC GG    A+QFI  +GGL TE+DYPY   E+
Sbjct  140  GINQIVTGQLVSLSEQELIDCDKKADKGCDGGLMENAYQFIVENGGLDTETDYPYHASES  199

Query  251  RCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN + L +R   I GY+ + E  E ALL+AVA QPVS  I      ++  Q+Y   +G+
Sbjct  200  HCNMKKLNSRVVAIDGYKAIPEGDEQALLLAVAKQPVSVAIE---GASKDFQHY--ASGV  254

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FTG+     CG    H V I+GYG
Sbjct  255  FTGH-----CGEEINHGVLIVGYG  273



>gb|EMT08022.1| Vignain [Aegilops tauschii]
Length=341

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 92/148 (62%), Gaps = 19/148 (13%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI K+ TG+L+SLSEQ+LVDCD +  ++GC GG   +AF+FI  +GGL TE++YPY   +
Sbjct  158  GIVKLSTGKLVSLSEQELVDCDVHGVDQGCEGGEMDDAFKFIIKNGGLTTEANYPYTAQD  217

Query  254  ARCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
             +C T T  N  ATI GY++V A+ ES+L+ AVANQPVS  +  DG           G+ 
Sbjct  218  GQCKTSTTSNSVATIKGYEDVPANDESSLMKAVANQPVSVAV--DG-----------GDV  264

Query  77   IFTGYDN---TGECGSGYKHAVTIIGYG  3
            IF  Y     TG CG+   H +  IGYG
Sbjct  265  IFQHYSGGVMTGSCGTDLDHGIVAIGYG  292



>ref|XP_008349211.1| PREDICTED: zingipain-2-like [Malus domestica]
Length=345

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 91/147 (62%), Gaps = 15/147 (10%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP-NNRGCGGGNRVEAFQFIKGSGGLMTESDYPY---EG  261
            GIT+IKTG+LISLSEQQLV CD  NNRGC GG  V+AF +I  +GG+ +E +YPY   +G
Sbjct  160  GITQIKTGKLISLSEQQLVXCDTDNNRGCQGGWMVBAFAYIXQNGGIXSEENYPYQSLDG  219

Query  260  VEARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKG  84
             E  C+       AA I  Y EV   SE+ LL AV+ QPVS  I     M+   Q+Y   
Sbjct  220  SEGTCDMNKAXEAAARITSYAEVPPNSETDLLKAVSMQPVSVAI----NMSPAFQHY--S  273

Query  83   NGIFTGYDNTGECGSGYKHAVTIIGYG  3
             G+FTG D    CG+   HAVT+IGYG
Sbjct  274  GGVFTGDD----CGTSLDHAVTVIGYG  296



>ref|XP_006655467.1| PREDICTED: cysteine proteinase RD21a-like [Oryza brachyantha]
Length=377

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 88/144 (61%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKTG LISLSEQ+L+DCD + N GCGGG    A++F+  +GG+ TE DYPY   + 
Sbjct  88   GINKIKTGSLISLSEQELIDCDRSYNTGCGGGLMDYAYKFVVKNGGIDTEEDYPYRETDG  147

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN   L+ R  TI GY++V A +E  LL AVA QPVS GI      AR  Q Y K  GI
Sbjct  148  TCNKNKLKRRVVTIDGYKDVPANNEDLLLQAVAQQPVSVGICGS---ARAFQLYSK--GI  202

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F      G C +   HAV I+GYG
Sbjct  203  F-----DGPCPTSLDHAVLIVGYG  221



>ref|XP_009601308.1| PREDICTED: ervatamin-B-like isoform X3 [Nicotiana tomentosiformis]
Length=323

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIK G+LISLSEQ+LVDCD + + GC GG    AF++I  + GL TES+YPYEG++ 
Sbjct  141  GINKIKNGKLISLSEQELVDCDTSWDMGCQGGLMDYAFKYIIKNHGLTTESNYPYEGIDG  200

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T      AA I GY++V A SESAL  AVA+QPVS  I   G   ++       +G+
Sbjct  201  TCKTGKKSKHAAKITGYKDVPANSESALQKAVAHQPVSVAIDASGPDFQFYS-----SGV  255

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT IGYG
Sbjct  256  F-----TGECGTELDHGVTAIGYG  274



>ref|XP_008348586.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG LISLSEQ+LVDCD    ++GC GG   +AFQFI+ + G+ TE++YPYEGV+
Sbjct  161  GITQLTTGTLISLSEQELVDCDTASEDQGCEGGLMDDAFQFIQQNHGIGTEANYPYEGVD  220

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN++   + AA I G+++V A SE  LL AVA+QPVS  I   G   ++       +G
Sbjct  221  GTCNSKKEASHAAKITGFEDVPANSEKDLLAAVAHQPVSVAIDASGSDFQFY-----SSG  275

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  276  VF-----TGTCGTSLDHGVTAVGYG  295



>ref|XP_009601306.1| PREDICTED: ervatamin-B-like isoform X1 [Nicotiana tomentosiformis]
Length=341

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIK G+LISLSEQ+LVDCD + + GC GG    AF++I  + GL TES+YPYEG++ 
Sbjct  159  GINKIKNGKLISLSEQELVDCDTSWDMGCQGGLMDYAFKYIIKNHGLTTESNYPYEGIDG  218

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T      AA I GY++V A SESAL  AVA+QPVS  I   G   ++       +G+
Sbjct  219  TCKTGKKSKHAAKITGYKDVPANSESALQKAVAHQPVSVAIDASGPDFQFYS-----SGV  273

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT IGYG
Sbjct  274  F-----TGECGTELDHGVTAIGYG  292



>gb|AAR92154.1| putative cysteine protease 1 [Iris x hollandica]
Length=340

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ++VDCD   +++GC GG   +AF++I  + G+ TE++YPY+  +
Sbjct  157  GITKLSTGKLISLSEQEVVDCDVTSDDQGCNGGEMDDAFEYIIKNKGITTEANYPYKAAD  216

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   + AA+I GY++V   SE+ALL A ANQP++  I   G  A   Q Y   +G
Sbjct  217  GTCNTKKAASHAASITGYEDVTVNSEAALLKAAANQPIAVAID-AGDFA--FQMY--SSG  271

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG+CG+   H VT++GYG
Sbjct  272  VF-----TGDCGTDLDHGVTLVGYG  291



>ref|XP_009601307.1| PREDICTED: ervatamin-B-like isoform X2 [Nicotiana tomentosiformis]
Length=331

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIK G+LISLSEQ+LVDCD + + GC GG    AF++I  + GL TES+YPYEG++ 
Sbjct  149  GINKIKNGKLISLSEQELVDCDTSWDMGCQGGLMDYAFKYIIKNHGLTTESNYPYEGIDG  208

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C T      AA I GY++V A SESAL  AVA+QPVS  I   G   ++       +G+
Sbjct  209  TCKTGKKSKHAAKITGYKDVPANSESALQKAVAHQPVSVAIDASGPDFQFYS-----SGV  263

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECG+   H VT IGYG
Sbjct  264  F-----TGECGTELDHGVTAIGYG  282



>ref|XP_003539770.1| PREDICTED: vignain-like [Glycine max]
Length=343

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 91/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ TG+LISLSEQ+L+DCD N  N GC  G   EAF+FI  + GL TE+ YPY+ V+
Sbjct  160  GITKLTTGELISLSEQELIDCDTNGDNGGCKWGIIQEAFKFIVQNKGLATEASYPYQAVD  219

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +      A+I GY++V A +E+ALL AVANQPVS  +       R+       +G
Sbjct  220  GTCNAKVESKHVASIKGYEDVPANNETALLNAVANQPVSVLVDSSDYDFRFY-----SSG  274

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +      +G CG+ + HAVT++GYG
Sbjct  275  VL-----SGSCGTTFDHAVTVVGYG  294



>ref|XP_011009172.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Populus 
euphratica]
Length=340

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI K+ TG+LISLSEQ++VDCD    ++GC GG   +AF+FI+ + GL TE++YPY+G  
Sbjct  158  GINKLTTGKLISLSEQEVVDCDTKGEDQGCNGGLMDDAFKFIEKNKGLTTEANYPYKGTH  217

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   N AA I G+++V A SE+AL+ AVA QPVS  I   G   ++       +G
Sbjct  218  GTCNTKKAANHAAKITGFEDVPANSEAALMKAVAKQPVSVAIDAGGYDFQFY-----SSG  272

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            IF     TG CG+   H VT +GYG
Sbjct  273  IF-----TGSCGTQLDHGVTAVGYG  292



>gb|KFK34125.1| hypothetical protein AALP_AA5G104600 [Arabis alpina]
Length=348

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP-NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKT +L+SLSEQ+LVDCD   N GC GG    AF+FIK +GG+ TE +YPYEG++ 
Sbjct  148  GINKIKTNKLVSLSEQELVDCDTYQNEGCNGGLMEIAFEFIKKNGGITTEDNYPYEGIDG  207

Query  251  RCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +C+         TI G+++V E  ESALL AVANQPVS  I  D   + + Q Y K  G+
Sbjct  208  KCDASKDNGVIVTIDGHEDVPENDESALLKAVANQPVSVAI--DAGSSNF-QFYSK--GV  262

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   H V  +GYG
Sbjct  263  F-----TGQCGTELNHGVAAVGYG  281



>emb|CDP18641.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI ++KTG+LISLSEQ+LVDCD    ++GC GG   +AF FI  + GL TE++YPY+ V+
Sbjct  155  GIHQLKTGKLISLSEQELVDCDTAGEDQGCNGGLMDDAFTFIINNKGLTTEANYPYQAVD  214

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT      AA I G+++V A +E+ALL AVANQPVS  I   G   ++       +G
Sbjct  215  GTCNTNKEAKPAAKITGFEDVPANNEAALLKAVANQPVSVAIDASGSAFQFY-----SSG  269

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG+CG+   H VT +GYG
Sbjct  270  VF-----TGDCGTELDHGVTAVGYG  289



>ref|XP_010682353.1| PREDICTED: vignain-like [Beta vulgaris subsp. vulgaris]
Length=357

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 86/143 (60%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI +IKT QL+SLSEQ+LVDCD +N GC GG    AF +IK SGG++ E+ YPYE     
Sbjct  160  GINQIKTKQLLSLSEQELVDCDHDNYGCEGGLVEHAFSYIKKSGGVVAETTYPYEAKNDI  219

Query  248  CNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            CN+         I GY+ V E  E+ALL AVANQPVS  I   G     LQ Y    G+F
Sbjct  220  CNSAKANAPVVKIDGYEVVPENDENALLKAVANQPVSVAIDASGSD---LQFY--SEGVF  274

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 +GECG+   HAVT +GYG
Sbjct  275  -----SGECGTDLDHAVTAVGYG  292



>gb|ABF70145.1| cysteine protease, putative [Musa acuminata]
Length=373

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 93/145 (64%), Gaps = 12/145 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITKI TG+LISLSEQQLVDCD +  ++GC GG+   AF+FI  +GG+ +E++YPYE V+
Sbjct  155  GITKIVTGKLISLSEQQLVDCDVHGKDQGCQGGDMDAAFEFIVNNGGITSEANYPYEEVQ  214

Query  254  ARCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN        ATI  +++V  + E AL  AVANQPVS GI  D   +   Q Y    G
Sbjct  215  RLCNAHNASFVVATIESHEDVPTNDEKALRKAVANQPVSVGI--DAGSSLDFQLYS--GG  270

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     +GECG+   HAVT++GYG
Sbjct  271  VF-----SGECGTDLDHAVTVVGYG  290



>ref|XP_002305072.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
 gb|EEE85583.2| hypothetical protein POPTR_0004s05520g [Populus trichocarpa]
Length=340

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 93/143 (65%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI K++TG LISLSEQQLVDC   N+GC GG+   AFQ+I  +GGL +E +YPY+GV+  
Sbjct  159  GIIKLQTGNLISLSEQQLVDCTAGNKGCQGGHMDTAFQYIIRNGGLTSEDNYPYQGVDGT  218

Query  248  CNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            C+++   +  A I GY++V + +E+ALL AVA QPVS  +   G   ++ +     +G+F
Sbjct  219  CSSEKAASTEAQITGYEDVPQNNENALLQAVAKQPVSVAVEGGGHDFQFYK-----SGVF  273

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                  G+CG+   HAVT IGYG
Sbjct  274  -----EGDCGTNLNHAVTAIGYG  291



>ref|XP_006830175.1| hypothetical protein AMTR_s00374p00012080 [Amborella trichopoda]
 gb|ERM97591.1| hypothetical protein AMTR_s00374p00012080 [Amborella trichopoda]
Length=337

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 95/144 (66%), Gaps = 13/144 (9%)
 Frame = -2

Query  425  ITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            ITKIKTG L+SLSEQ+++DC     +RGC  G   EAF+FI  +GGL  E+DYPY+ ++ 
Sbjct  159  ITKIKTGNLVSLSEQEVLDCVTGGVSRGCISGLMGEAFRFIINNGGLARETDYPYQSIQG  218

Query  251  RCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             C+ Q   ++A TI GY+ +    E +LL+AVANQPVS GI  DG    + ++Y +  G+
Sbjct  219  TCDAQKSSSKAGTITGYERILSGDEDSLLLAVANQPVSVGI--DGSGFEF-KHYSE--GV  273

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG+CG+   HAVTIIGYG
Sbjct  274  F-----TGDCGTQMNHAVTIIGYG  292



>ref|XP_009354269.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=333

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            G+T++ TG+LISLSEQ+LVDCD    ++GC GG   +AFQFI+ + G+ TE++YPY GV+
Sbjct  150  GVTQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTETNYPYNGVD  209

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+     AA I G+++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  210  GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFY-----SSG  264

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  265  VF-----TGTCGTSLDHGVTAVGYG  284



>ref|XP_002446128.1| hypothetical protein SORBIDRAFT_06g002110 [Sorghum bicolor]
 gb|EES10456.1| hypothetical protein SORBIDRAFT_06g002110 [Sorghum bicolor]
Length=186

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 90/145 (62%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            G  KI TG+L+SLSEQ+LVDCD N  ++GC GG   +AF+F+  +GGL TES YPY G +
Sbjct  3    GAVKISTGKLVSLSEQELVDCDVNGMDQGCEGGEMDDAFEFVVDNGGLTTESKYPYTGSD  62

Query  254  ARCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN+   +N AA+I GY++V A+ E++L  AVANQPVS  +     + R+ +      G
Sbjct  63   GNCNSDEAKNDAASITGYEDVPANDETSLRKAVANQPVSVAVDGGDNLFRFYK-----GG  117

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +      +G CG+   H +  +GYG
Sbjct  118  VL-----SGACGTELDHGIAAVGYG  137



>gb|EAY98636.1| hypothetical protein OsI_20560 [Oryza sativa Indica Group]
Length=449

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 89/144 (62%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKTG LISLSEQ+L+DCD + N GCGGG    A++F+  +GG+ TE+DYPY   + 
Sbjct  160  GINKIKTGSLISLSEQELIDCDRSYNSGCGGGLMDYAYKFVVKNGGIDTEADYPYRETDG  219

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN   L+ R  TI GY++V A +E  LL AVA QPVS GI      AR  Q Y K  GI
Sbjct  220  TCNKNKLKRRVVTIDGYKDVPANNEDMLLQAVAQQPVSVGIC---GSARAFQLYSK--GI  274

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F      G C +   HA+ I+GYG
Sbjct  275  F-----DGPCPTSLDHAILIVGYG  293



>ref|NP_001055994.1| Os05g0508300 [Oryza sativa Japonica Group]
 gb|AAT44258.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF17908.1| Os05g0508300 [Oryza sativa Japonica Group]
Length=450

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 89/144 (62%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KIKTG LISLSEQ+L+DCD + N GCGGG    A++F+  +GG+ TE+DYPY   + 
Sbjct  161  GINKIKTGSLISLSEQELIDCDRSYNSGCGGGLMDYAYKFVVKNGGIDTEADYPYRETDG  220

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
             CN   L+ R  TI GY++V A +E  LL AVA QPVS GI      AR  Q Y K  GI
Sbjct  221  TCNKNKLKRRVVTIDGYKDVPANNEDMLLQAVAQQPVSVGIC---GSARAFQLYSK--GI  275

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F      G C +   HA+ I+GYG
Sbjct  276  F-----DGPCPTSLDHAILIVGYG  294



>ref|XP_008362418.1| PREDICTED: vignain-like [Malus domestica]
Length=198

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 91/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ LVDCD    ++GC GG   +AFQF + + G+ TE +YPY+GV+
Sbjct  15   GITQLTTGKLISLSEQXLVDCDTAGEDQGCEGGLMDBAFQFXQQNHGISTEXNYPYBGVD  74

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+     AA I G+++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  75   GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYS-----SG  129

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  130  VF-----TGTCGTSLDHGVTAVGYG  149



>ref|XP_004505522.1| PREDICTED: KDEL-tailed cysteine endopeptidase CEP2-like [Cicer 
arietinum]
Length=343

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 91/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNN--RGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI KIKTG+L+SLSEQ+LVDCD  N  +GC GG    AF FI  +GGL TE +YPYEGV+
Sbjct  161  GIHKIKTGELVSLSEQELVDCDVKNGNQGCEGGLMETAFTFIVKNGGLTTEKEYPYEGVD  220

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   + A +I+GY+EV A +E+ L  A ++QPVS  I   G      Q Y +  G
Sbjct  221  GTCNKEKAAHHAVSISGYEEVPAENEAKLKAAASHQPVSVAIDAGGYS---FQLYSE--G  275

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F+G      CG    HAVT++GYG
Sbjct  276  VFSGI-----CGKQLNHAVTVVGYG  295



>ref|XP_008353750.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=344

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            G+T++ TG+LISLSEQ+LVDCD    ++GC GG   +AFQFI+ + G+ TE++YPY GV+
Sbjct  161  GVTQLTTGRLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTETNYPYNGVD  220

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+     AA I G+++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  221  GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFY-----SSG  275

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  276  VF-----TGTCGTSLDHGVTAVGYG  295



>ref|XP_009354268.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            G+T++ TG+LISLSEQ+LVDCD    ++GC GG   +AFQFI+ + G+ TE++YPY GV+
Sbjct  161  GVTQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTETNYPYNGVD  220

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+     AA I G+++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  221  GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFY-----SSG  275

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  276  VF-----TGTCGTSLDHGVTAVGYG  295



>ref|XP_006411912.1| hypothetical protein EUTSA_v10025483mg [Eutrema salsugineum]
 gb|ESQ53365.1| hypothetical protein EUTSA_v10025483mg [Eutrema salsugineum]
Length=376

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+L+SLSEQ+LVDCD + N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  181  GINKIVTGELVSLSEQELVDCDRSYNQGCNGGLMDYAFQFIMKNGGLNTEQDYPYRGSNG  240

Query  251  RCNTQTLRN-RAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
            +CN+   +N R  +I GY++V   +E AL  AV+ QPVS  I   GR+ ++ Q     +G
Sbjct  241  KCNSLVKKNSRVVSIDGYEDVPTKNEMALKRAVSYQPVSVAIEAGGRVFQHYQ-----SG  295

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            IF     TG+CG+   HAV  +GYG
Sbjct  296  IF-----TGKCGTNMDHAVVAVGYG  315



>ref|XP_004291399.1| PREDICTED: cysteine proteinase RD21a-like [Fragaria vesca subsp. 
vesca]
Length=441

 Score =   121 bits (303),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 74/146 (51%), Positives = 88/146 (60%), Gaps = 15/146 (10%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD---PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGV  258
            GI KI TG L+SLSEQ+L+DCD   PN+ GC GG   +AFQFI  + G+ TE DYPY+G 
Sbjct  152  GINKIVTGSLVSLSEQELIDCDRVYPNS-GCNGGLMDDAFQFIIDNNGIDTEEDYPYQGA  210

Query  257  EARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGN  81
            +  CN Q L+    TI GY +V A +E  LL AVA QPVS GI   G   R  Q Y K  
Sbjct  211  DGTCNKQKLKRHVVTIDGYTDVPANNEEQLLKAVATQPVSVGIAGSG---REFQFYSK--  265

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            GIF      G C +   HAV I+GYG
Sbjct  266  GIF-----AGPCSTTLDHAVLIVGYG  286



>ref|XP_008342777.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ LVDCD    ++GC GG   +AFQFI+ + G+ TE++YPY GV+
Sbjct  150  GITQLTTGKLISLSEQXLVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTEANYPYNGVD  209

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+     AA I G+++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  210  GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYS-----SG  264

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  265  VF-----TGTCGTSLDHGVTAVGYG  284



>ref|XP_004506025.1| PREDICTED: vignain-like [Cicer arietinum]
Length=342

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+ +G+L+SLSEQ+LVDCD    ++GC GG   +AF+F+  + GL TE  YPY+GV+
Sbjct  159  GITKLSSGKLVSLSEQELVDCDIKGVDQGCEGGLMDDAFKFMLQNKGLTTEVVYPYQGVD  218

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   N  A+I GY++V A SESALL AVANQP+S  I   G   ++       +G
Sbjct  219  GTCNAKAEGNHVASIKGYEDVPANSESALLKAVANQPISVAIDASGSEFQFY-----SSG  273

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  274  VF-----TGTCGTELDHGVTAVGYG  293



>gb|EYU34557.1| hypothetical protein MIMGU_mgv1a007408mg [Erythranthe guttata]
Length=408

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 87/143 (61%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+L++LSEQ+LVDCD + N GC GG    AFQFI  +GG+ TE DYPY G++ 
Sbjct  169  GINKITTGELLTLSEQELVDCDKSENAGCSGGLMDYAFQFIISNGGMDTEDDYPYRGIDG  228

Query  251  RCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            +C+      +  +I GY++V   E AL  AVA+QPVS  I   GR    LQ Y   +G+F
Sbjct  229  KCDFARKNAKVVSIDGYEDVPQDEKALQKAVAHQPVSVAIEASGRA---LQLY--SSGVF  283

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 TGECG    H V  +GYG
Sbjct  284  -----TGECGKQLDHGVVAVGYG  301



>ref|XP_008803660.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
 ref|XP_008812192.1| PREDICTED: ervatamin-B-like [Phoenix dactylifera]
Length=338

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 90/143 (63%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI +I TG+L SLSEQQLVDCD  N GCGGG   +AF++I  + G+ TE++YPY   E  
Sbjct  157  GIAQISTGKLTSLSEQQLVDCDKVNGGCGGGIMDDAFKYIISNKGITTEANYPYVAKEGT  216

Query  248  CNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            C+T    + AATI+GY++V   SES+LL AVA QPVS  I   G+  ++          +
Sbjct  217  CDTNKSSSVAATISGYEDVPRNSESSLLQAVAKQPVSVAIEGSGKDFQF----------Y  266

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
            +G    G CG+   HAVT++GYG
Sbjct  267  SGDVFMGNCGTDLDHAVTVVGYG  289



>ref|XP_008244499.1| PREDICTED: ervatamin-B-like [Prunus mume]
Length=345

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+L+SLSEQ+LVDCD    ++GC GG   +AFQFI+ + GL TE++YPY GV+
Sbjct  162  GITQLTTGKLVSLSEQELVDCDTKGVDQGCEGGLMDDAFQFIQQNHGLSTEANYPYNGVD  221

Query  254  ARCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+   N AA I  +++V A+ E ALL AVA+QPVS  I   G   ++       +G
Sbjct  222  GTCNTKKEANIAAKITDHEDVPANDEKALLNAVAHQPVSVAIDASGSDFQFY-----SSG  276

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  277  VF-----TGTCGTSLDHGVTAVGYG  296



>ref|XP_011097243.1| PREDICTED: cysteine proteinase COT44 [Sesamum indicum]
Length=371

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 88/143 (62%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI +I TG++I+LSEQ+LVDCD   N GC GG    AFQFI  +GG+ TE+DYPY G++ 
Sbjct  172  GINQIVTGEMITLSEQELVDCDKTENAGCNGGLMDYAFQFIISNGGMDTEADYPYRGLDG  231

Query  251  RCNTQTLRNRAATIAGYQEVEASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            RC+      +  +I G+++V   E AL  AVA+QPVS  I   GR    LQ Y   +G+F
Sbjct  232  RCDPTRKNAKVVSIDGFEDVPHDERALQKAVAHQPVSVAIEASGRA---LQLY--SSGVF  286

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
                 TGECGS   H V  +GYG
Sbjct  287  -----TGECGSQLDHGVVAVGYG  304



>ref|XP_009354321.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=393

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            G+T++ TG+LISLSEQ+LVDCD    ++GC GG   +AFQFI+ + G+ TE++YPY GV+
Sbjct  210  GVTQLTTGKLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTETNYPYNGVD  269

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+     AA I G+++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  270  GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFY-----SSG  324

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  325  VF-----TGTCGTSLDHGVTAVGYG  344



>gb|KDP45355.1| hypothetical protein JCGZ_09604 [Jatropha curcas]
Length=311

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 90/145 (62%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GITK+KTG LISLSEQ+LVDCD    + GC GG    AFQ+I  +GGL +E++YPY+G +
Sbjct  128  GITKLKTGNLISLSEQELVDCDVAGEDYGCDGGFMDTAFQYILKNGGLTSEANYPYQGED  187

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              C+ +      A I GY++V + SE ALL AVANQPVS  I   G   R+       +G
Sbjct  188  GICSKKKTATSMAKITGYEDVPSNSEKALLQAVANQPVSVAIDASGYDFRFYS-----SG  242

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F      G+C +   HAVT+IGYG
Sbjct  243  VF-----KGDCPTDLNHAVTVIGYG  262



>ref|XP_007048674.1| Senescence-associated gene 12 [Theobroma cacao]
 gb|EOX92831.1| Senescence-associated gene 12 [Theobroma cacao]
Length=344

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 88/145 (61%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI  I TG+LISLSEQ+LVDCD    ++GC GG   +AF+FI+   GL TE+DYPY GV+
Sbjct  161  GINMITTGKLISLSEQELVDCDTKGEDQGCQGGLMDDAFKFIQKIQGLTTETDYPYRGVD  220

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT    N AA I GY++V A SE+ LL AVANQPVS  I   G   ++        G
Sbjct  221  GTCNTNKEANHAAKINGYEDVPANSETVLLKAVANQPVSVAIDAGGFEFQFY-----SGG  275

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            IF     TG C +   H VT +GYG
Sbjct  276  IF-----TGACETQLDHGVTAVGYG  295



>ref|XP_009357171.1| PREDICTED: ervatamin-B-like [Pyrus x bretschneideri]
Length=344

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCD--PNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG LISLSEQ+LVDCD    ++GC GG   +AFQFI+ + G+ TE++YPYEGV+
Sbjct  161  GITQLTTGTLISLSEQELVDCDTASEDQGCEGGLMDDAFQFIQQNHGISTEANYPYEGVD  220

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   + AA I G+++V A SE  LL AVA+QPVS  I   G   ++       +G
Sbjct  221  GTCNAKKEASHAAKITGFEDVPANSEKDLLAAVAHQPVSVAIDASGSDFQFY-----SSG  275

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     +G CG+   H VT +GYG
Sbjct  276  VF-----SGTCGTSLDHGVTAVGYG  295



>ref|XP_008342776.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            G+T++ TG LISLSEQ+LVDCD    ++GC GG   +AFQFI+ + G+ TE +YPY+GV+
Sbjct  150  GVTQLTTGXLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTEXNYPYBGVD  209

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+     AA I G+++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  210  GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFY-----SSG  264

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  265  VF-----TGTCGTSLDHGVTAVGYG  284



>ref|XP_008342782.1| PREDICTED: ervatamin-B-like [Malus domestica]
Length=333

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ LVDCD    ++GC GG   +AFQFI+ + G+ TE++YPY+GV+
Sbjct  150  GITQLTTGKLISLSEQVLVDCDTAGEDQGCEGGLMDBAFQFIQQNHGISTEANYPYBGVD  209

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+     AA I G+++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  210  GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYS-----SG  264

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  265  VF-----TGTCGTSLDHGVTAVGYG  284



>ref|XP_009372437.1| PREDICTED: cysteine proteinase COT44-like [Pyrus x bretschneideri]
Length=366

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI +I TG+L+SLSEQ+LVDCD + N GC GG    AF+FI  +GG+ TESDYPY+  + 
Sbjct  162  GINQIVTGELVSLSEQELVDCDRSYNAGCNGGLMDYAFEFIIQNGGMDTESDYPYKAYDQ  221

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN     N+  +I GY++V +  E+AL  AVA+QPVS  I   GR  +  Q     +G+
Sbjct  222  KCNVALENNKVVSIDGYEDVPSYDENALKKAVAHQPVSVAIEAGGRALQLYQ-----SGV  276

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECGS   H V  +GYG
Sbjct  277  F-----TGECGSALDHGVVAVGYG  295



>gb|AAP32196.1| cysteine protease 8 [Trifolium repens]
Length=343

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 90/145 (62%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GI K+ TG+LISLSEQ+LVDCD    ++GC GG   +AF+FI  + GL TE+ YPYEGV+
Sbjct  160  GIHKLSTGKLISLSEQELVDCDTKGVDQGCEGGLMDDAFKFIIQNHGLSTEAQYPYEGVD  219

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN      +A TI GY++V A SE AL  AVANQP+S  I   G   ++ +     +G
Sbjct  220  GTCNANKASVQAVTITGYEDVPANSEQALQKAVANQPISVAIDASGSDFQFYK-----SG  274

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  275  VF-----TGSCGTELDHGVTAVGYG  294



>ref|XP_008362421.1| PREDICTED: LOW QUALITY PROTEIN: ervatamin-B-like [Malus domestica]
Length=344

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 91/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDP--NNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG LISLSEQ+LVDCD    ++GC GG   +AFQFI+ + G+ TE +YPY GV+
Sbjct  161  GITQLTTGNLISLSEQELVDCDTAGEDQGCEGGLMDDAFQFIQQNHGISTEXNYPYNGVD  220

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CNT+     AA I G+++V A SE ALL AVA+QPVS  I   G   ++       +G
Sbjct  221  GTCNTKKEAIIAAKITGFEDVPANSEKALLTAVAHQPVSVAIDASGSDFQFYS-----SG  275

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  276  VF-----TGTCGTSLDHGVTAVGYG  295



>ref|XP_004306851.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=340

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD N  ++GC GG    AF+FI  + GL TE++YPY GV+
Sbjct  157  GITQLTTGKLISLSEQELVDCDVNGEDQGCEGGLMDNAFEFINQNHGLSTEANYPYTGVD  216

Query  254  ARCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +   N AA+I G+++V  + ESAL  AVANQP+S  I   G   ++       +G
Sbjct  217  GTCNAKKEANHAASITGHEDVPPNDESALQKAVANQPISVAIDASGSGFQFY-----SSG  271

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  272  VF-----TGPCGTSLDHGVTAVGYG  291



>gb|AAT34987.1| putative cysteine protease [Gossypium hirsutum]
Length=344

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 91/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT+I TG+LISLSEQ+LVDCD    + GC GG    AF+FI  +GGL TES+YPY+G +
Sbjct  161  GITQISTGKLISLSEQELVDCDTKGIDHGCEGGLMDTAFEFIINNGGLTTESNYPYKGED  220

Query  254  ARCNTQTLRNRAATIAGYQEVEAS-ESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN       A +I GY++V A+ E AL+ AVA+QPVS  I   G   ++       +G
Sbjct  221  GTCNFNKTNPIAVSITGYEDVPANDEQALMKAVAHQPVSVAIEAGGSDFQFY-----SSG  275

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TGECG+   HAVT +GYG
Sbjct  276  VF-----TGECGTELDHAVTAVGYG  295



>ref|XP_010052198.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76120.1| hypothetical protein EUGRSUZ_D00497 [Eucalyptus grandis]
Length=345

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 90/146 (62%), Gaps = 17/146 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GIT I+ G+L+ LS Q+LVDCD N+ GCGGG     F+FI  +GGL TE++YP +G +  
Sbjct  162  GITMIRKGKLVPLSVQELVDCDDNDEGCGGGLVDCVFKFIVSNGGLTTEANYPCQGNKGT  221

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            CNT      AA+I GYQ+V A +E ALL AVANQPVS  I    FD       Q Y   +
Sbjct  222  CNTAKAATPAASITGYQDVPANNEKALLQAVANQPVSVAIEGGGFD------FQFY--SS  273

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            G+F     TG CG+   HAVT +GYG
Sbjct  274  GVF-----TGSCGTDIDHAVTAVGYG  294



>ref|XP_010054322.1| PREDICTED: ervatamin-B-like [Eucalyptus grandis]
 gb|KCW76126.1| hypothetical protein EUGRSUZ_D00502 [Eucalyptus grandis]
Length=345

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 89/146 (61%), Gaps = 17/146 (12%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GIT IK  +L+ LS Q+LVDCD N+ GC GG    AF+FI  +GGL TE++YPY+  +  
Sbjct  162  GITMIKKRKLVPLSVQELVDCDDNDDGCIGGLMDSAFEFIVSNGGLTTEANYPYQENKGT  221

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGIT---FDGRMARYLQNYPKGN  81
            CNT    N AA+I GY++V A +E ALL AVANQPVS  I    FD       Q Y    
Sbjct  222  CNTAKAANPAASITGYKDVPANNEKALLQAVANQPVSVAIEGGGFD------FQFY--ST  273

Query  80   GIFTGYDNTGECGSGYKHAVTIIGYG  3
            G+F     TG CG+   HAVT +GYG
Sbjct  274  GVF-----TGSCGTDIDHAVTAVGYG  294



>ref|XP_010679531.1| PREDICTED: cysteine proteinase COT44-like [Beta vulgaris subsp. 
vulgaris]
Length=371

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 89/144 (62%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
             I +I TG + SLSEQ+LVDCD   ++GC GG    AFQFI  +GGL TE DYPY+GV+ 
Sbjct  168  AINQIVTGNMTSLSEQELVDCDRVVDQGCNGGLMDNAFQFILENGGLDTEQDYPYKGVDG  227

Query  251  RCNTQTLRNRAATIAGYQEV-EASESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +C+     N+  TI GY++V   SE AL  AVA+QPVS  I   GR  +  Q     +G+
Sbjct  228  QCDLNRKNNKVVTIDGYEDVLPYSEKALKKAVAHQPVSVAIEASGRALQLYQ-----SGV  282

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            FTG+     CG+   HAV ++GYG
Sbjct  283  FTGH-----CGTSLDHAVVVVGYG  301



>ref|XP_008383642.1| PREDICTED: zingipain-1-like [Malus domestica]
Length=341

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 88/143 (62%), Gaps = 11/143 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPNNRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEAR  249
            GI +IKT +LISLSEQQLV+CD +N GC GG  V AF +I+ + G+ +E +YPY+ +E  
Sbjct  160  GIIQIKTDKLISLSEQQLVNCDTDNNGCQGGWMVNAFAYIQRNXGITSEENYPYQSLEGT  219

Query  248  CNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGIF  72
            C+T      AA I  Y EV   SE+ LL AV+ QPVS  I      +   Q+Y    G+F
Sbjct  220  CDTNKENEAAAQITSYAEVPPNSETDLLKAVSMQPVSVSI----HASPAFQHY--SGGVF  273

Query  71   TGYDNTGECGSGYKHAVTIIGYG  3
            TG D    CG+   HAVTIIGYG
Sbjct  274  TGDD----CGTELNHAVTIIGYG  292



>ref|XP_004308524.1| PREDICTED: vignain-like [Fragaria vesca subsp. vesca]
Length=341

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN--NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVE  255
            GIT++ TG+LISLSEQ+LVDCD N  ++GC GG   +AFQF+  + G+ TE++YPY   +
Sbjct  158  GITQLTTGKLISLSEQELVDCDVNGVDQGCSGGLMDDAFQFVIQNHGINTEANYPYTAAD  217

Query  254  ARCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNG  78
              CN +     AATI G+++V A SESALL AVANQP+S  I   G      Q Y   +G
Sbjct  218  GTCNAKKAAGHAATITGHEDVPANSESALLKAVANQPISVAIDASGYD---FQLY--SSG  272

Query  77   IFTGYDNTGECGSGYKHAVTIIGYG  3
            +F     TG CG+   H VT +GYG
Sbjct  273  VF-----TGTCGTELDHGVTAVGYG  292



>gb|AFR11773.1| cysteine protease [Fragaria x ananassa]
Length=354

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 89/144 (62%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+L+SLSEQ+LVDCD   N GC GG    AF+FI  +GG+ TESDYPY+ V  
Sbjct  159  GINKIATGELVSLSEQELVDCDRKYNAGCNGGLMDYAFEFIIKNGGMDTESDYPYKAVNQ  218

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +C+     N+  TI GY++V A +E AL  AVA+QPVS  I   G     LQ Y   +G+
Sbjct  219  QCDASLENNKVVTIDGYEDVPAFNEEALKKAVAHQPVSVAIEAGGVA---LQLY--DSGV  273

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TGECGS   H V  +GYG
Sbjct  274  F-----TGECGSALDHGVVAVGYG  292



>ref|XP_010510777.1| PREDICTED: ervatamin-B-like [Camelina sativa]
Length=350

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 93/147 (63%), Gaps = 15/147 (10%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GITKI  GQL+SLSEQQL+DCD + N+GC GG   +AF++I  + G+ TE +YPY+  E 
Sbjct  165  GITKITKGQLVSLSEQQLLDCDRDYNQGCRGGIMSKAFEYIIKNQGITTEDNYPYQESEQ  224

Query  251  RCN---TQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKG  84
             C+   TQ+   RAATI+GY+ V   +E ALL AV+ QPVS GI   G   R+       
Sbjct  225  TCSSATTQSSSFRAATISGYETVPMNNEEALLQAVSQQPVSVGIEGSGAAFRHY-----S  279

Query  83   NGIFTGYDNTGECGSGYKHAVTIIGYG  3
             G+F      GECG+   HAVTI+GYG
Sbjct  280  GGVF-----DGECGTDLHHAVTIVGYG  301



>dbj|BAF00916.1| cysteine proteinase [Arabidopsis thaliana]
Length=376

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 89/144 (62%), Gaps = 12/144 (8%)
 Frame = -2

Query  428  GITKIKTGQLISLSEQQLVDCDPN-NRGCGGGNRVEAFQFIKGSGGLMTESDYPYEGVEA  252
            GI KI TG+LISLSEQ+LVDCD + N+GC GG    AFQFI  +GGL TE DYPY G   
Sbjct  180  GINKIVTGELISLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPYRGFGG  239

Query  251  RCNTQTLRNRAATIAGYQEVEA-SESALLVAVANQPVSAGITFDGRMARYLQNYPKGNGI  75
            +CN+    +R  +I GY++V    E+AL  A++ QPV   I   GR+ ++ Q     +GI
Sbjct  240  KCNSFLKNSRVVSIDGYEDVPTKDETALKKAISYQPVRVAIEAGGRIFQHYQ-----SGI  294

Query  74   FTGYDNTGECGSGYKHAVTIIGYG  3
            F     TG CG+   HAV  +GYG
Sbjct  295  F-----TGSCGTNLDHAVVAVGYG  313



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507223292940