BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24042_g1_i2 len=1169 path=[1423:0-472 193:473-509 230:510-553
78:554-579 104:580-613 3470:614-618 3475:619-717 3126:718-737
2155:738-796 2688:797-827 2245:828-892 2310:893-1168]

Length=1169
                                                                      Score     E

emb|CAD20555.1|  tropinone reductase I                                  462   7e-160   Calystegia sepium
sp|P50165.1|TRNH_DATST  RecName: Full=Tropinone reductase homolog...    378   1e-126   Datura stramonium [common thornapple]
ref|XP_006429154.1|  hypothetical protein CICLE_v10012494mg             368   9e-123   
ref|XP_006493560.1|  PREDICTED: tropinone reductase homolog             368   1e-122   
ref|XP_010654243.1|  PREDICTED: tropinone reductase homolog             365   9e-122   
ref|XP_006493561.1|  PREDICTED: tropinone reductase homolog             363   6e-121   
emb|CBI30508.3|  unnamed protein product                                363   1e-120   
ref|XP_006429155.1|  hypothetical protein CICLE_v10012221mg             363   3e-120   
emb|CBI30506.3|  unnamed protein product                                360   1e-119   
ref|XP_002271837.2|  PREDICTED: tropinone reductase homolog             359   5e-119   Vitis vinifera
ref|XP_009621668.1|  PREDICTED: tropinone reductase homolog             358   7e-119   
ref|XP_006355361.1|  PREDICTED: tropinone reductase homolog             358   8e-119   
ref|XP_006493568.1|  PREDICTED: tropinone reductase homolog isofo...    357   2e-118   
ref|XP_004237405.1|  PREDICTED: tropinone reductase homolog             354   2e-117   
ref|XP_006493569.1|  PREDICTED: tropinone reductase homolog isofo...    353   4e-117   
ref|XP_006493570.1|  PREDICTED: tropinone reductase homolog             353   4e-117   
ref|XP_006429160.1|  hypothetical protein CICLE_v10012493mg             353   4e-117   
ref|XP_004246428.1|  PREDICTED: tropinone reductase homolog isofo...    353   6e-117   
ref|XP_006429157.1|  hypothetical protein CICLE_v10012496mg             352   1e-116   
ref|XP_006341006.1|  PREDICTED: tropinone reductase 1-like              352   2e-116   
gb|KDO52384.1|  hypothetical protein CISIN_1g024752mg                   350   7e-116   
ref|XP_006341201.1|  PREDICTED: tropinone reductase homolog             345   5e-114   
gb|AFP55030.1|  tropinone reductase I                                   345   1e-113   
ref|XP_008222026.1|  PREDICTED: tropinone reductase homolog At1g0...    343   3e-113   
ref|XP_006493567.1|  PREDICTED: tropinone reductase homolog             343   3e-113   
ref|XP_010920509.1|  PREDICTED: tropinone reductase homolog             343   3e-113   
gb|AIN39992.1|  tropinone reductase I                                   342   9e-113   
emb|CAQ19734.1|  putative tropinone reductase I                         341   3e-112   Solanum nigrum subsp. nigrum
gb|AGY46257.1|  tropinone reductase I                                   341   4e-112   
sp|P50162.1|TRN1_DATST  RecName: Full=Tropinone reductase 1; AltN...    340   6e-112   Datura stramonium [common thornapple]
ref|XP_006341200.1|  PREDICTED: tropinone reductase homolog             340   8e-112   
ref|XP_009630417.1|  PREDICTED: tropinone reductase 1-like              339   1e-111   
ref|NP_001275290.1|  tropinone reductase 1-like                         339   2e-111   
gb|AGL76989.1|  tropinone reductase I                                   339   2e-111   
ref|XP_004246864.1|  PREDICTED: tropinone reductase homolog             338   2e-111   
ref|XP_009375951.1|  PREDICTED: tropinone reductase homolog At1g0...    338   2e-111   
gb|AGB56644.1|  tropinone reductase I                                   338   3e-111   
gb|EYU19938.1|  hypothetical protein MIMGU_mgv1a012090mg                338   4e-111   
ref|XP_009421329.1|  PREDICTED: tropinone reductase homolog             338   4e-111   
ref|XP_007205726.1|  hypothetical protein PRUPE_ppa010064mg             338   5e-111   
gb|ACB71202.1|  tropinone reductase I                                   338   7e-111   Anisodus acutangulus
ref|XP_002520507.1|  tropinone reductase, putative                      337   1e-110   Ricinus communis
ref|XP_010033094.1|  PREDICTED: tropinone reductase homolog At1g0...    337   1e-110   
ref|XP_008222016.1|  PREDICTED: tropinone reductase homolog At1g0...    336   2e-110   
dbj|BAA13547.1|  tropinone reductase-I                                  336   3e-110   Hyoscyamus niger [black henbane]
ref|XP_010033096.1|  PREDICTED: tropinone reductase homolog At1g0...    337   3e-110   
ref|XP_009794560.1|  PREDICTED: tropinone reductase homolog             336   3e-110   
ref|XP_004249378.1|  PREDICTED: tropinone reductase 1 isoform X2        335   4e-110   
emb|CAB88214.1|  putative tropinone reductase                           335   6e-110   Solanum tuberosum [potatoes]
ref|XP_009772417.1|  PREDICTED: tropinone reductase homolog             335   6e-110   
ref|XP_010256814.1|  PREDICTED: tropinone reductase homolog At1g0...    335   8e-110   
ref|XP_006424908.1|  hypothetical protein CICLE_v10029047mg             335   1e-109   
gb|AIN39993.1|  tropinone reductase I                                   334   2e-109   
ref|XP_008801625.1|  PREDICTED: tropinone reductase homolog At1g0...    337   2e-109   
ref|XP_002308174.2|  hypothetical protein POPTR_0006s09080g             333   3e-109   Populus trichocarpa [western balsam poplar]
ref|XP_006344593.1|  PREDICTED: tropinone reductase homolog             335   4e-109   
ref|XP_010521894.1|  PREDICTED: tropinone reductase homolog At1g0...    333   5e-109   
ref|XP_011006388.1|  PREDICTED: tropinone reductase homolog             333   5e-109   
ref|XP_010033099.1|  PREDICTED: tropinone reductase homolog At1g0...    333   8e-109   
ref|XP_002277835.1|  PREDICTED: tropinone reductase homolog At1g0...    332   8e-109   Vitis vinifera
ref|XP_006424909.1|  hypothetical protein CICLE_v10029051mg             332   8e-109   
ref|XP_009375952.1|  PREDICTED: tropinone reductase homolog At1g0...    332   1e-108   
ref|XP_004235264.1|  PREDICTED: tropinone reductase homolog isofo...    332   1e-108   
ref|XP_010469970.1|  PREDICTED: tropinone reductase homolog At1g0...    331   2e-108   
ref|XP_010542632.1|  PREDICTED: tropinone reductase homolog At1g0...    331   2e-108   
ref|XP_009623489.1|  PREDICTED: tropinone reductase 1-like isofor...    331   3e-108   
ref|XP_010414408.1|  PREDICTED: tropinone reductase homolog At1g0...    331   3e-108   
ref|XP_006846356.1|  hypothetical protein AMTR_s00012p00261070          331   3e-108   
ref|XP_006352698.1|  PREDICTED: tropinone reductase homolog             331   3e-108   
emb|CAN63543.1|  hypothetical protein VITISV_035429                     330   4e-108   Vitis vinifera
gb|KCW52641.1|  hypothetical protein EUGRSUZ_J02019                     331   4e-108   
ref|XP_006352700.1|  PREDICTED: tropinone reductase homolog             330   5e-108   
ref|XP_010685684.1|  PREDICTED: tropinone reductase homolog At1g0...    330   5e-108   
ref|XP_006838385.1|  hypothetical protein AMTR_s00002p00066940          330   7e-108   
emb|CDY68057.1|  BnaAnng26060D                                          329   9e-108   
gb|KEH34737.1|  NAD(P)-binding rossmann-fold protein                    330   9e-108   
ref|XP_009110944.1|  PREDICTED: tropinone reductase homolog At1g0...    329   1e-107   
ref|XP_010256821.1|  PREDICTED: tropinone reductase homolog             328   2e-107   
ref|XP_008442514.1|  PREDICTED: tropinone reductase homolog             328   2e-107   
gb|ABW81120.1|  putative tropinone reductase-14                         328   3e-107   Boechera divaricarpa
ref|XP_011076794.1|  PREDICTED: tropinone reductase homolog             328   3e-107   
ref|XP_006488391.1|  PREDICTED: tropinone reductase homolog At1g0...    328   5e-107   
ref|XP_008233480.1|  PREDICTED: tropinone reductase homolog At1g0...    328   6e-107   
emb|CDX86485.1|  BnaC08g02180D                                          327   7e-107   
ref|XP_011094903.1|  PREDICTED: tropinone reductase homolog             327   7e-107   
gb|KEH30187.1|  enoyl-(acyl carrier) reductase                          327   8e-107   
ref|XP_010650984.1|  PREDICTED: tropinone reductase homolog At1g0...    327   8e-107   
ref|XP_010469989.1|  PREDICTED: tropinone reductase homolog At1g0...    327   8e-107   
ref|XP_002282755.1|  PREDICTED: tropinone reductase homolog At1g0...    327   9e-107   Vitis vinifera
emb|CBI16073.3|  unnamed protein product                                327   9e-107   
ref|XP_010521893.1|  PREDICTED: tropinone reductase homolog At1g0...    327   1e-106   
ref|XP_011023546.1|  PREDICTED: tropinone reductase homolog At1g0...    327   1e-106   
ref|XP_010650983.1|  PREDICTED: tropinone reductase homolog At1g0...    327   1e-106   
emb|CDY09823.1|  BnaC09g43380D                                          327   1e-106   
emb|CAN69507.1|  hypothetical protein VITISV_016037                     327   1e-106   Vitis vinifera
ref|XP_007218806.1|  hypothetical protein PRUPE_ppa009941mg             327   2e-106   
emb|CDY09824.1|  BnaC09g43370D                                          327   2e-106   
ref|XP_004137775.1|  PREDICTED: tropinone reductase homolog             326   2e-106   
ref|XP_010650991.1|  PREDICTED: tropinone reductase homolog At1g0...    326   2e-106   
ref|XP_006846352.1|  hypothetical protein AMTR_s00012p00260130          326   2e-106   
ref|XP_010650992.1|  PREDICTED: tropinone reductase homolog At1g0...    326   3e-106   
ref|XP_006358703.1|  PREDICTED: tropinone reductase homolog At1g0...    327   3e-106   
gb|ABK94587.1|  unknown                                                 326   3e-106   Populus trichocarpa [western balsam poplar]
ref|XP_010312198.1|  PREDICTED: tropinone reductase 1 isoform X1        326   3e-106   
ref|XP_010654244.1|  PREDICTED: tropinone reductase homolog             326   3e-106   
ref|XP_010650989.1|  PREDICTED: tropinone reductase homolog At1g0...    326   3e-106   
emb|CDP14238.1|  unnamed protein product                                325   4e-106   
gb|ADE76974.1|  unknown                                                 325   4e-106   
gb|ABW81087.1|  TRL11                                                   325   6e-106   Tarenaya spinosa
ref|XP_008349592.1|  PREDICTED: tropinone reductase homolog At1g0...    325   7e-106   
emb|CDX86486.1|  BnaC08g02170D                                          325   7e-106   
ref|XP_002319562.1|  hypothetical protein POPTR_0013s02690g             325   7e-106   Populus trichocarpa [western balsam poplar]
gb|ABW81146.1|  TRL26                                                   325   8e-106   Capsella rubella
ref|XP_010650985.1|  PREDICTED: tropinone reductase homolog At1g0...    325   9e-106   
gb|ACU16743.1|  unknown                                                 325   9e-106   Glycine max [soybeans]
ref|XP_003632186.1|  PREDICTED: tropinone reductase homolog At1g0...    325   1e-105   
ref|XP_003538423.1|  PREDICTED: tropinone reductase homolog At1g0...    324   1e-105   
ref|XP_010414428.1|  PREDICTED: tropinone reductase homolog At1g0...    324   1e-105   
ref|XP_004291519.1|  PREDICTED: tropinone reductase homolog At1g0...    324   1e-105   
ref|XP_006846355.1|  hypothetical protein AMTR_s00012p00260970          324   2e-105   
ref|XP_007206210.1|  hypothetical protein PRUPE_ppa015172mg             323   2e-105   
gb|AFK38962.1|  unknown                                                 324   2e-105   
ref|XP_011023547.1|  PREDICTED: tropinone reductase homolog At1g0...    323   2e-105   
ref|XP_002524214.1|  tropinone reductase, putative                      323   2e-105   Ricinus communis
ref|XP_010557237.1|  PREDICTED: tropinone reductase homolog At1g0...    323   3e-105   
ref|XP_004240378.1|  PREDICTED: tropinone reductase homolog             324   3e-105   
ref|XP_008461702.1|  PREDICTED: tropinone reductase homolog             323   3e-105   
ref|XP_004235263.1|  PREDICTED: tropinone reductase homolog             323   4e-105   
ref|XP_007016329.1|  NAD(P)-binding Rossmann-fold superfamily pro...    325   4e-105   
gb|AAC95218.1|  putative tropinone reductase                            323   4e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006295594.1|  hypothetical protein CARUB_v10024703mg             323   4e-105   
ref|XP_008223763.1|  PREDICTED: tropinone reductase homolog At1g0...    323   5e-105   
ref|XP_010414423.1|  PREDICTED: tropinone reductase homolog At1g0...    323   5e-105   
ref|XP_007163456.1|  hypothetical protein PHAVU_001G235700g             323   6e-105   
emb|CDP12723.1|  unnamed protein product                                322   6e-105   
ref|XP_010542622.1|  PREDICTED: tropinone reductase homolog At1g0...    322   6e-105   
ref|XP_008356743.1|  PREDICTED: tropinone reductase homolog At1g0...    322   7e-105   
ref|XP_007026941.1|  NAD(P)-binding Rossmann-fold superfamily pro...    323   7e-105   
ref|XP_006488388.1|  PREDICTED: tropinone reductase homolog isofo...    325   7e-105   
ref|XP_010691207.1|  PREDICTED: tropinone reductase homolog At1g0...    322   7e-105   
ref|XP_002532998.1|  tropinone reductase, putative                      322   7e-105   Ricinus communis
ref|XP_004150641.1|  PREDICTED: tropinone reductase homolog At1g0...    322   8e-105   
ref|XP_009375950.1|  PREDICTED: tropinone reductase homolog At1g0...    322   8e-105   
ref|XP_004507158.1|  PREDICTED: tropinone reductase homolog             323   9e-105   
ref|XP_011006389.1|  PREDICTED: tropinone reductase homolog isofo...    322   1e-104   
gb|ABW81066.1|  tropinone-reductase-like53                              322   1e-104   Arabidopsis lyrata subsp. lyrata
ref|XP_008358998.1|  PREDICTED: tropinone reductase homolog At1g0...    322   1e-104   
ref|XP_007016318.1|  Senescence-associated gene 13 isoform 1            322   1e-104   
ref|XP_011070195.1|  PREDICTED: tropinone reductase 1-like              322   1e-104   
ref|XP_009358752.1|  PREDICTED: tropinone reductase homolog isofo...    321   1e-104   
ref|XP_002319563.2|  tropinone reductase family protein                 322   1e-104   Populus trichocarpa [western balsam poplar]
gb|AFD23289.1|  tropinone reductase II                                  322   1e-104   
ref|XP_010040245.1|  PREDICTED: tropinone reductase homolog At1g0...    322   2e-104   
ref|XP_011023548.1|  PREDICTED: tropinone reductase homolog At1g0...    321   2e-104   
ref|XP_008356736.1|  PREDICTED: tropinone reductase homolog At1g0...    321   2e-104   
ref|XP_008359743.1|  PREDICTED: tropinone reductase homolog isofo...    320   2e-104   
emb|CDY31776.1|  BnaA04g17120D                                          321   2e-104   
ref|XP_010685685.1|  PREDICTED: tropinone reductase homolog At1g0...    320   2e-104   
ref|XP_010931228.1|  PREDICTED: tropinone reductase homolog At1g0...    321   3e-104   
gb|KDO66642.1|  hypothetical protein CISIN_1g019370mg                   323   3e-104   
ref|NP_001237661.1|  uncharacterized protein LOC100306108               321   3e-104   
ref|XP_010096620.1|  Tropinone reductase-like protein                   321   3e-104   
ref|XP_010033100.1|  PREDICTED: tropinone reductase homolog At1g0...    321   3e-104   
ref|XP_009603003.1|  PREDICTED: tropinone reductase homolog isofo...    320   3e-104   
ref|XP_004492175.1|  PREDICTED: tropinone reductase homolog             320   4e-104   
ref|NP_180479.1|  tropinone reductase-like protein                      320   4e-104   Arabidopsis thaliana [mouse-ear cress]
gb|KHG29311.1|  Tropinone reductase                                     321   4e-104   
ref|XP_011089795.1|  PREDICTED: tropinone reductase homolog isofo...    322   4e-104   
ref|XP_002879208.1|  hypothetical protein ARALYDRAFT_481843             320   5e-104   
gb|KDO38494.1|  hypothetical protein CISIN_1g024551mg                   320   6e-104   
ref|XP_011089796.1|  PREDICTED: tropinone reductase homolog isofo...    321   6e-104   
ref|XP_004503163.1|  PREDICTED: tropinone reductase homolog             320   6e-104   
ref|XP_008387076.1|  PREDICTED: tropinone reductase homolog At1g0...    320   6e-104   
ref|XP_007009277.1|  NAD(P)-binding Rossmann-fold superfamily pro...    320   7e-104   
ref|XP_009364346.1|  PREDICTED: tropinone reductase homolog At1g0...    320   7e-104   
gb|ADE77494.1|  unknown                                                 320   7e-104   
ref|XP_004293354.1|  PREDICTED: tropinone reductase homolog At1g0...    320   7e-104   
gb|ABW74557.1|  tropinone-reductase-like protein                        320   7e-104   Boechera divaricarpa
ref|XP_006409971.1|  hypothetical protein EUTSA_v10017105mg             319   8e-104   
ref|NP_180489.1|  NAD(P)-binding Rossmann-fold superfamily protein      322   8e-104   Arabidopsis thaliana [mouse-ear cress]
gb|ABW81158.1|  TRL13                                                   321   9e-104   Capsella rubella
ref|XP_003552795.1|  PREDICTED: tropinone reductase homolog             320   1e-103   
ref|XP_008375982.1|  PREDICTED: tropinone reductase homolog At1g0...    319   1e-103   
ref|XP_009760666.1|  PREDICTED: LOW QUALITY PROTEIN: tropinone re...    320   1e-103   
ref|XP_002308173.1|  hypothetical protein POPTR_0006s09070g             319   1e-103   Populus trichocarpa [western balsam poplar]
ref|XP_006429152.1|  hypothetical protein CICLE_v10012433mg             319   1e-103   
ref|XP_010033103.1|  PREDICTED: tropinone reductase homolog At1g0...    319   2e-103   
ref|XP_009611893.1|  PREDICTED: tropinone reductase homolog At1g0...    318   2e-103   
ref|XP_010067433.1|  PREDICTED: tropinone reductase homolog At1g0...    318   2e-103   
ref|XP_010542627.1|  PREDICTED: tropinone reductase homolog At1g0...    318   2e-103   
ref|XP_010040250.1|  PREDICTED: tropinone reductase homolog At1g0...    319   2e-103   
ref|XP_010033102.1|  PREDICTED: tropinone reductase homolog At1g0...    319   2e-103   
ref|XP_009796888.1|  PREDICTED: tropinone reductase homolog             318   2e-103   
gb|KCW65560.1|  hypothetical protein EUGRSUZ_G02957                     318   2e-103   
ref|XP_010414393.1|  PREDICTED: tropinone reductase homolog At1g0...    319   2e-103   
ref|XP_006429149.1|  hypothetical protein CICLE_v10012479mg             318   2e-103   
ref|XP_004137777.1|  PREDICTED: tropinone reductase homolog             318   3e-103   
ref|XP_009343858.1|  PREDICTED: tropinone reductase homolog At1g0...    318   3e-103   
ref|XP_007205718.1|  hypothetical protein PRUPE_ppa009959mg             318   3e-103   
gb|KCW65561.1|  hypothetical protein EUGRSUZ_G02957                     318   3e-103   
ref|XP_010910872.1|  PREDICTED: tropinone reductase homolog At1g0...    318   3e-103   
gb|KDP44893.1|  hypothetical protein JCGZ_01393                         318   4e-103   
ref|XP_002311182.2|  tropinone reductase family protein                 318   4e-103   Populus trichocarpa [western balsam poplar]
ref|XP_010510499.1|  PREDICTED: tropinone reductase homolog At1g0...    326   4e-103   
gb|KFK43068.1|  hypothetical protein AALP_AA1G074500                    317   5e-103   
ref|XP_010067438.1|  PREDICTED: tropinone reductase homolog At1g0...    318   5e-103   
gb|AAO42159.1|  putative tropinone reductase                            319   5e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003540716.1|  PREDICTED: tropinone reductase homolog             318   7e-103   
emb|CDP00133.1|  unnamed protein product                                317   7e-103   
ref|XP_008777412.1|  PREDICTED: tropinone reductase homolog At1g0...    317   7e-103   
ref|XP_004503172.1|  PREDICTED: tropinone reductase homolog At1g0...    317   7e-103   
ref|XP_011033874.1|  PREDICTED: tropinone reductase homolog At1g0...    317   7e-103   
ref|XP_002314932.1|  tropinone reductase family protein                 317   1e-102   Populus trichocarpa [western balsam poplar]
ref|XP_010067435.1|  PREDICTED: tropinone reductase homolog At1g0...    317   1e-102   
ref|XP_007206734.1|  hypothetical protein PRUPE_ppa024823mg             317   1e-102   
ref|XP_004302763.1|  PREDICTED: tropinone reductase homolog             316   1e-102   
ref|NP_180497.1|  tropinone reductase-like protein                      317   1e-102   Arabidopsis thaliana [mouse-ear cress]
gb|EYU41758.1|  hypothetical protein MIMGU_mgv1a011856mg                316   2e-102   
ref|XP_004294665.1|  PREDICTED: tropinone reductase homolog At1g0...    316   2e-102   
ref|XP_008442511.1|  PREDICTED: tropinone reductase homolog             316   2e-102   
gb|ABW81165.1|  TRL5                                                    316   2e-102   Capsella rubella
ref|XP_010469962.1|  PREDICTED: tropinone reductase homolog At1g0...    316   2e-102   
emb|CDX98899.1|  BnaC09g49360D                                          316   2e-102   
gb|AFK36242.1|  unknown                                                 316   2e-102   
ref|XP_011010114.1|  PREDICTED: tropinone reductase homolog At1g0...    315   2e-102   
gb|KEH34749.1|  NAD(P)-binding rossmann-fold protein                    316   3e-102   
ref|XP_007026940.1|  NAD(P)-binding Rossmann-fold superfamily pro...    318   3e-102   
emb|CBI30509.3|  unnamed protein product                                315   3e-102   
gb|KDP42205.1|  hypothetical protein JCGZ_02935                         317   3e-102   
ref|XP_010256816.1|  PREDICTED: tropinone reductase homolog At1g0...    318   3e-102   
ref|XP_006294815.1|  hypothetical protein CARUB_v10023866mg             315   3e-102   
ref|XP_008221978.1|  PREDICTED: tropinone reductase homolog At1g0...    315   3e-102   
ref|XP_008777422.1|  PREDICTED: tropinone reductase homolog At1g0...    315   4e-102   
ref|XP_008777402.1|  PREDICTED: tropinone reductase homolog At1g0...    315   4e-102   
ref|XP_002881032.1|  hypothetical protein ARALYDRAFT_481835             315   4e-102   
ref|XP_006435623.1|  hypothetical protein CICLE_v10032389mg             315   4e-102   
gb|KDO69163.1|  hypothetical protein CISIN_1g024125mg                   315   4e-102   
ref|XP_010469988.1|  PREDICTED: tropinone reductase homolog At1g0...    315   4e-102   
ref|XP_010414424.1|  PREDICTED: tropinone reductase homolog At1g0...    315   4e-102   
gb|AIX10937.1|  putative tropinone reductase                            315   5e-102   
ref|XP_009140979.1|  PREDICTED: tropinone reductase homolog At1g0...    316   5e-102   
ref|XP_007140482.1|  hypothetical protein PHAVU_008G116300g             315   5e-102   
ref|XP_010521558.1|  PREDICTED: tropinone reductase homolog At1g0...    315   5e-102   
ref|XP_002873234.1|  hypothetical protein ARALYDRAFT_487407             315   5e-102   
ref|XP_010510510.1|  PREDICTED: tropinone reductase homolog At1g0...    316   7e-102   
emb|CDX70101.1|  BnaA10g24500D                                          314   8e-102   
ref|XP_003537468.1|  PREDICTED: tropinone reductase homolog At1g0...    315   8e-102   
ref|XP_007205714.1|  hypothetical protein PRUPE_ppa009944mg             315   8e-102   
gb|KFK24998.1|  hypothetical protein AALP_AA8G053200                    314   9e-102   
ref|XP_010510526.1|  PREDICTED: tropinone reductase homolog At1g0...    314   9e-102   
gb|ABK96466.1|  unknown                                                 314   9e-102   Populus trichocarpa x Populus deltoides
gb|KHN25230.1|  Tropinone reductase like                                314   9e-102   
ref|XP_010650990.1|  PREDICTED: tropinone reductase homolog isofo...    323   1e-101   
ref|XP_006294711.1|  hypothetical protein CARUB_v10023749mg             315   1e-101   
ref|XP_003539545.1|  PREDICTED: tropinone reductase homolog At1g0...    314   1e-101   
ref|XP_003539556.1|  PREDICTED: tropinone reductase homolog At1g0...    314   1e-101   
gb|ABW81067.1|  Tropinon-reductase-like54                               314   1e-101   Arabidopsis lyrata subsp. lyrata
ref|XP_010469976.1|  PREDICTED: tropinone reductase homolog At1g0...    315   1e-101   
ref|XP_009122209.1|  PREDICTED: tropinone reductase homolog At1g0...    313   2e-101   
ref|XP_007163457.1|  hypothetical protein PHAVU_001G235800g             314   2e-101   
ref|XP_006846351.1|  hypothetical protein AMTR_s00012p00260070          315   2e-101   
gb|AAM63669.1|  putative tropinone reductase                            313   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011023549.1|  PREDICTED: tropinone reductase homolog At1g0...    313   3e-101   
ref|XP_003552193.1|  PREDICTED: tropinone reductase homolog isofo...    313   3e-101   
ref|XP_004302760.1|  PREDICTED: tropinone reductase homolog             313   3e-101   
ref|XP_004307471.1|  PREDICTED: tropinone reductase homolog             313   3e-101   
gb|KHN04080.1|  Tropinone reductase like                                313   3e-101   
ref|XP_007206475.1|  hypothetical protein PRUPE_ppa018984mg             313   3e-101   
ref|NP_196225.1|  putative tropine dehydrogenase                        312   4e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010931230.1|  PREDICTED: tropinone reductase homolog At1g0...    312   4e-101   
ref|XP_003558258.1|  PREDICTED: tropinone reductase homolog At1g0...    313   4e-101   
emb|CBI16074.3|  unnamed protein product                                312   5e-101   
ref|XP_008349700.1|  PREDICTED: uncharacterized protein LOC103412975    326   5e-101   
ref|NP_001118408.1|  tropinone reductase-like protein                   312   5e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010542633.1|  PREDICTED: tropinone reductase homolog At1g0...    312   6e-101   
emb|CDY14094.1|  BnaC02g02110D                                          312   7e-101   
emb|CAO02390.1|  tropinone reductase                                    312   7e-101   Cochlearia officinalis [scurvy-grass]
emb|CDY04977.1|  BnaAnng01590D                                          311   8e-101   
ref|XP_010557240.1|  PREDICTED: tropinone reductase homolog At1g0...    313   9e-101   
ref|XP_010510518.1|  PREDICTED: tropinone reductase homolog At1g0...    313   1e-100   
emb|CAN69103.1|  hypothetical protein VITISV_027298                     311   1e-100   
emb|CBI16068.3|  unnamed protein product                                310   1e-100   
ref|XP_008221969.1|  PREDICTED: tropinone reductase homolog At1g0...    311   2e-100   
gb|ABW81178.1|  tropinone reductase-like protein 16                     311   2e-100   
ref|XP_002299848.2|  hypothetical protein POPTR_0001s25170g             313   2e-100   
gb|KEH34739.1|  NAD(P)-binding rossmann-fold protein                    311   2e-100   
ref|XP_010650986.1|  PREDICTED: tropinone reductase homolog At1g0...    311   2e-100   
ref|XP_002282638.2|  PREDICTED: tropinone reductase homolog At1g0...    313   2e-100   
gb|KEH34736.1|  NAD(P)-binding rossmann-fold protein                    311   2e-100   
gb|AFK39944.1|  unknown                                                 311   2e-100   
gb|KHG18781.1|  Tropinone reductase                                     313   2e-100   
ref|XP_009140995.1|  PREDICTED: tropinone reductase homolog At1g0...    311   2e-100   
ref|XP_002863054.1|  hypothetical protein ARALYDRAFT_497196             311   2e-100   
ref|XP_011023544.1|  PREDICTED: tropinone reductase homolog At1g0...    310   2e-100   
ref|XP_010423393.1|  PREDICTED: tropinone reductase homolog At1g0...    310   2e-100   
ref|XP_010650987.1|  PREDICTED: tropinone reductase homolog At1g0...    310   2e-100   
emb|CDO98530.1|  unnamed protein product                                310   3e-100   
ref|XP_010325840.1|  PREDICTED: tropinone reductase homolog isofo...    310   3e-100   
ref|XP_006399065.1|  hypothetical protein EUTSA_v10014421mg             310   3e-100   
ref|XP_010469963.1|  PREDICTED: tropinone reductase homolog At1g0...    310   3e-100   
gb|AFK45411.1|  unknown                                                 310   3e-100   
ref|XP_010521549.1|  PREDICTED: tropinone reductase homolog At1g0...    310   4e-100   
ref|XP_002465494.1|  hypothetical protein SORBIDRAFT_01g039880          310   4e-100   
ref|XP_010414419.1|  PREDICTED: tropinone reductase homolog At1g0...    310   4e-100   
ref|XP_010452515.1|  PREDICTED: tropinone reductase homolog At1g0...    310   4e-100   
ref|NP_001149071.1|  LOC100282692                                       310   4e-100   
ref|XP_002879212.1|  hypothetical protein ARALYDRAFT_481853             310   4e-100   
ref|XP_010510516.1|  PREDICTED: tropinone reductase homolog At1g0...    310   4e-100   
ref|XP_009600097.1|  PREDICTED: tropinone reductase homolog isofo...    311   5e-100   
ref|XP_009125632.1|  PREDICTED: tropinone reductase homolog At1g0...    310   5e-100   
ref|NP_850132.2|  tropinone reductase-like protein                      310   5e-100   
ref|XP_009804542.1|  PREDICTED: tropinone reductase homolog isofo...    313   6e-100   
ref|XP_006294799.1|  hypothetical protein CARUB_v10023850mg             310   6e-100   
gb|KHG00112.1|  Tropinone reductase                                     310   7e-100   
gb|ABW81145.1|  TRL27                                                   309   8e-100   
emb|CDY09917.1|  BnaC08g45340D                                          309   8e-100   
gb|AFK34899.1|  unknown                                                 309   8e-100   
ref|XP_006649826.1|  PREDICTED: tropinone reductase homolog At1g0...    309   8e-100   
gb|AAM61117.1|  short chain alcohol dehydrogenase-like                  309   9e-100   
gb|AFK33539.1|  unknown                                                 309   9e-100   
ref|XP_009118438.1|  PREDICTED: tropinone reductase homolog At1g0...    309   1e-99    
ref|XP_002879211.1|  hypothetical protein ARALYDRAFT_481852             309   1e-99    
gb|KHN04072.1|  Tropinone reductase like                                308   1e-99    
ref|XP_009358760.1|  PREDICTED: tropinone reductase homolog             308   1e-99    
ref|XP_011035256.1|  PREDICTED: tropinone reductase homolog             311   1e-99    
ref|XP_008221957.1|  PREDICTED: tropinone reductase homolog At1g0...    308   2e-99    
ref|NP_180496.1|  senescence-associated protein 13                      308   2e-99    
ref|XP_010521889.1|  PREDICTED: tropinone reductase homolog At1g0...    308   2e-99    
gb|ABW74581.1|  putative tropinone reductase                            308   2e-99    
ref|XP_010685687.1|  PREDICTED: tropinone reductase homolog At1g0...    310   2e-99    
ref|XP_004984926.1|  PREDICTED: tropinone reductase homolog At1g0...    308   2e-99    
gb|EMT31236.1|  Tropinone reductase-like protein                        310   3e-99    
ref|XP_010557238.1|  PREDICTED: tropinone reductase homolog At1g0...    308   3e-99    
ref|XP_002299847.1|  tropinone reductase family protein                 308   3e-99    
sp|P50163.1|TRN2_DATST  RecName: Full=Tropinone reductase 2; AltN...    308   3e-99    
ref|XP_006344583.1|  PREDICTED: tropinone reductase homolog             308   3e-99    
ref|XP_010491151.1|  PREDICTED: tropinone reductase homolog At1g0...    308   3e-99    
dbj|BAC65128.2|  short chain alcohol dehydrogenase-like protein         309   3e-99    
pdb|1IPE|A  Chain A, Tropinone Reductase-Ii Complexed With Nadph        307   4e-99    
ref|XP_006409970.1|  hypothetical protein EUTSA_v10016944mg             310   4e-99    
ref|XP_010521885.1|  PREDICTED: tropinone reductase homolog At1g0...    307   4e-99    
gb|KCW45356.1|  hypothetical protein EUGRSUZ_L00970                     307   4e-99    
gb|ABW81156.1|  TRL15                                                   307   4e-99    
dbj|BAJ87177.1|  predicted protein                                      307   4e-99    
ref|XP_009346407.1|  PREDICTED: tropinone reductase homolog isofo...    307   5e-99    
ref|XP_010685686.1|  PREDICTED: tropinone reductase homolog At1g0...    310   5e-99    
emb|CAN69508.1|  hypothetical protein VITISV_016038                     308   5e-99    
ref|XP_006288477.1|  hypothetical protein CARUB_v10001737mg             307   6e-99    
gb|AFK35677.1|  unknown                                                 307   6e-99    
ref|XP_004242399.2|  PREDICTED: tropinone reductase homolog             306   7e-99    
ref|XP_006590970.1|  PREDICTED: tropinone reductase homolog At1g0...    308   7e-99    
ref|NP_001239850.1|  uncharacterized protein LOC100785449               307   7e-99    
gb|ABF95188.1|  Tropinone reductase, putative, expressed                307   7e-99    
ref|XP_010665941.1|  PREDICTED: tropinone reductase homolog At1g0...    306   8e-99    
ref|XP_010034592.1|  PREDICTED: tropinone reductase homolog At1g0...    307   8e-99    
gb|ABW81118.1|  putative tropinone reductase                            308   8e-99    
emb|CDP12722.1|  unnamed protein product                                306   9e-99    
emb|CDY06260.1|  BnaA09g49430D                                          306   9e-99    
gb|KEH34753.1|  NAD(P)-binding rossmann-fold protein                    307   9e-99    
ref|XP_002879210.1|  hypothetical protein ARALYDRAFT_481850             306   1e-98    
ref|XP_006417804.1|  hypothetical protein EUTSA_v10008362mg             307   1e-98    
ref|XP_010414425.1|  PREDICTED: tropinone reductase homolog At1g0...    306   1e-98    
gb|ACJ84726.1|  unknown                                                 306   1e-98    
gb|ABW81164.1|  TRL6                                                    306   2e-98    
emb|CDO98523.1|  unnamed protein product                                305   2e-98    
gb|KDP35685.1|  hypothetical protein JCGZ_09123                         306   2e-98    
ref|XP_007140493.1|  hypothetical protein PHAVU_008G117200g             306   2e-98    
ref|XP_007016327.1|  Senescence-associated gene 13, putative isof...    307   2e-98    
ref|XP_010043492.1|  PREDICTED: tropinone reductase homolog             308   2e-98    
ref|XP_010931231.1|  PREDICTED: tropinone reductase homolog At1g0...    306   2e-98    
ref|XP_010521883.1|  PREDICTED: tropinone reductase homolog At1g0...    305   2e-98    
emb|CDP11659.1|  unnamed protein product                                305   2e-98    
ref|XP_010521892.1|  PREDICTED: tropinone reductase homolog At1g0...    306   2e-98    
ref|XP_006294788.1|  hypothetical protein CARUB_v10023838mg             306   2e-98    
ref|NP_001275240.1|  tropinone reductase 2-like                         305   2e-98    
ref|XP_004294666.1|  PREDICTED: tropinone reductase homolog At1g0...    305   3e-98    
ref|XP_010106552.1|  Tropinone reductase-like protein                   305   3e-98    
ref|XP_010414392.1|  PREDICTED: tropinone reductase homolog At1g0...    305   3e-98    
ref|XP_006429148.1|  hypothetical protein CICLE_v10012479mg             305   3e-98    
ref|XP_007140477.1|  hypothetical protein PHAVU_008G115900g             305   3e-98    
ref|XP_008363884.1|  PREDICTED: tropinone reductase homolog             305   3e-98    
ref|XP_010040249.1|  PREDICTED: tropinone reductase homolog At1g0...    305   4e-98    
gb|AGH24753.1|  tropinone reductase-II                                  305   4e-98    
emb|CAQ19732.1|  tropinone reductase II                                 305   4e-98    
ref|XP_010487469.1|  PREDICTED: tropinone reductase homolog At1g0...    305   4e-98    
gb|ABW81184.1|  tropinone-reductase-like24                              305   5e-98    
ref|XP_010469961.1|  PREDICTED: tropinone reductase homolog At1g0...    305   6e-98    
ref|XP_010510523.1|  PREDICTED: tropinone reductase homolog At1g0...    305   6e-98    
gb|ABW81054.1|  tropinone-reductase-like39                              306   6e-98    
gb|KDO52375.1|  hypothetical protein CISIN_1g024994mg                   304   6e-98    
gb|KCW49544.1|  hypothetical protein EUGRSUZ_K03064                     304   6e-98    
gb|KDP30781.1|  hypothetical protein JCGZ_13724                         304   7e-98    
gb|ABW81127.1|  putative tropinone reductase-22                         304   8e-98    
ref|XP_010475505.1|  PREDICTED: tropinone reductase homolog At1g0...    304   8e-98    
gb|KHN17894.1|  Tropinone reductase like                                303   8e-98    
ref|XP_007132036.1|  hypothetical protein PHAVU_011G061400g             305   9e-98    
gb|KFK41764.1|  hypothetical protein AALP_AA2G169200                    303   1e-97    
ref|XP_010037803.1|  PREDICTED: tropinone reductase 1-like              305   1e-97    
ref|XP_011048910.1|  PREDICTED: tropinone reductase homolog At1g0...    304   1e-97    
gb|KHN40273.1|  Tropinone reductase like                                303   1e-97    
ref|XP_009346409.1|  PREDICTED: tropinone reductase homolog             303   1e-97    
emb|CAC19810.1|  tropinone reductase II                                 303   1e-97    
ref|XP_006290197.1|  hypothetical protein CARUB_v10003882mg             303   1e-97    
ref|XP_009407503.1|  PREDICTED: tropinone reductase homolog             303   1e-97    
ref|XP_002282875.1|  PREDICTED: tropinone reductase homolog At1g0...    303   2e-97    
ref|XP_008363883.1|  PREDICTED: tropinone reductase 1-like              303   2e-97    
gb|KHG18782.1|  hypothetical protein F383_24463                         303   2e-97    
ref|XP_011035255.1|  PREDICTED: tropinone reductase homolog At1g0...    303   2e-97    
ref|XP_010658532.1|  PREDICTED: tropinone reductase homolog At1g0...    303   2e-97    
gb|KEH22973.1|  NAD(P)-binding rossmann-fold protein                    303   2e-97    
gb|KFK41763.1|  hypothetical protein AALP_AA2G169000                    303   2e-97    
gb|KEH22982.1|  enoyl-(acyl carrier) reductase                          303   2e-97    
ref|XP_008387806.1|  PREDICTED: tropinone reductase homolog             303   3e-97    
ref|XP_010312199.1|  PREDICTED: tropinone reductase 1 isoform X3        302   3e-97    
ref|NP_172224.1|  NAD(P)-binding Rossmann-fold superfamily protein      303   3e-97    
ref|XP_004302758.1|  PREDICTED: tropinone reductase homolog             302   3e-97    
emb|CDY51372.1|  BnaA04g28660D                                          303   5e-97    
ref|XP_009358754.1|  PREDICTED: tropinone reductase homolog isofo...    302   5e-97    
ref|XP_004503173.1|  PREDICTED: tropinone reductase homolog At1g0...    302   5e-97    
ref|XP_011048909.1|  PREDICTED: tropinone reductase homolog At1g0...    304   5e-97    
gb|KDP35675.1|  hypothetical protein JCGZ_09113                         301   5e-97    
gb|AGL76990.1|  tropinone reductase II                                  301   5e-97    
ref|XP_003538424.1|  PREDICTED: tropinone reductase homolog At1g0...    302   6e-97    
ref|XP_008359746.1|  PREDICTED: tropinone reductase homolog             301   6e-97    
ref|XP_006429161.1|  hypothetical protein CICLE_v10012645mg             300   6e-97    
ref|XP_003529117.1|  PREDICTED: tropinone reductase homolog isofo...    302   6e-97    
sp|P50164.1|TRN2_HYONI  RecName: Full=Tropinone reductase 2; AltN...    301   6e-97    
ref|XP_006409980.1|  hypothetical protein EUTSA_v10017118mg             301   7e-97    
ref|XP_004236988.1|  PREDICTED: tropinone reductase 2                   301   7e-97    
ref|XP_007132035.1|  hypothetical protein PHAVU_011G061300g             301   7e-97    
emb|CBI16078.3|  unnamed protein product                                301   7e-97    
gb|EAY89400.1|  hypothetical protein OsI_10905                          302   8e-97    
ref|XP_011048912.1|  PREDICTED: tropinone reductase homolog At1g0...    301   8e-97    
ref|XP_002892399.1|  hypothetical protein ARALYDRAFT_470766             301   8e-97    
ref|XP_009346408.1|  PREDICTED: tropinone reductase homolog isofo...    301   8e-97    
ref|XP_010034595.1|  PREDICTED: tropinone reductase homolog At1g0...    301   1e-96    
ref|XP_002892400.1|  hypothetical protein ARALYDRAFT_470767             301   1e-96    
gb|ACB71203.1|  tropinone reductase II                                  301   1e-96    
ref|XP_010033101.1|  PREDICTED: tropinone reductase homolog At1g0...    301   1e-96    
ref|XP_010931229.1|  PREDICTED: tropinone reductase homolog At1g0...    301   1e-96    
ref|XP_004303414.1|  PREDICTED: tropinone reductase homolog             300   1e-96    
gb|KEH34754.1|  NAD(P)-binding rossmann-fold protein                    301   1e-96    
gb|KHN17906.1|  Tropinone reductase like                                301   2e-96    
ref|XP_010452516.1|  PREDICTED: tropinone reductase homolog At1g0...    300   2e-96    
ref|XP_011048908.1|  PREDICTED: tropinone reductase homolog At1g0...    303   2e-96    
ref|XP_010088522.1|  Tropinone reductase-like protein                   301   2e-96    
emb|CAD62568.1|  putative tropinone reductase                           300   2e-96    
ref|XP_004242401.1|  PREDICTED: tropinone reductase homolog At1g0...    301   2e-96    
ref|NP_172225.1|  NAD(P)-binding Rossmann-fold superfamily protein      300   2e-96    
gb|KHN17893.1|  Tropinone reductase like                                301   2e-96    
ref|XP_010931237.1|  PREDICTED: tropinone reductase homolog At1g0...    301   3e-96    
ref|XP_008349593.1|  PREDICTED: tropinone reductase homolog At1g0...    300   3e-96    
gb|KEH22981.1|  NAD(P)-binding rossmann-fold protein                    300   3e-96    
ref|XP_010543921.1|  PREDICTED: tropinone reductase homolog At1g0...    299   3e-96    
emb|CDO98525.1|  unnamed protein product                                300   3e-96    
ref|XP_009358759.1|  PREDICTED: tropinone reductase homolog             300   4e-96    
ref|XP_010475501.1|  PREDICTED: tropinone reductase homolog At1g0...    301   4e-96    
ref|XP_009140980.1|  PREDICTED: tropinone reductase homolog At1g0...    299   5e-96    
ref|XP_006649828.1|  PREDICTED: tropinone reductase homolog At1g0...    300   5e-96    
gb|ABW81121.1|  putative tropinone reductase-15                         299   5e-96    
ref|XP_006352697.1|  PREDICTED: tropinone reductase homolog At1g0...    300   6e-96    
gb|ABW81086.1|  TRL9                                                    300   6e-96    
gb|ABI78943.1|  tropinone reductase                                     299   6e-96    
ref|XP_009358758.1|  PREDICTED: tropinone reductase homolog             299   6e-96    
ref|XP_010228815.1|  PREDICTED: tropinone reductase homolog At1g0...    299   6e-96    
gb|KDO38492.1|  hypothetical protein CISIN_1g0356422mg                  298   7e-96    
ref|NP_001242650.1|  uncharacterized protein LOC100819646               299   8e-96    
gb|ABW81080.1|  TRL3                                                    300   8e-96    
ref|XP_007016320.1|  NAD(P)-binding Rossmann-fold superfamily pro...    300   8e-96    
ref|XP_007016314.1|  NAD(P)-binding Rossmann-fold superfamily pro...    300   8e-96    
ref|XP_002520511.1|  tropinone reductase, putative                      309   9e-96    
ref|NP_180491.1|  tropinone reductase-like protein                      299   9e-96    
gb|ABW81042.1|  tropinone-reductase-like protein                        298   1e-95    
ref|XP_010414398.1|  PREDICTED: tropinone reductase homolog At1g0...    298   1e-95    
ref|XP_010558920.1|  PREDICTED: tropinone reductase homolog At1g0...    304   1e-95    
ref|XP_006293509.1|  hypothetical protein CARUB_v10023815mg             299   1e-95    
ref|NP_001049677.1|  Os03g0269100                                       298   1e-95    
ref|XP_009127473.1|  PREDICTED: tropinone reductase homolog At1g0...    298   2e-95    
ref|XP_010414404.1|  PREDICTED: tropinone reductase homolog At1g0...    298   2e-95    
ref|NP_180625.1|  NAD(P)-binding Rossmann-fold superfamily protein      298   2e-95    
emb|CDO98527.1|  unnamed protein product                                298   3e-95    
ref|XP_007205761.1|  hypothetical protein PRUPE_ppa010313mg             297   3e-95    
emb|CDO98526.1|  unnamed protein product                                297   3e-95    
ref|XP_006352699.1|  PREDICTED: tropinone reductase homolog At1g0...    297   3e-95    
gb|ABW81147.1|  TRL24                                                   298   3e-95    
ref|XP_009133859.1|  PREDICTED: tropinone reductase homolog At1g0...    297   4e-95    
gb|KEH22972.1|  NAD(P)-binding rossmann-fold protein                    297   4e-95    
emb|CDP09107.1|  unnamed protein product                                296   4e-95    
gb|ABW81152.1|  TRL19                                                   297   5e-95    
ref|XP_008457446.1|  PREDICTED: tropinone reductase homolog At1g0...    299   5e-95    
ref|NP_180493.1|  tropinone reductase-like protein                      297   5e-95    
emb|CDY40185.1|  BnaC04g14130D                                          296   5e-95    
emb|CDY40188.1|  BnaC04g14160D                                          296   5e-95    
gb|ABW81047.1|  tropinone-reductase-like32                              296   5e-95    
ref|XP_009140976.1|  PREDICTED: tropinone reductase homolog At1g0...    297   6e-95    
ref|XP_006305532.1|  hypothetical protein CARUB_v10010021mg             297   6e-95    
emb|CDO98529.1|  unnamed protein product                                298   7e-95    
gb|AAK97712.1|  At2g29320/F16P2.30                                      296   7e-95    
gb|ABW81122.1|  putative tropinone reductase-18                         296   7e-95    
ref|XP_004242400.2|  PREDICTED: tropinone reductase homolog             296   9e-95    



>emb|CAD20555.1| tropinone reductase I [Calystegia sepium]
Length=263

 Score =   462 bits (1189),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 221/263 (84%), Positives = 246/263 (94%), Gaps = 0/263 (0%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            MS G+GKWSLQGMTALVTGGTRGIGY I+EELAGFGAEVY C+R QN+V ECV +WREKG
Sbjct  1    MSFGQGKWSLQGMTALVTGGTRGIGYGIVEELAGFGAEVYICSRKQNEVDECVGKWREKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             KVAGSACD+SSR QREEL++ VA+HFNGKLNILVNNAGT++PKDATEF AEDYT++MGT
Sbjct  61   FKVAGSACDISSRTQREELIKNVAHHFNGKLNILVNNAGTILPKDATEFKAEDYTLIMGT  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            NFEASFHLCQLA+P+LKAS MG+IVFNSS  G +PV KTTLY+ASKGAINQ+TKNLACEW
Sbjct  121  NFEASFHLCQLAHPFLKASSMGTIVFNSSVAGIIPVFKTTLYAASKGAINQVTKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIRVNSVAPW+IRTKLVND +S+++ S+EIERMIRRTPISRPGEVGEVSSLVAFLCL
Sbjct  181  AKDNIRVNSVAPWVIRTKLVNDFDSESEGSEEIERMIRRTPISRPGEVGEVSSLVAFLCL  240

Query  826  PAASYITGQTICVDGGYTITGFP  894
            PAASYITGQTICVDGGYTITGFP
Sbjct  241  PAASYITGQTICVDGGYTITGFP  263



>sp|P50165.1|TRNH_DATST RecName: Full=Tropinone reductase homolog; AltName: Full=P29X 
[Datura stramonium]
 gb|AAA33280.1| 29kDa protein; high homology to aa sequence of tropinone reductases 
[Datura stramonium]
Length=268

 Score =   378 bits (970),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/264 (67%), Positives = 214/264 (81%), Gaps = 0/264 (0%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            +E+  G+ +WSL+GMTALVTGGTRGIGYAI+EELA FGAEVYTC+R+QND+ EC+E+WR 
Sbjct  4    REIGGGDRRWSLRGMTALVTGGTRGIGYAIVEELANFGAEVYTCSRSQNDLDECLEKWRR  63

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            KG KV+G  CDVSS  QR+ LME V + FNGKLNIL+NNAGT +PK+AT FTAEDY+I+M
Sbjct  64   KGFKVSGPVCDVSSISQRQTLMESVTSSFNGKLNILINNAGTTIPKEATNFTAEDYSIIM  123

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
            GTNFEAS++LCQLA+P LKAS   SIVFNSSA G + V  +++Y+ASKGAINQ+TK+LAC
Sbjct  124  GTNFEASYNLCQLAHPLLKASGNASIVFNSSAAGVIAVPLSSIYAASKGAINQVTKSLAC  183

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWAKD+IRVN+VAPWII T ++  A         IE +I R P+ R GE  EVSSLV +L
Sbjct  184  EWAKDSIRVNAVAPWIINTPIIEAACQVPSQKKNIESLIGRAPMKRAGEPSEVSSLVTYL  243

Query  820  CLPAASYITGQTICVDGGYTITGF  891
            CLP ASYITGQ ICVDGGYT+ GF
Sbjct  244  CLPTASYITGQIICVDGGYTVNGF  267



>ref|XP_006429154.1| hypothetical protein CICLE_v10012494mg [Citrus clementina]
 gb|ESR42394.1| hypothetical protein CICLE_v10012494mg [Citrus clementina]
Length=263

 Score =   368 bits (944),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 166/258 (64%), Positives = 212/258 (82%), Gaps = 0/258 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSL+GMTALVTGGTRGIGYAI+EEL  FGA V+TC+RN+ ++ E ++ W+ KGLKV+
Sbjct  6    EQRWSLKGMTALVTGGTRGIGYAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVS  65

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GSACD+  R +R++LME V + F+GKLNILVNNAGT +PK+ATEFT ED++ +M TNFE+
Sbjct  66   GSACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFES  125

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HL QLAYP LKAS  G+I+F SS  G + V   ++Y+++KGA+NQ+TKNLACEW KDN
Sbjct  126  AYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDN  185

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVN+VAPWIIRT L++  E D +V +   R+I RTPI RPGE  EVSS+VAFLCLPAAS
Sbjct  186  IRVNAVAPWIIRTSLIDSIEKDPRVLEHASRLIARTPIPRPGEPNEVSSVVAFLCLPAAS  245

Query  838  YITGQTICVDGGYTITGF  891
            YITGQ IC+DGGY++TGF
Sbjct  246  YITGQVICIDGGYSVTGF  263



>ref|XP_006493560.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   368 bits (944),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 166/258 (64%), Positives = 212/258 (82%), Gaps = 0/258 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSL+GMTALVTGGTRGIGYAI+EEL  FGA V+TC+RN+ ++ E ++ W+ KGLKV+
Sbjct  6    EQRWSLKGMTALVTGGTRGIGYAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVS  65

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GSACD+  R +R++LME V + F+GKLNILVNNAGT +PK+ATEFT ED++ +M TNFE+
Sbjct  66   GSACDLKIRAERQKLMEAVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFES  125

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HL QLAYP LKAS  G+I+F SS  G + V   ++Y+++KGA+NQ+TKNLACEW KDN
Sbjct  126  AYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDN  185

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVN+VAPWIIRT L++  E D +V +   R+I RTPI RPGE  EVSS+VAFLCLPAAS
Sbjct  186  IRVNAVAPWIIRTSLIDSIEKDPRVLEHASRLIARTPIPRPGEPNEVSSVVAFLCLPAAS  245

Query  838  YITGQTICVDGGYTITGF  891
            YITGQ IC+DGGY++TGF
Sbjct  246  YITGQVICIDGGYSVTGF  263



>ref|XP_010654243.1| PREDICTED: tropinone reductase homolog [Vitis vinifera]
Length=269

 Score =   365 bits (938),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 167/263 (63%), Positives = 212/263 (81%), Gaps = 0/263 (0%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            EMS    +WSLQG TALVTGGTRGIG+AI+EELA FGA V+TC+RNQ ++ E ++ W+ K
Sbjct  7    EMSSRNSRWSLQGTTALVTGGTRGIGHAIVEELAAFGATVHTCSRNQKELDEMLQVWKSK  66

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G KV+GS CDVSSRPQR +LM+ V++ F+GKLNILVNNAGT++ K   E+T ED +I+MG
Sbjct  67   GFKVSGSVCDVSSRPQRTQLMDTVSSLFDGKLNILVNNAGTVISKRTEEYTVEDVSIIMG  126

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TNFE+++HL QL YP LKAS  GSIVF SS  G + +   ++Y+ASKGA+NQ+T+NLACE
Sbjct  127  TNFESAYHLSQLGYPLLKASGRGSIVFISSVAGVMALPVISIYAASKGAMNQVTRNLACE  186

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WA+DNIRVN++APW+I T L++ A+ D    ++I+R+I RTPI R GE  EVSSLVAFLC
Sbjct  187  WAEDNIRVNTIAPWVINTSLIHKAKDDPSSEEKIKRIISRTPICRMGEPDEVSSLVAFLC  246

Query  823  LPAASYITGQTICVDGGYTITGF  891
             PAASYITGQ ICVDGGY++TGF
Sbjct  247  FPAASYITGQVICVDGGYSVTGF  269



>ref|XP_006493561.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   363 bits (932),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 162/258 (63%), Positives = 211/258 (82%), Gaps = 0/258 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSL+GMTALVTGGTRGIG+AI+EEL  FGA V+TC+RN+ ++ E ++ W+ KGLKV+
Sbjct  6    EQRWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVS  65

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GSACD+  R +R++LME V + F+GKLNILVNNAGT +PK+ATEFT ED++ +M TNFE+
Sbjct  66   GSACDLKIRAERQKLMEAVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFES  125

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HL QLAYP LKAS  G+I+F SS  G + V  +++Y+++KGA+NQ+TKNLACEW KDN
Sbjct  126  AYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLSSIYASTKGAMNQLTKNLACEWGKDN  185

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVN+VAPWIIRT L++  E D +V +   R+I RTPI RPGE  EVSS+VAFLCLPAAS
Sbjct  186  IRVNAVAPWIIRTSLIDSIEKDPRVMEHASRLIPRTPIPRPGEPNEVSSVVAFLCLPAAS  245

Query  838  YITGQTICVDGGYTITGF  891
            Y+TGQ  C+DGGY++ GF
Sbjct  246  YVTGQVFCIDGGYSVNGF  263



>emb|CBI30508.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 211/262 (81%), Gaps = 0/262 (0%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            MS    +WSLQG TALVTGGTRGIG+AI+EELA FGA V+TC+RNQ ++ E ++ W+ KG
Sbjct  1    MSSRNSRWSLQGTTALVTGGTRGIGHAIVEELAAFGATVHTCSRNQKELDEMLQVWKSKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             KV+GS CDVSSRPQR +LM+ V++ F+GKLNILVNNAGT++ K   E+T ED +I+MGT
Sbjct  61   FKVSGSVCDVSSRPQRTQLMDTVSSLFDGKLNILVNNAGTVISKRTEEYTVEDVSIIMGT  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            NFE+++HL QL YP LKAS  GSIVF SS  G + +   ++Y+ASKGA+NQ+T+NLACEW
Sbjct  121  NFESAYHLSQLGYPLLKASGRGSIVFISSVAGVMALPVISIYAASKGAMNQVTRNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            A+DNIRVN++APW+I T L++ A+ D    ++I+R+I RTPI R GE  EVSSLVAFLC 
Sbjct  181  AEDNIRVNTIAPWVINTSLIHKAKDDPSSEEKIKRIISRTPICRMGEPDEVSSLVAFLCF  240

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQ ICVDGGY++TGF
Sbjct  241  PAASYITGQVICVDGGYSVTGF  262



>ref|XP_006429155.1| hypothetical protein CICLE_v10012221mg [Citrus clementina]
 gb|ESR42395.1| hypothetical protein CICLE_v10012221mg [Citrus clementina]
Length=320

 Score =   363 bits (933),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 162/258 (63%), Positives = 211/258 (82%), Gaps = 0/258 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSL+GMTALVTGGTRGIG+AI+EEL  FGA V+TC+RN+ ++ E ++ W+ KGLKV+
Sbjct  63   EQRWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVS  122

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GSACD+  R +R++LME V + F+GKLNILVNNAGT +PK+ATEFT ED++ +M TNFE+
Sbjct  123  GSACDLKIRAERQKLMEAVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFES  182

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HL QLAYP LKAS  G+I+F SS  G + V  +++Y+++KGA+NQ+TKNLACEW KDN
Sbjct  183  AYHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLSSIYASTKGAMNQLTKNLACEWGKDN  242

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVN+VAPWIIRT L++  E D +V +   R+I RTPI RPGE  EVSS+VAFLCLPAAS
Sbjct  243  IRVNAVAPWIIRTSLIDSIEKDPRVMEHASRLIPRTPIPRPGEPNEVSSVVAFLCLPAAS  302

Query  838  YITGQTICVDGGYTITGF  891
            Y+TGQ  C+DGGY++ GF
Sbjct  303  YVTGQVFCIDGGYSVNGF  320



>emb|CBI30506.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   360 bits (923),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 211/263 (80%), Gaps = 0/263 (0%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            EMS    +WSL+GMTALVTGG+RGIG+AI+EELA FGA V+TC+RNQ ++ + ++ W+ K
Sbjct  5    EMSSRNRRWSLEGMTALVTGGSRGIGHAIVEELAAFGATVHTCSRNQEELDQRLQEWKNK  64

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G KV+ S CDVSSR QR +LME V++ F+GKL+ILVNNAGT++ K+ATE TAED++ +MG
Sbjct  65   GFKVSASLCDVSSRSQRTQLMETVSSIFDGKLSILVNNAGTIILKEATECTAEDFSTIMG  124

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TNFE+++HLCQL +P LKAS  GSIVF SS  G L    +++Y+ASKGA+NQ+TKNLACE
Sbjct  125  TNFESAYHLCQLGHPLLKASGNGSIVFISSISGLLAFPASSIYAASKGAMNQVTKNLACE  184

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKD IRVN++APWII+T L++  +    + + + R+I RTPISRPGE  EVS LVAFLC
Sbjct  185  WAKDGIRVNTIAPWIIKTSLLHVIDDHPNIKENMSRLISRTPISRPGEPDEVSPLVAFLC  244

Query  823  LPAASYITGQTICVDGGYTITGF  891
             P ASYITGQ ICVDGGY +TGF
Sbjct  245  FPVASYITGQVICVDGGYKVTGF  267



>ref|XP_002271837.2| PREDICTED: tropinone reductase homolog [Vitis vinifera]
Length=291

 Score =   359 bits (921),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 211/263 (80%), Gaps = 0/263 (0%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            EMS    +WSL+GMTALVTGG+RGIG+AI+EELA FGA V+TC+RNQ ++ + ++ W+ K
Sbjct  29   EMSSRNRRWSLEGMTALVTGGSRGIGHAIVEELAAFGATVHTCSRNQEELDQRLQEWKNK  88

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G KV+ S CDVSSR QR +LME V++ F+GKL+ILVNNAGT++ K+ATE TAED++ +MG
Sbjct  89   GFKVSASLCDVSSRSQRTQLMETVSSIFDGKLSILVNNAGTIILKEATECTAEDFSTIMG  148

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TNFE+++HLCQL +P LKAS  GSIVF SS  G L    +++Y+ASKGA+NQ+TKNLACE
Sbjct  149  TNFESAYHLCQLGHPLLKASGNGSIVFISSISGLLAFPASSIYAASKGAMNQVTKNLACE  208

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKD IRVN++APWII+T L++  +    + + + R+I RTPISRPGE  EVS LVAFLC
Sbjct  209  WAKDGIRVNTIAPWIIKTSLLHVIDDHPNIKENMSRLISRTPISRPGEPDEVSPLVAFLC  268

Query  823  LPAASYITGQTICVDGGYTITGF  891
             P ASYITGQ ICVDGGY +TGF
Sbjct  269  FPVASYITGQVICVDGGYKVTGF  291



>ref|XP_009621668.1| PREDICTED: tropinone reductase homolog [Nicotiana tomentosiformis]
Length=267

 Score =   358 bits (918),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 209/262 (80%), Gaps = 1/262 (0%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            S G+G+WSL GMTALVTGGTRGIG+AI+EELA FGA ++TC+RN+ D+ EC+E+W++KG 
Sbjct  7    SNGDGRWSLHGMTALVTGGTRGIGHAIVEELASFGATIFTCSRNKKDLDECLEKWQKKGY  66

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
            KV GS CD+ S  QR +L+EK   +FNG+L+ILVNNAG  VPK+ T+ T+ D +++MGTN
Sbjct  67   KVNGSTCDLFSEDQRNQLIEKATEYFNGRLDILVNNAGVCVPKETTKITSGDCSLMMGTN  126

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            FEAS+HLCQLAYP+LK S   SIVF SS  G + +   +LY+A+KGAINQ+TKNLACEW 
Sbjct  127  FEASYHLCQLAYPFLKVSGKASIVFISSISGIMAIPFVSLYAATKGAINQLTKNLACEWG  186

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            KDNIRVN+VAPWII T L +    D + S ++E +I+RTPISR G+  EVSSLVA+LC P
Sbjct  187  KDNIRVNAVAPWIIDTALTDSVAEDFE-SKDVENLIKRTPISRMGKPNEVSSLVAYLCFP  245

Query  829  AASYITGQTICVDGGYTITGFP  894
            AA+YITGQ ICVDGG T+ GFP
Sbjct  246  AAAYITGQIICVDGGKTVCGFP  267



>ref|XP_006355361.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=263

 Score =   358 bits (918),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 166/260 (64%), Positives = 206/260 (79%), Gaps = 1/260 (0%)
 Frame = +1

Query  115  GEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKV  294
            G+G+WSL GMTALVTGGTRGIGYAI+EELA FGA +YTC+RN+ D+ EC+E+W+ KG KV
Sbjct  5    GDGRWSLHGMTALVTGGTRGIGYAIVEELASFGASIYTCSRNKKDLDECLEKWQTKGYKV  64

Query  295  AGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFE  474
             GS CD+    QR EL++K   HFNGKL+ILVNNA   VPK+  + T+ D +++MGTNFE
Sbjct  65   NGSTCDLFLEDQRIELIDKATQHFNGKLDILVNNAAICVPKETAQITSADCSLMMGTNFE  124

Query  475  ASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKD  654
            AS++LCQLAYPYLK S   SIVF SS  G + +   +LY+A+KGAINQ+TKNLACEW KD
Sbjct  125  ASYNLCQLAYPYLKGSGKASIVFISSISGIMAIPFVSLYAATKGAINQLTKNLACEWGKD  184

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            NIRVN+VAPWII T L +    D + SD +E++I+RTPISR G+  EVSSLVA+LC PAA
Sbjct  185  NIRVNAVAPWIIDTALTDTVAEDFESSD-VEKLIKRTPISRMGKPNEVSSLVAYLCFPAA  243

Query  835  SYITGQTICVDGGYTITGFP  894
            +YITGQ ICVDGG T++GFP
Sbjct  244  AYITGQIICVDGGKTVSGFP  263



>ref|XP_006493568.1| PREDICTED: tropinone reductase homolog isoform X1 [Citrus sinensis]
Length=263

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 160/258 (62%), Positives = 210/258 (81%), Gaps = 0/258 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSL+GMTALVTGGT+GIGYA++EELA FGA V+TC+RN+ ++ + ++ W+ KGL+V+
Sbjct  6    EKRWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVS  65

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            G+ACDV  R QRE+LME V++ F+GKLNIL+NNAGT +PK+ TEFT ED++ VM TNFE+
Sbjct  66   GNACDVKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFES  125

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++H+ QLA+P LK+S  G+I+F SS  G + +   ++ ++SKGA+NQ+TKNLACEWAKD 
Sbjct  126  AYHVSQLAHPLLKSSGNGNIIFISSVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDK  185

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVNSVAPWIIRT L++    D+   ++  RMI RTPI RPGE  EVSS+VAFLC PAAS
Sbjct  186  IRVNSVAPWIIRTPLIDKVLKDSTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAAS  245

Query  838  YITGQTICVDGGYTITGF  891
            Y+TGQ ICVDGGY+ITGF
Sbjct  246  YVTGQVICVDGGYSITGF  263



>ref|XP_004237405.1| PREDICTED: tropinone reductase homolog [Solanum lycopersicum]
Length=263

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/260 (63%), Positives = 206/260 (79%), Gaps = 1/260 (0%)
 Frame = +1

Query  115  GEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKV  294
            G+G+WSL GMTALVTGGTRGIGYAI+EELA FGA +YTC+RN+ D+ EC+E+W+ KG KV
Sbjct  5    GDGRWSLHGMTALVTGGTRGIGYAIVEELASFGASIYTCSRNKKDLDECLEKWQTKGYKV  64

Query  295  AGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFE  474
             GS CD+    QR EL+ K   HFNG+L+ILVNNA   VPK+ T+ T+ D +++MGTNFE
Sbjct  65   NGSTCDLFLEDQRIELIGKATQHFNGELDILVNNAAICVPKETTQITSADCSLMMGTNFE  124

Query  475  ASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKD  654
            AS++LCQLAYP+LK S   S+VF SS  G + +   +LY+A+KGAINQ+TKNLACEW KD
Sbjct  125  ASYNLCQLAYPFLKGSGKASVVFISSISGIMAIPFVSLYAATKGAINQLTKNLACEWGKD  184

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            NIRVN+VAPWII T L +    D + SD +E++I+RTPISR G+  EVSSLVA+LC PAA
Sbjct  185  NIRVNAVAPWIIDTALTDTVAEDFESSD-VEKLIKRTPISRMGKPNEVSSLVAYLCFPAA  243

Query  835  SYITGQTICVDGGYTITGFP  894
            +YITGQ ICVDGG T++GFP
Sbjct  244  AYITGQIICVDGGKTVSGFP  263



>ref|XP_006493569.1| PREDICTED: tropinone reductase homolog isoform X2 [Citrus sinensis]
Length=261

 Score =   353 bits (907),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 160/258 (62%), Positives = 211/258 (82%), Gaps = 2/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSL+GMTALVTGGT+GIGYA++EELA FGA V+TC+RN+ ++ + ++ W+ KGL+V+
Sbjct  6    EKRWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVS  65

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            G+ACDV  R QRE+LME V++ F+GKLNIL+NNAGT +PK+ TEFT ED++ VM TNFE+
Sbjct  66   GNACDVKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFES  125

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++H+ QLA+P LK+S  G+I+F SS  G + +   ++ ++SKGA+NQ+TKNLACEWAKD 
Sbjct  126  AYHVSQLAHPLLKSSGNGNIIFISSVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDK  185

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVNSVAPWIIRT L++  + D+   ++  RMI RTPI RPGE  EVSS+VAFLC PAAS
Sbjct  186  IRVNSVAPWIIRTPLID--KKDSTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAAS  243

Query  838  YITGQTICVDGGYTITGF  891
            Y+TGQ ICVDGGY+ITGF
Sbjct  244  YVTGQVICVDGGYSITGF  261



>ref|XP_006493570.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 209/258 (81%), Gaps = 0/258 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSL+GMTALVTGGT+GIGYA++EELA FGA V+TC+RN+ ++ + ++ W+ KGL+V+
Sbjct  6    EQRWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVS  65

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+  R QRE+LME V++ F+GKLNIL+NNAGT +PK+ TEFT ED++ VM TNFE+
Sbjct  66   GSVCDLKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFES  125

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HL QLA+P LK++  G+I+F SS  G + +   ++Y++SKGA+NQ+TKNLACEWAKD 
Sbjct  126  AYHLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKGAMNQLTKNLACEWAKDK  185

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVN+VAPW+IRT L++  E D+   +   RM+ RTP+ RPGE  EVSS+VAFLCL A S
Sbjct  186  IRVNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCLSATS  245

Query  838  YITGQTICVDGGYTITGF  891
            Y+TGQ ICVDGGY++TGF
Sbjct  246  YVTGQVICVDGGYSVTGF  263



>ref|XP_006429160.1| hypothetical protein CICLE_v10012493mg [Citrus clementina]
 gb|ESR42400.1| hypothetical protein CICLE_v10012493mg [Citrus clementina]
Length=263

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 158/258 (61%), Positives = 209/258 (81%), Gaps = 0/258 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSL+GMTALVTGGT+GIGYA++EELA FGA V+TC+RN+ ++ + ++ W+ KGL+V+
Sbjct  6    EKRWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVS  65

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            G+ACD+  R QRE+LME V++ F+G LNIL+NNAGT +PK+ TEFT ED++ VM TNFE+
Sbjct  66   GNACDLKIRAQREKLMETVSSQFDGMLNILINNAGTFIPKETTEFTEEDFSTVMTTNFES  125

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++H+ QLA+P LK+S  G+I+F SS  G + +   ++ ++SKGA+NQ+TKNLACEWAKD 
Sbjct  126  AYHVSQLAHPLLKSSGNGNIIFISSVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDK  185

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVNSVAPWIIRT L++    D+   ++  RMI RTPI RPGE  EVSS+VAFLC PAAS
Sbjct  186  IRVNSVAPWIIRTPLIDKVLKDSTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAAS  245

Query  838  YITGQTICVDGGYTITGF  891
            Y+TGQ ICVDGGY+ITGF
Sbjct  246  YVTGQVICVDGGYSITGF  263



>ref|XP_004246428.1| PREDICTED: tropinone reductase homolog isoform X1 [Solanum lycopersicum]
Length=270

 Score =   353 bits (906),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/257 (65%), Positives = 204/257 (79%), Gaps = 0/257 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            +G+W+LQG TALVTGGT+GIG+AI+EELAGFGA VYTC RNQ  + EC+E+WR KG KV 
Sbjct  12   DGRWTLQGKTALVTGGTKGIGHAIVEELAGFGATVYTCCRNQEQLDECLEKWRGKGYKVE  71

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            G  CD++ R QRE LMEKV N F GKLNIL+NNAG L+ K ATEFT +DY+I+M TNFEA
Sbjct  72   GCVCDLTLRSQREMLMEKVINFFQGKLNILINNAGILIVKPATEFTEDDYSILMKTNFEA  131

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            S H+ Q+A+P LKASE G+IVF SS  G + +   ++Y+A+KGA+NQ+T++LA EWAKDN
Sbjct  132  SHHISQIAHPILKASESGNIVFISSIAGLVALPTNSIYAATKGAMNQLTRSLAYEWAKDN  191

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVN+VAPWII T L+  A+ D+   + IER I RTPI R GE  EVS++VAFLC PAAS
Sbjct  192  IRVNAVAPWIINTPLIEAAKKDSLTKELIERSISRTPICRAGEPKEVSAMVAFLCFPAAS  251

Query  838  YITGQTICVDGGYTITG  888
            YITGQ ICVDGG+TI G
Sbjct  252  YITGQVICVDGGHTING  268



>ref|XP_006429157.1| hypothetical protein CICLE_v10012496mg [Citrus clementina]
 gb|ESR42397.1| hypothetical protein CICLE_v10012496mg [Citrus clementina]
Length=263

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 209/258 (81%), Gaps = 0/258 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSL+GMTALVTGGT+GIGYA++EELA FGA V+TC+RN+ ++ + ++ W+ KGL+V+
Sbjct  6    EQRWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVS  65

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+  R QRE+LM  V++ F+GKLNIL+NNAGT +PK+ TEFT ED++ VM TNFE+
Sbjct  66   GSVCDLKIRAQREKLMLTVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFES  125

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HL QLA+P LK++  G+I+F SS  G + +   ++Y++SKGA+NQ+TKNLACEWAKD 
Sbjct  126  AYHLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKGAMNQLTKNLACEWAKDK  185

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVN+VAPW+IRT L++  E D+   +   RM+ RTP+ RPGE  EVSS+VAFLCL AAS
Sbjct  186  IRVNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCLSAAS  245

Query  838  YITGQTICVDGGYTITGF  891
            Y+TGQ ICVDGGY++TGF
Sbjct  246  YVTGQVICVDGGYSVTGF  263



>ref|XP_006341006.1| PREDICTED: tropinone reductase 1-like [Solanum tuberosum]
Length=270

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/257 (64%), Positives = 204/257 (79%), Gaps = 0/257 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            +G+W+LQG TALVTGGT+GIG+AI+EELAGFGA VYTC RNQ  + +C+ERWR KG KV 
Sbjct  12   DGRWTLQGKTALVTGGTKGIGHAIVEELAGFGAIVYTCCRNQEQLDQCLERWRGKGYKVE  71

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            G  CD++ RPQRE LMEKV N F GKLNIL+NNAG L+ K ATEFT +DY+++M TNFEA
Sbjct  72   GCVCDLTLRPQREMLMEKVINFFQGKLNILINNAGILIVKAATEFTEDDYSLIMKTNFEA  131

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            S H+ Q+A+P LKASE G+IVF SS  G + +  +++Y+A+KGA+NQ+T+NLA EWAKDN
Sbjct  132  SHHISQIAHPILKASENGNIVFISSVAGLVALPISSIYAATKGAMNQLTRNLAYEWAKDN  191

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVN+VAPWII T L+  A+ +    + +E+ I RTPI R GE  EVS++VAFLC PAAS
Sbjct  192  IRVNAVAPWIINTPLIEAAKKNPLTKERMEKSISRTPICRAGEPKEVSAMVAFLCFPAAS  251

Query  838  YITGQTICVDGGYTITG  888
            YITGQ ICVDGG TI G
Sbjct  252  YITGQVICVDGGLTING  268



>gb|KDO52384.1| hypothetical protein CISIN_1g024752mg [Citrus sinensis]
Length=263

 Score =   350 bits (898),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 154/258 (60%), Positives = 208/258 (81%), Gaps = 0/258 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSL+GMTALVTGGT+GIGYA++EELA FGA V+TC+RN+ ++ + ++ W+ KGL+V+
Sbjct  6    EQRWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVS  65

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+  R QRE+LME V++ F+GKLNIL+NNAGT +PK+ TEFT ED++ VM TNFE+
Sbjct  66   GSVCDLKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFES  125

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HL QLA+P LK++  G+I+F SS  G + +   ++Y++SK A+NQ+TKNLACEWAKD 
Sbjct  126  AYHLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKVAMNQLTKNLACEWAKDK  185

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVN+VAPW+IRT L++  E D+   +   RM+ RTP+ RPGE  EVSS+VAFLCL A S
Sbjct  186  IRVNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCLSATS  245

Query  838  YITGQTICVDGGYTITGF  891
            Y+TGQ ICVDGGY++TGF
Sbjct  246  YVTGQVICVDGGYSVTGF  263



>ref|XP_006341201.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=263

 Score =   345 bits (886),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 205/258 (79%), Gaps = 1/258 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            +G+W+LQG TA+VTGGTRGIGYAI+EELA FGA VYTC+RNQ ++ EC+ +W+ KG KV 
Sbjct  4    DGRWTLQGNTAIVTGGTRGIGYAIVEELASFGANVYTCSRNQMELDECLRKWKAKGFKVG  63

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+ SR QR++ M+ V+++F+GK+NIL+NNA  +V   ATE T EDY  +MGTNFEA
Sbjct  64   GSMCDLLSRTQRQKFMDNVSSYFDGKINILINNAAVIVSNLATESTHEDYNTMMGTNFEA  123

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            S+HL QLA+P+LKAS+ G IVF SS  GF+ +   ++YSA+KGA+NQ+T++LACEWA DN
Sbjct  124  SYHLSQLAHPFLKASKNGRIVFISSVAGFVSLPFCSIYSAAKGAMNQLTRSLACEWAMDN  183

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPI-SRPGEVGEVSSLVAFLCLPAA  834
            IRVN+VAPW+I+T L+  A  D++V   I +++ RTPI  RPGE  EVS++VAFLC P A
Sbjct  184  IRVNAVAPWVIKTSLIEAASQDSEVKKRINKLVSRTPIGGRPGEPKEVSAMVAFLCFPCA  243

Query  835  SYITGQTICVDGGYTITG  888
            SYITGQ +CVDGG TI G
Sbjct  244  SYITGQIMCVDGGITING  261



>gb|AFP55030.1| tropinone reductase I [Atropa belladonna]
Length=272

 Score =   345 bits (885),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/257 (63%), Positives = 204/257 (79%), Gaps = 1/257 (0%)
 Frame = +1

Query  121  GKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAG  300
            G+WSL+G TALVTGG++GIGYAI+EELAGFGA VYTC+RN+N+++EC++ WR+ GLKV G
Sbjct  14   GRWSLKGTTALVTGGSKGIGYAIVEELAGFGATVYTCSRNENELQECIDNWRKNGLKVEG  73

Query  301  SACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEAS  480
            S CD+  R +RE+LM+ V + FNGKL+ILVNNAG ++ K+A +FTAEDY IVMGTNFEA+
Sbjct  74   SVCDLLLRTEREKLMQTVGDAFNGKLSILVNNAGVVIHKEAKDFTAEDYNIVMGTNFEAA  133

Query  481  FHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNI  660
            +HL Q+AYP LKASE G+++F SS  GF  +   +LYSASK AINQMTKNLACEWAKDNI
Sbjct  134  YHLSQIAYPLLKASENGNVIFLSSIAGFSALPSVSLYSASKAAINQMTKNLACEWAKDNI  193

Query  661  RVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            RVNSVAP +I T LV  A + +    +EI+  I +TP+ R G   EVS+L+AFLC PAAS
Sbjct  194  RVNSVAPGVILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGNPKEVSALIAFLCFPAAS  253

Query  838  YITGQTICVDGGYTITG  888
            YITGQ I  DGG+T  G
Sbjct  254  YITGQIIWADGGFTANG  270



>ref|XP_008222026.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=264

 Score =   343 bits (881),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/261 (62%), Positives = 204/261 (78%), Gaps = 3/261 (1%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            MS  E +WSL+G+TALVTGGT+GIGYAI+EELAG GA ++TCARN+ D+ +C+ +W +KG
Sbjct  1    MSSREKRWSLEGLTALVTGGTKGIGYAIVEELAGLGATIHTCARNEVDLNDCLSQWGKKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             KV GS CDV S+ QREEL+ KV++ F+GKLNIL+NN GT +PK  TE+TAEDYT +M T
Sbjct  61   FKVTGSVCDVVSKTQREELINKVSSLFDGKLNILINNVGTNIPKPTTEYTAEDYTFLMST  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N E+++HLCQLA+P LKAS  G+IVF SS  G + +   T+YSA+KGA+NQ+ KNLACEW
Sbjct  121  NLESAYHLCQLAHPLLKASGAGNIVFLSSVAGVVSLEIGTIYSATKGAMNQLAKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR NSVAPW I+T L +      K    ++ +  RTP+ RPGE  EVS+LVAFLCL
Sbjct  181  AKDNIRTNSVAPWFIKTLLGDHFLGHEKT---LKIINSRTPLGRPGEPEEVSALVAFLCL  237

Query  826  PAASYITGQTICVDGGYTITG  888
            PAASYITGQTICVDGG T+ G
Sbjct  238  PAASYITGQTICVDGGVTVNG  258



>ref|XP_006493567.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   343 bits (881),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/260 (60%), Positives = 211/260 (81%), Gaps = 1/260 (0%)
 Frame = +1

Query  112  RGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLK  291
            RG+ +WSL+ MTALVTGGT+GIGYAI++ELA FGA V+TC+RN+ ++ + V+ W+  GLK
Sbjct  5    RGQ-RWSLKDMTALVTGGTKGIGYAIVKELAAFGAIVHTCSRNEAELNQRVQEWKSMGLK  63

Query  292  VAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNF  471
            V+GS CD+  R Q+E+LME V++ F+GKLNILVNNAG  +PK+ATEFT ED++ ++ TNF
Sbjct  64   VSGSVCDLKVRAQQEKLMETVSSLFDGKLNILVNNAGISIPKEATEFTMEDFSTIITTNF  123

Query  472  EASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAK  651
            E+++HL Q+A+P LKAS  G+I+F SS  G + +   ++Y++SKGA+N++TKNLACEWAK
Sbjct  124  ESAYHLSQIAHPLLKASGNGNIIFISSVAGVIALPMCSIYASSKGAMNELTKNLACEWAK  183

Query  652  DNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPA  831
            D IRVNSVAPW+IRT L+++ E D+   ++  R+I RTPI RP E  EVSS+VAFLC PA
Sbjct  184  DKIRVNSVAPWMIRTPLLDNFEKDSTFLEQANRLILRTPIPRPREPNEVSSVVAFLCFPA  243

Query  832  ASYITGQTICVDGGYTITGF  891
            ASY+TGQ ICVDGGY+ITGF
Sbjct  244  ASYVTGQVICVDGGYSITGF  263



>ref|XP_010920509.1| PREDICTED: tropinone reductase homolog [Elaeis guineensis]
Length=272

 Score =   343 bits (881),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/257 (63%), Positives = 206/257 (80%), Gaps = 3/257 (1%)
 Frame = +1

Query  121  GKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAG  300
            G+WSLQGMTALVTGGTRGIG+A++EELAGFGA V+TC+R + ++ EC+++W  +GL+V G
Sbjct  14   GRWSLQGMTALVTGGTRGIGHAVVEELAGFGATVHTCSRKEGELSECLKKWEAQGLRVTG  73

Query  301  SACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEAS  480
            S CDVS   +RE+LM +V++ F+GKLNIL+NNAGT + K A E+TAE+Y+ +M TN E++
Sbjct  74   SVCDVSIPDRREDLMREVSSLFDGKLNILINNAGTNIRKKAVEYTAEEYSSIMATNLESA  133

Query  481  FHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNI  660
            FHLCQLA+P+LKA+  GSIVF SS  G + V   T+Y+A+KGAINQ+TKN ACEWAKDNI
Sbjct  134  FHLCQLAHPFLKAAGRGSIVFISSVAGVVAVPSGTIYAATKGAINQLTKNFACEWAKDNI  193

Query  661  RVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASY  840
            R N VAPW IRT LV   E+  K  + +ER++ RTP+ R GE  EVSSLVAFLCLPAASY
Sbjct  194  RTNCVAPWYIRTSLV---ENVIKQEEFMERLVDRTPLGRVGEPEEVSSLVAFLCLPAASY  250

Query  841  ITGQTICVDGGYTITGF  891
            I+GQ ICVDGG ++ GF
Sbjct  251  ISGQVICVDGGMSVNGF  267



>gb|AIN39992.1| tropinone reductase I [Datura inoxia]
Length=273

 Score =   342 bits (878),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 162/258 (63%), Positives = 205/258 (79%), Gaps = 1/258 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            EG+WSL+G TALVTGG++GIGYAI+EELAG GA VYTC+RN+ ++ EC+E WR+KGL V 
Sbjct  14   EGRWSLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWRKKGLNVE  73

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+ SR +R++LM+ VA+ F+GKLNILVNNAG ++ K+A +FT EDY I+MGTNFEA
Sbjct  74   GSVCDLLSRTERDKLMQTVAHVFDGKLNILVNNAGVVIHKEAKDFTEEDYNIIMGTNFEA  133

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HL Q+AYP LKAS+ G+++F SS  GF  +   +LYSASKGAINQMTKNLACEWAKDN
Sbjct  134  AYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKNLACEWAKDN  193

Query  658  IRVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            IRVNSVAP +I T LV  A + +    +EI+  I +TP+ R G+  EVS+L+AFLC PAA
Sbjct  194  IRVNSVAPGVILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFPAA  253

Query  835  SYITGQTICVDGGYTITG  888
            SYITGQ I  DGG+T  G
Sbjct  254  SYITGQIIWADGGFTANG  271



>emb|CAQ19734.1| putative tropinone reductase I [Solanum nigrum subsp. nigrum]
Length=264

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 205/262 (78%), Gaps = 1/262 (0%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            M+    KWSL+G TALVTGG++GIGYAI+EELA FGA VYTC+RN+N+++EC+E WR+ G
Sbjct  1    MAELREKWSLKGTTALVTGGSKGIGYAIVEELANFGARVYTCSRNENELQECLEIWRKNG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
            LKV GS CD+ S  +RE+LM+ V N F+GKLNILVNNAG ++ KDA +FT EDY I+MG 
Sbjct  61   LKVEGSVCDLLSHTEREKLMKNVTNVFDGKLNILVNNAGVVIHKDAKDFTKEDYNIIMGI  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            NFEA++HL Q+AYP LKAS+ G+I+F SS  GF  +   +LYSASKGAINQ+TKNLACEW
Sbjct  121  NFEAAYHLSQIAYPLLKASQNGNIIFLSSIAGFSALPSVSLYSASKGAINQLTKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            AKDNIRVNSVAP +I T L+  A + + K  +EI+  + +TP+ R G+  EVS+++AFLC
Sbjct  181  AKDNIRVNSVAPAVILTPLIETAIKKNPKQKEEIDSFVVKTPMGRAGKPEEVSAIIAFLC  240

Query  823  LPAASYITGQTICVDGGYTITG  888
             PAASYITGQ I  DGG+T  G
Sbjct  241  FPAASYITGQIIWADGGFTANG  262



>gb|AGY46257.1| tropinone reductase I [Withania somnifera]
Length=273

 Score =   341 bits (874),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/261 (61%), Positives = 208/261 (80%), Gaps = 1/261 (0%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            + G  +WSL+G TALVTGG++GIGYAI+EELAG GA VYTC+RN+N++++C+E WREKGL
Sbjct  11   NHGRSRWSLKGTTALVTGGSKGIGYAIVEELAGLGATVYTCSRNENELQQCLEIWREKGL  70

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
            KV GS CD+  R +RE+LM+ VA+ F+GKLNILVNNAG ++ K+A +FT +DY I+MGTN
Sbjct  71   KVEGSICDLLVRTEREKLMQTVADVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTN  130

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            FEA++HL Q+AYP LKAS+ G+++F SS  GF  +   +LYSASKGAINQMTKNLACEWA
Sbjct  131  FEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKNLACEWA  190

Query  649  KDNIRVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            KDNIRVNSVAP +I T LV  A + + +  DEI+  + +TP+ R G+  EV++++AFLC 
Sbjct  191  KDNIRVNSVAPGVIVTPLVEAAIKKNPQQKDEIDNFVVKTPMGRAGKPEEVAAVIAFLCF  250

Query  826  PAASYITGQTICVDGGYTITG  888
            PAASY+TGQ I  DGG+T  G
Sbjct  251  PAASYVTGQIIWADGGFTANG  271



>sp|P50162.1|TRN1_DATST RecName: Full=Tropinone reductase 1; AltName: Full=Tropine dehydrogenase; 
AltName: Full=Tropinone reductase I; Short=TR-I 
[Datura stramonium]
 pdb|1AE1|A Chain A, Tropinone Reductase-I Complex With Nadp
 pdb|1AE1|B Chain B, Tropinone Reductase-I Complex With Nadp
 gb|AAA33281.1| tropinone reductase-I [Datura stramonium]
Length=273

 Score =   340 bits (873),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/258 (62%), Positives = 205/258 (79%), Gaps = 1/258 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            EG+WSL+G TALVTGG++GIGYAI+EELAG GA VYTC+RN+ ++ EC+E WREKGL V 
Sbjct  14   EGRWSLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNVE  73

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+ SR +R++LM+ VA+ F+GKLNILVNNAG ++ K+A +FT +DY I+MGTNFEA
Sbjct  74   GSVCDLLSRTERDKLMQTVAHVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEA  133

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HL Q+AYP LKAS+ G+++F SS  GF  +   +LYSASKGAINQMTK+LACEWAKDN
Sbjct  134  AYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDN  193

Query  658  IRVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            IRVNSVAP +I T LV  A + +    +EI+  I +TP+ R G+  EVS+L+AFLC PAA
Sbjct  194  IRVNSVAPGVILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFPAA  253

Query  835  SYITGQTICVDGGYTITG  888
            SYITGQ I  DGG+T  G
Sbjct  254  SYITGQIIWADGGFTANG  271



>ref|XP_006341200.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=270

 Score =   340 bits (872),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 162/257 (63%), Positives = 199/257 (77%), Gaps = 0/257 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            +G+W+LQG TALVTGGT+GIG+AI+EELA FGA VYTC RNQ  + +C+ +WR K  KV 
Sbjct  12   DGRWTLQGKTALVTGGTKGIGHAIVEELAEFGAIVYTCCRNQEQLDQCLMKWRGKDYKVE  71

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            G  CD++ R QRE LMEKV N F GKLNIL+NN G  + K ATE+T E Y+I+M TNFEA
Sbjct  72   GCVCDLTLRLQREMLMEKVTNFFQGKLNILINNVGIQIGKPATEYTEEVYSIIMKTNFEA  131

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            S+H+ Q+A+P LKAS  GSIVF SS VGF+ +   ++YSA+KGAINQ+T+NLA EWAKDN
Sbjct  132  SYHISQIAHPILKASGSGSIVFISSVVGFVALPANSIYSATKGAINQLTRNLAYEWAKDN  191

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVN+VAPWII+T L    + +  V + +E+ I RTPISR GE  EVS++VAFLC PAAS
Sbjct  192  IRVNAVAPWIIKTSLTEALKQNPLVKELMEKNISRTPISRAGEPKEVSAMVAFLCFPAAS  251

Query  838  YITGQTICVDGGYTITG  888
            YITGQ ICVDGG TI G
Sbjct  252  YITGQVICVDGGLTING  268



>ref|XP_009630417.1| PREDICTED: tropinone reductase 1-like [Nicotiana tomentosiformis]
Length=263

 Score =   339 bits (870),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 201/256 (79%), Gaps = 1/256 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            +G+WSLQG TA+VTGGTRGIG+AI+EELA FGA VYTC+RNQ ++ EC+ +W+ KG KV 
Sbjct  4    DGRWSLQGTTAIVTGGTRGIGHAIVEELASFGANVYTCSRNQMELDECLRQWKTKGFKVE  63

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+ SR QRE+ M+ V+N+F+GK+NIL+NNAG  + K  TEFT EDY  +MG NFEA
Sbjct  64   GSVCDLLSRSQREKFMDTVSNYFDGKINILINNAGVAIAKLTTEFTHEDYNTMMGINFEA  123

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            S+HL QLA+P+L+AS  GSIVF SS  G + +   ++YSASKGA+NQ+T++LACEWAKDN
Sbjct  124  SYHLSQLAHPFLQASGNGSIVFISSVAGLVSLPLCSIYSASKGAMNQLTRSLACEWAKDN  183

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPI-SRPGEVGEVSSLVAFLCLPAA  834
            IRVN+VAPWIIRT L++ A  +    + I ++  RTPI  R GE  EVS++VAFLC P A
Sbjct  184  IRVNAVAPWIIRTSLIDVASQNPVHKENINKLTIRTPIGGRVGEPKEVSAMVAFLCFPCA  243

Query  835  SYITGQTICVDGGYTI  882
            SYITGQ +CVDGG TI
Sbjct  244  SYITGQIMCVDGGITI  259



>ref|NP_001275290.1| tropinone reductase 1-like [Solanum tuberosum]
 emb|CAC34420.1| tropinone reductase I [Solanum tuberosum]
Length=264

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/262 (61%), Positives = 206/262 (79%), Gaps = 1/262 (0%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            M+    KWSL+G TALVTGG++GIGYAI+EELA FGA VYTC+RN+N+++EC++ WR+KG
Sbjct  1    MAELREKWSLKGTTALVTGGSKGIGYAIVEELANFGARVYTCSRNENELQECLDIWRKKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
            LKV GS CD+ SR +RE+LM+ V + F+GKLNILVNNAG  + K+A +FT EDY I+MGT
Sbjct  61   LKVEGSVCDLLSRTEREKLMKTVEDVFDGKLNILVNNAGVAIHKEAKDFTKEDYNIIMGT  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            NFEA++HL Q+AYP LKAS+ G+++F SS  GF  +   +LYSASKGAINQMTKNLACEW
Sbjct  121  NFEAAYHLSQIAYPLLKASQNGNVIFVSSIAGFSALPSLSLYSASKGAINQMTKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            AKDNIRVNSVAP +I T LV  A + + +  +EI+  + +TP+ R G+  E S+++AFLC
Sbjct  181  AKDNIRVNSVAPAVILTPLVETAIKKNPQQKEEIDSFVVKTPLGRAGKPEEASAVIAFLC  240

Query  823  LPAASYITGQTICVDGGYTITG  888
             PAASYITGQ I  DGG+T  G
Sbjct  241  FPAASYITGQIIWADGGFTANG  262



>gb|AGL76989.1| tropinone reductase I [Anisodus luridus]
Length=273

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 205/265 (77%), Gaps = 1/265 (0%)
 Frame = +1

Query  97   YQEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWR  276
            Y   + G  +WSL+G TALVTGG++GIGYA++EELAGFGA VYTC+RN+ ++++C+E W 
Sbjct  7    YMNGNHGGTRWSLKGTTALVTGGSKGIGYAVVEELAGFGATVYTCSRNEKELQQCLEIWS  66

Query  277  EKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIV  456
            ++GLKV GS CD+  R +RE+LM+ V + FNGKLNILVNNAG ++ K+A +FT EDY IV
Sbjct  67   KEGLKVEGSVCDLLLRSEREKLMQAVGDLFNGKLNILVNNAGVVIHKEAKDFTEEDYNIV  126

Query  457  MGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLA  636
            MGTNFEA++HL QLAYP LKASE G+++F SS  GF  +   +LYSASK AINQMTKNLA
Sbjct  127  MGTNFEAAYHLSQLAYPLLKASENGNVIFLSSIAGFSALPSVSLYSASKAAINQMTKNLA  186

Query  637  CEWAKDNIRVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVA  813
            CEWAK+NIRVNSVAP II T LV  A + +    +EI+  I +TP+ R G+  EVS+L+A
Sbjct  187  CEWAKENIRVNSVAPGIILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGKPKEVSALIA  246

Query  814  FLCLPAASYITGQTICVDGGYTITG  888
            FLC PAASYITGQ I  DGG+T  G
Sbjct  247  FLCFPAASYITGQIIWADGGFTANG  271



>ref|XP_004246864.1| PREDICTED: tropinone reductase homolog [Solanum lycopersicum]
Length=263

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 203/258 (79%), Gaps = 1/258 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            +G+W+LQG TA+VTGGTRGIG+AI+EELA FGA VYTC+RNQ ++ EC+ +W+ KG  V 
Sbjct  4    DGRWTLQGNTAIVTGGTRGIGHAIVEELASFGANVYTCSRNQMELDECLRQWKAKGYTVG  63

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+ SR QR + M+ V+++F GK+NIL+NNA  +V   ATE+T EDY  +MGTNFEA
Sbjct  64   GSMCDLQSRSQRLKFMDNVSSYFEGKINILINNAAVVVSNIATEYTHEDYNTMMGTNFEA  123

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            S+HL QLA+P+LKAS+ G IVF SS  GF+ +   ++YSA+KGAINQ+T++LACEWA DN
Sbjct  124  SYHLSQLAHPFLKASKNGRIVFISSVAGFVSLPLCSIYSAAKGAINQLTRSLACEWAMDN  183

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPI-SRPGEVGEVSSLVAFLCLPAA  834
            IRVN+VAPW+I+T L+  A  D +++  I +++ RTPI  R GE  EVS++VAFLCLP A
Sbjct  184  IRVNAVAPWVIKTSLIEAASKDLEMNKRINKLVSRTPIGGRAGEPKEVSAMVAFLCLPCA  243

Query  835  SYITGQTICVDGGYTITG  888
            SYITGQ +CVDGG TI G
Sbjct  244  SYITGQIMCVDGGITING  261



>ref|XP_009375951.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=264

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/262 (61%), Positives = 203/262 (77%), Gaps = 3/262 (1%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            M+  EG+WSL+GMTALVTGGT+GIGYAI+EELAG GA V+TC+RN+ D+ +C  +W++KG
Sbjct  1    MNSREGRWSLRGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCQSQWKKKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             +V GS CDV S+ QREEL+ KV++ F+GKLNI +NN GT+VPK   E+TAEDY+ +M T
Sbjct  61   FQVTGSVCDVVSKTQREELINKVSSLFDGKLNIFINNVGTVVPKATLEYTAEDYSFMMST  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N E++++LCQL +P LKAS + +IVF SS  G +  +  ++YSA+KGA+NQ+ KNLACEW
Sbjct  121  NLESAYNLCQLTHPLLKASGVANIVFVSSVAGVVSASVGSIYSATKGAMNQLAKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR NSVAPW IRT LV     D K   ++E +  R P+ RPGE  EVSSLVAFLCL
Sbjct  181  AKDNIRTNSVAPWFIRTPLVEPFLRDEK---KLEMINSRCPLGRPGEPKEVSSLVAFLCL  237

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQTI VDGG T+ G 
Sbjct  238  PAASYITGQTIIVDGGVTVNGL  259



>gb|AGB56644.1| tropinone reductase I [Withania coagulans]
Length=273

 Score =   338 bits (868),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/261 (60%), Positives = 206/261 (79%), Gaps = 1/261 (0%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            + G  +WSL+G TALVTGG++GIGYA +EELAG GA VYTC+RN+N++++C+E WREKG 
Sbjct  11   NHGRSRWSLKGTTALVTGGSKGIGYATVEELAGLGATVYTCSRNENELQQCLEIWREKGF  70

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
            KV GS CD+  R + E+LM+ VA+ F+GKLNILVNNAG ++ K+A +FT +DY I+MGTN
Sbjct  71   KVEGSICDLLVRTEHEKLMQTVADVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTN  130

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            FEA++HL Q+AYP LKAS+ G+++F SS  GF  +   +LYSASKGAINQMTKNLACEWA
Sbjct  131  FEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKNLACEWA  190

Query  649  KDNIRVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            KDNIRVNSVAP +I T LV  A + + +  DEI+  + +TP+ R G+ GEV++++AFLC 
Sbjct  191  KDNIRVNSVAPGVIVTPLVEAAIKKNPQQKDEIDNFVVKTPMGRAGKPGEVAAVIAFLCF  250

Query  826  PAASYITGQTICVDGGYTITG  888
            PAASY+TGQ I  DGG+T  G
Sbjct  251  PAASYVTGQIIWADGGFTANG  271



>gb|EYU19938.1| hypothetical protein MIMGU_mgv1a012090mg [Erythranthe guttata]
Length=262

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/260 (62%), Positives = 196/260 (75%), Gaps = 3/260 (1%)
 Frame = +1

Query  115  GEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKV  294
            G  +WSL G TALVTGGTRGIGYA +EELA  GA VYTC+RNQ ++ + ++ W  KG KV
Sbjct  5    GSSRWSLSGTTALVTGGTRGIGYATVEELAEMGATVYTCSRNQEELTQRLQEWSSKGFKV  64

Query  295  AGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFE  474
            +GS CD SSR QR +LMEKV++ FNGKLNIL+NN GT + K   E+TAE+Y+ +M TN E
Sbjct  65   SGSVCDASSREQRVQLMEKVSSSFNGKLNILINNVGTNIRKPTVEYTAEEYSSIMTTNLE  124

Query  475  ASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKD  654
            +S+HLCQLA+P LKAS   SIVF SS  G + +   ++Y A+KGAINQ+TKNLACEWAKD
Sbjct  125  SSYHLCQLAHPLLKASANSSIVFISSVAGLVHLYTGSIYGATKGAINQLTKNLACEWAKD  184

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            NIRVN VAPW I+T LV     + +    +E ++ RTP+ RPGE  EVSSLVAFLCLPAA
Sbjct  185  NIRVNCVAPWYIKTSLVKHLLENEEF---LEHVVSRTPLKRPGEPQEVSSLVAFLCLPAA  241

Query  835  SYITGQTICVDGGYTITGFP  894
            SYITGQ I VDGG+T+  FP
Sbjct  242  SYITGQVISVDGGFTVNAFP  261



>ref|XP_009421329.1| PREDICTED: tropinone reductase homolog [Musa acuminata subsp. 
malaccensis]
Length=271

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 156/256 (61%), Positives = 200/256 (78%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GMTALVTGGTRGIG+A++EELAG GA V+TC+R + D+ EC+ +W  KG +V GS
Sbjct  15   RWSLGGMTALVTGGTRGIGHAVVEELAGLGASVHTCSRKEADLTECLRKWAAKGFRVTGS  74

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD+SSR QR++L+ +V+  FNGKLNILVNN GT + K   E++AE+Y+ +M TN E+++
Sbjct  75   VCDLSSREQRDQLIREVSATFNGKLNILVNNVGTNIRKPTVEYSAEEYSFLMATNLESAY  134

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HLCQLA+P LKAS MGSIVF SS  G + ++  ++Y+A+K A+NQMTKNLACEWAKDNIR
Sbjct  135  HLCQLAHPLLKASGMGSIVFISSVAGVVALSSGSIYAAAKAAMNQMTKNLACEWAKDNIR  194

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             NSV+PW I+TKLV    +D    D ++R+I RTP+ R GE  EVSSLV +LCLPAASYI
Sbjct  195  TNSVSPWYIKTKLVEHLLND---KDSLQRIIDRTPLGRVGEPEEVSSLVGYLCLPAASYI  251

Query  844  TGQTICVDGGYTITGF  891
            TGQ I VDGG T+ GF
Sbjct  252  TGQIISVDGGMTVNGF  267



>ref|XP_007205726.1| hypothetical protein PRUPE_ppa010064mg [Prunus persica]
 gb|EMJ06925.1| hypothetical protein PRUPE_ppa010064mg [Prunus persica]
Length=266

 Score =   338 bits (866),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/260 (62%), Positives = 201/260 (77%), Gaps = 7/260 (3%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSL+G+TALVTGGT+GIG+AI+EELAG GA ++TCARN+ D+ +C+ +W +KG +V 
Sbjct  7    ERRWSLEGLTALVTGGTKGIGHAIVEELAGLGATIHTCARNEVDLNDCLSQWEKKGFQVT  66

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDV SR QREEL+ KV++ F+GKLNIL+NN GT + K   EFTAEDYT +M TN E+
Sbjct  67   GSVCDVVSRAQREELINKVSSLFDGKLNILINNVGTSILKPTMEFTAEDYTFLMSTNLES  126

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++H CQLA+P LKAS  G+IVF SS  G + V   + YSA+KGAINQ+ KNLACEWAKDN
Sbjct  127  AYHFCQLAHPLLKASGAGNIVFLSSVAGVVSVEVGSAYSATKGAINQLAKNLACEWAKDN  186

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMI--RRTPISRPGEVGEVSSLVAFLCLPA  831
            IR+NSVAPW I+T L     ++  +SDE    I   RTP+ RPGE  EVS+LVAFLCLPA
Sbjct  187  IRINSVAPWFIKTPL-----AEHFLSDEFFLKIINSRTPLGRPGEPEEVSALVAFLCLPA  241

Query  832  ASYITGQTICVDGGYTITGF  891
            ASYITGQTICVDGG T+ G 
Sbjct  242  ASYITGQTICVDGGMTVNGL  261



>gb|ACB71202.1| tropinone reductase I [Anisodus acutangulus]
Length=273

 Score =   338 bits (866),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 205/265 (77%), Gaps = 1/265 (0%)
 Frame = +1

Query  97   YQEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWR  276
            Y   + G  +WSL+G TALVTGG++GIGYA++EELAGFGA VYTC+RN+ ++++C+E W 
Sbjct  7    YMNGNHGGTRWSLKGTTALVTGGSKGIGYAVVEELAGFGATVYTCSRNEKELQQCLEIWS  66

Query  277  EKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIV  456
            ++GLKV GS CD+  R +RE+LM+ V + FNGKLNILVNNAG ++ K+A +FT EDY IV
Sbjct  67   KEGLKVEGSVCDLLLRSEREKLMQAVGDLFNGKLNILVNNAGVVIHKEAKDFTEEDYNIV  126

Query  457  MGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLA  636
            MGTNFEA++HL QLAYP LKASE G+++F SS  GF  +   +LYSASK AINQMTKNLA
Sbjct  127  MGTNFEAAYHLSQLAYPLLKASENGNVIFLSSIAGFSALPSVSLYSASKAAINQMTKNLA  186

Query  637  CEWAKDNIRVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVA  813
            CEWAK+NIRVNSVAP II T LV  A + +    +EI+  I +TP+ R G+  EVS+L++
Sbjct  187  CEWAKENIRVNSVAPGIILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGKPKEVSALIS  246

Query  814  FLCLPAASYITGQTICVDGGYTITG  888
            FLC PAASYITGQ I  DGG+T  G
Sbjct  247  FLCFPAASYITGQIIWADGGFTANG  271



>ref|XP_002520507.1| tropinone reductase, putative [Ricinus communis]
 gb|EEF41920.1| tropinone reductase, putative [Ricinus communis]
Length=268

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 198/263 (75%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E SR + +WSL+GMTALVTGGT+GIG+AI+EELAG GAEVYTC+RN+  + EC+ +W+ K
Sbjct  2    ESSRKDSRWSLEGMTALVTGGTKGIGHAIVEELAGLGAEVYTCSRNEVQLNECIHKWKAK  61

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G KV GS CDVSSR  RE+LM ++++ FN KLNIL+NN GT + K   ++TAED++ ++ 
Sbjct  62   GFKVTGSVCDVSSRANREDLMNRISSLFNRKLNILINNVGTNIGKPTVKYTAEDFSYLVN  121

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TNFE+++HL QLA P LK S  GSIVF SS  G L V   T+Y A+K A+NQ+TKNLACE
Sbjct  122  TNFESAYHLSQLAQPLLKGSGAGSIVFMSSVSGVLSVNVGTIYGATKAAMNQLTKNLACE  181

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKDNIR N VAPW IRT L     +  + S+ I     RTP+ R GE  EVSSLVAFLC
Sbjct  182  WAKDNIRTNCVAPWFIRTPLTEQDLNHERFSNSIA---ARTPMGRVGEAEEVSSLVAFLC  238

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPAASYITGQTICVDGG T+ GF
Sbjct  239  LPAASYITGQTICVDGGMTVNGF  261



>ref|XP_010033094.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW52634.1| hypothetical protein EUGRSUZ_J02006 [Eucalyptus grandis]
Length=279

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 202/265 (76%), Gaps = 3/265 (1%)
 Frame = +1

Query  97   YQEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWR  276
            Y   +  + +WSL GMTALVTGGT+GIG+AI+EEL G G+ V+TC+RN+ ++ EC++ W+
Sbjct  13   YSSSNDNKNRWSLHGMTALVTGGTKGIGHAIVEELGGLGSTVHTCSRNEAEINECLKDWK  72

Query  277  EKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIV  456
             KG +V+GS CDVSSR +RE+LM  V++ F+GKLNIL+NN GT   K   ++TAED++ +
Sbjct  73   SKGFRVSGSTCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFI  132

Query  457  MGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLA  636
            M  NFE+++HL QLA+P LKAS  GSIVF SS  G + +   ++YSA+KGA+NQ+TKNLA
Sbjct  133  MTINFESAYHLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLA  192

Query  637  CEWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAF  816
            CEWAKDNIR NSVAPW I T L     SD K  +E+   I RTP+ R GE  EVSSLVAF
Sbjct  193  CEWAKDNIRSNSVAPWFILTPLAEPVLSDEKFHEEV---IARTPLGRTGEPEEVSSLVAF  249

Query  817  LCLPAASYITGQTICVDGGYTITGF  891
            LCLPAASYITGQTICVDGG+T+ GF
Sbjct  250  LCLPAASYITGQTICVDGGFTVNGF  274



>ref|XP_008222016.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=264

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 201/262 (77%), Gaps = 3/262 (1%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            MS  E +WSL+G+TALVTGGT+GIGYAI+EELAGFGA ++TCARN+ D+ +C+ +W  KG
Sbjct  1    MSSRERRWSLEGLTALVTGGTKGIGYAIVEELAGFGATIHTCARNEVDLNDCLSQWENKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             KV GS CDV S+ QREEL+ K+++ F+GKLNIL++N GT + K  TEFTAEDYT +M T
Sbjct  61   FKVTGSVCDVVSKSQREELINKLSSLFDGKLNILISNVGTNITKPTTEFTAEDYTFLMST  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N E++++LCQLA+P LKAS  G+IVF SS  G   +   ++YSA+KGAINQ+ KNLACEW
Sbjct  121  NLESAYNLCQLAHPLLKASGAGNIVFVSSVAGVTSLEVGSIYSAAKGAINQLAKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR NSVAPW I T L +    + K    ++ +  RTP+ RPGE  EVSSLVAFLCL
Sbjct  181  AKDNIRTNSVAPWFITTPLADHFLGNEK---SLKIIKSRTPLRRPGEPEEVSSLVAFLCL  237

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQTI VDGG T+ G 
Sbjct  238  PAASYITGQTISVDGGVTVNGL  259



>dbj|BAA13547.1| tropinone reductase-I [Hyoscyamus niger]
 dbj|BAA85844.1| tropinone reductase-I [Hyoscyamus niger]
Length=274

 Score =   336 bits (862),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 207/265 (78%), Gaps = 1/265 (0%)
 Frame = +1

Query  97   YQEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWR  276
            Y   + G  +WSL+G TALVTGG++GIGYA++EELAG GA VYTC+RN+ ++++C++ WR
Sbjct  8    YINGNNGGIRWSLKGTTALVTGGSKGIGYAVVEELAGLGARVYTCSRNEKELQQCLDIWR  67

Query  277  EKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIV  456
             +GL+V GS CD+  R +R++LM+ VA+ FNGKLNILVNNAG ++ K+A +FT EDY IV
Sbjct  68   NEGLQVEGSVCDLLLRSERDKLMQTVADLFNGKLNILVNNAGVVIHKEAKDFTKEDYDIV  127

Query  457  MGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLA  636
            +GTNFEA++HLCQLAYP+LKAS+ G+++F SS  GF  +   +LYSASK AINQ+TKNLA
Sbjct  128  LGTNFEAAYHLCQLAYPFLKASQNGNVIFLSSIAGFSALPSVSLYSASKAAINQITKNLA  187

Query  637  CEWAKDNIRVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVA  813
            CEWAKDNIRVNSVAP +I T L+  A + +    +EI+  I +TP+ R G+  EVS+L+A
Sbjct  188  CEWAKDNIRVNSVAPGVILTPLIETAIKKNPHQKEEIDNFIVKTPMGRAGKPNEVSALIA  247

Query  814  FLCLPAASYITGQTICVDGGYTITG  888
            FLC PAASYITGQ I  DGG+T  G
Sbjct  248  FLCFPAASYITGQIIWADGGFTANG  272



>ref|XP_010033096.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW52638.1| hypothetical protein EUGRSUZ_J02011 [Eucalyptus grandis]
Length=279

 Score =   337 bits (863),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 201/258 (78%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSL GMTALVTGGT+GIG+AI+EELA  GA V+TC+RN+ ++ EC++ W+ KG +V+
Sbjct  20   KNRWSLHGMTALVTGGTKGIGHAIVEELARLGATVHTCSRNEAEINECLKDWKSKGFRVS  79

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDVSSR +RE+LM  V++ F+GKLNIL+NN GT   K   ++TAED++ +M TNFE+
Sbjct  80   GSTCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFIMTTNFES  139

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HL QLA+P LKAS  GSIVF SS  G + +   ++YSA+KGA+NQ+TKNLACEWAKDN
Sbjct  140  AYHLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLACEWAKDN  199

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NSVAPW I T L     SD K  +E+   I RTP+ R GE  EVSSLVAFLCLPAAS
Sbjct  200  IRSNSVAPWFILTPLAEPLLSDKKFHEEV---IARTPLGRTGEPEEVSSLVAFLCLPAAS  256

Query  838  YITGQTICVDGGYTITGF  891
            YITGQTICVDGG+T+ GF
Sbjct  257  YITGQTICVDGGFTVNGF  274



>ref|XP_009794560.1| PREDICTED: tropinone reductase homolog [Nicotiana sylvestris]
Length=268

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/266 (62%), Positives = 211/266 (79%), Gaps = 2/266 (1%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
             E + G+G+WSL GMTALVTGGTRGIG+AI+EELA FGA ++TC+RN+ D+ EC+E+W++
Sbjct  4    NENNNGDGRWSLHGMTALVTGGTRGIGHAIVEELASFGATIFTCSRNKKDLIECLEKWQK  63

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            KG KV GS CD+ S  +R +L+EK   +FNGKL+ILVNNAG  VPK+ T+ T+ D ++++
Sbjct  64   KGYKVNGSTCDLFSEDERNQLIEKATEYFNGKLDILVNNAGICVPKETTKTTSGDCSLMI  123

Query  460  GTNFEASFHLCQLAYPYLKAS-EMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLA  636
            GTNFEAS+HLCQLAYP+LK S +  SIVF SS  G + +   +LY+A+KGAINQ+TKNLA
Sbjct  124  GTNFEASYHLCQLAYPFLKVSGKASSIVFISSISGIMAIPFVSLYAATKGAINQLTKNLA  183

Query  637  CEWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAF  816
            CEW KDNIRVN+VAPWII T L +    D + S ++E +I+RTPISR G+  EVSSLVA+
Sbjct  184  CEWGKDNIRVNAVAPWIIDTALTDTVAEDFE-SKDVENLIKRTPISRMGKPNEVSSLVAY  242

Query  817  LCLPAASYITGQTICVDGGYTITGFP  894
            LC PAASYITGQ ICVDGG T+ GFP
Sbjct  243  LCFPAASYITGQIICVDGGKTVCGFP  268



>ref|XP_004249378.1| PREDICTED: tropinone reductase 1 isoform X2 [Solanum lycopersicum]
Length=264

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 206/262 (79%), Gaps = 1/262 (0%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            M+    KWSL+G TALVTGG++GIGYAI+EELA FGA VYTC+RN+N++++C++ WR+KG
Sbjct  1    MAELREKWSLEGTTALVTGGSKGIGYAIVEELANFGARVYTCSRNENELQKCLDIWRKKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
            LKV GS CD+ S  +RE+LM+ + + F+GKLNILVNNAG ++ K+A +FT EDY I+MGT
Sbjct  61   LKVEGSVCDLLSHTEREKLMKNIEDVFDGKLNILVNNAGVVIYKEAKDFTKEDYNIIMGT  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            NFEA +HL Q+AYP LK+S+ G+I+F SS  GF  +   +LYSASKGAINQMTKNLACEW
Sbjct  121  NFEAGYHLSQIAYPLLKSSQNGNIIFVSSIAGFSALPSLSLYSASKGAINQMTKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            AKDNIRVNSVAP +I T L+  A + + +  +EI+  + +TP+ R G+  EVS++VAFLC
Sbjct  181  AKDNIRVNSVAPAVILTPLIETAIKKNPQQKEEIDSFVVKTPLGRAGKPEEVSAVVAFLC  240

Query  823  LPAASYITGQTICVDGGYTITG  888
             PAASYITGQ I  DGG+T  G
Sbjct  241  FPAASYITGQIIWADGGFTANG  262



>emb|CAB88214.1| putative tropinone reductase [Solanum tuberosum]
Length=264

 Score =   335 bits (859),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 157/262 (60%), Positives = 206/262 (79%), Gaps = 1/262 (0%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            M+    KW L+G TALVTGG++GIGYAI+EELA FGA VYTC+RN+N+++EC++ WR+KG
Sbjct  1    MAELREKWCLKGTTALVTGGSKGIGYAIVEELANFGARVYTCSRNENELQECLDIWRKKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
            LKV GS CD+ SR +RE+LM+ + + F+GKLNILVNNAG  + K+A +FT EDY I+MGT
Sbjct  61   LKVEGSVCDLLSRTEREKLMKTIEDVFDGKLNILVNNAGVAIHKEAKDFTKEDYNIIMGT  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            NFEA++HL Q+AYP LKAS+ G+++F SS  GF  +   +LYSASKGAINQMTKNLACEW
Sbjct  121  NFEAAYHLSQIAYPLLKASQNGNVIFVSSIAGFSALPSLSLYSASKGAINQMTKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            AKDNIRVNSVAP +I T  +  A + + +  +EI+ ++ +TP+ R G+  EVS+++AFLC
Sbjct  181  AKDNIRVNSVAPAVILTPQIETAIKKNPQQKEEIDSIVVKTPLGRAGKPEEVSAVIAFLC  240

Query  823  LPAASYITGQTICVDGGYTITG  888
             PAASYITGQ I  DGG+T  G
Sbjct  241  FPAASYITGQIIWADGGFTANG  262



>ref|XP_009772417.1| PREDICTED: tropinone reductase homolog [Nicotiana sylvestris]
Length=263

 Score =   335 bits (859),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 156/256 (61%), Positives = 199/256 (78%), Gaps = 1/256 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            +G+WSLQG TA+VTGGTRGIG+AI+EELA FGA VYTC+RNQ ++ EC+ +W+ KG KV 
Sbjct  4    DGRWSLQGTTAIVTGGTRGIGHAIVEELASFGANVYTCSRNQMELDECLRQWKTKGSKVE  63

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+ SR QRE+ M+ V+++F+GK+NIL+NNA   + K  TEFT EDY  +MG NFEA
Sbjct  64   GSVCDLLSRSQREKFMDTVSSYFDGKINILINNAAVAIAKLTTEFTHEDYNTMMGINFEA  123

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            S+HL QLA+P+LKAS  GSIVF SS  G + +   ++YSASKGA+NQ+ ++LACEWAKDN
Sbjct  124  SYHLSQLAHPFLKASGNGSIVFISSVAGLVSLPLCSIYSASKGAMNQLARSLACEWAKDN  183

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPI-SRPGEVGEVSSLVAFLCLPAA  834
            IRVN+VAPWIIRT L++ A  +    + I ++  RTPI  R GE  EVS++VAFLC P A
Sbjct  184  IRVNAVAPWIIRTSLIDAASQNPVHKENINKLTSRTPIGGRVGEPKEVSAMVAFLCFPCA  243

Query  835  SYITGQTICVDGGYTI  882
            SYITGQ +CVDGG TI
Sbjct  244  SYITGQIMCVDGGITI  259



>ref|XP_010256814.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Nelumbo nucifera]
Length=269

 Score =   335 bits (859),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 201/263 (76%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E S  + +W L+GMTALVTGGTRGIG+AI+EELAG GA V+TC+R ++++  C+  W  K
Sbjct  5    ESSSRDSRWYLKGMTALVTGGTRGIGHAIVEELAGLGATVHTCSRKEDELNGCLRDWASK  64

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G +V+GS CDVSSRPQRE+L+E V++ F+GKLNIL+NNAGT + K   E+TAE+++ ++ 
Sbjct  65   GFRVSGSVCDVSSRPQREKLIETVSSVFSGKLNILINNAGTNIRKPTIEYTAEEFSTLIA  124

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN E+++HLCQLAYP LK S +GSIVF SS  G + +   T+Y ASKGAINQ+TKNLACE
Sbjct  125  TNLESAYHLCQLAYPLLKLSGVGSIVFISSVAGVVALGSGTVYGASKGAINQLTKNLACE  184

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKDNIR N VAPW IRT LV     + +  D +   I RTP+ RPGE  EVSSLVAFLC
Sbjct  185  WAKDNIRTNCVAPWYIRTSLVEHLLDNKEFLDTV---IARTPLRRPGEPKEVSSLVAFLC  241

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPA+SYITGQ I VDGG T+ GF
Sbjct  242  LPASSYITGQVISVDGGMTVNGF  264



>ref|XP_006424908.1| hypothetical protein CICLE_v10029047mg [Citrus clementina]
 ref|XP_006488390.1| PREDICTED: tropinone reductase homolog At1g07440-like [Citrus 
sinensis]
 gb|ESR38148.1| hypothetical protein CICLE_v10029047mg [Citrus clementina]
 gb|KDO66644.1| hypothetical protein CISIN_1g024230mg [Citrus sinensis]
Length=270

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 196/258 (76%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSLQGMTALVTGGT+G+G A++EEL+  GA V+TC+R + ++ EC+   + KGLKV 
Sbjct  13   QNRWSLQGMTALVTGGTKGLGLAVVEELSMLGATVHTCSRTETELNECIHHLQMKGLKVT  72

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDVSSRPQR+ L+  V++ FNGKLNI VNN GT V K   E+ AED+++VM TNFE+
Sbjct  73   GSVCDVSSRPQRQTLINTVSSLFNGKLNIFVNNVGTSVLKPTLEYNAEDFSLVMSTNFES  132

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            +FHLCQLA+P L+AS   SIV  SSA+G +     T+YSA+KGA+NQ+ KNLACEWAKDN
Sbjct  133  AFHLCQLAHPLLRASGAASIVLMSSALGIVSANVGTVYSATKGAMNQLAKNLACEWAKDN  192

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NSVAPW IRT        + K  DE++    RTP+ R GE  EVSSLVAFLC+PAAS
Sbjct  193  IRTNSVAPWYIRTPFTEPLLGNGKFVDEVK---SRTPMGRLGEPKEVSSLVAFLCMPAAS  249

Query  838  YITGQTICVDGGYTITGF  891
            YITGQT+C+DGG+T+ GF
Sbjct  250  YITGQTVCIDGGFTVNGF  267



>gb|AIN39993.1| tropinone reductase I [Brugmansia arborea]
Length=272

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/260 (61%), Positives = 204/260 (78%), Gaps = 1/260 (0%)
 Frame = +1

Query  112  RGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLK  291
            + E +WSL+G TALVTGG++GIGYAI+EELAG GA VYTC+RN+ +++EC++ WR+ GL 
Sbjct  11   KNEERWSLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELQECLDFWRKNGLN  70

Query  292  VAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNF  471
            V GS CD+ SR +RE+LM+ VA+ F+ KLNILVNNAG ++ K+A +FT EDY I+MGTNF
Sbjct  71   VEGSVCDLLSRTEREKLMQTVAHIFDEKLNILVNNAGVVIHKEAKDFTEEDYNIIMGTNF  130

Query  472  EASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAK  651
            EA++HL Q+AYP LKAS+ G+++F SS  GF  +   +LYSASKGAINQMTK+LACEWAK
Sbjct  131  EAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAK  190

Query  652  DNIRVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            DNIRVNSVAP +I T LV  A + +    +EI+  I +TP+ R G+  EVS+L+AFLC P
Sbjct  191  DNIRVNSVAPGVILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFP  250

Query  829  AASYITGQTICVDGGYTITG  888
            AASYITGQ I  DGG+T  G
Sbjct  251  AASYITGQIIWADGGFTANG  270



>ref|XP_008801625.1| PREDICTED: tropinone reductase homolog At1g07440-like [Phoenix 
dactylifera]
Length=332

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/257 (61%), Positives = 198/257 (77%), Gaps = 3/257 (1%)
 Frame = +1

Query  121  GKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAG  300
            G+WSLQGMTALVTGGTRGIG+A++EELAG GA V+TC+R + ++ EC+ +W  +GL+V G
Sbjct  77   GRWSLQGMTALVTGGTRGIGHAVVEELAGLGATVHTCSRKEGELSECLNKWEAQGLRVTG  136

Query  301  SACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEAS  480
            S CD+S   QR++LM KV++ F+GKLNIL+NN GT + K A E+TAE+Y+ +M TN E++
Sbjct  137  SVCDLSVPDQRDDLMRKVSSLFDGKLNILINNVGTNIRKKAIEYTAEEYSFIMATNLESA  196

Query  481  FHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNI  660
            FHLCQLA+P LKAS  GSIVF SS  G + V   T+Y+A+KGAINQ+TKN ACEWAKDNI
Sbjct  197  FHLCQLAHPLLKASGRGSIVFISSVAGVVAVPSGTIYAATKGAINQLTKNFACEWAKDNI  256

Query  661  RVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASY  840
            R NSVAPW IRT LV +   D +    +ER + RTP+ R GE  EVSSLVAFLCLPAASY
Sbjct  257  RTNSVAPWYIRTSLVENVIKDEEF---MERFVHRTPLGRVGEPEEVSSLVAFLCLPAASY  313

Query  841  ITGQTICVDGGYTITGF  891
            I GQ I  DGG ++ GF
Sbjct  314  INGQVIIADGGMSVNGF  330



>ref|XP_002308174.2| hypothetical protein POPTR_0006s09080g [Populus trichocarpa]
 gb|EEE91697.2| hypothetical protein POPTR_0006s09080g [Populus trichocarpa]
Length=275

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/264 (60%), Positives = 201/264 (76%), Gaps = 2/264 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E+S  E +WSL+GMTALVTGGTRGIG+AI+EELAGFGA V+TC+RN+  + EC+  W  K
Sbjct  5    EVSSRESRWSLKGMTALVTGGTRGIGFAIVEELAGFGAAVHTCSRNETKLDECIREWESK  64

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G +V GS CDVS R QR++L+EKV++ F GKLNILVNNA  +V K++T+ TAED    +G
Sbjct  65   GFRVTGSVCDVSCRTQRDKLIEKVSSTFQGKLNILVNNAAAVVSKNSTKVTAEDMAYTLG  124

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN EAS+HLCQLA+P LKAS  GSIVF SS    + +   + Y ASKGA+NQ+TK+LACE
Sbjct  125  TNVEASYHLCQLAHPLLKASGNGSIVFISSVAAVVALPTLSFYGASKGALNQLTKSLACE  184

Query  643  WAKDNIRVNSVAPWIIRTKLVND--AESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAF  816
            WA D IR N+V+PWII+T L++   A+S ++    + R++ +TPISR GE  E+SSLVAF
Sbjct  185  WAHDKIRANAVSPWIIKTPLLDASLAKSPSEQRAGMSRIVAQTPISRLGEASEISSLVAF  244

Query  817  LCLPAASYITGQTICVDGGYTITG  888
            LCLP A+YITGQ I VDGGYT  G
Sbjct  245  LCLPTAAYITGQIISVDGGYTANG  268



>ref|XP_006344593.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=316

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/279 (56%), Positives = 206/279 (74%), Gaps = 11/279 (4%)
 Frame = +1

Query  79   WFFINN--------YQEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCA  234
            WF +          ++ M R   +WSL GMTALVTGGTRGIG+A++EELA  GA VYTC+
Sbjct  36   WFLLGELFSVLYILHKSMFRSSSRWSLSGMTALVTGGTRGIGHAVVEELAELGATVYTCS  95

Query  235  RNQNDVKECVERWREKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVP  414
            RN+  + +C++ W  KGLKV G  CDVSS PQR +L+E V++ F+GKL+IL+NNAGT + 
Sbjct  96   RNEEALNKCLQEWSVKGLKVNGCVCDVSSTPQRVKLIENVSSAFHGKLSILINNAGTNIR  155

Query  415  KDATEFTAEDYTIVMGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYS  594
            K   ++TAE+Y  + GTNFE+ +H+CQLA+P LKASE+GSIVF SS  G + ++ +++Y+
Sbjct  156  KPTIDYTAEEYAHLFGTNFESGYHICQLAHPLLKASEVGSIVFISSVAGLVHLSTSSIYA  215

Query  595  ASKGAINQMTKNLACEWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPIS  774
            A+KGA+NQ+T++LACEWAKDNIRVN VAPW I+T  V     +  + D I   I RTP+ 
Sbjct  216  ATKGAMNQLTRDLACEWAKDNIRVNGVAPWYIKTSSVEYVIKNKTLLDGI---ISRTPLM  272

Query  775  RPGEVGEVSSLVAFLCLPAASYITGQTICVDGGYTITGF  891
            RPGE  EVSSLVA+LCLP ASYITGQ I VDGG+T+ GF
Sbjct  273  RPGEAQEVSSLVAYLCLPGASYITGQVIAVDGGFTVNGF  311



>ref|XP_010521894.1| PREDICTED: tropinone reductase homolog At1g07440-like [Tarenaya 
hassleriana]
Length=269

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/264 (60%), Positives = 200/264 (76%), Gaps = 3/264 (1%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            +E  R   +WSLQG TALVTGGT+G+G A++EELAGFGA ++TCAR+ + + +C+  W+ 
Sbjct  5    EESIRQNSRWSLQGKTALVTGGTKGLGEAVVEELAGFGARIHTCARDGDHLNKCLREWQA  64

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            KG +V GS CDVS R +RE+LME V++ FNG+LNIL+NN GT + K  TE+TAED++ +M
Sbjct  65   KGFQVTGSVCDVSLRTEREKLMETVSSLFNGELNILINNVGTNIWKPTTEYTAEDFSFLM  124

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
             TNFE+S+HLCQL++P LKAS  GSIVF SS  G + V   ++Y A+KGA+NQ+T+NLAC
Sbjct  125  TTNFESSYHLCQLSHPLLKASGSGSIVFMSSVCGVVSVNVGSIYGATKGAMNQLTRNLAC  184

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWA DNIR NSV PW I T LV  A  D K     E ++ R+PISR GE  EVSSLV FL
Sbjct  185  EWASDNIRANSVCPWFISTPLVYRALEDEKFK---EAVVSRSPISRVGEPEEVSSLVTFL  241

Query  820  CLPAASYITGQTICVDGGYTITGF  891
            CLPAASYITGQTICVDGG T+ GF
Sbjct  242  CLPAASYITGQTICVDGGMTVNGF  265



>ref|XP_011006388.1| PREDICTED: tropinone reductase homolog [Populus euphratica]
Length=275

 Score =   333 bits (854),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/264 (60%), Positives = 202/264 (77%), Gaps = 2/264 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E+S  E +WSL+GMTALVTGGTRGIG+AI+EELAGFGA V+TC+RN+  + EC+  W  K
Sbjct  5    EVSSRESRWSLKGMTALVTGGTRGIGFAIVEELAGFGAAVHTCSRNETKLDECIREWESK  64

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G +V GS CDVS R QRE+L+EKV++ F GKLNILVNNA  +V K++T+ TAED    +G
Sbjct  65   GFRVTGSVCDVSCRTQREKLIEKVSSTFQGKLNILVNNAAAVVSKNSTKVTAEDMANTLG  124

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN EAS+HLCQLA+P LKAS  GSIVF SS    + +   + Y ASKGA+NQ+TK+LACE
Sbjct  125  TNVEASYHLCQLAHPLLKASGNGSIVFISSVAAVVALPTLSFYGASKGALNQLTKSLACE  184

Query  643  WAKDNIRVNSVAPWIIRTKLVND--AESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAF  816
            WA+D IR N+V+PWII+T L++   A+S ++    + R++ +TPI+R GE  E+SSLVAF
Sbjct  185  WAQDKIRANAVSPWIIKTPLLDASLAKSASEQRAGMSRIVSQTPINRLGEPTEISSLVAF  244

Query  817  LCLPAASYITGQTICVDGGYTITG  888
            LCLP ASYITGQ I VDGGYT  G
Sbjct  245  LCLPTASYITGQIISVDGGYTANG  268



>ref|XP_010033099.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
Length=279

 Score =   333 bits (853),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 200/265 (75%), Gaps = 3/265 (1%)
 Frame = +1

Query  97   YQEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWR  276
            Y   +  + +W L GMT LVTGGT+GIG+AI+EELA  GA V+TC+RN+ ++ EC++ W+
Sbjct  13   YSSSNNNKNRWLLHGMTTLVTGGTKGIGHAIVEELARLGATVHTCSRNEAEINECLKDWK  72

Query  277  EKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIV  456
             KG +V+GS CDVSSR +RE+LM  V++ F+GKLNIL+NN GT   K   ++TAED++ +
Sbjct  73   SKGFRVSGSTCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFI  132

Query  457  MGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLA  636
            M TNFE+++HL QLA+P LKAS  GSIVF SS  G + +   ++YSA+KGA+NQ+TKNLA
Sbjct  133  MTTNFESAYHLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLA  192

Query  637  CEWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAF  816
            CEWAKDNIR NSVAPW I T       SD K  +E+   I RTP+ R GE  EVSSLVAF
Sbjct  193  CEWAKDNIRSNSVAPWFILTPQTEPVLSDKKFHEEV---IARTPLGRTGEPEEVSSLVAF  249

Query  817  LCLPAASYITGQTICVDGGYTITGF  891
            LCLPAASYITGQTICVDGG+T+ GF
Sbjct  250  LCLPAASYITGQTICVDGGFTVNGF  274



>ref|XP_002277835.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera]
 emb|CBI31630.3| unnamed protein product [Vitis vinifera]
Length=268

 Score =   332 bits (852),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 157/255 (62%), Positives = 194/255 (76%), Gaps = 3/255 (1%)
 Frame = +1

Query  127  WSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGSA  306
            WSL+G TALVTGGTRGIGYA++EELAG G+ V+TC+RN+ ++ +C+  W  KG  V GS 
Sbjct  13   WSLRGTTALVTGGTRGIGYAVVEELAGLGSTVHTCSRNEAELDKCLREWHAKGFAVTGSV  72

Query  307  CDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASFH  486
            CD S R QRE+LMEKV++ FNGKLNIL+NN GT + K   +FTA +Y+ +M TN E+++H
Sbjct  73   CDGSDRAQREQLMEKVSSIFNGKLNILINNVGTNIRKPTVDFTAAEYSTIMTTNLESAYH  132

Query  487  LCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIRV  666
            LCQLA+P LKAS  GSIVF SS  G L +   ++Y+A+K A+NQ+TKNL+CEWAKDNIR 
Sbjct  133  LCQLAHPLLKASGAGSIVFISSVAGVLSLGTGSIYAATKAAMNQLTKNLSCEWAKDNIRS  192

Query  667  NSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYIT  846
            NSVAPW I+T LV   E   +  D  E +I RTP+ RPGE  EVSSLVAFLCLP ASYIT
Sbjct  193  NSVAPWYIKTSLV---EHLLQKQDFFESVISRTPLRRPGEPKEVSSLVAFLCLPVASYIT  249

Query  847  GQTICVDGGYTITGF  891
            GQ ICVDGG T+ GF
Sbjct  250  GQVICVDGGMTVNGF  264



>ref|XP_006424909.1| hypothetical protein CICLE_v10029051mg [Citrus clementina]
 gb|ESR38149.1| hypothetical protein CICLE_v10029051mg [Citrus clementina]
Length=270

 Score =   332 bits (852),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 158/261 (61%), Positives = 202/261 (77%), Gaps = 4/261 (2%)
 Frame = +1

Query  112  RGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLK  291
            RG+ +W+L+G TALVTGGT+G+G+A++EELA  GA V+TCARN+ D+ EC+  W+ KG K
Sbjct  8    RGQSRWTLEGKTALVTGGTKGLGHAVVEELAELGAIVHTCARNEADLDECLREWKMKGFK  67

Query  292  VAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNF  471
            V GS CD SSR +RE LM+KV+  FNGKLNIL+NN GT + K   E+TAED++++M TNF
Sbjct  68   VTGSICDASSRGEREMLMDKVSTLFNGKLNILINNVGTSIRKPTVEYTAEDFSVLMATNF  127

Query  472  EASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPV-TKTTLYSASKGAINQMTKNLACEWA  648
            E+++HL QLA+P LKAS  G+I+  SS  G + + T  ++Y+A+KGA+NQ+ KNLACEWA
Sbjct  128  ESAYHLSQLAHPLLKASGAGNIILMSSIAGVVSLNTGNSIYAATKGAMNQLAKNLACEWA  187

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            +DNIR NSVAPW IRT LV    SD K  +EI+    RTP+ R GE  EVSSLVAFLC+P
Sbjct  188  RDNIRTNSVAPWFIRTPLVEPYLSDEKFLEEIK---CRTPMERTGEPDEVSSLVAFLCMP  244

Query  829  AASYITGQTICVDGGYTITGF  891
            AASYITGQTICVDGG T+ GF
Sbjct  245  AASYITGQTICVDGGLTVNGF  265



>ref|XP_009375952.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=264

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 202/262 (77%), Gaps = 3/262 (1%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            M+  EG+W+L GMTALVTGGT+GIGYAI+EEL G GA V+TC+RN+ D+ +C+ +W +KG
Sbjct  1    MNSREGRWALPGMTALVTGGTKGIGYAIVEELVGLGALVHTCSRNEVDLNDCLSQWEKKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             +V GS CDV S+ +REEL+ KV++ F+GKLNIL+NN GT++PK   E+TAEDY+ +M T
Sbjct  61   FQVTGSVCDVVSKTEREELINKVSSLFDGKLNILINNVGTVLPKATLEYTAEDYSFIMST  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N E++++  QL++P LKA+E  SIVF SS  G + +   ++YSA+KGA+NQ+TKNLACEW
Sbjct  121  NLESAYNFLQLSHPLLKAAEAASIVFLSSTAGVVSINGASIYSAAKGAMNQLTKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR+N+VAPW I T LV     + K   ++E +  R P+ RPGE  EVSSLVAFLCL
Sbjct  181  AKDNIRINNVAPWFITTPLVEPILRNEK---KLEMINSRCPLGRPGEPKEVSSLVAFLCL  237

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQTI VDGG T+ G 
Sbjct  238  PAASYITGQTIIVDGGLTVNGL  259



>ref|XP_004235264.1| PREDICTED: tropinone reductase homolog isoform X1 [Solanum lycopersicum]
Length=264

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/262 (58%), Positives = 201/262 (77%), Gaps = 3/262 (1%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            MSR   +W+L GMTALVTGGTRGIG+A++EELA  GA VYTC+RN+N + +C++ W  KG
Sbjct  1    MSRSSSRWTLSGMTALVTGGTRGIGHAVVEELAELGATVYTCSRNENALNKCLQEWSVKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             KV G  CDVSSRPQR +L++ V++ F+GKLNIL+NNAGT + K   ++T E+Y  + GT
Sbjct  61   FKVNGCVCDVSSRPQRVKLIQNVSSAFHGKLNILINNAGTNIRKPTIDYTGEEYAHLFGT  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N E+ +H+CQLA+P LKASE+GS+VF SS  G + ++ +++Y+A+KGA+NQ+T++LACEW
Sbjct  121  NLESGYHICQLAHPLLKASEVGSVVFISSVAGLVHLSTSSIYAATKGAMNQLTRDLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIRVN VAPW I+T  V     +  + D I+    RTP+ RPGE  EVSSLVA+LCL
Sbjct  181  AKDNIRVNGVAPWYIKTSSVEYVIKNKTLLDGIK---SRTPLMRPGEAQEVSSLVAYLCL  237

Query  826  PAASYITGQTICVDGGYTITGF  891
            P ASYITGQ I VDGG+T+ GF
Sbjct  238  PGASYITGQVIAVDGGFTVNGF  259



>ref|XP_010469970.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Camelina sativa]
 ref|XP_010469971.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Camelina sativa]
Length=261

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 200/258 (78%), Gaps = 4/258 (2%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSLQGMTALVTGG++GIG A++EEL+  GA V+TCAR++  +++ + +W+ KG +V+
Sbjct  2    EKRWSLQGMTALVTGGSKGIGEAVVEELSMLGARVHTCARDETQLQDSLRKWQAKGFQVS  61

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
             S CDVSSR QRE+L+E V++ F GKLNILVNNAGT + K  TEFT E+Y+ +M TN E+
Sbjct  62   TSICDVSSREQREKLIETVSSLFQGKLNILVNNAGTFIDKPTTEFTTEEYSFIMATNLES  121

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            +FHL QLA+P LKAS  GSIVF SS  G +  T +++Y A+KGA+NQ+ +NLACEWA DN
Sbjct  122  AFHLSQLAHPLLKASSSGSIVFISSVSGVVH-TGSSIYGATKGAMNQLGRNLACEWASDN  180

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVNSV PW+I T LV D  SD KV+  +E    RTP+ R GE  EVSSLVAFLCL AAS
Sbjct  181  IRVNSVCPWVIATPLVADILSDEKVNKAVE---SRTPMGRVGEANEVSSLVAFLCLHAAS  237

Query  838  YITGQTICVDGGYTITGF  891
            YITGQTICVDGG+TI GF
Sbjct  238  YITGQTICVDGGFTINGF  255



>ref|XP_010542632.1| PREDICTED: tropinone reductase homolog At1g07440 [Tarenaya hassleriana]
Length=262

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/258 (59%), Positives = 198/258 (77%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSL+GMTALVTGGT+GIG A++EELAGFGA+++TCAR++  +  C+  W+ KG +V 
Sbjct  2    DNRWSLRGMTALVTGGTKGIGQAVVEELAGFGAKIHTCARDEALLNRCLREWQSKGFQVT  61

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+SSRP+R+ LM+ V++ F+GKLNIL+NN GT + K A E T ED++I M TN E+
Sbjct  62   GSVCDLSSRPERQRLMQDVSSQFHGKLNILINNVGTFILKPAVECTEEDFSISMATNLES  121

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HLCQL +P LKAS  GSIVF SSA G +    T++Y  +KGA+NQ+ +NLACEWA DN
Sbjct  122  AYHLCQLGHPLLKASGYGSIVFISSASGVVSALNTSIYGPTKGAMNQLARNLACEWASDN  181

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NSVAPW+  T LV +   D K+   +E +I RTP+ R  E  +VSSLVAF+CLPAAS
Sbjct  182  IRANSVAPWLTVTPLVENLLEDEKL---MEAIISRTPLGRVAEPRDVSSLVAFMCLPAAS  238

Query  838  YITGQTICVDGGYTITGF  891
            YITGQTICVDGGYT+ GF
Sbjct  239  YITGQTICVDGGYTVNGF  256



>ref|XP_009623489.1| PREDICTED: tropinone reductase 1-like isoform X2 [Nicotiana tomentosiformis]
Length=275

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 161/258 (62%), Positives = 197/258 (76%), Gaps = 1/258 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            EG+WSL+G TALVTGG++GIGYAI+EELAG GA VYTC+RN+ +++EC+E WR KG KV 
Sbjct  16   EGRWSLKGKTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELQECLEIWRNKGFKVE  75

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+    +RE LM+ V + FNGKLNILVNNAG ++ K+  +FTAEDY IVMGTNFEA
Sbjct  76   GSVCDLLLCTERENLMQAVGDVFNGKLNILVNNAGVVIHKETKDFTAEDYNIVMGTNFEA  135

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
             FHL QLAYP LKASE G+++F SS  GF  +   +LYSASKG INQ TK+LACEWAKDN
Sbjct  136  GFHLSQLAYPLLKASENGNVIFLSSIAGFSALPSLSLYSASKGQINQTTKSLACEWAKDN  195

Query  658  IRVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            IRVNSVAP II T LV  A + + +  +EI+  I RTP+ R G+  E+S+L+ FLC PAA
Sbjct  196  IRVNSVAPGIIMTPLVETAIKRNPRQREEIDHFIVRTPMGRAGKPEEISALITFLCFPAA  255

Query  835  SYITGQTICVDGGYTITG  888
            SYITGQ I  D G+T  G
Sbjct  256  SYITGQIIWADCGFTANG  273



>ref|XP_010414408.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=261

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/258 (61%), Positives = 199/258 (77%), Gaps = 4/258 (2%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSLQGMTALVTGG++GIG A++EEL+  GA V+TCAR++  ++E + +W+ KG +V+
Sbjct  2    EKRWSLQGMTALVTGGSKGIGEAVVEELSMLGARVHTCARDETQLQESLRKWQAKGFQVS  61

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
             S CDVSSR QRE+L+E V++ F GKLNILVNNAGT + K  TEFT E+Y+ +M TN E+
Sbjct  62   TSICDVSSREQREKLIETVSSLFQGKLNILVNNAGTFIDKPTTEFTTEEYSFIMATNLES  121

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            +FHL QL++P LKAS  G IVF SS  G +  T +++Y A+KGA+NQ+ +NLACEWA DN
Sbjct  122  AFHLSQLSHPLLKASSSGGIVFMSSVSGVVH-TGSSVYGATKGAMNQLGRNLACEWASDN  180

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVNSV PW+I T LV D  SD KV+  +E    RTP+ R GE  EVS LVAFLCLPAAS
Sbjct  181  IRVNSVCPWVITTPLVADMLSDEKVNKAVE---SRTPMGRVGEANEVSLLVAFLCLPAAS  237

Query  838  YITGQTICVDGGYTITGF  891
            YITGQTICVDGG+TI GF
Sbjct  238  YITGQTICVDGGFTINGF  255



>ref|XP_006846356.1| hypothetical protein AMTR_s00012p00261070 [Amborella trichopoda]
 gb|ERN08031.1| hypothetical protein AMTR_s00012p00261070 [Amborella trichopoda]
Length=273

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/262 (60%), Positives = 199/262 (76%), Gaps = 4/262 (2%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            + RG  +WSL GMTALVTGGT+GIG+AIIEELAG GA VYTCARN++D+ +C+ +W+  G
Sbjct  14   IKRGGERWSLNGMTALVTGGTKGIGHAIIEELAGLGASVYTCARNEDDLNKCLNQWKGMG  73

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
            L V GS CD+SSR  R +L+E V++HF GKLNILVNN GT + K   EFTAED++ +M T
Sbjct  74   LDVHGSVCDLSSRSDRHKLIEAVSSHFKGKLNILVNNVGTAIGKSTVEFTAEDFSFMMMT  133

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            NFE+++H+CQL++P LKAS  GSIVFNSS  G +  T  +LY A+K A+NQ+TKNLACEW
Sbjct  134  NFESAYHMCQLSHPLLKASGAGSIVFNSSVTGVVG-THCSLYGATKAAMNQITKNLACEW  192

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            A D IR NSVAPW I+T  V D   +    + +  ++ RTP+ R G+  EVSSLVAFLC+
Sbjct  193  ANDKIRTNSVAPWFIKTPFVKDVLEN---KEWLAGIVARTPMRRVGDPEEVSSLVAFLCM  249

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQ ICVDGG T+ G+
Sbjct  250  PAASYITGQVICVDGGMTVNGW  271



>ref|XP_006352698.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=265

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/259 (60%), Positives = 200/259 (77%), Gaps = 3/259 (1%)
 Frame = +1

Query  115  GEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKV  294
            G  +WSL G+ ALVTGGT GIG+AI+EEL  FGA+VYTC+RN++ + EC+++W +KGL+V
Sbjct  5    GGSRWSLNGLVALVTGGTYGIGHAIVEELCEFGAKVYTCSRNESVLNECLKKWTDKGLQV  64

Query  295  AGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFE  474
             G  CDVSS+ QR +LMEKV+  F+GKLNIL+NN GT + K  TE+T E+Y  +M TN E
Sbjct  65   KGCVCDVSSKEQRVQLMEKVSLEFDGKLNILINNVGTNIWKPTTEYTGEEYAHIMATNLE  124

Query  475  ASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKD  654
            +SFHLCQLA+P LK+S  GSIVF SS  G + ++ T++Y A+KGA+NQ+T+NLACEWAKD
Sbjct  125  SSFHLCQLAHPLLKSSGSGSIVFLSSVAGLVHLSGTSIYGATKGAMNQLTRNLACEWAKD  184

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
             IRVN VAPW I T LV     D +    +E ++ RTP+ RPGEV EVSS+VA+LCLPAA
Sbjct  185  GIRVNGVAPWYINTPLVEHVLGDKEF---MEGVVSRTPLKRPGEVEEVSSMVAYLCLPAA  241

Query  835  SYITGQTICVDGGYTITGF  891
            SY+TGQ I VDGG+T+ GF
Sbjct  242  SYVTGQVIAVDGGFTVYGF  260



>emb|CAN63543.1| hypothetical protein VITISV_035429 [Vitis vinifera]
Length=270

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/264 (59%), Positives = 202/264 (77%), Gaps = 3/264 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            S G+ +WSL+GMTALVTGGT+GIG+AI+EELAG GA ++TC+R + ++ EC++ W+ KG 
Sbjct  8    SSGDSRWSLKGMTALVTGGTKGIGHAIVEELAGLGAAIHTCSRKETELNECLKDWKAKGF  67

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
             V+GS CDVSSR QRE+LME V++ FNGKLNILVNNA  ++ K   E TAE+++ +M  N
Sbjct  68   GVSGSVCDVSSRAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAIN  127

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            FE+ +HL QLA+P LKAS  GSIVF SS  G + +   + YSA+KGA+NQ+TKNLACEWA
Sbjct  128  FESVYHLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEWA  187

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            +DNIR N+VAPW I+T +V+   S+      +E +I R P+ R G+  EVSSLVAFLCLP
Sbjct  188  EDNIRSNAVAPWYIKTPMVDQMLSNKTF---LEXVINRAPLRRVGDPKEVSSLVAFLCLP  244

Query  829  AASYITGQTICVDGGYTITGFP*N  900
            A+SYITGQTICVDGG T+ GF  N
Sbjct  245  ASSYITGQTICVDGGVTVNGFEPN  268



>gb|KCW52641.1| hypothetical protein EUGRSUZ_J02019 [Eucalyptus grandis]
Length=279

 Score =   331 bits (848),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 199/258 (77%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + KW L GMTALVTG T+GIG+AI++ELA  GA V+TC+RN+ ++ EC++ W+ KG +V+
Sbjct  20   KNKWLLHGMTALVTGRTKGIGHAIVKELARLGATVHTCSRNEAEINECLKDWKSKGFRVS  79

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDVSSR +RE+LM  V++ F+GKLNIL+NN GT   K   ++TAED++ +M TNFE+
Sbjct  80   GSTCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFIMTTNFES  139

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HL QLA+P LKAS  GSIVF SS  G + +   ++YSA+KGA+NQ+TKNLACEWAKDN
Sbjct  140  TYHLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLACEWAKDN  199

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NSVAPW I T L     SD K  +E+   I RTP+ R GE  EVSSLVAFLCLPAAS
Sbjct  200  IRSNSVAPWFILTPLAEPVLSDEKFHEEV---IARTPLGRTGEPEEVSSLVAFLCLPAAS  256

Query  838  YITGQTICVDGGYTITGF  891
            YITGQTICVDGG+T+ GF
Sbjct  257  YITGQTICVDGGFTVNGF  274



>ref|XP_006352700.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=265

 Score =   330 bits (846),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 155/259 (60%), Positives = 201/259 (78%), Gaps = 3/259 (1%)
 Frame = +1

Query  115  GEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKV  294
            G  +WSL G+ ALVTGGT GIG+AI+EEL  FGA+VYTC+RN++ + EC+++W +KGL+V
Sbjct  5    GGSRWSLNGLVALVTGGTCGIGHAIVEELCEFGAKVYTCSRNESVLNECLKKWTDKGLQV  64

Query  295  AGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFE  474
             G  CDVSS+ QR +LMEKV+  F+GKLNIL+NN GT + K  TE+T+EDY  +M TN E
Sbjct  65   KGCVCDVSSKEQRVQLMEKVSLEFDGKLNILINNVGTNIWKPTTEYTSEDYAHMMATNLE  124

Query  475  ASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKD  654
            +SFHLCQLA+P LK+S  G+IVF SS  G + ++ T++Y A+KGA+NQ+T+NLACEWAKD
Sbjct  125  SSFHLCQLAHPLLKSSGSGTIVFLSSVAGLVHLSGTSIYGATKGAMNQLTRNLACEWAKD  184

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
             IRVN VAPW I T LV     D +    +E ++ RTP+ RPGEV EVSS+VA+LCLPAA
Sbjct  185  GIRVNGVAPWYINTPLVEHVLGDKEF---MEGVVSRTPLKRPGEVEEVSSMVAYLCLPAA  241

Query  835  SYITGQTICVDGGYTITGF  891
            SY+TGQ I VDGG+T+ GF
Sbjct  242  SYVTGQVIAVDGGFTVYGF  260



>ref|XP_010685684.1| PREDICTED: tropinone reductase homolog At1g07440-like [Beta vulgaris 
subsp. vulgaris]
Length=267

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/256 (61%), Positives = 190/256 (74%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GMTALVTGGT+G+G+AI+EELAG GA V+TCARN+ +++ C   W  KG  V  S
Sbjct  14   RWSLVGMTALVTGGTKGLGHAIVEELAGLGARVHTCARNETELEACKRNWETKGFHVTAS  73

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDV+SR QRE LME V++ FNGKLNILVNN GT V K  TE TAE+Y  VM TN E+++
Sbjct  74   VCDVTSRAQRENLMEIVSSEFNGKLNILVNNVGTYVKKPTTELTAEEYATVMTTNLESAY  133

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            H CQLA+P LKAS   SI+F SS  G + +   ++Y  +KGA+NQ+ KNLACEWAKDNIR
Sbjct  134  HFCQLAHPLLKASGFASIIFMSSVAGVVALDVGSVYGTTKGAMNQLAKNLACEWAKDNIR  193

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             NSVAPW IRT L     SD    + + ++  RTP+ R GEV EVSSLVAFLC+PAASYI
Sbjct  194  TNSVAPWYIRTPLTEVVLSD---KEYLAKVKERTPLGRTGEVEEVSSLVAFLCMPAASYI  250

Query  844  TGQTICVDGGYTITGF  891
            TGQTICVDGG+TI G 
Sbjct  251  TGQTICVDGGFTIHGL  266



>ref|XP_006838385.1| hypothetical protein AMTR_s00002p00066940 [Amborella trichopoda]
 gb|ERN00954.1| hypothetical protein AMTR_s00002p00066940 [Amborella trichopoda]
Length=270

 Score =   330 bits (846),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/262 (60%), Positives = 200/262 (76%), Gaps = 4/262 (2%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            M RGE +WSL GMTALVTGGT+GIG+A +EE+A  GA VYTC+RN++D+ +C+  W+  G
Sbjct  11   MRRGE-RWSLNGMTALVTGGTKGIGHATVEEIASLGASVYTCSRNEDDLNKCLNEWKGMG  69

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
            L   GS CD+SSRP RE+L++ V++HF GKLNILVNN GT + K   ++TA +++ +M T
Sbjct  70   LDAHGSVCDLSSRPDREKLIDAVSSHFKGKLNILVNNVGTNIRKPTMQYTAAEFSFLMAT  129

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N E+++H+CQL +P LKAS +GSIVF SS  G + +   T+Y+A+KGA+NQ+TKNLACEW
Sbjct  130  NLESAYHMCQLTHPLLKASGVGSIVFISSVAGVVALHTGTIYAATKGALNQITKNLACEW  189

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR NSVAPW I+T LV D     +V    E +I RTP+ R GE  EVSSLVAFLCL
Sbjct  190  AKDNIRTNSVAPWFIKTPLVEDF---LQVKGITEGIIARTPMRRMGEPEEVSSLVAFLCL  246

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQ ICVDGG T+ G+
Sbjct  247  PAASYITGQIICVDGGMTVNGW  268



>emb|CDY68057.1| BnaAnng26060D [Brassica napus]
Length=262

 Score =   329 bits (844),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 154/258 (60%), Positives = 196/258 (76%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSL+GMTALVTGGT+GIGYAI+EELAGFGA V+TCAR+Q  + EC+  W+EKG +V 
Sbjct  2    DSRWSLRGMTALVTGGTKGIGYAIVEELAGFGARVHTCARDQTLLDECLSEWKEKGFQVT  61

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDVSSRPQR+ELM+ V++ F+GKLNIL+NN GTLV K  TEFTA+D++  + TN ++
Sbjct  62   GSVCDVSSRPQRDELMKTVSSLFSGKLNILINNVGTLVSKPTTEFTAQDFSGQIATNLDS  121

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++H  QLA+P LKAS  GSIVF SS  G +     ++YS +KG +NQ+ +NLACEWA D 
Sbjct  122  AYHFSQLAHPLLKASGFGSIVFLSSVCGVVSSGFVSIYSLTKGCMNQLARNLACEWASDG  181

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NSVAPW+ +T LV     D K ++ I     RTP+ R  E  EV+SLV FLCLPAAS
Sbjct  182  IRANSVAPWMTKTPLVQKRLDDEKFAEAI---FSRTPLGRACEPREVASLVTFLCLPAAS  238

Query  838  YITGQTICVDGGYTITGF  891
            YITGQTIC+DGG+T+ GF
Sbjct  239  YITGQTICIDGGFTVNGF  256



>gb|KEH34737.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=269

 Score =   330 bits (845),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 159/264 (60%), Positives = 196/264 (74%), Gaps = 3/264 (1%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            QE S    +WSL+G TALVTGGTRGIG+A++EELA FGA V+TC+RN+ ++ +C+  W+E
Sbjct  4    QESSMRGSRWSLKGTTALVTGGTRGIGHAVVEELAEFGATVFTCSRNEEELNKCLNEWKE  63

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            KG  V GS CD SS  QREEL+ +VA+ FNGKLNILVNNAGT V K   E+TAEDY+ VM
Sbjct  64   KGFSVYGSVCDASSPSQREELIRQVASAFNGKLNILVNNAGTNVRKPTIEYTAEDYSKVM  123

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
             TN ++++HLCQLAYP LK S  GSIVF SS    + V   ++Y+ SK AINQ+TKNLAC
Sbjct  124  TTNLDSAYHLCQLAYPLLKESGNGSIVFISSVASLISVGTGSIYAVSKAAINQLTKNLAC  183

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWAKDNIR N VAPW  +T LV    ++ +  DE+   + RTPI R  E  EVS+LV FL
Sbjct  184  EWAKDNIRSNCVAPWYTKTSLVEQFIANKEFVDEV---LSRTPIKRIAETHEVSALVTFL  240

Query  820  CLPAASYITGQTICVDGGYTITGF  891
            CLPAASYITGQT+ VDGG+T+ GF
Sbjct  241  CLPAASYITGQTVSVDGGFTVNGF  264



>ref|XP_009110944.1| PREDICTED: tropinone reductase homolog At1g07440-like [Brassica 
rapa]
Length=262

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/258 (60%), Positives = 196/258 (76%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSL+GMTALVTGGT+GIGYAI+EELAGFGA V+TCAR+Q  + EC+  W+EKG +V 
Sbjct  2    DSRWSLRGMTALVTGGTKGIGYAIVEELAGFGARVHTCARDQTLLDECLSEWKEKGFQVT  61

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDVSSR QR+ELM+ V++ F+GKLNIL+NN GTLV K  TEFTA+D++  + TN ++
Sbjct  62   GSVCDVSSRAQRDELMKTVSSLFSGKLNILINNVGTLVSKPTTEFTAQDFSGQIATNLDS  121

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++H  QLA+P LKAS  GSIVF SS  G +     ++YS +KG +NQ+ +NLACEWA D 
Sbjct  122  AYHFSQLAHPLLKASGFGSIVFLSSVCGVVSSGFVSIYSLTKGCMNQLARNLACEWASDG  181

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NSVAPW+ +T LV     D K ++ I     RTP+ R  E GEV+SLV FLCLPAAS
Sbjct  182  IRANSVAPWMTKTPLVQKRLDDEKFAEAI---FSRTPLGRACEPGEVASLVTFLCLPAAS  238

Query  838  YITGQTICVDGGYTITGF  891
            YITGQTIC+DGG+T+ GF
Sbjct  239  YITGQTICIDGGFTVNGF  256



>ref|XP_010256821.1| PREDICTED: tropinone reductase homolog [Nelumbo nucifera]
Length=273

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/269 (60%), Positives = 198/269 (74%), Gaps = 10/269 (4%)
 Frame = +1

Query  85   FINNYQEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECV  264
            FIN +       G+WSL+GMTALVTGGTRGIG+A++EEL G GA +YTC RN+ ++ E +
Sbjct  10   FINKH-------GRWSLKGMTALVTGGTRGIGHAVVEELGGLGAIIYTCCRNETELSERL  62

Query  265  ERWREKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAED  444
            + W  KG +V GS CD+SSR  RE+LME V++ FNGKL+I VNN  T+V K   E TAED
Sbjct  63   QEWTRKGFQVTGSVCDISSRQGREKLMESVSSAFNGKLHIFVNNPATVVMKQILESTAED  122

Query  445  YTIVMGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMT  624
             T  M  NFE+++HLCQLAYP LKAS MGSIVF SS    + +   ++Y ASKGAINQ+T
Sbjct  123  LTSTMAVNFESAYHLCQLAYPLLKASGMGSIVFISSLSSVVALPYMSVYGASKGAINQVT  182

Query  625  KNLACEWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSS  804
            K+LACEWAKDNIR NSVAP IIRT  V     + ++   +ER+I R PI+R GE  EVSS
Sbjct  183  KSLACEWAKDNIRTNSVAPSIIRTSSVEPYLENKEL---VERVISRAPITRIGEPQEVSS  239

Query  805  LVAFLCLPAASYITGQTICVDGGYTITGF  891
            LVAFLCLP+ASYITGQ ICVDGGY + GF
Sbjct  240  LVAFLCLPSASYITGQVICVDGGYAVNGF  268



>ref|XP_008442514.1| PREDICTED: tropinone reductase homolog [Cucumis melo]
Length=259

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/262 (60%), Positives = 201/262 (77%), Gaps = 3/262 (1%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            MS    +WSL G TALVTGGTRGIGYAI+EELA  GA V+TC+RNQ ++ + ++ W++KG
Sbjct  1    MSSPLQRWSLDGFTALVTGGTRGIGYAIVEELASLGASVHTCSRNQTEIDQRLQEWQQKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             KV  S CD++S  QR++L++ V++ FNG LNILVNNAGT+  K ATE+T EDY  +M T
Sbjct  61   FKVTASVCDLTSSSQRQQLIDTVSSIFNGTLNILVNNAGTVTLKGATEYTTEDYNYMMST  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            NFEA +HL Q+++P LKAS  GSIVF SS  G   + K ++Y+A+KGAINQ+TKNLACEW
Sbjct  121  NFEAPYHLSQISHPILKASGYGSIVFVSSIAGVTALPKISIYAATKGAINQITKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIRVN+VAPW +RT +   ++ DA V +E  R+I RTP  R GE  E+SS+VAFLCL
Sbjct  181  AKDNIRVNTVAPWGVRTTI---SKPDAAVVEEYGRLIGRTPAGRIGEPEEISSVVAFLCL  237

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASY++GQ ICVDGG+T  G+
Sbjct  238  PAASYVSGQIICVDGGFTAGGW  259



>gb|ABW81120.1| putative tropinone reductase-14 [Boechera divaricarpa]
Length=262

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/256 (61%), Positives = 195/256 (76%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSLQGMTALVTGGT+GIG A++EEL+  GA V+TCAR++  ++E +  W+ KG +V+ S
Sbjct  4    RWSLQGMTALVTGGTKGIGEAVVEELSMLGARVHTCARDETQLQERLREWQAKGFQVSTS  63

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSSR QRE+LME VA  F GKLNILVNNAGT + K  TEFTAE+Y+ +M TN E++F
Sbjct  64   ICDVSSREQREKLMETVAALFQGKLNILVNNAGTFIFKPTTEFTAEEYSFIMATNLESAF  123

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLA+P LKAS  G IV  SS  G + V   ++Y A+KGA+NQ+ +NLACEWA DNIR
Sbjct  124  HLSQLAHPLLKASGSGRIVLMSSVAGVVHVNVGSIYGATKGAMNQLARNLACEWASDNIR  183

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N++ PW+I T LVND  ++ +V  E    +RRTP+ R GE  EV+SLVAFLCLPAASYI
Sbjct  184  TNAICPWLIVTPLVNDLLNEEEVKKE---AVRRTPLGRVGEPNEVASLVAFLCLPAASYI  240

Query  844  TGQTICVDGGYTITGF  891
            TGQTICVDGG T+ GF
Sbjct  241  TGQTICVDGGLTVNGF  256



>ref|XP_011076794.1| PREDICTED: tropinone reductase homolog [Sesamum indicum]
Length=266

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/260 (60%), Positives = 193/260 (74%), Gaps = 3/260 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GMTALVTGGTRGIG A +EELA  GA VYTC+RN+ ++ + ++ W  KG KV+GS
Sbjct  8    RWSLSGMTALVTGGTRGIGQATVEELAEMGATVYTCSRNEEELNQRLQEWNSKGFKVSGS  67

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD SSR +R +LMEKV++ FN KL+IL+NN GT + K   +FTAE+Y+ +M TN E+S+
Sbjct  68   VCDASSREERVQLMEKVSSVFNAKLDILINNVGTNIRKPTVDFTAEEYSTIMATNLESSY  127

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLA+P LKAS   SIVF SS  G + +   ++Y A+KGAINQ+TKNLACEWAKDNIR
Sbjct  128  HLSQLAHPLLKASGTSSIVFISSVAGLVHLFSGSIYGATKGAINQLTKNLACEWAKDNIR  187

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VNSVAPW I+T L      + K  D +   I RTP+ RPGE  EVSSLVAFLCLPAASYI
Sbjct  188  VNSVAPWYIKTSLTKSLLENTKFLDNV---ISRTPLKRPGEPQEVSSLVAFLCLPAASYI  244

Query  844  TGQTICVDGGYTITGFP*NN  903
            TGQ I VDGG T+  FP +N
Sbjct  245  TGQIIAVDGGMTVNAFPLDN  264



>ref|XP_006488391.1| PREDICTED: tropinone reductase homolog At1g07440-like [Citrus 
sinensis]
Length=270

 Score =   328 bits (840),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 157/261 (60%), Positives = 201/261 (77%), Gaps = 4/261 (2%)
 Frame = +1

Query  112  RGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLK  291
            RG+ +W+L+G TALVTGGT+G+G+A++EELA  GA V+TCARN+ D+ EC+  W+ KG K
Sbjct  8    RGQSRWTLEGKTALVTGGTKGLGHAVVEELAELGAIVHTCARNEADLDECLREWKMKGFK  67

Query  292  VAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNF  471
            V GS CD SSR +RE LM+KV+  FNGKLNIL+NN GT + K   E+TAED++++M TNF
Sbjct  68   VTGSICDASSRGEREMLMDKVSALFNGKLNILINNVGTSIRKPTVEYTAEDFSVLMATNF  127

Query  472  EASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPV-TKTTLYSASKGAINQMTKNLACEWA  648
            E+++HL QLA+P LKAS  G+I+  SS  G + + T  ++Y+A+KGA+NQ+ KNLACEWA
Sbjct  128  ESAYHLSQLAHPLLKASGAGNIILMSSIAGVVSLNTGNSIYAATKGAMNQLAKNLACEWA  187

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            +DNIR NSVAPW IRT LV    SD K  +EI+    RTP+   GE  EVSSLVAFLC+P
Sbjct  188  RDNIRTNSVAPWFIRTPLVEPYLSDEKFLEEIK---CRTPMECTGEPDEVSSLVAFLCMP  244

Query  829  AASYITGQTICVDGGYTITGF  891
            AASYITGQTICVDGG T+ GF
Sbjct  245  AASYITGQTICVDGGLTVNGF  265



>ref|XP_008233480.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=271

 Score =   328 bits (840),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 159/263 (60%), Positives = 197/263 (75%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E S    +WSL+GMTALVTGGTRGIGYA++EELAGFGA V+TC+RN+ ++ +C++ W  K
Sbjct  5    ESSLPNSRWSLKGMTALVTGGTRGIGYAVVEELAGFGAAVHTCSRNEAELHKCLKEWEAK  64

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G  V GS CD SS+ +RE+L+++VA+ FNGKLNILVNN GT + K  TE+T+E+Y+IVM 
Sbjct  65   GFLVTGSVCDASSKTEREKLVQQVASSFNGKLNILVNNVGTNIRKPTTEYTSEEYSIVMA  124

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN E+++HL QLA+P L+AS  GSIVF SS  G + +   T+Y+ASK AINQ+TKNLACE
Sbjct  125  TNLESTYHLSQLAHPLLRASGAGSIVFISSVAGLVGIGSGTIYAASKAAINQLTKNLACE  184

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKDNIR NSV PW  RT LV     + +  +EI     RTPI R  E  EVSSLVAFLC
Sbjct  185  WAKDNIRSNSVCPWYTRTSLVGHLLGNKEFLEEI---TSRTPIDRVAEPEEVSSLVAFLC  241

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPAASYITGQ I VDGG T+  F
Sbjct  242  LPAASYITGQIISVDGGMTVNSF  264



>emb|CDX86485.1| BnaC08g02180D [Brassica napus]
Length=262

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 154/258 (60%), Positives = 193/258 (75%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSL+GMT LVTGGT+GIGYAI+EELAGFGA V+TCAR+Q  + EC+  W+ KG +V 
Sbjct  2    DSRWSLRGMTGLVTGGTKGIGYAIVEELAGFGARVHTCARDQTLLDECLNEWKAKGYQVT  61

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDVSSRPQR+ELM+ V++ F+GKLNIL+NN GTL  K ATEFTA+D++  + TN E+
Sbjct  62   GSVCDVSSRPQRDELMKTVSSLFSGKLNILINNVGTLTSKPATEFTAQDFSSQIATNLES  121

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HL QLA+P LKAS  GSIVF SS  G +     ++YS +KG +NQ+ +NLACEWA D 
Sbjct  122  AYHLSQLAHPLLKASGFGSIVFMSSVCGVVSAGTVSIYSLTKGGMNQLARNLACEWASDG  181

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NSVAPW+ RT L  D   D K ++ I     RTP+ R  E  EV+SLV FLCLPAAS
Sbjct  182  IRANSVAPWVTRTPLAQDRLDDKKYAEAI---CSRTPLGRTCEPSEVASLVTFLCLPAAS  238

Query  838  YITGQTICVDGGYTITGF  891
            YITGQTI +DGG T+ GF
Sbjct  239  YITGQTIFIDGGLTVNGF  256



>ref|XP_011094903.1| PREDICTED: tropinone reductase homolog [Sesamum indicum]
Length=268

 Score =   327 bits (839),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 200/265 (75%), Gaps = 1/265 (0%)
 Frame = +1

Query  100  QEMSRG-EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWR  276
            +E SR  E +W+LQGMTALVTGGT+GIGYAI+EELAGFGA VYTC+RNQ ++ E ++ W 
Sbjct  4    EEQSRSREQRWTLQGMTALVTGGTKGIGYAIVEELAGFGATVYTCSRNQAELSERLKEWE  63

Query  277  EKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIV  456
             KG KV GSACD+SS PQREEL++ V+  F+GKLNILVNNA   + K A++ TAEDY  +
Sbjct  64   GKGFKVKGSACDLSSSPQREELIQSVSAAFDGKLNILVNNAAMSLLKRASDHTAEDYRRI  123

Query  457  MGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLA  636
            M TN E+ +H+CQLAYP LKAS +G+IVF SS  G + +   + Y+ASKGAINQ+TKNLA
Sbjct  124  METNLESPYHICQLAYPLLKASGLGNIVFISSVAGGVALPAISAYAASKGAINQLTKNLA  183

Query  637  CEWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAF  816
            CEWAKDNIR N+VAP+ +RT ++   + D  + +    ++ RTPI R  E  EVSSLV F
Sbjct  184  CEWAKDNIRTNTVAPFGVRTSILKPEDIDPSILEMFIPLMGRTPIGRIAEPEEVSSLVTF  243

Query  817  LCLPAASYITGQTICVDGGYTITGF  891
            LCLPAASYITGQ I VDGG+T   F
Sbjct  244  LCLPAASYITGQVIYVDGGFTAGSF  268



>gb|KEH30187.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=268

 Score =   327 bits (839),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 155/256 (61%), Positives = 196/256 (77%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            KWSL GMTALVTGGTRGIGYAI+EEL GFGA+V+TCARN++D+ +C++ W   G +V GS
Sbjct  11   KWSLNGMTALVTGGTRGIGYAIVEELMGFGAKVHTCARNEDDLNKCLKDWNHLGFEVTGS  70

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVS   QRE LME V++ FNGKLNIL+NN GT + K   +FTA +++ ++ TN  ++F
Sbjct  71   ICDVSVPQQREVLMEDVSSVFNGKLNILINNVGTNIRKPMIDFTAAEFSRLIDTNLGSTF  130

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            H+CQLAYP LKAS +GS+VF SS  GF+ +   ++  A+KGAINQ+T+NLACEWAKDNIR
Sbjct  131  HMCQLAYPLLKASGVGSVVFISSVSGFVSLKSMSVQGATKGAINQLTRNLACEWAKDNIR  190

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N+VAPW IRT +V    S+    D +E +  RTP+ R G+  EVSSLVAFLCLPA+SYI
Sbjct  191  SNAVAPWYIRTSMVEQVLSN---KDYLEEVYSRTPLRRLGDPAEVSSLVAFLCLPASSYI  247

Query  844  TGQTICVDGGYTITGF  891
            TGQ ICVDGG +I GF
Sbjct  248  TGQIICVDGGMSINGF  263



>ref|XP_010650984.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Vitis vinifera]
Length=270

 Score =   327 bits (839),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 201/265 (76%), Gaps = 3/265 (1%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
             S G+ +WSL+GMTALVTGGT+GIG+AI+EELAG  A ++TC+R + ++ EC++ W+ KG
Sbjct  7    FSSGDSRWSLKGMTALVTGGTKGIGHAIVEELAGLVATIHTCSRKETELDECLKDWKAKG  66

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
              V+GS CDVSSR QRE+LME V++ FNGKLNILVNNA  ++ K   E TAE+++ +M  
Sbjct  67   FGVSGSVCDVSSRAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAI  126

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            NFE+ +HL QLA+P LKAS  GSIVF SS  G + +   + YSA+KGA+NQ+TKNLACEW
Sbjct  127  NFESVYHLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEW  186

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            A+DNIR N+VAPW I+T +V+   S+      +E +I R P+ R G+  EVSSLVAFLCL
Sbjct  187  AEDNIRSNAVAPWYIKTPMVDQMFSNKTF---LEEVINRAPLRRVGDPKEVSSLVAFLCL  243

Query  826  PAASYITGQTICVDGGYTITGFP*N  900
            PA+SYITGQTICVDGG T+ GF  N
Sbjct  244  PASSYITGQTICVDGGVTVNGFEPN  268



>ref|XP_010469989.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=264

 Score =   327 bits (838),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 154/256 (60%), Positives = 194/256 (76%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GMTALVTGG++GIG A++EEL+  GA V+TCAR++  ++E +  W+ KG +V  S
Sbjct  6    RWSLGGMTALVTGGSKGIGEAVVEELSMMGARVHTCARDETQLQERLREWQAKGFQVTTS  65

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSSR QRE LME V++ F GKLNILVNNAGT + K  TE+TAE+Y+ +M TN E+SF
Sbjct  66   ICDVSSREQRETLMETVSSLFQGKLNILVNNAGTYISKPTTEYTAEEYSFIMATNLESSF  125

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLA+P LKAS  GSIV  SS  G + V   ++Y A+KGA+NQ+ +NLACEWA DNIR
Sbjct  126  HLSQLAHPLLKASGSGSIVHMSSVAGVVHVNVGSIYGATKGAMNQLARNLACEWASDNIR  185

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N+V PW+I+T L ND  +D ++  E+E    RTP+ R GE  EVSSLVAFLCLPAASYI
Sbjct  186  TNAVCPWLIKTPLANDLLNDEEIKKEVE---SRTPMGRVGETNEVSSLVAFLCLPAASYI  242

Query  844  TGQTICVDGGYTITGF  891
            TGQ ICVDGG+T+ GF
Sbjct  243  TGQVICVDGGFTVNGF  258



>ref|XP_002282755.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera]
 emb|CBI31629.3| unnamed protein product [Vitis vinifera]
Length=268

 Score =   327 bits (838),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 157/261 (60%), Positives = 193/261 (74%), Gaps = 3/261 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            S G   WSL+G TALVTGGTRGIGYA++EELAG GA V+TC+RN+ ++ +C+  W  KG 
Sbjct  7    SFGGSGWSLRGTTALVTGGTRGIGYAVVEELAGLGATVHTCSRNEAELDKCLREWHAKGF  66

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
             V  S CD S R QRE+LMEKV++ FNGKLNILVNN GT   K   ++TA +Y+ +M TN
Sbjct  67   SVTASICDGSDRAQREKLMEKVSSIFNGKLNILVNNVGTSFRKPTVDYTAAEYSTIMTTN  126

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
             E+++HLCQLA+P LKAS  GSIVF SS  G + +   ++Y+A+K AINQ+TKN ACEWA
Sbjct  127  LESAYHLCQLAHPLLKASGAGSIVFVSSVAGVVSLGTGSIYAATKAAINQLTKNFACEWA  186

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            KDNIR NSVAPW I+T LV   E   +  D  E ++ RTP+ RPGE  EV+SLVAFLCLP
Sbjct  187  KDNIRSNSVAPWYIKTSLV---EHLLQKKDFFEGIVSRTPLGRPGEPKEVASLVAFLCLP  243

Query  829  AASYITGQTICVDGGYTITGF  891
             ASYITGQ ICVDGG T+ GF
Sbjct  244  VASYITGQVICVDGGMTVNGF  264



>emb|CBI16073.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   327 bits (838),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 154/264 (58%), Positives = 200/264 (76%), Gaps = 3/264 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            S G+ +WSL+GMTALVTGGT+GIG+AI+EELAG GA ++TC+R + ++ EC++ W+ KG 
Sbjct  8    SSGDSRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGF  67

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
             V+GS CDVSSR QRE+LME V++ F GKLNILVNNA  ++ K   E TAE+++ +M  N
Sbjct  68   GVSGSVCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAIN  127

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            FE+ +HL QLA+P LKAS  GSIVF SS  G + +   + YS +KGA+NQ+TKNLACEWA
Sbjct  128  FESVYHLSQLAHPLLKASGAGSIVFISSVAGVVSIKYLSAYSVTKGAMNQLTKNLACEWA  187

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            +DNIR N+VAPW I+T +V+   S+      +E +I R P+ R G+  EVSSLVAFLCLP
Sbjct  188  EDNIRSNAVAPWYIKTPMVDQMFSNKTF---LEEVINRAPLRRVGDPKEVSSLVAFLCLP  244

Query  829  AASYITGQTICVDGGYTITGFP*N  900
            A+SYITGQTICVDGG T+ GF  N
Sbjct  245  ASSYITGQTICVDGGVTVNGFEPN  268



>ref|XP_010521893.1| PREDICTED: tropinone reductase homolog At1g07440-like [Tarenaya 
hassleriana]
 gb|ABW81088.1| TRL10 [Cleome spinosa]
Length=269

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/264 (59%), Positives = 196/264 (74%), Gaps = 3/264 (1%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            +E  R   +WSLQG TALVTGGT+G+G A++EELAGFGA ++TCAR+ + + +C+  W+ 
Sbjct  5    EESIRQNSRWSLQGKTALVTGGTKGLGEAVVEELAGFGARIHTCARDGDHLNKCLREWQA  64

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            KG +V GS CDVS R +RE+LME V++ FNG+LNIL+NN GT + K  TE+TAED++ +M
Sbjct  65   KGFQVTGSVCDVSLRTEREKLMETVSSLFNGELNILINNVGTNMTKPTTEYTAEDFSFLM  124

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
             TNFE+S+HLCQL++P LKAS  GSIVF SS  G + +   ++Y A+KGA+NQ+T+NLAC
Sbjct  125  ATNFESSYHLCQLSHPLLKASGSGSIVFMSSVCGVVSINVGSIYGATKGAMNQLTRNLAC  184

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWA DNIR NSV PW I T L      D K     E ++ R PI R GE  EVSSLV FL
Sbjct  185  EWASDNIRANSVCPWFISTPLAYRYLEDEKFK---EAVVSRNPIRRVGEPEEVSSLVTFL  241

Query  820  CLPAASYITGQTICVDGGYTITGF  891
            CLPAASYITGQTICVDGG T+ GF
Sbjct  242  CLPAASYITGQTICVDGGMTVNGF  265



>ref|XP_011023546.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=260

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/259 (60%), Positives = 196/259 (76%), Gaps = 4/259 (2%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSLQGMTALVTGGT+GIGYA+++ELA  GA V+TCARNQ  + E +  W EKG KV 
Sbjct  2    EKRWSLQGMTALVTGGTKGIGYAVVDELAALGAIVHTCARNQEQLNERIREWNEKGFKVT  61

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDVSS  +RE+LME+V++ F+GKLNILVNNAGT + K   ++TAED+T +M TN ++
Sbjct  62   GSVCDVSSDAEREKLMEEVSSRFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQS  121

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPV-TKTTLYSASKGAINQMTKNLACEWAKD  654
            +FHL QLA+P LKAS  G IVF SS    + + T+  LYSASKGA+NQ+T+NLACEWAKD
Sbjct  122  AFHLSQLAHPLLKASGAGKIVFMSSITSVVSINTQYPLYSASKGAMNQLTRNLACEWAKD  181

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            NIRVN+VAPW IRT L   +  D  +  E+     RTP+ R GE GEVSS+VAFLCLPA 
Sbjct  182  NIRVNAVAPWFIRTPLTTPSLDDENILKEV---FNRTPMKRVGEPGEVSSVVAFLCLPAP  238

Query  835  SYITGQTICVDGGYTITGF  891
             ++TGQ IC+DGG ++ GF
Sbjct  239  GFLTGQVICIDGGMSVNGF  257



>ref|XP_010650983.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Vitis vinifera]
Length=270

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 201/265 (76%), Gaps = 3/265 (1%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
             S G+ +WSL+GMTALVTGGT+GIG+AI+EELAG  A ++TC+R + ++ EC++ W+ KG
Sbjct  7    FSSGDSRWSLKGMTALVTGGTKGIGHAIVEELAGLVATIHTCSRKETELDECLKDWKAKG  66

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
              V+GS CDVSSR QRE+LME V++ FNGKLNILVNNA  ++ K   E TAE+++ +M  
Sbjct  67   FGVSGSVCDVSSRAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAI  126

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            NFE+ +HL QLA+P LKAS  GSIVF SS  G + +   + YSA+KGA+NQ+TKNLACEW
Sbjct  127  NFESVYHLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEW  186

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            A+DNIR N+VAPW I+T +V+   S+      +E +I R P+ R G+  EVSSLVAFLCL
Sbjct  187  AEDNIRSNAVAPWYIKTPMVDQMLSNKTF---LEGVINRAPLRRVGDPKEVSSLVAFLCL  243

Query  826  PAASYITGQTICVDGGYTITGFP*N  900
            PA+SYITGQTICVDGG T+ GF  N
Sbjct  244  PASSYITGQTICVDGGVTVNGFEPN  268



>emb|CDY09823.1| BnaC09g43380D [Brassica napus]
Length=271

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/263 (59%), Positives = 195/263 (74%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E SR   +WSL+GMTALVTGG++G+G A++EELA  GA V+TCAR++  ++EC+  W+ K
Sbjct  6    EKSRDISRWSLRGMTALVTGGSKGLGSAVVEELAMLGARVHTCARDETQLQECLLEWQAK  65

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G +V  S CDVSSR QRE+LME V+  F GKLNILVNNAGT + K  TEF+AED++ +M 
Sbjct  66   GFQVTTSVCDVSSRVQREKLMETVSTLFQGKLNILVNNAGTCITKPTTEFSAEDFSFLMA  125

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN E++FHL QLA+P+LKAS  GSIVF SSA G + V   ++Y A+KGA+NQ+ +NLACE
Sbjct  126  TNLESAFHLSQLAHPFLKASGSGSIVFMSSAAGVVHVNVGSIYGATKGAMNQLARNLACE  185

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WA D+IRVNSV PW I T L N      ++  E+E    +TP+ R GE  EVSSLVAFLC
Sbjct  186  WASDSIRVNSVCPWFIATPLANKFMDHEELKKEVE---TKTPMGRVGEANEVSSLVAFLC  242

Query  823  LPAASYITGQTICVDGGYTITGF  891
             PAASYITGQ ICVDGG TI G 
Sbjct  243  FPAASYITGQVICVDGGATINGL  265



>emb|CAN69507.1| hypothetical protein VITISV_016037 [Vitis vinifera]
Length=270

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/264 (58%), Positives = 199/264 (75%), Gaps = 3/264 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            S G+ +WSL+GMTALVTGGT+GIG+AI+EELAG GA ++TC+R + ++ EC++ W+ KG 
Sbjct  8    SSGDSRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGF  67

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
             V+GS CDVSSR QRE+LME V++ F GKLNILVNNA  ++ K   E TAE+++ +M  N
Sbjct  68   GVSGSVCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAIN  127

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            FE+ +HL QLA+P LKAS  GSIVF SS  G   +   + YS +KGA+NQ+TKNLACEWA
Sbjct  128  FESVYHLSQLAHPLLKASGAGSIVFISSVAGVASIKYLSAYSVTKGAMNQLTKNLACEWA  187

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            +DNIR N+VAPW I+T +V+   S+      +E +I R P+ R G+  EVSSLVAFLCLP
Sbjct  188  EDNIRSNAVAPWYIKTPMVDQMLSNKTF---LEEVINRAPLRRVGDPKEVSSLVAFLCLP  244

Query  829  AASYITGQTICVDGGYTITGFP*N  900
            A+SYITGQTICVDGG T+ GF  N
Sbjct  245  ASSYITGQTICVDGGVTVNGFEPN  268



>ref|XP_007218806.1| hypothetical protein PRUPE_ppa009941mg [Prunus persica]
 gb|EMJ20005.1| hypothetical protein PRUPE_ppa009941mg [Prunus persica]
Length=271

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/263 (60%), Positives = 196/263 (75%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E S    +WSL+GMTALVTGGTRGIGYA++EELAGFGA V+TC+R + ++ +C++ W  K
Sbjct  5    ESSLPNSRWSLKGMTALVTGGTRGIGYAVVEELAGFGAAVHTCSRKEAELHKCLKEWEAK  64

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G  V GS CD SS+ +RE+L+++VA+ FNGKLNILVNN GT + K  TE+T+E+Y+IVM 
Sbjct  65   GFLVTGSVCDASSKTEREKLVQQVASSFNGKLNILVNNVGTNIRKPTTEYTSEEYSIVMA  124

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN E+++HL QLA+P L+AS  GSIVF SS  G + +   T+Y+ASK AINQ+TKNLACE
Sbjct  125  TNLESTYHLSQLAHPLLRASGAGSIVFISSVAGLVSIGSGTIYAASKAAINQLTKNLACE  184

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKDNIR+NSV PW  RT LV     + +  +EI     RTPI R  E  EVSSLVAFLC
Sbjct  185  WAKDNIRINSVCPWYTRTSLVEHLLDNKEFLEEI---TSRTPIDRVAEPEEVSSLVAFLC  241

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPAASYITGQ I VDGG T   F
Sbjct  242  LPAASYITGQIISVDGGMTANSF  264



>emb|CDY09824.1| BnaC09g43370D [Brassica napus]
 emb|CDX97893.1| BnaC04g40460D [Brassica napus]
Length=271

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/268 (58%), Positives = 196/268 (73%), Gaps = 3/268 (1%)
 Frame = +1

Query  88   INNYQEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVE  267
            + N +E  R   +WSL GMTALVTGG++G+G A++EELA  GA V+TCAR++  ++EC+ 
Sbjct  1    MTNTRESLRDNSRWSLGGMTALVTGGSKGLGEAVVEELAMLGARVHTCARDETQLQECLL  60

Query  268  RWREKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDY  447
             W+ KG +V  S CDVSSR QRE+LME V+  F GKLNILVNNAGT + K  TEF+AED+
Sbjct  61   EWQAKGFQVTTSVCDVSSRVQREKLMETVSTLFQGKLNILVNNAGTCITKPTTEFSAEDF  120

Query  448  TIVMGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTK  627
            + +M TN E++FHL QLA+P+LKAS  GSIVF SSA G + V   ++Y A+KGA+NQ+ +
Sbjct  121  SFLMATNLESAFHLSQLAHPFLKASGSGSIVFMSSAAGVVHVNVGSIYGATKGAMNQLAR  180

Query  628  NLACEWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSL  807
            NLACEWA D+IRVNSV PW I T L N      ++  E+E    +TP+ R GE  EVSSL
Sbjct  181  NLACEWASDSIRVNSVCPWFIATPLANKFMDHEELKKEVE---TKTPMGRVGEANEVSSL  237

Query  808  VAFLCLPAASYITGQTICVDGGYTITGF  891
            VAFLC PAASYITGQ ICVDGG TI G 
Sbjct  238  VAFLCFPAASYITGQVICVDGGATINGL  265



>ref|XP_004137775.1| PREDICTED: tropinone reductase homolog [Cucumis sativus]
 ref|XP_004169351.1| PREDICTED: tropinone reductase homolog [Cucumis sativus]
 gb|KGN58843.1| hypothetical protein Csa_3G733970 [Cucumis sativus]
Length=259

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 199/262 (76%), Gaps = 3/262 (1%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            MS    +WSL G TALVTGGTRGIGYAI+EELA  GA V+TC+RNQ ++ + ++ W++KG
Sbjct  1    MSSPLQRWSLNGFTALVTGGTRGIGYAIVEELASLGASVHTCSRNQTEIDQRLQEWQQKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             KV  S CD++S  QR++L++ V++ FNG LNILVNNAGT+  K ATE+T EDY  +M T
Sbjct  61   FKVTASVCDLTSSSQRQQLIDTVSSIFNGTLNILVNNAGTVTMKTATEYTTEDYNYMMST  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            NFEA +HL Q+++P LKAS  GSIVF SS  G   + + ++Y+A+KGAINQ+TKNLACEW
Sbjct  121  NFEAPYHLSQISHPILKASGYGSIVFVSSIAGVTALPRISIYAATKGAINQITKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR+N+VAPW +RT +   +  DA   +E  R+I RTP  R GE  E+SS+VAFLCL
Sbjct  181  AKDNIRINTVAPWGVRTTI---STPDAAAVEEYGRLIGRTPAGRLGEPEEISSVVAFLCL  237

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASY++GQ ICVDGGYT  G+
Sbjct  238  PAASYVSGQIICVDGGYTAGGW  259



>ref|XP_010650991.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Vitis vinifera]
 emb|CBI16061.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/264 (58%), Positives = 201/264 (76%), Gaps = 3/264 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            S G+G+WSL+GMTALVTGGT+GIG+AI+EELAG GA ++TC+R + ++ EC++ W+ KG 
Sbjct  8    SSGDGRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGF  67

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
             V+GS CDVSSR QRE+LM+ +++ FNGKLNIL+NNA   + K   E TAE+++ +M  N
Sbjct  68   GVSGSVCDVSSRAQREKLMQTISSVFNGKLNILINNAAITIQKPTVEVTAEEFSTIMAIN  127

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            FE+ +HL Q+A+P LKAS  GSIVF SS  G +     + YS +KGA+NQ+TKNLACEWA
Sbjct  128  FESVYHLSQIAHPLLKASGAGSIVFISSVCGIVAHKNISAYSVTKGAMNQLTKNLACEWA  187

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            +DNIR N+VAPW I+T +V+   S+      +E +I RTP+ R G+  EVSS+VAFLCLP
Sbjct  188  EDNIRSNAVAPWYIKTPMVDQMLSNKTF---LEGVINRTPLRRVGDPKEVSSVVAFLCLP  244

Query  829  AASYITGQTICVDGGYTITGFP*N  900
            A+SYITGQTICVDGG T+ GF  N
Sbjct  245  ASSYITGQTICVDGGMTVNGFEPN  268



>ref|XP_006846352.1| hypothetical protein AMTR_s00012p00260130 [Amborella trichopoda]
 gb|ERN08027.1| hypothetical protein AMTR_s00012p00260130 [Amborella trichopoda]
Length=266

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 203/266 (76%), Gaps = 5/266 (2%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            ++M R E +WSL+ MTALVTGGT+GIGYAI+EELAG GA +YTCAR + D+ +C++ W+ 
Sbjct  5    EKMKREE-RWSLRCMTALVTGGTKGIGYAIVEELAGLGASIYTCARTEVDLNKCLDEWKG  63

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            +G  V GS CD+SSR  RE L+E V+ HFNGKLNILVNN GT   K + E+TA+D++ ++
Sbjct  64   RGFNVHGSVCDLSSRANRENLIEAVSAHFNGKLNILVNNVGTGFRKPSVEYTAKDFSFLV  123

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
             T+ E+++H+CQL++P LKASE GSIVF SS    + +   ++Y A+K AINQ+TKNLAC
Sbjct  124  STDLESAYHMCQLSHPLLKASEAGSIVFISSVAAVVALDVGSIYPATKAAINQITKNLAC  183

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWAKDNIR NSV PW I+T LV D  ++ ++   +E +I RTP+ R GE  EV+SLVAFL
Sbjct  184  EWAKDNIRTNSVTPWAIKTPLVEDLLANKEI---LESVIARTPMRRTGEREEVASLVAFL  240

Query  820  CLPAASYITGQTICVDGGYTITG-FP  894
            C+PAASYITGQ ICVDG +T+ G FP
Sbjct  241  CMPAASYITGQVICVDGAFTVNGWFP  266



>ref|XP_010650992.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Vitis vinifera]
Length=270

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/264 (58%), Positives = 201/264 (76%), Gaps = 3/264 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            S G+G+WSL+GMTALVTGGT+GIG+AI+EELAG GA ++TC+R + ++ EC++ W+ KG 
Sbjct  8    SSGDGRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGF  67

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
             V+GS CDVSSR QRE+LM+ +++ FNGKLNIL+NNA   + K   E TAE+++ +M  N
Sbjct  68   GVSGSVCDVSSRAQREKLMQTISSVFNGKLNILINNAAITIQKPTVEVTAEEFSTIMAIN  127

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            FE+ +HL Q+A+P LKAS  GSIVF SS  G +     + YS +KGA+NQ+TKNLACEWA
Sbjct  128  FESVYHLSQIAHPLLKASGAGSIVFISSVCGIVAHKNISAYSVTKGAMNQLTKNLACEWA  187

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            +DNIR N+VAPW I+T +V+   S+      +E +I RTP+ R G+  EVSS+VAFLCLP
Sbjct  188  EDNIRSNAVAPWYIKTPMVDQMLSNKTF---LEGVINRTPLRRVGDPKEVSSVVAFLCLP  244

Query  829  AASYITGQTICVDGGYTITGFP*N  900
            A+SYITGQTICVDGG T+ GF  N
Sbjct  245  ASSYITGQTICVDGGMTVNGFEPN  268



>ref|XP_006358703.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Solanum tuberosum]
Length=304

 Score =   327 bits (839),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/272 (58%), Positives = 204/272 (75%), Gaps = 7/272 (3%)
 Frame = +1

Query  85   FINNYQEMSRGEGK---WSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVK  255
            ++N Y  + R  GK   WSL GM ALVTGGTRGIG+AI+EEL G GA V+TCARN++++ 
Sbjct  32   WMNKYNSI-RCAGKVNRWSLNGMNALVTGGTRGIGHAIVEELCGLGATVHTCARNEDELG  90

Query  256  ECVERWREKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFT  435
             C+  W+++G  V+GS CDVSS+  R++LME V++ FNGKL+IL+NNAGT + K   +FT
Sbjct  91   TCLRSWKDEGFTVSGSLCDVSSQVDRQKLMEVVSSTFNGKLDILINNAGTNIRKAMVDFT  150

Query  436  AEDYTIVMGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAIN  615
            AE+++ +M TNFE+ FHLCQLAYP LKAS  GS+VF SS  GF+ +   +L  A+KGAIN
Sbjct  151  AEEFSSLMATNFESVFHLCQLAYPLLKASGAGSVVFTSSVSGFVSLKSMSLQGATKGAIN  210

Query  616  QMTKNLACEWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGE  795
            Q+TKNLACEWAKDNIR N+VAPW I+T +V    S+    D ++ +  RTP+ R GE  E
Sbjct  211  QLTKNLACEWAKDNIRSNAVAPWYIKTSMVEQVLSN---KDYLQEVYDRTPLGRLGEPSE  267

Query  796  VSSLVAFLCLPAASYITGQTICVDGGYTITGF  891
            VSSLV FLCLPA+SYITGQ ICVDGG ++ GF
Sbjct  268  VSSLVGFLCLPASSYITGQIICVDGGMSVNGF  299



>gb|ABK94587.1| unknown [Populus trichocarpa]
Length=267

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/264 (59%), Positives = 199/264 (75%), Gaps = 4/264 (2%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E S  + +W LQGMTALVTGGT+G+GYAI+EELA  GA V+TCARNQ+ + E V  W+EK
Sbjct  4    ESSSRDKRWGLQGMTALVTGGTKGLGYAIVEELAALGAIVHTCARNQDQINERVREWKEK  63

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G KV GS CDVSS  +RE+LM++V++ F+GKLNILVNNAGT + K   ++TAED+T +M 
Sbjct  64   GFKVTGSVCDVSSNAEREKLMKEVSSLFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMN  123

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVT-KTTLYSASKGAINQMTKNLAC  639
            TN +++FHL QLA+P LKAS  G IVF SS +  + +  +  LYSASKGA+NQ+T+NLAC
Sbjct  124  TNLQSAFHLSQLAHPLLKASGAGKIVFMSSIISVVSMNPQYPLYSASKGAMNQLTRNLAC  183

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWAKDNIRVN+VAPW IRT L   +  D  +  E+     RTP+ R GE GEVSS+VAFL
Sbjct  184  EWAKDNIRVNAVAPWFIRTPLTAHSLDDESIVKEV---FNRTPMRRVGEPGEVSSVVAFL  240

Query  820  CLPAASYITGQTICVDGGYTITGF  891
            CLPA  ++TGQ IC+DGG ++ GF
Sbjct  241  CLPAPGFLTGQVICIDGGMSVNGF  264



>ref|XP_010312198.1| PREDICTED: tropinone reductase 1 isoform X1 [Solanum lycopersicum]
Length=275

 Score =   326 bits (836),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/273 (58%), Positives = 206/273 (75%), Gaps = 12/273 (4%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIG-----------YAIIEELAGFGAEVYTCARNQNDV  252
            M+    KWSL+G TALVTGG++GIG           YAI+EELA FGA VYTC+RN+N++
Sbjct  1    MAELREKWSLEGTTALVTGGSKGIGLCIEVEDIWQRYAIVEELANFGARVYTCSRNENEL  60

Query  253  KECVERWREKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEF  432
            ++C++ WR+KGLKV GS CD+ S  +RE+LM+ + + F+GKLNILVNNAG ++ K+A +F
Sbjct  61   QKCLDIWRKKGLKVEGSVCDLLSHTEREKLMKNIEDVFDGKLNILVNNAGVVIYKEAKDF  120

Query  433  TAEDYTIVMGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAI  612
            T EDY I+MGTNFEA +HL Q+AYP LK+S+ G+I+F SS  GF  +   +LYSASKGAI
Sbjct  121  TKEDYNIIMGTNFEAGYHLSQIAYPLLKSSQNGNIIFVSSIAGFSALPSLSLYSASKGAI  180

Query  613  NQMTKNLACEWAKDNIRVNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEV  789
            NQMTKNLACEWAKDNIRVNSVAP +I T L+  A + + +  +EI+  + +TP+ R G+ 
Sbjct  181  NQMTKNLACEWAKDNIRVNSVAPAVILTPLIETAIKKNPQQKEEIDSFVVKTPLGRAGKP  240

Query  790  GEVSSLVAFLCLPAASYITGQTICVDGGYTITG  888
             EVS++VAFLC PAASYITGQ I  DGG+T  G
Sbjct  241  EEVSAVVAFLCFPAASYITGQIIWADGGFTANG  273



>ref|XP_010654244.1| PREDICTED: tropinone reductase homolog [Vitis vinifera]
Length=267

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 196/256 (77%), Gaps = 0/256 (0%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL+GMTAL+TGGTRGIGYAI+EELA  GA V+TC+RNQ ++ E ++ W  KG +V+GS
Sbjct  12   RWSLKGMTALITGGTRGIGYAIVEELAELGAIVHTCSRNQTELNERLQEWEGKGFRVSGS  71

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD++SR QRE+L E V++ F GKLNILVNNA T+  K  T +TAED + ++ TNFE+ +
Sbjct  72   VCDLTSRAQREKLTETVSSLFEGKLNILVNNAATVALKAPTNYTAEDCSSILQTNFESPY  131

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HLCQLA+P LKAS  GSI+F SS  G + +   ++Y+A+KGAINQ+TKNLACEWAKDNIR
Sbjct  132  HLCQLAHPLLKASGRGSIIFISSVAGLISLPHMSVYAATKGAINQVTKNLACEWAKDNIR  191

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N+VAPW +RT +    E D  ++    +++ RTP+ R  E  EVS LVAFLCLPAASYI
Sbjct  192  TNAVAPWTVRTSVRPILEPDNPMATAYPQLLARTPLHRIAEPDEVSPLVAFLCLPAASYI  251

Query  844  TGQTICVDGGYTITGF  891
            TGQ ICVDGG+++ GF
Sbjct  252  TGQVICVDGGFSVNGF  267



>ref|XP_010650989.1| PREDICTED: tropinone reductase homolog At1g07440 isoform X1 [Vitis 
vinifera]
 emb|CBI16066.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/264 (58%), Positives = 200/264 (76%), Gaps = 3/264 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            S G+ +WSL+GMTALVTGGT+GIG+AI+EELAG GA ++TC+R + ++ EC++ W+ KG 
Sbjct  8    SSGDSRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGF  67

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
             V+GS CDVSSR QRE+LME V++ F GKLNILVNNA  ++ K   E TAE+++ +M  N
Sbjct  68   GVSGSVCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAIN  127

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            FE+ +HL QLA+P LKAS  GSIVF SS  G + V   + Y+ +KGA+NQ+TKNLACEWA
Sbjct  128  FESVYHLSQLAHPLLKASGAGSIVFISSVAGVVSVKYLSAYAVTKGAMNQLTKNLACEWA  187

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            +DNIR N+VAPW I+T +V+   S+      +E +I R P+ R G+  EVSSLVAFLCLP
Sbjct  188  EDNIRSNAVAPWCIKTPMVDQMLSNKTF---LEGVINRAPLRRVGDPKEVSSLVAFLCLP  244

Query  829  AASYITGQTICVDGGYTITGFP*N  900
            A+SYITGQTICVDGG T+ GF  N
Sbjct  245  ASSYITGQTICVDGGVTVNGFEPN  268



>emb|CDP14238.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/254 (60%), Positives = 194/254 (76%), Gaps = 0/254 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSL+G TALVTGGTRGIG+AI+EELAGFGA V+TC+RNQ ++ + ++ W+ KG +V+
Sbjct  10   EQRWSLKGQTALVTGGTRGIGHAIVEELAGFGARVHTCSRNQTELNDRLKEWKAKGFQVS  69

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+ SR QREELM+ V++ F+ KLNILVNNA T   K A   T+EDY+ +M TN E+
Sbjct  70   GSVCDLLSRTQREELMKTVSSEFDAKLNILVNNAATTKMKRAENSTSEDYSFLMSTNLES  129

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            SFHL QLAYP LKAS  G+IVF SS  G   +   ++YSA+KGAINQ+TKNLACEWAKD+
Sbjct  130  SFHLSQLAYPLLKASANGNIVFISSVAGATALPGLSIYSATKGAINQLTKNLACEWAKDS  189

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVN+VAPW +RT ++   E+D  +      ++ RTP+ R  E  E+S LVAFLCLPAAS
Sbjct  190  IRVNTVAPWAVRTTVLKPEEADESLLRMFFPLVNRTPLRRIAEANEISPLVAFLCLPAAS  249

Query  838  YITGQTICVDGGYT  879
            YITGQ ICVDGG+T
Sbjct  250  YITGQVICVDGGFT  263



>gb|ADE76974.1| unknown [Picea sitchensis]
Length=266

 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/256 (60%), Positives = 192/256 (75%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSLQGMTALVTGGT+GIG A++EELAGFGA VYTC R + D+ +C+ +W+E GL V GS
Sbjct  11   RWSLQGMTALVTGGTKGIGRAVVEELAGFGAAVYTCGRTEKDLNDCLNQWKEAGLHVGGS  70

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD+SSR  REEL+ K ++ FNGKLNIL+NN GT + K A  +TAED++ +M TNFE+ F
Sbjct  71   LCDLSSRSAREELIGKASSFFNGKLNILINNVGTNIMKPAVGYTAEDFSFIMSTNFESGF  130

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HLCQL++P LKAS  GSIVF SS  G + +    +Y+ASKGA+NQ+TKNLA EWA D IR
Sbjct  131  HLCQLSHPLLKASGNGSIVFMSSVAGVVALQFAPIYAASKGAMNQITKNLAFEWASDKIR  190

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VN VAPW  +T  V +   D + + +I   + RTP+ R  E  +VSSLVAFLCLP+ASYI
Sbjct  191  VNCVAPWFTKTPFVKEILEDEETAKKI---LERTPLKRIAEPHDVSSLVAFLCLPSASYI  247

Query  844  TGQTICVDGGYTITGF  891
            TGQ ICVDGG TI GF
Sbjct  248  TGQIICVDGGMTINGF  263



>gb|ABW81087.1| TRL11 [Cleome spinosa]
Length=280

 Score =   325 bits (834),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 200/275 (73%), Gaps = 14/275 (5%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            +E  R   +WSLQG TALVTGGT+G+G A++EELAGFGA ++TCAR+ + + +C+  W+ 
Sbjct  5    EESIRQNSRWSLQGKTALVTGGTKGLGEAVVEELAGFGARIHTCARDGDHLNKCLREWQA  64

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILV-----------NNAGTLVPKDAT  426
            KG +V GS CDVS R +RE+LME V++ FNG+LNILV           NN GT + K  T
Sbjct  65   KGFQVTGSVCDVSLRTEREKLMETVSSLFNGELNILVMNRIDFVVEQINNVGTNIWKPTT  124

Query  427  EFTAEDYTIVMGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKG  606
            E+TAED++ +M TNFE+S+HLCQL++P LKAS  GSIVF SS  G + V   ++Y A+KG
Sbjct  125  EYTAEDFSFLMTTNFESSYHLCQLSHPLLKASGSGSIVFMSSVCGVVSVNVGSIYGATKG  184

Query  607  AINQMTKNLACEWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGE  786
            A+NQ+T+NLACEWA DNIR NSV PW I T LV  A  D K     E ++ R+PISR GE
Sbjct  185  AMNQLTRNLACEWASDNIRANSVCPWFISTPLVYRALEDEKFK---EAVVSRSPISRVGE  241

Query  787  VGEVSSLVAFLCLPAASYITGQTICVDGGYTITGF  891
              EVSSLV FLCLPAASYITGQTICVDGG T+ GF
Sbjct  242  PEEVSSLVTFLCLPAASYITGQTICVDGGMTVNGF  276



>ref|XP_008349592.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
 ref|XP_008358999.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
Length=264

 Score =   325 bits (832),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 198/262 (76%), Gaps = 3/262 (1%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            M+  E +WSL+GMTALVTGGT+GIGYAI+EELAG GA V+TC+RN+ D+ +C  +W +KG
Sbjct  1    MNSRERRWSLRGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCQSQWEKKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             +V GS CDV S+ QREEL+ KV++ F+GKLNIL+NN GT + K   E+TAEDY+ +M T
Sbjct  61   FQVTGSVCDVVSKTQREELINKVSSLFDGKLNILINNVGTSLTKATLEYTAEDYSFIMST  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N E++++ CQL++P LKA+   SIVF SS  G + +   ++YSA+KGA+NQ+ KNLACEW
Sbjct  121  NLESAYNFCQLSHPLLKAAGAASIVFLSSTAGVVSIDGESIYSATKGAMNQLAKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR NSVAPW I T L   AE   +   ++E +  R P+ RPGE  EVSSLVAFLCL
Sbjct  181  AKDNIRTNSVAPWFITTPL---AEPFLRNEKKLEMINSRCPLGRPGEPEEVSSLVAFLCL  237

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQTI VDGG T+ G 
Sbjct  238  PAASYITGQTIIVDGGVTVNGL  259



>emb|CDX86486.1| BnaC08g02170D [Brassica napus]
Length=262

 Score =   325 bits (832),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 152/258 (59%), Positives = 193/258 (75%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSLQGMTALVTGG RGIGYAI+EELAGFGA+++TC R+Q  + EC+  W+ KG +V 
Sbjct  2    DSRWSLQGMTALVTGGARGIGYAIVEELAGFGAKIHTCDRDQTLLDECLSEWKAKGFQVT  61

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDVSSRPQR+ LM+ V++ F+GKLNIL+NN GTLV K  TEFTA+D++  + TN E+
Sbjct  62   GSVCDVSSRPQRDGLMKTVSSLFSGKLNILINNVGTLVSKPTTEFTAQDFSGQIATNLES  121

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++H  QLA+P LKAS  GSIVF SS  G +     ++YS +KG +NQ+ +NLACEWA D 
Sbjct  122  AYHFSQLAHPLLKASGFGSIVFLSSVCGVVSSGFVSIYSLTKGGMNQLARNLACEWASDG  181

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NSVAPW+ +T LV     D K ++ I     RTP+ R  E  EV+SLV FLCLPAAS
Sbjct  182  IRANSVAPWMTKTPLVQKRLDDEKFAEAI---FSRTPLGRACEPREVASLVTFLCLPAAS  238

Query  838  YITGQTICVDGGYTITGF  891
            YITGQTIC+DGG+T+ GF
Sbjct  239  YITGQTICIDGGFTVNGF  256



>ref|XP_002319562.1| hypothetical protein POPTR_0013s02690g [Populus trichocarpa]
 gb|EEE95485.1| hypothetical protein POPTR_0013s02690g [Populus trichocarpa]
Length=260

 Score =   325 bits (832),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 156/259 (60%), Positives = 196/259 (76%), Gaps = 4/259 (2%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSLQGMTALVTGGT+GIGYA+++ELA  GA V+TCARNQ+ + E +  W EKG KV 
Sbjct  2    EKRWSLQGMTALVTGGTKGIGYAVVDELAALGAIVHTCARNQDQLNERIREWNEKGFKVT  61

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDVSS  +RE+LME+V++ F+GKLNILVNNAGT + K   ++TAED+T +M TN ++
Sbjct  62   GSVCDVSSDAEREKLMEEVSSRFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQS  121

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVT-KTTLYSASKGAINQMTKNLACEWAKD  654
            +FHL QLA+P LKAS  G IVF SS    + V  +  LYSASKGA+NQ+T+NLACEWAKD
Sbjct  122  AFHLSQLAHPLLKASGAGKIVFMSSIGSVVSVNPQYPLYSASKGAMNQLTRNLACEWAKD  181

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            NIRVN VAPW +RT L   +  D  ++ E+     RTP+ R GE GEVSS+VAFLCLPA 
Sbjct  182  NIRVNGVAPWFVRTPLTAHSLDDESIAKEV---FSRTPMRRVGEPGEVSSVVAFLCLPAP  238

Query  835  SYITGQTICVDGGYTITGF  891
             ++TGQ ICVDGG ++ GF
Sbjct  239  GFLTGQIICVDGGMSVNGF  257



>gb|ABW81146.1| TRL26 [Capsella rubella]
Length=271

 Score =   325 bits (832),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 157/263 (60%), Positives = 196/263 (75%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E  R   +WSL+GMTALVTGG++GIG AI+EELA  GA V+TCAR++ +++E + +W+EK
Sbjct  6    ESLRENPRWSLRGMTALVTGGSKGIGEAIVEELAMLGARVHTCARDETELQESLRKWQEK  65

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G +V  S CDVSSR QRE+LME V++ F GKLNILVNN G ++ K     T+ED++  M 
Sbjct  66   GFQVTTSVCDVSSRDQREKLMETVSSVFQGKLNILVNNVGAIIVKPTVMHTSEDFSFTMA  125

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN E++FHL QLA+P LKAS  G+IV  SS  G + VT  ++Y ASKGA+NQ+ +NLACE
Sbjct  126  TNLESAFHLSQLAHPLLKASGSGNIVLISSVSGVVHVTGASMYGASKGALNQLGRNLACE  185

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WA DNIRVNSV PW I T  VN+  SD +  +E+E    R P+ R GE  EVSSLVAFLC
Sbjct  186  WASDNIRVNSVCPWFIATPFVNEVLSDKEFRNEVE---SRPPMGRVGEPNEVSSLVAFLC  242

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPAASYITGQTICVDGG+TI GF
Sbjct  243  LPAASYITGQTICVDGGFTINGF  265



>ref|XP_010650985.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X3 [Vitis vinifera]
 ref|XP_010650988.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X6 [Vitis vinifera]
Length=270

 Score =   325 bits (832),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 154/264 (58%), Positives = 200/264 (76%), Gaps = 3/264 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            S G+ +WSL+GMTALVTGGT+GIG+AI+EELAG GA ++TC+R + ++ EC++ W+ KG 
Sbjct  8    SSGDSRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGF  67

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
             V+GS CDVSS  QRE+LME V++ F GKLNILVNNA  ++ K   E TAE+++ +M  N
Sbjct  68   GVSGSVCDVSSPAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAIN  127

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            FE+ +HL QLA+P LKAS  GSIVF SS  G + +   + YSA+KGA+NQ+TKNLACEWA
Sbjct  128  FESVYHLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEWA  187

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            +DNIR N+VAPW I+T +V+   S+      +E +I R P+ R G+  EVSSLVAFLCLP
Sbjct  188  EDNIRSNAVAPWYIKTPMVDQMLSNKTF---LEGVINRAPLRRVGDPKEVSSLVAFLCLP  244

Query  829  AASYITGQTICVDGGYTITGFP*N  900
            A+SYITGQTICVDGG T+ GF  N
Sbjct  245  ASSYITGQTICVDGGVTVNGFEPN  268



>gb|ACU16743.1| unknown [Glycine max]
Length=269

 Score =   325 bits (832),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 196/262 (75%), Gaps = 4/262 (2%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            ++RGE +WSL GMTALVTGGTRGIG++I+ +LA FGA V+TC+R Q ++ +C++ W+ +G
Sbjct  6    INRGE-RWSLNGMTALVTGGTRGIGHSIVSDLAAFGAAVHTCSRTQTELNKCLQEWQSQG  64

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             +V GS CDVSS PQRE+L+++VA+ FNGKLNI VNN G  + K   E+TAE+Y+ +M  
Sbjct  65   FQVTGSLCDVSSPPQREKLIQEVASTFNGKLNIYVNNVGINIRKPTIEYTAEEYSQIMTV  124

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N ++SFHLCQLAYP LKASE GSIVF SS  G + +    +++ASK AINQ+TKNLAC+W
Sbjct  125  NLDSSFHLCQLAYPLLKASEKGSIVFISSVAGVVSLGTGAVFAASKAAINQLTKNLACDW  184

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR N V PW  RT +V     D K  D+I   + RTPI R  E  EVSSLV FLCL
Sbjct  185  AKDNIRSNCVVPWATRTPVVEHLFKDQKFVDDI---MSRTPIKRIAEPEEVSSLVNFLCL  241

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAAS+ITGQ ICVDGG T+ GF
Sbjct  242  PAASFITGQVICVDGGLTVNGF  263



>ref|XP_003632186.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera]
 emb|CBI16071.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 198/264 (75%), Gaps = 3/264 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            S G+ +WSL+GMTALVTGGT+GIG+AI+EELAG GA ++TC+R + ++ EC++ W+ KG 
Sbjct  8    SSGDSRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGF  67

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
             V+GS CDVSSR QRE+LM+ +++ FNGKLNIL+NNA   + K   E TAE+++ +M TN
Sbjct  68   GVSGSVCDVSSRAQREKLMQTISSVFNGKLNILINNAAISIQKPTIEVTAEEFSTIMATN  127

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            FE+ +HL Q+A+P LKAS  GSIVF SS  G +     + YS +KGA+NQ+TKNLACEWA
Sbjct  128  FESVYHLSQIAHPLLKASGAGSIVFISSVSGIVAHKNISAYSVTKGAMNQLTKNLACEWA  187

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            KDNIR N+VAPW I+T +V    ++      +E +I R P+ R G+  EVSSLVAFLCLP
Sbjct  188  KDNIRSNAVAPWYIKTPMVEQMLTNQAF---LEEVINRAPLRRVGDPKEVSSLVAFLCLP  244

Query  829  AASYITGQTICVDGGYTITGFP*N  900
            A+SYITGQ ICVDGG T+ GF  N
Sbjct  245  ASSYITGQIICVDGGMTVNGFESN  268



>ref|XP_003538423.1| PREDICTED: tropinone reductase homolog At1g07440 [Glycine max]
Length=270

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 196/262 (75%), Gaps = 4/262 (2%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            ++RGE +WSL GMTALVTGGTRGIG++I+ +LA FGA V+TC+R Q ++ +C++ W+ +G
Sbjct  6    INRGE-RWSLNGMTALVTGGTRGIGHSIVSDLAAFGAAVHTCSRTQTELNKCLQEWQSQG  64

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             +V GS CDVSS PQRE+L+++VA+ FNGKLNI VNN G  + K   E+TAE+Y+ +M  
Sbjct  65   FQVTGSLCDVSSPPQREKLIQEVASTFNGKLNIYVNNVGINIRKPTIEYTAEEYSQIMTV  124

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N ++SFHLCQLAYP LKASE GSIVF SS  G + +    +++ASK AINQ+TKNLAC+W
Sbjct  125  NLDSSFHLCQLAYPLLKASEKGSIVFISSVAGVVSLGTGAVFAASKAAINQLTKNLACDW  184

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR N V PW  RT +V     D K  D+I   + RTPI R  E  EVSSLV FLCL
Sbjct  185  AKDNIRSNCVVPWATRTPVVEHLFKDQKFVDDI---MSRTPIKRIAEPEEVSSLVNFLCL  241

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAAS+ITGQ ICVDGG T+ GF
Sbjct  242  PAASFITGQVICVDGGLTVNGF  263



>ref|XP_010414428.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=264

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/256 (60%), Positives = 192/256 (75%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GMTALVTGG++GIG A++EEL+  GA V+TCAR++  ++E +  W+ KG +V  S
Sbjct  6    RWSLGGMTALVTGGSKGIGEAVVEELSMMGASVHTCARDETQLQERLREWQAKGFQVTTS  65

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSSR +RE LME V++ F GKLNILVNNAGT + K  TE+TAE+Y+ +M TN E+SF
Sbjct  66   VCDVSSREKRETLMETVSSLFQGKLNILVNNAGTYISKPTTEYTAEEYSFIMPTNLESSF  125

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLA+P LKAS  GSIV  SS  G + V   ++Y A+KGA+NQ+ +NLACEWA DNIR
Sbjct  126  HLSQLAHPLLKASGSGSIVHMSSVAGVVHVNVGSIYGATKGAMNQLARNLACEWASDNIR  185

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N+V PW I T LVND   D ++  E+E    RTP+ R GE  EVSSLVAFLCLPAASYI
Sbjct  186  TNAVCPWFITTPLVNDLLHDEEIKKEVE---SRTPMGRVGETNEVSSLVAFLCLPAASYI  242

Query  844  TGQTICVDGGYTITGF  891
            TGQ ICVDGG+T+ GF
Sbjct  243  TGQVICVDGGFTVNGF  258



>ref|XP_004291519.1| PREDICTED: tropinone reductase homolog At1g07440-like [Fragaria 
vesca subsp. vesca]
Length=264

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 202/262 (77%), Gaps = 6/262 (2%)
 Frame = +1

Query  115  GEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL-K  291
            G  +WSL+GMTALVTGGT+GIGYAI+EELAG GA V+TC+RN+  + EC+ +W++KGL +
Sbjct  6    GGRRWSLEGMTALVTGGTKGIGYAIVEELAGLGARVHTCSRNEAQLHECLSQWKKKGLHQ  65

Query  292  VAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVP-KDATEFTAEDYTIVMGTN  468
            V GS CDV S+  REEL+ +V++ F+GKLNIL+NN GT    K  TE+T+E+Y+ ++ TN
Sbjct  66   VTGSVCDVVSKIHREELIHRVSSLFHGKLNILINNVGTTHKTKPTTEYTSEEYSFIISTN  125

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKT-TLYSASKGAINQMTKNLACEW  645
             E+++++CQLA P LKAS  G+I+  SS  G + + K  ++Y A+KGA+NQ+ KNLACEW
Sbjct  126  LESTYNMCQLAQPLLKASSAGNIILLSSVAGVVSIGKVGSIYGATKGAMNQLAKNLACEW  185

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR+NSVAPW IRT LV    SD K S   E +I RTP+ R GE  EVS+LVAFLCL
Sbjct  186  AKDNIRINSVAPWFIRTPLVEPLLSDEKFS---EAVISRTPLERIGEPEEVSALVAFLCL  242

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQTICVDGG TI GF
Sbjct  243  PAASYITGQTICVDGGMTINGF  264



>ref|XP_006846355.1| hypothetical protein AMTR_s00012p00260970 [Amborella trichopoda]
 gb|ERN08030.1| hypothetical protein AMTR_s00012p00260970 [Amborella trichopoda]
Length=268

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/253 (60%), Positives = 192/253 (76%), Gaps = 3/253 (1%)
 Frame = +1

Query  133  LQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGSACD  312
            L GM+ALVTGGT+GIGYAI+EELAG GA +YTCAR + D+ +C+  W+ +G  V GS CD
Sbjct  17   LHGMSALVTGGTKGIGYAIVEELAGLGASIYTCARTEVDLNKCLNEWKGQGFSVHGSVCD  76

Query  313  VSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASFHLC  492
            +SSRP RE L+E V+ HFNGKLNILVNN GT +PK   ++TAED++ ++ TN E++FH+C
Sbjct  77   LSSRPHRENLIEAVSAHFNGKLNILVNNVGTNIPKQTVDYTAEDFSFLVSTNLESAFHMC  136

Query  493  QLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIRVNS  672
            QL++P LKAS  GSIVF SS  G + +   ++Y A+KGAINQ+TKNLACEWAKDNIR NS
Sbjct  137  QLSHPLLKASGAGSIVFISSVAGVVALQVGSIYGATKGAINQLTKNLACEWAKDNIRTNS  196

Query  673  VAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYITGQ  852
            V PW IRT L   AE      +  ++++ RTP+ R GE  EVSSLVA+LCLPAASYITGQ
Sbjct  197  VTPWFIRTPL---AELILGNEEHYKQIVARTPLKRVGEPEEVSSLVAYLCLPAASYITGQ  253

Query  853  TICVDGGYTITGF  891
             I VDGG ++ G+
Sbjct  254  VISVDGGVSVNGW  266



>ref|XP_007206210.1| hypothetical protein PRUPE_ppa015172mg [Prunus persica]
 gb|EMJ07409.1| hypothetical protein PRUPE_ppa015172mg [Prunus persica]
Length=249

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/262 (60%), Positives = 194/262 (74%), Gaps = 18/262 (7%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            MS  E +WSL+G+TALVTGGT+GIGYAI+EELAG GA ++TCARN+ D+ +C+ +W +KG
Sbjct  1    MSSREKRWSLEGLTALVTGGTKGIGYAIVEELAGLGATIHTCARNEVDLNDCLSQWGKKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             KV GS CDV S+ QREEL+ KV++ F+GKLNIL+NN GT +PK  TE+TAEDYT +M T
Sbjct  61   FKVTGSVCDVVSKTQREELINKVSSLFDGKLNILINNVGTNIPKPTTEYTAEDYTFLMST  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N E+++HLCQLA+P LKAS  G+IVF SS                 GA+NQ+ KNLACEW
Sbjct  121  NLESAYHLCQLAHPLLKASGAGNIVFLSSVA---------------GAMNQLAKNLACEW  165

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR NSVAPW I+T L +      K    ++ +  RTP+ RPGE  EVS+LVAFLCL
Sbjct  166  AKDNIRTNSVAPWFIKTLLGDHFLGHEKT---LKIINSRTPLGRPGEPEEVSALVAFLCL  222

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQTICVDGG T+ G 
Sbjct  223  PAASYITGQTICVDGGVTVNGL  244



>gb|AFK38962.1| unknown [Medicago truncatula]
Length=269

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/264 (59%), Positives = 195/264 (74%), Gaps = 3/264 (1%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            QE S    +WSL+G TALVTGGTRGIG+A++EELA FGA V+TC+RN+ ++ +C+  W+E
Sbjct  4    QESSMRGSRWSLKGTTALVTGGTRGIGHAVVEELAEFGATVFTCSRNEEELNKCLNEWKE  63

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            KG  V GS CD SS  QREEL+ +VA+ FNGKLNILV+NAGT V K   E+TAEDY+ VM
Sbjct  64   KGFSVYGSVCDASSPSQREELIRQVASAFNGKLNILVSNAGTNVRKPTIEYTAEDYSKVM  123

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
             TN ++++HLCQLAYP LK S  GSIVF SS    + V   ++Y+ SK AINQ+TKNLAC
Sbjct  124  TTNLDSAYHLCQLAYPLLKESGNGSIVFISSVASLISVGTGSIYAVSKAAINQLTKNLAC  183

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWAKDNI  N VAPW  +T LV    ++ +  DE+   + RTPI R  E  EVS+LV FL
Sbjct  184  EWAKDNIGSNCVAPWYTKTSLVEQFIANKEFVDEV---LSRTPIKRIAETHEVSALVTFL  240

Query  820  CLPAASYITGQTICVDGGYTITGF  891
            CLPAASYITGQT+ VDGG+T+ GF
Sbjct  241  CLPAASYITGQTVSVDGGFTVNGF  264



>ref|XP_011023547.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=260

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/259 (60%), Positives = 197/259 (76%), Gaps = 4/259 (2%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSLQGMTALVTGGT+GIGYA+++ELA  GA V+TCARN++ + E +  W EKG KV 
Sbjct  2    EKRWSLQGMTALVTGGTKGIGYAVVDELAALGAIVHTCARNKDQLNERIREWNEKGFKVT  61

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDVSS  +RE+LME+V++ F+GKLNILVNNAGT + K   ++TAED+T +M TN ++
Sbjct  62   GSVCDVSSDAEREKLMEEVSSRFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQS  121

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPV-TKTTLYSASKGAINQMTKNLACEWAKD  654
            +FHL QLA+P LKAS  G IVF SS    + V T+  +YSASKGA+NQ+T+NLACEWAKD
Sbjct  122  AFHLSQLAHPLLKASGAGKIVFMSSIGSVVSVNTQYPVYSASKGAMNQLTRNLACEWAKD  181

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            NIRVN+VAPW IRT L   +  D  +  E+     RTP+ R GE GEVSS+VAFLCLPA 
Sbjct  182  NIRVNAVAPWFIRTPLTTPSLDDENILKEV---FNRTPMKRVGEPGEVSSVVAFLCLPAP  238

Query  835  SYITGQTICVDGGYTITGF  891
             ++TGQ IC+DGG ++ GF
Sbjct  239  GFLTGQVICIDGGMSVNGF  257



>ref|XP_002524214.1| tropinone reductase, putative [Ricinus communis]
 gb|EEF38138.1| tropinone reductase, putative [Ricinus communis]
Length=272

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/271 (59%), Positives = 199/271 (73%), Gaps = 3/271 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E S  E  WSL G TALVTGGTRGIG A + ELA  GA V+TC+RN  ++ +C++ W EK
Sbjct  5    ESSFKESIWSLHGRTALVTGGTRGIGNATVVELARLGARVHTCSRNGEELNKCLKEWEEK  64

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            GL V GS CD SSR QRE+L+E+V + FNG LNILVNN GT + K   E+TAE+Y+ +M 
Sbjct  65   GLLVTGSVCDASSRAQREKLIEEVGSVFNGSLNILVNNVGTNIRKPTNEYTAEEYSEIMI  124

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TNFE+++H+CQLA+P LKAS +GSIVF SS  G   +   ++Y A+KGAI+Q+TKNLACE
Sbjct  125  TNFESAYHMCQLAHPLLKASGVGSIVFISSVAGLQHIGSGSIYGATKGAIHQLTKNLACE  184

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKDNIR NSVAPW IRT LV   E   K+ + +E+++ +TP+ R GE  EVSSLVAFLC
Sbjct  185  WAKDNIRTNSVAPWYIRTSLV---ERLLKIKEFVEKVVAKTPLKRIGEPTEVSSLVAFLC  241

Query  823  LPAASYITGQTICVDGGYTITGFP*NNKLLF  915
            LPAASYITGQ I VDGG T  GF    +L+ 
Sbjct  242  LPAASYITGQIISVDGGMTANGFDSGMRLVL  272



>ref|XP_010557237.1| PREDICTED: tropinone reductase homolog At1g07440-like [Tarenaya 
hassleriana]
Length=262

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/255 (59%), Positives = 195/255 (76%), Gaps = 3/255 (1%)
 Frame = +1

Query  127  WSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGSA  306
            WSL+GMTALVTGGT+GIG A++EELAGFGA V+ CARN++ + EC+  W+ KGL+V GS 
Sbjct  7    WSLRGMTALVTGGTKGIGSAVVEELAGFGARVHACARNESLLNECLREWQTKGLQVTGSV  66

Query  307  CDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASFH  486
            CDVS R +R++LM+ V++ F GKLN+L+NN GT++PK  TE+TAED++ +M TNFE+S+H
Sbjct  67   CDVSCRSERQKLMQTVSSLFRGKLNLLINNVGTVLPKPTTEYTAEDFSFLMRTNFESSYH  126

Query  487  LCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIRV  666
            LCQLAYP LKA   GSIVFNSS+ G +     ++Y  +KGA+NQ+ +NLACEWA DNIR 
Sbjct  127  LCQLAYPLLKALGSGSIVFNSSSGGIVSCILGSIYGPTKGAMNQLARNLACEWASDNIRA  186

Query  667  NSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYIT  846
            N+VAP+ I T L      D  V    + ++ RTP+ R GE  EV+SLV FLCLPA+SYIT
Sbjct  187  NAVAPYSISTPLAQPFLEDENVE---KALMSRTPLGRVGEPEEVASLVTFLCLPASSYIT  243

Query  847  GQTICVDGGYTITGF  891
            GQTICVDGG T+ GF
Sbjct  244  GQTICVDGGLTVNGF  258



>ref|XP_004240378.1| PREDICTED: tropinone reductase homolog [Solanum lycopersicum]
Length=301

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 204/274 (74%), Gaps = 7/274 (3%)
 Frame = +1

Query  79   WFFINNYQEMSRGEGK---WSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQND  249
            W ++N Y  + R  GK   WSL GM ALVTGGTRGIG+AI+EEL G GA V+TCARN+++
Sbjct  27   WSWMNKYSSI-RCAGKVNRWSLDGMNALVTGGTRGIGHAIVEELCGLGATVHTCARNEDE  85

Query  250  VKECVERWREKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATE  429
            ++ C+  W+++G  V+GS CDVSS+  R++LME V++ FNGKL+IL+NN GT + K   +
Sbjct  86   LEICLRSWKDEGFTVSGSLCDVSSQVDRQKLMEVVSSTFNGKLDILINNVGTNIRKAMVD  145

Query  430  FTAEDYTIVMGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGA  609
            FTAE+++ VM TNFE+ FHLCQLAYP LKAS  GS+VF SS  GF+ +   +L  A+KGA
Sbjct  146  FTAEEFSSVMATNFESVFHLCQLAYPLLKASGAGSVVFTSSVSGFVSLKSMSLQGATKGA  205

Query  610  INQMTKNLACEWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEV  789
            INQ+TK LACEWAKDNIR N+VAPW I+T +V    S+    + ++ +  RTP+ R GE 
Sbjct  206  INQLTKYLACEWAKDNIRSNAVAPWYIKTSMVEQVLSN---KEYLQEVYDRTPLGRLGEP  262

Query  790  GEVSSLVAFLCLPAASYITGQTICVDGGYTITGF  891
             EVSSLV FLCLPA+SYITGQ ICVDGG ++ GF
Sbjct  263  SEVSSLVGFLCLPASSYITGQIICVDGGMSVNGF  296



>ref|XP_008461702.1| PREDICTED: tropinone reductase homolog [Cucumis melo]
Length=273

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/261 (60%), Positives = 196/261 (75%), Gaps = 3/261 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            S G  +WSL+G TALVTGGTRGIG+A++EELAG GA V+TC+RNQ+D+ +C++ W  KG 
Sbjct  7    SAGIPRWSLKGFTALVTGGTRGIGHAVVEELAGLGASVHTCSRNQSDLNQCLKEWEAKGF  66

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
             V GS CD SSR QREEL+++VA+ FNG LNILVNNAGT + K   E++ ED + +M TN
Sbjct  67   VVTGSVCDASSRTQREELIQEVASSFNGTLNILVNNAGTNIRKPTAEYSLEDVSTLMTTN  126

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            FE+++HL QL++P LKAS  GSIVF SS  G + V   ++Y+A+K AINQ+TK LACEWA
Sbjct  127  FESAYHLSQLSHPLLKASGNGSIVFISSVGGLVSVGSGSIYAATKSAINQLTKYLACEWA  186

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            KDNIRVN VAPW I T LV    ++  + D I   + RTP+ R GE  EVSSLVAFLCLP
Sbjct  187  KDNIRVNGVAPWYINTPLVEKLLNNKTLVDNI---VSRTPLRRIGESKEVSSLVAFLCLP  243

Query  829  AASYITGQTICVDGGYTITGF  891
            AASYITGQ + VDGG+T  GF
Sbjct  244  AASYITGQIMSVDGGFTANGF  264



>ref|XP_004235263.1| PREDICTED: tropinone reductase homolog [Solanum lycopersicum]
Length=268

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 193/259 (75%), Gaps = 3/259 (1%)
 Frame = +1

Query  115  GEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKV  294
            G  +WSL G TALVTGGTRGIG+A++EELA  GA VYTC+RN+ ++ E ++ W  KGL+V
Sbjct  8    GSSRWSLSGFTALVTGGTRGIGHAVVEELAELGATVYTCSRNEAELNERLQEWAVKGLQV  67

Query  295  AGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFE  474
             GS CD SSR QR +LME V+  F+GKLNIL+NN GT + K  T++TAE+Y  +  TN E
Sbjct  68   KGSVCDASSREQRIQLMENVSAAFDGKLNILINNVGTNIRKPTTDYTAEEYAHLFSTNLE  127

Query  475  ASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKD  654
            +++HLCQLA+P LKAS  GS+VF SS  G + ++  ++Y A+KGAINQ+T+NLACEWAKD
Sbjct  128  SAYHLCQLAHPLLKASGNGSVVFISSVAGLVHLSSGSIYGATKGAINQLTRNLACEWAKD  187

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            NIRVN VAPW I+T LV     +    D +   I RTP+ RPGE  EVSSLVA+LCLP A
Sbjct  188  NIRVNGVAPWYIKTSLVEHLLENKTFLDGV---ISRTPLRRPGESQEVSSLVAYLCLPGA  244

Query  835  SYITGQTICVDGGYTITGF  891
            SYITGQ I VDGG+T+ GF
Sbjct  245  SYITGQVIAVDGGFTVNGF  263



>ref|XP_007016329.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY33948.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=320

 Score =   325 bits (832),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/256 (60%), Positives = 196/256 (77%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSLQGMTALVTGGTRG+G AI+EELAG GA VYTC+RN+N++ +C+  W+  G +V+GS
Sbjct  63   RWSLQGMTALVTGGTRGVGRAIVEELAGLGARVYTCSRNENELDKCLVDWKSLGFEVSGS  122

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVS   +RE LME V++ F+ KLNIL+NN GT + K   EFTAE+ + ++ TNFE+ F
Sbjct  123  ICDVSMGVERERLMENVSSLFDSKLNILINNVGTNIRKPMVEFTAEEVSTLLATNFESVF  182

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            +LCQLAYP LKAS +GS+VF SS  GF+ +   +L  A+KGAINQ+T+NLACEWAKDNIR
Sbjct  183  NLCQLAYPLLKASGVGSVVFTSSVSGFVSLKSMSLQGATKGAINQLTRNLACEWAKDNIR  242

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N+VAPW IRT +V    S+    + +E +  RTP+ R G+  EVSSLVAFLCLPA+SYI
Sbjct  243  SNAVAPWYIRTSMVEQVLSN---QEYLEEVYSRTPLQRLGDPTEVSSLVAFLCLPASSYI  299

Query  844  TGQTICVDGGYTITGF  891
            TGQ ICVDGG ++ GF
Sbjct  300  TGQIICVDGGMSVNGF  315



>gb|AAC95218.1| putative tropinone reductase [Arabidopsis thaliana]
Length=268

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 198/265 (75%), Gaps = 8/265 (3%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            +E  R + +WSL GMTALVTGG++G+G A++EELA  GA V+TCARN+  ++ECV  W+ 
Sbjct  5    EENLRDKCRWSLGGMTALVTGGSKGLGEAVVEELAMLGARVHTCARNETQLQECVREWQA  64

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            KG +V  S CDVSSR QRE+LME VA+ F GKLNILVNNAGT + K  TE+TA+DY+ +M
Sbjct  65   KGFEVTTSVCDVSSRDQREKLMENVASIFQGKLNILVNNAGTGITKPTTEYTAQDYSFLM  124

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
             TN +++FHL QLA+P LKAS  GSIV  SS  G + +   ++Y A+KGA+NQ+ KNLAC
Sbjct  125  ATNLDSAFHLSQLAHPLLKASGSGSIVLMSSTAGVVHINVGSIYGATKGAMNQLAKNLAC  184

Query  640  EWAKDNIRVNSVAPWIIRTKL-VNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAF  816
            EWA+DNIRVNSV PW I T L +ND E    +  E+E   R+TP+ R G   EVSSLVAF
Sbjct  185  EWARDNIRVNSVCPWFIATPLYLNDEE----LKKEVE---RKTPMGRVGNANEVSSLVAF  237

Query  817  LCLPAASYITGQTICVDGGYTITGF  891
            LC PAASYITGQTICVDGG+T+  F
Sbjct  238  LCFPAASYITGQTICVDGGFTVNCF  262



>ref|XP_006295594.1| hypothetical protein CARUB_v10024703mg [Capsella rubella]
 gb|EOA28492.1| hypothetical protein CARUB_v10024703mg [Capsella rubella]
Length=271

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/263 (59%), Positives = 196/263 (75%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E  R   +WSL+GMTALVTGG++GIG AI+EELA  GA V+TCAR++ +++E + +W+EK
Sbjct  6    ESLRENPRWSLRGMTALVTGGSKGIGEAIVEELAMLGARVHTCARDETELQESLRKWQEK  65

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G +V  S CDVSSR QRE+LME V++ F GKLNILVNN G ++ K     T+ED++  + 
Sbjct  66   GFQVTTSVCDVSSRDQREKLMETVSSVFQGKLNILVNNVGAIIVKPTVMHTSEDFSFTIA  125

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN E++FHL QLA+P LKAS  G+IV  SS  G + VT  ++Y ASKGA+NQ+ +NLACE
Sbjct  126  TNLESAFHLSQLAHPLLKASGSGNIVLISSVSGVVHVTGASMYGASKGALNQLGRNLACE  185

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WA DNIRVNSV PW I T  VN+  SD +  +E+E    R P+ R GE  EVSSLVAFLC
Sbjct  186  WASDNIRVNSVCPWFIATPFVNEVLSDKEFRNEVE---SRPPMGRVGEPNEVSSLVAFLC  242

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPAASYITGQTICVDGG+TI GF
Sbjct  243  LPAASYITGQTICVDGGFTINGF  265



>ref|XP_008223763.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=270

 Score =   323 bits (827),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/259 (59%), Positives = 192/259 (74%), Gaps = 4/259 (2%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL-KV  294
            + +WSL GMTALVTGGT+GIGYAI+EELAG GA V+TC+RN+  + +C+ +W+ KG  +V
Sbjct  10   DSRWSLHGMTALVTGGTKGIGYAIVEELAGLGATVHTCSRNEVQLNDCLSQWKIKGFDQV  69

Query  295  AGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFE  474
             GS CDV S+ QREEL+ KV++ F+GKLNIL+NN GT   K A E T EDY+ +M TN E
Sbjct  70   TGSVCDVVSKAQREELINKVSSLFHGKLNILINNVGTFKIKPAIESTTEDYSFIMSTNLE  129

Query  475  ASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKD  654
            +++H  QLA+P LKAS  G+I+F SS  G + V   T+Y+A+KGA+NQ+ KNLACEWAKD
Sbjct  130  SAYHFSQLAHPLLKASGAGNIIFMSSVAGVVSVGTATIYAATKGAMNQLAKNLACEWAKD  189

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            NIR NSVAPW IRT L     SD K  + I     R P+ R GE  EVS+LVAFLC PAA
Sbjct  190  NIRTNSVAPWFIRTPLTEPLLSDQKFMEAIN---SRCPLGRIGEPKEVSALVAFLCFPAA  246

Query  835  SYITGQTICVDGGYTITGF  891
            SYITGQTICVDGG+T+ G 
Sbjct  247  SYITGQTICVDGGFTVNGL  265



>ref|XP_010414423.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=272

 Score =   323 bits (827),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/264 (58%), Positives = 197/264 (75%), Gaps = 3/264 (1%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            + +   + +WSL GMTALVTGG++G+G A++EELA  GA V+TCAR++  ++E +  W E
Sbjct  6    ENLRDDKSRWSLGGMTALVTGGSKGLGEAVVEELAMLGARVHTCARDETQLQERLREWHE  65

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            KG +V+ S CDVSSR QRE+LME V+  F GKLNILVNNAGT + K  TE+T++DY+ +M
Sbjct  66   KGFQVSISVCDVSSRDQREKLMETVSTLFQGKLNILVNNAGTCIAKPTTEYTSQDYSFLM  125

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
             TN E++FHL QLA+P LKAS  GSIV  SSA G + V  +++Y+A+KGA+NQ+ +NLAC
Sbjct  126  ATNLESAFHLSQLAHPLLKASGSGSIVLMSSAAGVVHVNISSIYAATKGAMNQLGRNLAC  185

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWA D IRVNSV PW I T L  D   D +  DE+E   ++TP+ R G+  EVSSLVAFL
Sbjct  186  EWANDKIRVNSVCPWFIDTPLAKDYLDDEEYKDEVE---KKTPMGRAGKPNEVSSLVAFL  242

Query  820  CLPAASYITGQTICVDGGYTITGF  891
            C PAASYITGQTICVDGG T+ GF
Sbjct  243  CFPAASYITGQTICVDGGATVNGF  266



>ref|XP_007163456.1| hypothetical protein PHAVU_001G235700g [Phaseolus vulgaris]
 gb|ESW35450.1| hypothetical protein PHAVU_001G235700g [Phaseolus vulgaris]
Length=273

 Score =   323 bits (827),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/261 (60%), Positives = 188/261 (72%), Gaps = 3/261 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            S+  G+WSL GMTALVTGGTRGIG+AI+ +LA FGA V+TC+R Q ++ +C+E W+  G 
Sbjct  9    SKRGGRWSLSGMTALVTGGTRGIGHAIVSDLAAFGAAVHTCSRTQTELNKCLEEWQNLGF  68

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
            KV GS CDVSS PQRE L+++VA+ FNG+LNI VNN G    K   E++ ++Y+ +M  N
Sbjct  69   KVTGSVCDVSSPPQRENLIQEVASTFNGRLNIYVNNVGINFRKPTIEYSTDEYSQLMAVN  128

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
             ++SFHLCQLAYP LKAS  GSIVF SS  G + +    +Y+ASK AINQ+TKNLACEWA
Sbjct  129  LDSSFHLCQLAYPLLKASGKGSIVFISSVAGVVSLGTGAVYAASKAAINQLTKNLACEWA  188

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            KDNIR N V PW  RT LV     D K  DEI   + RTPI R  E  EVSSLV FLCLP
Sbjct  189  KDNIRSNCVVPWATRTSLVEHLLKDLKFVDEI---LSRTPIKRIAEPEEVSSLVTFLCLP  245

Query  829  AASYITGQTICVDGGYTITGF  891
             ASYITGQ ICVDGG T+ GF
Sbjct  246  GASYITGQVICVDGGLTVNGF  266



>emb|CDP12723.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/256 (61%), Positives = 193/256 (75%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GMTALVTGGTRGIG AI+EELAG GA+V+T +R ++++ E ++ W  KG KV GS
Sbjct  11   RWSLSGMTALVTGGTRGIGCAIVEELAGLGAKVHTFSRKESELNERLQEWSSKGFKVTGS  70

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD SSR QR +L+ +V++ FNGKLNILVNN GT V + A  FTAE+Y ++M TN ++ +
Sbjct  71   VCDASSREQRTQLIGEVSSIFNGKLNILVNNVGTGVFRQAEAFTAEEYNLIMSTNLDSGY  130

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            H  QLAYP LKAS +G+IVF SS  G + V   ++YS +KGA+NQ+TKNLACEWAKDNIR
Sbjct  131  HFSQLAYPLLKASGIGNIVFMSSVAGLVHVHHLSVYSMTKGAMNQLTKNLACEWAKDNIR  190

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VNSVAPW IRT L  +  SD +  + +E    RTP+ R GE  EVSSLVAFLCLPAASYI
Sbjct  191  VNSVAPWYIRTSLAEEKLSDKEYEERVE---SRTPMRRTGEPEEVSSLVAFLCLPAASYI  247

Query  844  TGQTICVDGGYTITGF  891
            TGQ I VDGG T+ GF
Sbjct  248  TGQVIAVDGGMTVYGF  263



>ref|XP_010542622.1| PREDICTED: tropinone reductase homolog At1g07440-like [Tarenaya 
hassleriana]
Length=271

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/257 (60%), Positives = 201/257 (78%), Gaps = 4/257 (2%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL+GMTALVTGGT+GIGYAI+EELAGFGA V+TCARNQ+ + +C+  W+ KG +V GS
Sbjct  12   RWSLRGMTALVTGGTQGIGYAIVEELAGFGARVHTCARNQSLLDQCLREWQTKGFQVTGS  71

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSSRP+RE+LM+ V++ F+GKLNIL+NN GT + K  TE+TAED++  + TN E+++
Sbjct  72   VCDVSSRPEREKLMQTVSSAFDGKLNILINNVGTSIVKPTTEYTAEDFSFHITTNLESAY  131

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLA+P +KA+  G+IVF SS  G +  +  ++Y+A+KGAINQ+ +NLACEWA D+IR
Sbjct  132  HLSQLAHPLVKATGFGNIVFISSIAGIVSTSVGSIYNATKGAINQLARNLACEWASDDIR  191

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDE-IERMIRRTPISRPGEVGEVSSLVAFLCLPAASY  840
            VNSVAP  I T +   AE+     D  ++ +I R P++R GE  EVSSLVAFLCLPAASY
Sbjct  192  VNSVAPGFIATPM---AETAVLGDDNFLKAVISRKPLARVGEPREVSSLVAFLCLPAASY  248

Query  841  ITGQTICVDGGYTITGF  891
            ITGQTICVDGG TI GF
Sbjct  249  ITGQTICVDGGLTINGF  265



>ref|XP_008356743.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Malus domestica]
Length=264

 Score =   322 bits (825),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/263 (59%), Positives = 198/263 (75%), Gaps = 7/263 (3%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            M+R + +WSL+GMTALVTGGT+GIGYAI+EELAG GA V+TCAR + D+ +C+ +W +KG
Sbjct  1    MNRRDRRWSLEGMTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEXDLNDCLSQWEKKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             +V GS CDV S+ QREEL+ KV++ F+GKLNIL+NN G   PK   E+TAEDY+ +M T
Sbjct  61   FQVTGSVCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMST  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N E+++HLCQL++P LKAS   +IV  SS  G + +   T+YSA+KGAINQ+ +NLACEW
Sbjct  121  NLESAYHLCQLSHPLLKASGSANIVLLSSIAGVVSLNIGTIYSATKGAINQLARNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDE--IERMIRRTPISRPGEVGEVSSLVAFL  819
            AKDNIR NSVAPW I T L      D  + +E  +E +  R P+ RPGE  EVSSLVAFL
Sbjct  181  AKDNIRTNSVAPWFIATPL-----GDMFLGNEKALEMINSRCPLGRPGEPEEVSSLVAFL  235

Query  820  CLPAASYITGQTICVDGGYTITG  888
            CLPAASYITGQT+ VDGG ++ G
Sbjct  236  CLPAASYITGQTLLVDGGVSVNG  258



>ref|XP_007026941.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY07443.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
Length=278

 Score =   323 bits (827),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 194/255 (76%), Gaps = 2/255 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSLQGMTALVTGGTRGIGYAI+EELA  GA V+TC+RNQ ++ E ++ W+ KG KV+GS
Sbjct  12   RWSLQGMTALVTGGTRGIGYAIVEELAALGAVVHTCSRNQTEINERLQEWQSKGFKVSGS  71

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD+SSR QRE+LME V++ F GKLNILVNNAG  + K   E T EDY+ VM TN EA +
Sbjct  72   VCDLSSREQREKLMETVSSVFYGKLNILVNNAGITMLKPCVEHTLEDYSTVMSTNVEAPY  131

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLA+P+LKAS  GSIVF SS  G L + + + YSASKGAINQ+TKNLACEWAKDNIR
Sbjct  132  HLSQLAHPFLKASGNGSIVFISSVAGSLALPRLSAYSASKGAINQITKNLACEWAKDNIR  191

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N+V+PW ++T ++     D+   +E  R+I  T + R GE  E+SSLVAFLCLPAASYI
Sbjct  192  TNTVSPWGVKTTIM--IPPDSPYVEEFIRLIAGTAMPRTGEPEEISSLVAFLCLPAASYI  249

Query  844  TGQTICVDGGYTITG  888
            TGQ I VDGGYT  G
Sbjct  250  TGQVISVDGGYTAGG  264



>ref|XP_006488388.1| PREDICTED: tropinone reductase homolog isoform X1 [Citrus sinensis]
Length=342

 Score =   325 bits (833),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/258 (59%), Positives = 194/258 (75%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSLQG TALVTGGTRGIG AI+EEL GFGA ++TC+RN+N++ +C+  W   GL+V 
Sbjct  83   ESRWSLQGKTALVTGGTRGIGRAIVEELVGFGASLHTCSRNENELNKCLTEWGSLGLEVT  142

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDVS R QRE L++ V++ F+GKLNIL+NN GT + K   EFTA ++  +M TNFE+
Sbjct  143  GSVCDVSLRNQRESLIDSVSSLFDGKLNILINNVGTNIRKPMVEFTAGEFATLMATNFES  202

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
             FHLCQL+YP LKAS  GS+VF SS  GF+ +   +++ ++KGAINQ+T+NLACEWAKDN
Sbjct  203  LFHLCQLSYPLLKASGEGSVVFTSSVSGFVSLKNMSVHGSTKGAINQLTRNLACEWAKDN  262

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NSVAPW I+T +V    S     D +E +  RTP+ R G+  EVSSLVAFLC PA+S
Sbjct  263  IRCNSVAPWYIKTSMVEQVLSK---EDYLEEVFSRTPLRRLGDPTEVSSLVAFLCFPASS  319

Query  838  YITGQTICVDGGYTITGF  891
            YITGQ ICVDGG ++ GF
Sbjct  320  YITGQVICVDGGMSVNGF  337



>ref|XP_010691207.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=263

 Score =   322 bits (825),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/256 (59%), Positives = 192/256 (75%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GMTALVTGGTRGIG A++EEL GFGA+++ C+RN+ ++ +C+E W+ KG +V+GS
Sbjct  6    RWSLSGMTALVTGGTRGIGNAVVEELGGFGAKIHLCSRNEVELNKCLEEWKIKGFQVSGS  65

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDV+SR QR++LM+ VA+ FNGKLNILVNNAGT +     E + E+YT VM TN E+++
Sbjct  66   VCDVTSREQRQKLMQDVASIFNGKLNILVNNAGTNIRNSTVEVSPEEYTKVMATNLESAY  125

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HLCQLA+P LK S  GSIVF SS  G   +   ++Y  SK AINQ+T+NLACEWAKDNIR
Sbjct  126  HLCQLAHPLLKDSGAGSIVFISSVAGVTHLGTGSVYGTSKAAINQLTRNLACEWAKDNIR  185

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N+VAPW  RT LV    +D    D++   I RTP+ R  E  EV+S+VAFLCLPAASYI
Sbjct  186  SNTVAPWYTRTSLVTHLLADESFVDKV---ISRTPLGRIAEAEEVASMVAFLCLPAASYI  242

Query  844  TGQTICVDGGYTITGF  891
            TGQ ICVDGG T+ GF
Sbjct  243  TGQVICVDGGMTVLGF  258



>ref|XP_002532998.1| tropinone reductase, putative [Ricinus communis]
 gb|EEF29390.1| tropinone reductase, putative [Ricinus communis]
Length=266

 Score =   322 bits (825),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 194/258 (75%), Gaps = 2/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSLQGMTALVTGGTRGIGYA++EELAGFGA+VYTC+RN+ ++ E ++ W  KG  V 
Sbjct  11   DQRWSLQGMTALVTGGTRGIGYAVVEELAGFGAKVYTCSRNEKELNERIKEWEIKGFNVC  70

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+  R QR+ L++ V++ F GKLNILVNNAGT+  K+  ++T EDY+ +M TN E+
Sbjct  71   GSVCDLICRDQRQNLIDTVSSSFEGKLNILVNNAGTIKHKNTVDYTLEDYSSIMSTNLES  130

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
             +HLCQLAYP LKAS  GSIVF SS  GF+ +   ++Y+A+KGAINQ+TKNLACEWAKDN
Sbjct  131  PYHLCQLAYPLLKASGNGSIVFLSSVAGFIALPLISVYAATKGAINQLTKNLACEWAKDN  190

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR N+VAP   RT ++   E D  V +    +I R PI    E  EVSSLVAFLCLPAAS
Sbjct  191  IRTNAVAPSGTRTTILQ--EPDPAVIEAYAGIIPRNPIRPIAEPNEVSSLVAFLCLPAAS  248

Query  838  YITGQTICVDGGYTITGF  891
            YI GQ ICVDGG+T+ GF
Sbjct  249  YINGQVICVDGGFTVNGF  266



>ref|XP_004150641.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cucumis 
sativus]
 ref|XP_004172534.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cucumis 
sativus]
 gb|KGN50576.1| hypothetical protein Csa_5G184270 [Cucumis sativus]
Length=273

 Score =   322 bits (826),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 154/261 (59%), Positives = 195/261 (75%), Gaps = 3/261 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            S G  +WSL+G TALVTGGTRGIG+A++EELAG GA V+TCARN++D+ +C++ W  KG 
Sbjct  7    SAGNSRWSLEGFTALVTGGTRGIGHAVVEELAGLGASVHTCARNESDLNQCLKEWEAKGY  66

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
             V GS CD SSR QREEL+++VA+ FNG LNILVNN GT + K + E++ E+ + +M TN
Sbjct  67   VVTGSVCDASSRTQREELIQEVASSFNGTLNILVNNVGTNIRKPSAEYSLEEVSTLMTTN  126

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            FE++FHL QL++P LKAS  GSIVF SS  G + +   ++Y+A+K AINQ+T+NL CEWA
Sbjct  127  FESAFHLSQLSHPLLKASGNGSIVFISSVGGLVSIGSGSIYAATKSAINQLTRNLTCEWA  186

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            KDNIRVN VAPW I T LV     +  + D I   + RTP+ R GE  EVSSLVAFLCLP
Sbjct  187  KDNIRVNCVAPWYINTPLVEKLMKNKTLVDNI---VSRTPLGRIGESKEVSSLVAFLCLP  243

Query  829  AASYITGQTICVDGGYTITGF  891
            AASYITGQ + VDGG+T  GF
Sbjct  244  AASYITGQIMSVDGGFTANGF  264



>ref|XP_009375950.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=263

 Score =   322 bits (825),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 197/262 (75%), Gaps = 4/262 (2%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            M+  E +WSL+GMTALVTGGT+GIGYAI+EELAG GA V+TC+RN+ D+ +C+ +W EKG
Sbjct  1    MNSRERRWSLRGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCLSQW-EKG  59

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             +V GS CDV  + QR++L+ KV++ F GKLNIL+NN GT + K   E+TAEDY+ VM T
Sbjct  60   FQVTGSVCDVMYKTQRDKLINKVSSLFEGKLNILINNVGTSILKATLEYTAEDYSFVMST  119

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N E+ +HLCQL++P LKAS   +IVF SS  G + +   ++YSA+KGAINQ+ KNLACEW
Sbjct  120  NLESVYHLCQLSHPLLKASGAANIVFLSSTAGVVSIDVGSIYSATKGAINQLAKNLACEW  179

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR NSVAPW I T L +    + K   ++E +  R P+ RPGE  EVSSLVAFLCL
Sbjct  180  AKDNIRTNSVAPWFITTPLTDPVLRNEK---KLEMINSRCPLGRPGEPKEVSSLVAFLCL  236

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQTI +DGG T+ G 
Sbjct  237  PAASYITGQTIIIDGGVTVNGL  258



>ref|XP_004507158.1| PREDICTED: tropinone reductase homolog [Cicer arietinum]
Length=298

 Score =   323 bits (828),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 152/264 (58%), Positives = 196/264 (74%), Gaps = 3/264 (1%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
               S+    WSLQGMTALVTGGTRGIG+AI+EEL GFGA+V+TCARN++D+ +C+  W  
Sbjct  33   HSHSQTHHNWSLQGMTALVTGGTRGIGHAIVEELVGFGAKVHTCARNEDDLNKCLNEWNH  92

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
               +V GS CDVS   QR+ LME V++ F+GKLNIL+NN GT + K  T+FT  +++ ++
Sbjct  93   LDFEVTGSICDVSVPHQRDLLMETVSSLFHGKLNILINNVGTNIRKPITDFTTAEFSKLI  152

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
             TN  ++FH+CQLAYP LKAS +GS+VF SS  GF+ +   ++  A+KGAINQ+TKNLAC
Sbjct  153  DTNLGSTFHMCQLAYPLLKASGVGSVVFISSVSGFVSLKSMSVQGATKGAINQLTKNLAC  212

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWAKDNIR N+VAPW IRT +V    S+    D +E +  RTP+ R G+  EVSSLVAFL
Sbjct  213  EWAKDNIRSNAVAPWYIRTSMVEQVLSN---KDYLEEVYSRTPLRRLGDPAEVSSLVAFL  269

Query  820  CLPAASYITGQTICVDGGYTITGF  891
            CLPA+SYITGQ ICVDGG ++ GF
Sbjct  270  CLPASSYITGQIICVDGGMSVNGF  293



>ref|XP_011006389.1| PREDICTED: tropinone reductase homolog isoform X1 [Populus euphratica]
Length=267

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/263 (58%), Positives = 192/263 (73%), Gaps = 0/263 (0%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            EM   E +WSL+GMTALVTGGTRGIG+AI+EELAGFGA VYTC+RN+ ++ E ++ W  K
Sbjct  5    EMGCREQRWSLKGMTALVTGGTRGIGFAIVEELAGFGARVYTCSRNEKELNERIKEWEIK  64

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G  V GS CD+SS+  R++L+  V + F GKLNILVNNA T+  + + ++T EDY+ +M 
Sbjct  65   GFNVRGSVCDLSSQDDRQKLIGSVTSAFEGKLNILVNNAATITLRKSLDYTLEDYSFMMN  124

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TNF++ +HLCQLA+P LKAS  G+IVF SS  G + +   ++YSA+KGAINQ+T+NLACE
Sbjct  125  TNFKSPYHLCQLAHPLLKASGNGNIVFISSVAGIVALPMLSVYSATKGAINQLTRNLACE  184

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKDNIR N+VAP  IRT +  D  +D  V +    M  R PISR GE  EVSSLV FLC
Sbjct  185  WAKDNIRTNTVAPGAIRTTVAQDQSADPDVGEAYSDMFSRIPISRRGEPNEVSSLVVFLC  244

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LP ASYI GQ ICVDGG T   F
Sbjct  245  LPTASYINGQVICVDGGLTAKAF  267



>gb|ABW81066.1| tropinone-reductase-like53 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/267 (58%), Positives = 195/267 (73%), Gaps = 3/267 (1%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            +E  R   +WSL GMTALVTGG++G+G A++EELA  GA V+TCAR++  ++E +  W+ 
Sbjct  5    EENFRDNSRWSLGGMTALVTGGSKGLGKAMVEELAMLGARVHTCARDETQLQERLREWQA  64

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            KG +V  S CDVSSR QRE+LME V++ F GKLNILVNN GT + K  T+FT +DY+ +M
Sbjct  65   KGFQVTTSVCDVSSRDQREKLMETVSSIFQGKLNILVNNVGTCITKPTTKFTEQDYSFLM  124

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
             TN E++FHL QLA+P LKAS  GSIV  SSA G + +   ++Y A+KGA+NQ+ KNLAC
Sbjct  125  ATNLESTFHLSQLAHPLLKASRSGSIVLMSSAAGVVHINVGSIYGATKGAMNQLAKNLAC  184

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWA DNIRVNSV PW I T L N+   D ++  E+E    +TP+ R G+  EVSSLVAFL
Sbjct  185  EWASDNIRVNSVCPWFIATPLANNYLDDEELKKEVE---SKTPMGRAGKANEVSSLVAFL  241

Query  820  CLPAASYITGQTICVDGGYTITGFP*N  900
            C PAASYITGQTICVDGG T+ GF  N
Sbjct  242  CFPAASYITGQTICVDGGATVNGFSFN  268



>ref|XP_008358998.1| PREDICTED: tropinone reductase homolog At1g07440-like [Malus 
domestica]
Length=264

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/262 (58%), Positives = 197/262 (75%), Gaps = 3/262 (1%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            M+  E  WSL+GMTALVTGGT+GIGYAI+EELAG GA V+TC+RN+ D+ +C+ +W +KG
Sbjct  1    MNSRERTWSLRGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCLSQWEKKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             +V GS CDV S+ QREEL+ KV++ F+GKLNIL+NN G +  K   E+TAEDY+ +M T
Sbjct  61   FQVTGSVCDVVSKTQREELINKVSSLFDGKLNILINNVGIVEAKATVEYTAEDYSFIMST  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N E++++ CQL++P LKA+   +IVF SS  G + +   ++YSA+KGA+NQ+ KNLACEW
Sbjct  121  NLESAYNFCQLSHPLLKAAGAANIVFLSSTAGVVSINGASIYSAAKGAMNQLAKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR NSVAPW I T L   +E   +   ++E +  R P+ RPGE  EVSSLVAFLCL
Sbjct  181  AKDNIRTNSVAPWFITTPL---SEPVLRNEKKLEMINSRCPLRRPGEPEEVSSLVAFLCL  237

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQTI VDGG T+ G 
Sbjct  238  PAASYITGQTIIVDGGVTVNGL  259



>ref|XP_007016318.1| Senescence-associated gene 13 isoform 1 [Theobroma cacao]
 gb|EOY33937.1| Senescence-associated gene 13 isoform 1 [Theobroma cacao]
Length=283

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 197/272 (72%), Gaps = 5/272 (2%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            SR + +WSLQGMTALVTGGT+GIG+AIIEELAG  A ++TC+R + D+ +C+  W  KG 
Sbjct  11   SRKDNRWSLQGMTALVTGGTKGIGHAIIEELAGLRARIHTCSRTETDLNKCLLDWAAKGF  70

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
            +V GS CDVSS+ QRE+L+  V++ F GKLNIL+NN GT + K   + T ED++ +MGTN
Sbjct  71   QVTGSVCDVSSQAQREKLINTVSSEFGGKLNILINNVGTAILKPTPDITTEDFSFMMGTN  130

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            FE++++LCQLAYP LKAS  GSIVF SS  G + V+  +LY  +KGA+N + K LACEWA
Sbjct  131  FESAYNLCQLAYPLLKASGAGSIVFLSSIAGVVSVSFGSLYGVTKGAMNHLAKYLACEWA  190

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            KDNIRVNSVAPW IRT L  D      +    E +I RTP+ R GE  EVSSLV FLCLP
Sbjct  191  KDNIRVNSVAPWFIRTPLTED-----YIQKFSENIISRTPMGRIGEPEEVSSLVGFLCLP  245

Query  829  AASYITGQTICVDGGYTITGFP*NNKLLFFSS  924
            A+SYITGQT C+DGG ++  F  +  LL  SS
Sbjct  246  ASSYITGQTFCIDGGMSVNAFFYHETLLGMSS  277



>ref|XP_011070195.1| PREDICTED: tropinone reductase 1-like [Sesamum indicum]
Length=266

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/263 (59%), Positives = 196/263 (75%), Gaps = 1/263 (0%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            +E+SR E KWSL+GMTALVTGGTRGIG+AI+EEL GFGA ++TC+RNQ ++ E ++ W+ 
Sbjct  5    KEVSRDE-KWSLKGMTALVTGGTRGIGHAIVEELGGFGARIHTCSRNQTELNERIQEWKG  63

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            KG +V+GS CD+SSR QREELM  VA+ F+ KLNILVNNA   + K A E T +D+  +M
Sbjct  64   KGFEVSGSVCDLSSRTQREELMHTVASLFDAKLNILVNNAAISIMKRAIEHTEQDFWHIM  123

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
             TN E+ +HLCQ+AYP LKAS  G+IVF SS  G + +    +YSASKGAINQ+TKNLAC
Sbjct  124  STNLESPYHLCQIAYPLLKASGKGNIVFISSVAGKMALPGLAIYSASKGAINQLTKNLAC  183

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWAKDNIRVN+VAP+ ++T ++N    D  +      ++ RTPI    E  E+S L AFL
Sbjct  184  EWAKDNIRVNTVAPFAVKTTIINPENVDKSIQIMYAPLLARTPIRAIAEADEISPLTAFL  243

Query  820  CLPAASYITGQTICVDGGYTITG  888
            CLPAAS+ITGQ I VDGG+T TG
Sbjct  244  CLPAASHITGQVIYVDGGFTSTG  266



>ref|XP_009358752.1| PREDICTED: tropinone reductase homolog isoform X1 [Pyrus x bretschneideri]
Length=260

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 197/256 (77%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL+G TALVTGGT+GIG+A++EELAG GA V+ CARN   + E ++ W+ KG +V+GS
Sbjct  8    RWSLKGRTALVTGGTKGIGFAVVEELAGLGATVHMCARNGELLHERIQEWKSKGFEVSGS  67

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD++S+ QREEL+  V++ F+GKLNILVNNAGT+  ++AT++T ED++ +M TN E+ F
Sbjct  68   VCDLTSKDQREELIRTVSSVFHGKLNILVNNAGTVTLRNATDYTLEDFSTMMSTNVESPF  127

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HLCQLA+P LKAS   SIVF SS  G   + KT+ Y+A+KGA+ Q+ KNLACEWAKDNIR
Sbjct  128  HLCQLAHPLLKASGNASIVFVSSVGGMKALPKTSAYAATKGAVIQIVKNLACEWAKDNIR  187

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             NSVAPW + T +  D++     SD+  R+I RTPI RP +  EVSSLV FLCLPAASYI
Sbjct  188  TNSVAPWAVNTTVKPDSDDH---SDDYRRLIGRTPICRPAQPNEVSSLVTFLCLPAASYI  244

Query  844  TGQTICVDGGYTITGF  891
            TGQ I +DGG+T++GF
Sbjct  245  TGQVISIDGGFTVSGF  260



>ref|XP_002319563.2| tropinone reductase family protein [Populus trichocarpa]
 gb|EEE95486.2| tropinone reductase family protein [Populus trichocarpa]
Length=267

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/264 (59%), Positives = 198/264 (75%), Gaps = 4/264 (2%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E S  + +W LQGMTALVTGGT+G+G AI+EELA  GA V+TCARNQ+ + E V  W+EK
Sbjct  4    ESSSRDKRWGLQGMTALVTGGTKGLGCAIVEELAALGAIVHTCARNQDQINERVREWKEK  63

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G KV GS CDVSS  +RE+LM++V++ F+GKLNILVNNAGT + K   ++TAED+T +M 
Sbjct  64   GFKVTGSVCDVSSNAEREKLMKEVSSLFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMN  123

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVT-KTTLYSASKGAINQMTKNLAC  639
            TN +++FHL QLA+P LKAS  G IVF SS +  + +  +  LYSASKGA+NQ+T+NLAC
Sbjct  124  TNLQSAFHLSQLAHPLLKASGAGKIVFMSSIISVVSMNPQYPLYSASKGAMNQLTRNLAC  183

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWAKDNIRVN VAPW +RT L   +  D  ++ E+     RTP+ R GE GEVSS+VAFL
Sbjct  184  EWAKDNIRVNGVAPWFVRTPLTAHSLDDESIAKEV---FSRTPMRRVGEPGEVSSVVAFL  240

Query  820  CLPAASYITGQTICVDGGYTITGF  891
            CLPA  ++TGQ ICVDGG ++ GF
Sbjct  241  CLPAPGFLTGQIICVDGGMSVNGF  264



>gb|AFD23289.1| tropinone reductase II, partial [Dendrobium nobile]
Length=272

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/261 (57%), Positives = 202/261 (77%), Gaps = 3/261 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            SR  G+WSL+GMTALVTGGTRGIG A++EELA  GA VYTC+R ++++ +C+++W   GL
Sbjct  9    SRIAGRWSLEGMTALVTGGTRGIGNAVVEELAELGAVVYTCSRKESELNDCLKKWEGLGL  68

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
            +V+GS CD+S R QR +L++KV++ F+GKLNIL+NN GT + K   +++ EDY+ +M TN
Sbjct  69   RVSGSICDLSVREQRVDLIQKVSSAFDGKLNILINNVGTNIRKPTVDYSEEDYSFIMKTN  128

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
            F+A+FH+CQLA+P LKAS  GSIVF SS  G + ++   +Y+A+K A+NQ+TKNLACEWA
Sbjct  129  FDAAFHICQLAHPLLKASGNGSIVFISSVAGVVAISSGVIYAATKAAMNQITKNLACEWA  188

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            KDNIR+NSV+PW I+T LVN      +  + +  ++ RTP++R GE  EVSSLVAFLC+P
Sbjct  189  KDNIRINSVSPWYIKTSLVNHL---LEKENFLNSVVSRTPLNRVGEAEEVSSLVAFLCMP  245

Query  829  AASYITGQTICVDGGYTITGF  891
             ASYITGQ I VDGG T+ GF
Sbjct  246  CASYITGQIISVDGGMTVNGF  266



>ref|XP_010040245.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW45355.1| hypothetical protein EUGRSUZ_L00968 [Eucalyptus grandis]
Length=282

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/266 (60%), Positives = 200/266 (75%), Gaps = 10/266 (4%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            S  + +WSLQGMTALVTGG++GIG AI+EELAG GA VYTC+R + ++ EC++ W+ KG 
Sbjct  17   SDNDNRWSLQGMTALVTGGSKGIGRAIVEELAGLGATVYTCSRTEAELNECLKEWKRKGF  76

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTL-----VPKDATEFTAEDYTI  453
            +VAGSACDVSSR +RE+LM  V++ F+GKLNIL+NN GTL     +P    ++TAED++ 
Sbjct  77   QVAGSACDVSSRSEREKLMLAVSSLFDGKLNILINNVGTLGTTGGMP--TVDYTAEDFSF  134

Query  454  VMGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNL  633
            +M TNFE+++HL QLA+P LKAS  GSIVF SS  G + +   ++YSA+KGA+NQ+TKNL
Sbjct  135  IMTTNFESAYHLSQLAHPLLKASGTGSIVFLSSVCGIVSLGLGSIYSATKGAMNQLTKNL  194

Query  634  ACEWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVA  813
            ACEWAKDNIR NSVAP+ I T L        +   E    I R P+ R GE  EVSSLVA
Sbjct  195  ACEWAKDNIRSNSVAPYFILTPLTEPLLCSEEYHKE---AIARAPLGRTGEPKEVSSLVA  251

Query  814  FLCLPAASYITGQTICVDGGYTITGF  891
            FLCLPAASYITGQTICVDGG+T+ GF
Sbjct  252  FLCLPAASYITGQTICVDGGFTVNGF  277



>ref|XP_011023548.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Populus euphratica]
Length=267

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/264 (59%), Positives = 197/264 (75%), Gaps = 4/264 (2%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E S  + +W LQGM+ALVTGGT+G+G AI+EELA  GA V+TCARNQ+ + E V  W+EK
Sbjct  4    ESSSRDKRWGLQGMSALVTGGTKGLGCAIVEELAALGAIVHTCARNQDQLNERVREWKEK  63

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G KV GS CDVSS  +RE+LM++V++ F+GKLNILVNNAGT + K   ++TAED+T +M 
Sbjct  64   GFKVTGSVCDVSSNAEREKLMKEVSSLFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMN  123

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPV-TKTTLYSASKGAINQMTKNLAC  639
            TN +++FHL QLA+P LKAS  G IVF SS    + + T   LYSASKGA+NQ+T+NLAC
Sbjct  124  TNLQSAFHLSQLAHPLLKASRAGKIVFMSSIASVVSINTLYALYSASKGAMNQLTRNLAC  183

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWAKDNIRVN+VAPW IRT L   +  D  +  E+     RTP+ R GE GEVSS+VAFL
Sbjct  184  EWAKDNIRVNAVAPWFIRTPLTTPSLDDENILKEV---FNRTPMRRVGEPGEVSSVVAFL  240

Query  820  CLPAASYITGQTICVDGGYTITGF  891
            CLPA  ++TGQ IC+DGG ++ GF
Sbjct  241  CLPAPGFLTGQVICIDGGMSVNGF  264



>ref|XP_008356736.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
Length=264

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/262 (60%), Positives = 197/262 (75%), Gaps = 8/262 (3%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            SRG  +WSL+GMTALVTGGT+GIGYAI+EELAG GA V+TCAR + D+ +C+ +W +KG 
Sbjct  3    SRGR-RWSLEGMTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEXDLNDCLSQWEKKGF  61

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
            +V GS CDV S+ QREEL+ KV++ F+GKLNIL+NN G   PK   E+TAEDY+ +M TN
Sbjct  62   QVTGSVCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTN  121

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
             E+++HLCQL++P LKAS   +IV  SS  G + +   T+YSA+KGAINQ+ +NLACEWA
Sbjct  122  LESAYHLCQLSHPLLKASGSANIVLLSSIAGVVSLNIGTIYSATKGAINQLARNLACEWA  181

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDE--IERMIRRTPISRPGEVGEVSSLVAFLC  822
            KDNIR NSVAPW I T L      D  + +E  +E +  R P+ RPGE  EVSSLVAFLC
Sbjct  182  KDNIRTNSVAPWFIATPL-----GDMFLGNEKALEMINSRCPLGRPGEPEEVSSLVAFLC  236

Query  823  LPAASYITGQTICVDGGYTITG  888
            LPAASYITGQT+ VDGG ++ G
Sbjct  237  LPAASYITGQTLLVDGGVSVNG  258



>ref|XP_008359743.1| PREDICTED: tropinone reductase homolog isoform X1 [Malus domestica]
Length=260

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 197/256 (77%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL+G TALVTGGT+GIG+A++EELAG GA V+ CARN   + E ++ W+ KG +V+GS
Sbjct  8    RWSLKGRTALVTGGTKGIGFAVVEELAGLGATVHMCARNGELLHERIQEWKSKGFEVSGS  67

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD++S+ QREEL+  V++ F+GKLNILVNNAGT+  ++AT++T ED++ +M TN E+ F
Sbjct  68   VCDLTSKDQREELIRTVSSVFDGKLNILVNNAGTVTLRNATDYTLEDFSTMMSTNVESPF  127

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HLCQLA+P LKAS   SIVF SS  G   + KT+ Y+A+KGA+ Q+ KNLACEWAKDNIR
Sbjct  128  HLCQLAHPLLKASGNASIVFVSSVGGMKALPKTSAYAATKGAVIQIVKNLACEWAKDNIR  187

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             NSVAPW + T +  D++     SD+  R+I RTPI RP +  EVSSLV FLCLPAASYI
Sbjct  188  TNSVAPWAVNTGVKPDSDDH---SDDYRRLIGRTPICRPAQPNEVSSLVTFLCLPAASYI  244

Query  844  TGQTICVDGGYTITGF  891
            TGQ I +DGG+T++GF
Sbjct  245  TGQVISIDGGFTVSGF  260



>emb|CDY31776.1| BnaA04g17120D [Brassica napus]
Length=271

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/263 (58%), Positives = 195/263 (74%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E SR   +WSL+GMTALVTGG++G+G A++EEL+  GA V+TCAR++  ++E +  W+ K
Sbjct  6    EKSRDISRWSLRGMTALVTGGSKGLGSAVVEELSMLGARVHTCARDETQLQESLLEWQAK  65

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G +V  S CDVSSR QRE+LME V+  F GKLNILVNNAGT + K  TEF+AED++ +M 
Sbjct  66   GFQVTTSVCDVSSRVQREKLMETVSTLFQGKLNILVNNAGTCITKPTTEFSAEDFSFLMA  125

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN E++FHL QLA+P+LKAS  GSIVF SSA G + +   ++Y A+KGA+NQ+ +NLACE
Sbjct  126  TNLESAFHLSQLAHPFLKASGSGSIVFMSSAAGVVHINVGSIYGATKGAMNQLARNLACE  185

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WA D+IRVNSV PW I T L N      + + E+E   ++TP+ R GE  EVSSLVAFLC
Sbjct  186  WASDSIRVNSVCPWFIATPLANKYIDHEEYNKEVE---KKTPMGRVGEANEVSSLVAFLC  242

Query  823  LPAASYITGQTICVDGGYTITGF  891
             PAASYITGQ ICVDGG TI G 
Sbjct  243  FPAASYITGQVICVDGGATINGL  265



>ref|XP_010685685.1| PREDICTED: tropinone reductase homolog At1g07440-like [Beta vulgaris 
subsp. vulgaris]
Length=258

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/256 (61%), Positives = 189/256 (74%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GMTALVTGGT+GIG+AI+EELAG GA V+TCARN+ +++ C   W  KG  V  S
Sbjct  5    RWSLVGMTALVTGGTKGIGHAIVEELAGLGARVHTCARNETELEACKRNWETKGFHVTAS  64

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDV+SR QRE LME V++ F GKLNILVNN G  + K  TEFTAE+Y  VM TN E+++
Sbjct  65   ICDVTSRVQRENLMEIVSSEFKGKLNILVNNVGAYMKKPTTEFTAEEYATVMTTNLESAY  124

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            H CQLA+P LKAS   SI+F SS  G + V   +LY  +KGA+NQ+ KNLACEWAKDNIR
Sbjct  125  HFCQLAHPLLKASGFASIIFMSSVAGVVAVDVGSLYGTAKGAMNQLAKNLACEWAKDNIR  184

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             NS+AP+ IRT L     SD    + + ++  RTP+ R GEV EVSSLVAFLC+PAASYI
Sbjct  185  TNSIAPFYIRTPLTEVVLSD---KEYLAKVKERTPLGRTGEVEEVSSLVAFLCMPAASYI  241

Query  844  TGQTICVDGGYTITGF  891
            TGQTICVDGG+TI G 
Sbjct  242  TGQTICVDGGFTIHGL  257



>ref|XP_010931228.1| PREDICTED: tropinone reductase homolog At1g07440-like [Elaeis 
guineensis]
Length=273

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/256 (60%), Positives = 193/256 (75%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            KW+L G TALVTGGT+GIG+AI+EELAGFGA V+TC+RN+ ++ +C+E+W+   + V GS
Sbjct  21   KWTLNGTTALVTGGTKGIGHAIVEELAGFGATVHTCSRNEAELSKCLEQWKSLNIHVTGS  80

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVS R +RE+LME V + F GKLNILVNNAGT + K A  FTAE+Y+ +M TN E++F
Sbjct  81   VCDVSKRAEREKLMEGVRSIFQGKLNILVNNAGTGIVKAAVHFTAEEYSFLMATNLESAF  140

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLA+P LKAS  GSIVF SS  G + +   ++Y+A+KGA+NQ+TKNLACEW KDNIR
Sbjct  141  HLSQLAHPLLKASGAGSIVFISSVAGVVALPTLSIYAATKGALNQLTKNLACEWIKDNIR  200

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VN VAP  IRT LV     D + +    R + R P+ R  E  EV+SLV+FLCLPAASYI
Sbjct  201  VNCVAPGFIRTPLVQSVLEDKEAT---AREVSRIPMGRVAEPEEVASLVSFLCLPAASYI  257

Query  844  TGQTICVDGGYTITGF  891
            TGQ ICVDGG T++GF
Sbjct  258  TGQVICVDGGRTVSGF  273



>gb|KDO66642.1| hypothetical protein CISIN_1g019370mg [Citrus sinensis]
Length=342

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/258 (59%), Positives = 193/258 (75%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E + SLQG TALVTGGTRGIG AI+EEL GFGA ++TC+RN+N++ +C+  W   GL+V 
Sbjct  83   ESRCSLQGKTALVTGGTRGIGRAIVEELVGFGASLHTCSRNENELNKCLTEWGSLGLEVT  142

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDVS R QRE L++ V+  F+GKLNIL+NN GT + K   EFTA ++  +MGTNFE+
Sbjct  143  GSVCDVSVRNQRESLIDSVSTLFDGKLNILINNVGTNIRKPMVEFTAGEFATLMGTNFES  202

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
             FHLCQL+YP LKAS  GS+VF SS  GF+ +   +++ ++KGAINQ+T+NLACEWAKDN
Sbjct  203  LFHLCQLSYPLLKASREGSVVFTSSVSGFVSLKNMSVHGSTKGAINQLTRNLACEWAKDN  262

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NSVAPW I+T +V    S     D +E +  RTP+ R G+  EVSSLVAFLC PA+S
Sbjct  263  IRCNSVAPWYIKTSMVEQVLSK---EDYLEEVFSRTPLRRLGDPTEVSSLVAFLCFPASS  319

Query  838  YITGQTICVDGGYTITGF  891
            YITGQ ICVDGG ++ GF
Sbjct  320  YITGQVICVDGGMSVNGF  337



>ref|NP_001237661.1| uncharacterized protein LOC100306108 [Glycine max]
 gb|ACU14130.1| unknown [Glycine max]
Length=266

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/256 (60%), Positives = 194/256 (76%), Gaps = 1/256 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSL GMTALVTGGTRGIGYAI EELA FGA V+ CAR Q D+ +C+E W +KGL + 
Sbjct  11   DKRWSLHGMTALVTGGTRGIGYAIAEELAEFGAAVHICARKQQDIDKCLEEWNKKGLPIT  70

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GSACDV SR QRE LM+ VA+ FNGKLNIL+NNAGT  PK+  ++TAED T +M TNF +
Sbjct  71   GSACDVLSRDQRENLMKNVASIFNGKLNILINNAGTTTPKNLIDYTAEDVTTIMETNFGS  130

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            S+HLCQLA+P LKAS  GSIVF SS  G   +  +++Y++SKGA+NQ TKN+A EWAKDN
Sbjct  131  SYHLCQLAHPLLKASGYGSIVFISSIAGLKALPYSSVYASSKGAMNQFTKNIALEWAKDN  190

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDE-IERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            IR N+VAP  ++T L++     A  +D+ +E ++ +TP+ R G+  ++S LVAFLCLPAA
Sbjct  191  IRANAVAPGTVKTVLLDSIMKAAAEADKAVEYIVSQTPVGRLGDPEDISPLVAFLCLPAA  250

Query  835  SYITGQTICVDGGYTI  882
            SYITGQ I  DGGY I
Sbjct  251  SYITGQIITADGGYII  266



>ref|XP_010096620.1| Tropinone reductase-like protein [Morus notabilis]
 gb|EXB65288.1| Tropinone reductase-like protein [Morus notabilis]
Length=275

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/256 (60%), Positives = 196/256 (77%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL+G TA+VTGGTRGIG A++EELA FGA V+TC+RN+ ++K C++ W  KGL V+GS
Sbjct  16   RWSLKGTTAVVTGGTRGIGRAVVEELAEFGAAVHTCSRNEEELKRCLKEWEGKGLLVSGS  75

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD SS+ QRE+L+++VA+ FNGKLNI+VNN GT + K   E+TAE+YT+++ TNFE+++
Sbjct  76   VCDASSKTQREKLIQEVASAFNGKLNIIVNNVGTNIRKPTLEYTAEEYTLLLSTNFESTY  135

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HLCQLA+P LKAS  GSIVF SS  G L ++  ++Y+ASK AINQ+TKNLACEWAKDNIR
Sbjct  136  HLCQLAHPLLKASGGGSIVFISSVAGLLNISSGSIYAASKAAINQLTKNLACEWAKDNIR  195

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N VAPW  RT LV     + +  +EI   I +TP+ R  E  EVSSLV +LCLPAASYI
Sbjct  196  SNCVAPWYTRTSLVEHLLDNKEFLEEI---IDKTPLHRVAEPEEVSSLVTYLCLPAASYI  252

Query  844  TGQTICVDGGYTITGF  891
            TGQ I VDGG  + GF
Sbjct  253  TGQVISVDGGMIVNGF  268



>ref|XP_010033100.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
Length=282

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/263 (60%), Positives = 199/263 (76%), Gaps = 10/263 (4%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSLQGMTALVTGG++GIG AI+EELAG GA VYTC+R + ++ EC++ W+ KG +VA
Sbjct  20   DNRWSLQGMTALVTGGSKGIGRAIVEELAGLGATVYTCSRTEAELNECLKEWKRKGFQVA  79

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTL-----VPKDATEFTAEDYTIVMG  462
            GSACDVSSR +RE+LM  V++ F+GKLNIL+NN GTL     +P    ++TAED++ +M 
Sbjct  80   GSACDVSSRSEREKLMLAVSSLFDGKLNILINNVGTLGTTGGMP--TVDYTAEDFSFIMT  137

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TNFE+++HL QLA+P LKAS  GSIVF SS  G + +   ++YSA+KGA+NQ+TKNLACE
Sbjct  138  TNFESAYHLSQLAHPLLKASGTGSIVFLSSVCGIVSLGLGSIYSATKGAMNQLTKNLACE  197

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKDNIR NSVAP+ I T L        +   E    I R P+ R GE  EVSSLVAFLC
Sbjct  198  WAKDNIRSNSVAPYFILTPLTEPLLCSEEYHKE---AIARAPLGRTGEPKEVSSLVAFLC  254

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPAASYITGQTICVDGG+T+ GF
Sbjct  255  LPAASYITGQTICVDGGFTVNGF  277



>ref|XP_009603003.1| PREDICTED: tropinone reductase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=269

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 193/256 (75%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL G TALVTGGTRGIG+A++EELA  GA VYTC+RNQ ++ E ++ W  KGL+V GS
Sbjct  12   RWSLSGFTALVTGGTRGIGHAVVEELAELGATVYTCSRNQAELNERLQEWAVKGLQVKGS  71

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD SSR QR +LME V++ F+GKLNILVNN GT + K  T+++AE+Y  ++ TN E+++
Sbjct  72   VCDASSREQRVQLMENVSSAFDGKLNILVNNVGTNIRKPTTDYSAEEYARLLSTNLESAY  131

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HLCQLA+P LKAS  GS+VF SS  G + ++  ++Y A+KGA+NQ+T+NLACEWA D+IR
Sbjct  132  HLCQLAHPLLKASGNGSVVFISSVAGLVHLSSGSIYGATKGAMNQLTRNLACEWANDSIR  191

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VN VAPW IRT LV     +    D +   I RTP+ RPGE  EVSSLVA+LCLP ASYI
Sbjct  192  VNGVAPWYIRTSLVEHLLENKTFLDGV---ISRTPLRRPGESQEVSSLVAYLCLPGASYI  248

Query  844  TGQTICVDGGYTITGF  891
            TGQ I VDGG+T+ GF
Sbjct  249  TGQVIAVDGGFTVNGF  264



>ref|XP_004492175.1| PREDICTED: tropinone reductase homolog [Cicer arietinum]
Length=265

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/254 (59%), Positives = 195/254 (77%), Gaps = 0/254 (0%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSLQGMTALVTGGTRGIG+AI+EELA FGA V+ CARNQ+D+ +C+E W++KG +V 
Sbjct  11   DQRWSLQGMTALVTGGTRGIGHAIVEELAEFGASVHICARNQDDINKCLEEWKDKGFRVT  70

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+    QR++LME VA+ FNGKLNILVNNAG  +PK+  ++T ED T +M TNF +
Sbjct  71   GSTCDLLFCDQRQKLMETVASVFNGKLNILVNNAGIFIPKNIIKYTDEDITTIMDTNFVS  130

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
             +HLCQLAYP LKAS  GSIVF SS  G   +   ++Y ASKGA+NQ+TKNLA EW+KDN
Sbjct  131  GYHLCQLAYPLLKASGYGSIVFISSISGLKALPLCSIYGASKGAMNQLTKNLALEWSKDN  190

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR N+VAP  ++T L+++A   A+V + I  ++ +TPI+R GE  +VS LVAFLCLP AS
Sbjct  191  IRANAVAPGPVKTLLLDNAMKSAEVVNAIGDIVSQTPINRVGEPKDVSGLVAFLCLPVAS  250

Query  838  YITGQTICVDGGYT  879
            +ITGQ I  DGG+T
Sbjct  251  HITGQIIAADGGFT  264



>ref|NP_180479.1| tropinone reductase-like protein [Arabidopsis thaliana]
 gb|AAC95219.1| putative tropinone reductase [Arabidopsis thaliana]
 gb|AAY78703.1| putative tropinone reductase/tropine dehydrogenase [Arabidopsis 
thaliana]
 gb|AEC08217.1| tropinone reductase-like protein [Arabidopsis thaliana]
Length=268

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 156/263 (59%), Positives = 199/263 (76%), Gaps = 4/263 (2%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E SR + +WSL+GMTALVTGG++G+G A++EELA  GA V+TCAR++  ++E +  W+ K
Sbjct  6    ENSRDKSRWSLEGMTALVTGGSKGLGEAVVEELAMLGARVHTCARDETQLQERLREWQAK  65

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G +V  S CDVSSR QRE+LME V++ F GKLNILVNNAGT + K +TE+TAEDY+ +M 
Sbjct  66   GFEVTTSVCDVSSREQREKLMETVSSVFQGKLNILVNNAGTGIIKPSTEYTAEDYSFLMA  125

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN E++FHL Q+A+P LKAS  GSIVF SS  G +  T  ++Y ASKGA+NQ+ ++LACE
Sbjct  126  TNLESAFHLSQIAHPLLKASGSGSIVFMSSVAGLVH-TGASIYGASKGAMNQLGRSLACE  184

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WA DNIRVNSV PW+I T L +   SD K+   +E    +TP+ R GE  EVSSLVAFLC
Sbjct  185  WASDNIRVNSVCPWVITTPLTSFIFSDEKLRKAVE---DKTPMGRVGEANEVSSLVAFLC  241

Query  823  LPAASYITGQTICVDGGYTITGF  891
             PAASYITGQTICVDGG ++ GF
Sbjct  242  FPAASYITGQTICVDGGASVNGF  264



>gb|KHG29311.1| Tropinone reductase [Gossypium arboreum]
Length=283

 Score =   321 bits (822),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 158/255 (62%), Positives = 196/255 (77%), Gaps = 1/255 (0%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSLQGMTALVTGGTRGIG+A++EELA  GA V+TC+RNQ+++ E ++ W+ KG K++GS
Sbjct  12   RWSLQGMTALVTGGTRGIGFAVVEELAALGAAVHTCSRNQSELNERLKEWQSKGFKLSGS  71

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSSR QRE+LME V++ FNGKLNILVNNAG    K   E + EDYT VM TN EA +
Sbjct  72   MCDVSSREQREKLMETVSSVFNGKLNILVNNAGITRIKPCVEQSLEDYTTVMSTNVEAPY  131

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLAYP+LKAS  GS+VF SS  G + +   + YSASKGAINQ+TKNLACEWAKDNIR
Sbjct  132  HLSQLAYPFLKASGNGSVVFISSVAGSMALPGLSAYSASKGAINQITKNLACEWAKDNIR  191

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N+V+PW ++TK+  +   +A ++ E+ R+I  T + R  E  E+SSLVAFLCLPAASYI
Sbjct  192  TNNVSPWGVKTKMA-EQNINAPLAGELFRLIAGTAMPRMAEPEEISSLVAFLCLPAASYI  250

Query  844  TGQTICVDGGYTITG  888
            TGQ I VDGGYT  G
Sbjct  251  TGQVISVDGGYTAGG  265



>ref|XP_011089795.1| PREDICTED: tropinone reductase homolog isoform X1 [Sesamum indicum]
Length=316

 Score =   322 bits (825),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 199/256 (78%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL G TALVTGGTRGIG+AI+EELAG GA V+TCAR+++++ +C+  W ++G  + GS
Sbjct  59   RWSLHGSTALVTGGTRGIGHAIVEELAGLGAAVHTCARSKDELDKCLRGWEDEGFGITGS  118

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSS+  RE+L++ V++ FN KLNIL+NN GT + K   +FT+E+ +++MGTNFE++F
Sbjct  119  VCDVSSQADREKLLDSVSSIFNQKLNILINNVGTNIRKPMVDFTSEEVSMLMGTNFESAF  178

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            H+CQLAYP LKAS  GS+VF SS  GF+ +   +++ ASKGAINQ+TKNLACEWA+D IR
Sbjct  179  HMCQLAYPLLKASGAGSVVFTSSVSGFVSLKYMSVHGASKGAINQLTKNLACEWARDGIR  238

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VN+VAPW I+T +V    S+ K    +E +  RTP+ R G+  EVSS+VAFLCLPA+S+I
Sbjct  239  VNAVAPWYIKTSMVEQVLSNKKY---LEEVYDRTPMRRLGDPTEVSSMVAFLCLPASSFI  295

Query  844  TGQTICVDGGYTITGF  891
            TGQ +CVDGG ++ GF
Sbjct  296  TGQIVCVDGGMSVNGF  311



>ref|XP_002879208.1| hypothetical protein ARALYDRAFT_481843 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55467.1| hypothetical protein ARALYDRAFT_481843 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score =   320 bits (819),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 196/256 (77%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSLQGMTALVTGGT+GIG A++EEL+  GA V+TCAR++  ++E +  W+ KG +V  S
Sbjct  4    RWSLQGMTALVTGGTKGIGEAVVEELSMLGARVHTCARDETQLQERLREWQGKGFQVTTS  63

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVS R QRE+L+E V++ F GKLNILVNNAGT + K  TE+TAE+++ +M TN E++F
Sbjct  64   VCDVSLRDQREKLIETVSSLFQGKLNILVNNAGTFILKPTTEYTAEEFSFIMATNLESAF  123

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            H+ QLA+P LKAS  GSIVF SS  G + V+  ++Y A+KGA+NQ+ +NLACEWA DNIR
Sbjct  124  HISQLAHPLLKASGSGSIVFMSSIAGVVHVSVGSIYGATKGAMNQLARNLACEWASDNIR  183

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N++ P +I+T L++D  SD ++  E E   +RTP+ R GE  EVS LVAFLCLPAASYI
Sbjct  184  TNAICPGVIKTPLISDLLSDEEIKKEAE---QRTPMGRVGEANEVSPLVAFLCLPAASYI  240

Query  844  TGQTICVDGGYTITGF  891
            TGQTICVDGG T+ GF
Sbjct  241  TGQTICVDGGLTVNGF  256



>gb|KDO38494.1| hypothetical protein CISIN_1g024551mg [Citrus sinensis]
Length=266

 Score =   320 bits (819),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/255 (60%), Positives = 196/255 (77%), Gaps = 1/255 (0%)
 Frame = +1

Query  115  GEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKV  294
            G+ KWSL+GMTALVTGGTRGIGYAI+EELA FGA V+TC R+QN + E ++ W  KG KV
Sbjct  10   GDKKWSLRGMTALVTGGTRGIGYAIVEELARFGASVHTCGRDQNMINERIQEWESKGFKV  69

Query  295  AGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFE  474
             GS CD+S   QRE+L+E V++ F+GKLNILVNNA  +V K ATE+T E+Y+ VM TN E
Sbjct  70   TGSVCDLSFGDQREKLIETVSSVFDGKLNILVNNAALVVMKRATEYTLEEYSSVMSTNVE  129

Query  475  ASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKD  654
            +S+HLCQLA+P LKAS   SIVF SS  G + + + + Y+ASKGAINQ+TKNLACEWA D
Sbjct  130  SSYHLCQLAHPLLKASGNASIVFMSSVAGAISIPRLSAYAASKGAINQLTKNLACEWATD  189

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            +IRVN+V+PW + T++     +D  V + + ++I +TP++R  E  E+S LVAFLCLPAA
Sbjct  190  SIRVNAVSPWAVNTQISPPDLNDLLVQEYV-KLIAKTPLARSAEPNEISPLVAFLCLPAA  248

Query  835  SYITGQTICVDGGYT  879
            SYITGQ I +DGGYT
Sbjct  249  SYITGQVISIDGGYT  263



>ref|XP_011089796.1| PREDICTED: tropinone reductase homolog isoform X2 [Sesamum indicum]
Length=297

 Score =   321 bits (822),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 199/256 (78%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL G TALVTGGTRGIG+AI+EELAG GA V+TCAR+++++ +C+  W ++G  + GS
Sbjct  40   RWSLHGSTALVTGGTRGIGHAIVEELAGLGAAVHTCARSKDELDKCLRGWEDEGFGITGS  99

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSS+  RE+L++ V++ FN KLNIL+NN GT + K   +FT+E+ +++MGTNFE++F
Sbjct  100  VCDVSSQADREKLLDSVSSIFNQKLNILINNVGTNIRKPMVDFTSEEVSMLMGTNFESAF  159

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            H+CQLAYP LKAS  GS+VF SS  GF+ +   +++ ASKGAINQ+TKNLACEWA+D IR
Sbjct  160  HMCQLAYPLLKASGAGSVVFTSSVSGFVSLKYMSVHGASKGAINQLTKNLACEWARDGIR  219

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VN+VAPW I+T +V    S+ K    +E +  RTP+ R G+  EVSS+VAFLCLPA+S+I
Sbjct  220  VNAVAPWYIKTSMVEQVLSNKKY---LEEVYDRTPMRRLGDPTEVSSMVAFLCLPASSFI  276

Query  844  TGQTICVDGGYTITGF  891
            TGQ +CVDGG ++ GF
Sbjct  277  TGQIVCVDGGMSVNGF  292



>ref|XP_004503163.1| PREDICTED: tropinone reductase homolog [Cicer arietinum]
Length=272

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 157/261 (60%), Positives = 194/261 (74%), Gaps = 4/261 (2%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            SRG  +WSL+G TALVTGGTRGIG+A++EELA FGA VYTC+RN+ ++ +C+ +W+EKG 
Sbjct  9    SRGS-RWSLKGATALVTGGTRGIGHAVVEELAEFGATVYTCSRNEVELNKCLNQWQEKGF  67

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
             V GS CD+SS  QREEL+ KVA+ FNGKLNILVNNAGT V K   ++TAE+Y+ VM TN
Sbjct  68   SVYGSVCDLSSSSQREELIRKVASAFNGKLNILVNNAGTNVRKPTIDYTAEEYSKVMNTN  127

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
             ++ +HL QLAY  LK S  GSIVFNSS      V   ++Y+ SK AINQ+TK+LACEWA
Sbjct  128  LDSVYHLSQLAYSLLKESGNGSIVFNSSVASLTSVGSGSIYALSKAAINQLTKSLACEWA  187

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
            KDNIR N VAPW  +T LV    ++ +  +EI   + RTPI R  E  EVSSLV FLCLP
Sbjct  188  KDNIRSNCVAPWYTKTSLVEHLIANEEFVNEI---LSRTPIKRIAEAHEVSSLVTFLCLP  244

Query  829  AASYITGQTICVDGGYTITGF  891
            AASYITGQ + VDGG+T+ GF
Sbjct  245  AASYITGQIVSVDGGFTVNGF  265



>ref|XP_008387076.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
Length=264

 Score =   320 bits (819),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 194/262 (74%), Gaps = 3/262 (1%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            M+  + +WSL+GMTALVTGGT+GIGYAI+EELAG GA V+TC+RN+ D+ +C+ +W +KG
Sbjct  1    MNSRDKRWSLKGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCLSQWEKKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             +V GS CDV S+ QREEL+ KV++ F+GKLNIL+NN G   PK   E+TAEDY+ +M  
Sbjct  61   FQVTGSVCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFMMSI  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N E+++HLCQL++P LKAS   +IVF SS  G + +   ++YSA+KGAINQ+ KNLACEW
Sbjct  121  NLESAYHLCQLSHPLLKASGSANIVFLSSVAGVVSLEVGSIYSATKGAINQLAKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKD IR NSVAPW I T L      + K S  I     R P+ RPGE  EVSSLVAFLCL
Sbjct  181  AKDKIRTNSVAPWFITTPLGEMFLGNKKKSAVIN---SRCPLGRPGEPEEVSSLVAFLCL  237

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQTI VDGG T+ G 
Sbjct  238  PAASYITGQTITVDGGVTVNGL  259



>ref|XP_007009277.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY18087.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=273

 Score =   320 bits (820),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/256 (60%), Positives = 197/256 (77%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GMTALVTGGTRGIG+AI+EELAG GA VYTC+RN+ ++ +C++ W  KG  V+GS
Sbjct  14   RWSLNGMTALVTGGTRGIGHAIVEELAGLGAAVYTCSRNEAELNKCLKEWEGKGFLVSGS  73

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD SS+ QR++L+E VA+ FNG+LNILVNN GT + K   E++AE+Y+ ++ TNFE+S+
Sbjct  74   VCDASSKDQRQKLVENVASLFNGRLNILVNNVGTNIRKPTIEYSAEEYSKLITTNFESSY  133

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HLCQLA+P LKAS++GSIVF SS  G + +   ++Y  +K AINQ+TKNLACEWAKDNIR
Sbjct  134  HLCQLAHPLLKASQVGSIVFISSVAGVMHIGSGSIYGPTKAAINQLTKNLACEWAKDNIR  193

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N VAPW IRT LV   E   +  + +E++I RTP+ R GE  EVSS+VAFLCLPA+SYI
Sbjct  194  TNCVAPWYIRTSLV---EHLLEKKELLEKIITRTPLQRVGEPEEVSSIVAFLCLPASSYI  250

Query  844  TGQTICVDGGYTITGF  891
            TGQ I VDGG T+   
Sbjct  251  TGQVISVDGGLTVNAL  266



>ref|XP_009364346.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=264

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 155/264 (59%), Positives = 196/264 (74%), Gaps = 7/264 (3%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            M+  + +WSL+GMTALVTGGT+GIGYAI+EELAG GA V+TCAR + D+ +C+ +W +KG
Sbjct  1    MNSRDRRWSLEGMTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEVDLNDCLSQWEKKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             +V GS CDV S+ QREEL+ KV++ F+GKLNIL+NN G   PK   E+TAEDY+ +M T
Sbjct  61   FQVTGSVCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMST  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N E+++HLCQL++P LKAS   +IV  SS  G + +   T+YSA+KGAINQ+ +NLACEW
Sbjct  121  NLESAYHLCQLSHPLLKASGSANIVLLSSIAGVVSLNIGTIYSATKGAINQLARNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDE--IERMIRRTPISRPGEVGEVSSLVAFL  819
            AKDNIR NSVAPW I T L      D  +  E  +E +  R P+ RPGE  EVSSLVAFL
Sbjct  181  AKDNIRTNSVAPWFIATPL-----GDMFLGKEKALEMINSRCPLGRPGEPEEVSSLVAFL  235

Query  820  CLPAASYITGQTICVDGGYTITGF  891
            CLPAASYITGQTI VDGG ++ G 
Sbjct  236  CLPAASYITGQTILVDGGVSVNGI  259



>gb|ADE77494.1| unknown [Picea sitchensis]
Length=265

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/253 (60%), Positives = 190/253 (75%), Gaps = 3/253 (1%)
 Frame = +1

Query  133  LQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGSACD  312
            LQGMTALVTGGT+GIG A++EEL G GA VYTCAR + D+ EC+ +W+E GL V GS CD
Sbjct  14   LQGMTALVTGGTKGIGRAVVEELTGLGAAVYTCARTEKDLNECLTQWKEAGLHVGGSVCD  73

Query  313  VSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASFHLC  492
            +SSR  REEL+EK ++  NGKLN+L+NN GT + K    +TAED++ +M TNFE+++HLC
Sbjct  74   LSSRSAREELVEKSSSFCNGKLNMLINNVGTNMRKPTVGYTAEDFSFLMSTNFESAYHLC  133

Query  493  QLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIRVNS  672
            QL++P LKAS  GSIVF SS  G + +   TLY+ASKGA+NQ+TKNLACEWA D IRVN 
Sbjct  134  QLSHPLLKASGKGSIVFISSVAGVVAIFSGTLYAASKGAMNQITKNLACEWASDKIRVNC  193

Query  673  VAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYITGQ  852
            VAPW  +T LV     D +    +E+++ RTP+ R  E  EVSSLVAFLCLPAASYITGQ
Sbjct  194  VAPWYTKTSLVEKLLEDKEF---VEKILDRTPLRRLAEPHEVSSLVAFLCLPAASYITGQ  250

Query  853  TICVDGGYTITGF  891
             I VDGG T+ GF
Sbjct  251  IISVDGGMTVNGF  263



>ref|XP_004293354.1| PREDICTED: tropinone reductase homolog At1g07440-like [Fragaria 
vesca subsp. vesca]
Length=268

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/259 (62%), Positives = 198/259 (76%), Gaps = 4/259 (2%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL-KVAG  300
            +WSL+GMTALVTGGT+GIGYAI+EELAG GA VYTC+RN+  + EC+ +W++KG  +V G
Sbjct  9    RWSLEGMTALVTGGTKGIGYAIVEELAGLGASVYTCSRNEAQLHECLNQWKKKGYHQVTG  68

Query  301  SACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLV-PKDATEFTAEDYTIVMGTNFEA  477
            S CDV+S+ QREEL+ KV++ F+GKLNILVNN GT   P   TE TAE+Y+ +M TN E+
Sbjct  69   SVCDVASKIQREELIHKVSSLFHGKLNILVNNVGTAHGPTPTTECTAEEYSSIMSTNLES  128

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPV-TKTTLYSASKGAINQMTKNLACEWAKD  654
            +++LCQLA+P LK S  G+IVF SS  G L      ++Y A+KGA+NQ+ KNLACEWAKD
Sbjct  129  TYNLCQLAHPLLKTSGAGNIVFMSSVAGVLSTWGGGSVYGATKGAMNQLAKNLACEWAKD  188

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            NIR+NSVAPW IRT  V    +D   S  IE +I RTP+ R GE  EVS+LVAFLCLPAA
Sbjct  189  NIRINSVAPWFIRTPFVEPMFNDDGKS-LIEAVISRTPLGRIGEPEEVSALVAFLCLPAA  247

Query  835  SYITGQTICVDGGYTITGF  891
            SYITGQT CVDGG TI GF
Sbjct  248  SYITGQTFCVDGGMTINGF  266



>gb|ABW74557.1| tropinone-reductase-like protein [Boechera divaricarpa]
Length=293

 Score =   320 bits (821),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 193/258 (75%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +W L GMTALVTGG++G+G A++EELA  GA V+TCAR++  ++E +  W+ KG ++ 
Sbjct  33   KSRWRLGGMTALVTGGSKGLGEAVVEELAMLGARVHTCARDETQLQESLREWQAKGFQIT  92

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
             S CDVSSR QRE+LME V++ F GKLNILVNNAGT + K  TE+TA+DY+ +M TN E+
Sbjct  93   TSVCDVSSRDQREKLMETVSSLFQGKLNILVNNAGTCITKPTTEYTAQDYSFLMATNLES  152

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            +FHL QLA+P LKAS  GSIV  SSA G + +  +++Y A+KGA+NQ+ KNLACEWA DN
Sbjct  153  AFHLSQLAHPLLKASVSGSIVLMSSAAGVMHINVSSIYGATKGAMNQLAKNLACEWASDN  212

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVNSV PW I T L N+  +D +    +E    +TP+ R G+  EVSSLVAFLC PAAS
Sbjct  213  IRVNSVCPWFIATPLANNYINDEEFKKAVE---SKTPMGRVGKANEVSSLVAFLCFPAAS  269

Query  838  YITGQTICVDGGYTITGF  891
            YITGQTICVDGG T+ GF
Sbjct  270  YITGQTICVDGGATVNGF  287



>ref|XP_006409971.1| hypothetical protein EUTSA_v10017105mg [Eutrema salsugineum]
 ref|XP_006409972.1| hypothetical protein EUTSA_v10017105mg [Eutrema salsugineum]
 gb|ESQ51424.1| hypothetical protein EUTSA_v10017105mg [Eutrema salsugineum]
 gb|ESQ51425.1| hypothetical protein EUTSA_v10017105mg [Eutrema salsugineum]
Length=262

 Score =   319 bits (818),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 152/258 (59%), Positives = 195/258 (76%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSL+GMTALVTGG++GIG A++EEL+  GA V+TC+R++  ++E +  W+ KG +V 
Sbjct  2    DNRWSLKGMTALVTGGSKGIGEAVVEELSMLGARVHTCSRDETQLQERLREWQTKGFQVT  61

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
               CDVSSR QRE+LME V++ F GKLNILVNNAGT + K  T++TAED++ +M TN E+
Sbjct  62   TFVCDVSSRAQREKLMETVSSAFQGKLNILVNNAGTCIVKPTTKYTAEDFSFLMATNLES  121

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            +FHL QLA+P LKAS  GSIVF SSA G + ++  ++Y A+KGA+NQ+T+NLACEWA DN
Sbjct  122  AFHLSQLAHPLLKASGFGSIVFMSSAAGVVHMSGGSIYGATKGAMNQLTRNLACEWASDN  181

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NSV PWII T L  +   D  + +E E   RRT + R GE  EVSSLVAFLCLPAAS
Sbjct  182  IRANSVCPWIITTPLTKNYLKDEVLKEEAE---RRTSVGRVGEAKEVSSLVAFLCLPAAS  238

Query  838  YITGQTICVDGGYTITGF  891
            YITGQTICVDGG T+ G 
Sbjct  239  YITGQTICVDGGATVNGI  256



>ref|NP_180489.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AAC95209.1| putative tropinone reductase [Arabidopsis thaliana]
 gb|AEC08226.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=322

 Score =   322 bits (824),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 195/256 (76%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GM+ALVTGGTRGIG AI+EELAG GAEV+TCARN+ +++ C+  W   G +VAGS
Sbjct  65   RWSLNGMSALVTGGTRGIGRAIVEELAGLGAEVHTCARNEYELENCLSDWNRSGFRVAGS  124

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVS R QRE LME V++ F GKL+ILVNN GT + K   EFTA +++ +M TNFE+ F
Sbjct  125  VCDVSDRSQREALMETVSSVFEGKLHILVNNVGTNIRKPMVEFTAGEFSTLMSTNFESVF  184

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HLCQLAYP L+ S+ GS+VF SS  GF+ +   ++ S++KGAINQ+T++LACEWAKDNIR
Sbjct  185  HLCQLAYPLLRESKAGSVVFISSVSGFVSLKNMSVQSSTKGAINQLTRSLACEWAKDNIR  244

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            +N+VAPW I+T +V    S+ +  +E+  +   TP+ R GE  EVSS VAFLCLPA+SYI
Sbjct  245  INAVAPWYIKTSMVEQVLSNKEYLEEVYSV---TPLGRLGEPREVSSAVAFLCLPASSYI  301

Query  844  TGQTICVDGGYTITGF  891
            TGQ +CVDGG +I GF
Sbjct  302  TGQILCVDGGMSINGF  317



>gb|ABW81158.1| TRL13 [Capsella rubella]
Length=313

 Score =   321 bits (823),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 154/256 (60%), Positives = 196/256 (77%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSLQG +ALVTGGTRGIG AI+EELAG GA+V+TCARN+++++ C+  W   GL++AGS
Sbjct  56   RWSLQGKSALVTGGTRGIGRAIVEELAGLGAKVHTCARNESELENCLRDWNSSGLRIAGS  115

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVS R QRE LME V++ F+GKL+ILVNN GT + K   EFTA +++ +M TNFE+ F
Sbjct  116  VCDVSDRGQREALMETVSSVFDGKLHILVNNVGTNIRKPMVEFTAGEFSTLMSTNFESVF  175

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            +LCQLAYP L+ASE GS V  SS  GF+ +   ++ SA+KGAINQ+T++LACEWAKDNIR
Sbjct  176  NLCQLAYPLLRASEAGSAVSISSVSGFVSLKNMSVQSATKGAINQLTRSLACEWAKDNIR  235

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VN+VAPW I+T +V    S+    D +E +   TP+ R GE  EVSS VAFLCLPA+SYI
Sbjct  236  VNAVAPWYIKTSMVEQVLSN---KDYLEEVYSITPLGRLGEPREVSSAVAFLCLPASSYI  292

Query  844  TGQTICVDGGYTITGF  891
            TGQ ICVDGG +I GF
Sbjct  293  TGQIICVDGGMSINGF  308



>ref|XP_003552795.1| PREDICTED: tropinone reductase homolog [Glycine max]
 gb|KHN07592.1| Tropinone reductase like [Glycine soja]
Length=272

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/262 (60%), Positives = 190/262 (73%), Gaps = 4/262 (2%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            ++RG  +WSL G TALVTGGTRGIG+AI+ +LA FGA V+TC+R Q ++ +C++ W+  G
Sbjct  8    INRG-ARWSLNGTTALVTGGTRGIGHAIVSDLAAFGAAVHTCSRTQTELNKCLQEWQSLG  66

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             +V GS CDVSS  QRE+L+E+V +  NGKLNI VNN GT   K   E+TAE+Y+ +M  
Sbjct  67   FQVTGSVCDVSSPSQREKLIEEVTSILNGKLNIYVNNVGTNFRKPTIEYTAEEYSQLMTV  126

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N ++SFHLCQLAYP LKASE GSIVF SS  G + +    +Y+ASK AINQ+TKNLACEW
Sbjct  127  NLDSSFHLCQLAYPLLKASENGSIVFISSVAGVVSLGTGAVYAASKAAINQLTKNLACEW  186

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR N V PW  RT LV     D K  D+I   + RTPI R  E  EVSSLV FLCL
Sbjct  187  AKDNIRSNCVVPWATRTPLVEHLLRDQKFVDDI---MSRTPIKRIAEPEEVSSLVTFLCL  243

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQ ICVDGG T+ GF
Sbjct  244  PAASYITGQVICVDGGLTVNGF  265



>ref|XP_008375982.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
Length=264

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 193/262 (74%), Gaps = 3/262 (1%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            M+  + +WSL GMTALVTGGT+GIGYAI+EELAG GA V+TC+RN+ D+ +C+ +W +KG
Sbjct  1    MNSRDKRWSLNGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCLSQWEKKG  60

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             +V GS CDV S+ QREEL+ KV++ F+GKLNIL+NN G   PK   E+TAEDY+ +M  
Sbjct  61   FQVTGSVCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFMMSI  120

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N E+++HLCQL++P LKAS   +IVF SS  G + +   ++YSA+KGAINQ+ KNLACEW
Sbjct  121  NLESAYHLCQLSHPLLKASGSANIVFLSSVAGVVSLEVGSIYSATKGAINQLAKNLACEW  180

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKD IR NSVAPW I T L      + K S  I     R P+ RPGE  EVSSLVAFLCL
Sbjct  181  AKDKIRTNSVAPWFITTPLGEMFLGNKKKSAVIN---SRCPLGRPGEPEEVSSLVAFLCL  237

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQTI VDGG T+ G 
Sbjct  238  PAASYITGQTITVDGGVTVNGL  259



>ref|XP_009760666.1| PREDICTED: LOW QUALITY PROTEIN: tropinone reductase 1-like [Nicotiana 
sylvestris]
Length=304

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/256 (61%), Positives = 195/256 (76%), Gaps = 4/256 (2%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL+G TALVTGG++GIGYAI+EELAG GA+VYTC+RN+ +++EC+E WR KG KV GS
Sbjct  50   RWSLKGKTALVTGGSKGIGYAIVEELAGLGAKVYTCSRNEKELQECLEIWRNKGFKVEGS  109

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD+  R +RE  M  + + FNGKLNILVNNAG ++ K+  +FTAED+ IVMGTNFEA F
Sbjct  110  VCDLLLRTERENFMHAIGDVFNGKLNILVNNAGVVIHKETKDFTAEDHNIVMGTNFEAGF  169

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLAYP LKASE G+ +F SS  GF  +   +LYSASKGAINQMTK+LACEWA+DNIR
Sbjct  170  HLSQLAYPLLKASEXGNAIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAEDNIR  229

Query  664  VNSVAPWIIRTKLVNDA-ESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASY  840
            VNSVA  +I T LV  A + +    ++++  I +    RPG+  E+S+L+AFLC PAASY
Sbjct  230  VNSVALGVIMTPLVETAIKKNPHQKEDVDHFIVK---GRPGKPEEISALIAFLCFPAASY  286

Query  841  ITGQTICVDGGYTITG  888
            ITGQ I VDGG+T  G
Sbjct  287  ITGQIIWVDGGFTANG  302



>ref|XP_002308173.1| hypothetical protein POPTR_0006s09070g [Populus trichocarpa]
 gb|EEE91696.1| hypothetical protein POPTR_0006s09070g [Populus trichocarpa]
Length=267

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/263 (58%), Positives = 192/263 (73%), Gaps = 0/263 (0%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            EM   E +WSL+GMTALVTGGTRGIG+AI+EELAGFGA VYTC+RN+ ++ E ++ W  K
Sbjct  5    EMGCREQRWSLKGMTALVTGGTRGIGFAIVEELAGFGARVYTCSRNEKELNERIKEWEIK  64

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G  V GS CD+SS+  R++L+  V + F+GKLNILVNNA T + + + ++T EDY+ +M 
Sbjct  65   GFNVRGSVCDLSSQDDRQKLIGSVTSAFDGKLNILVNNAATAILRKSLDYTLEDYSFIMN  124

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN ++ +HLCQLA+P LKAS  G+IVF SS  G + +   ++YSA+KGAINQ+T+NLACE
Sbjct  125  TNLQSPYHLCQLAHPLLKASGNGNIVFISSVAGIVALPMLSVYSATKGAINQLTRNLACE  184

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKDNIR N+VAP  IRT +  D  +D  V +    M  R PISR GE  EVSSLV FLC
Sbjct  185  WAKDNIRTNTVAPGGIRTTVGQDQSADPDVGEAYSDMFSRIPISRIGEPNEVSSLVVFLC  244

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LP ASYI GQ ICVDGG T   F
Sbjct  245  LPTASYINGQVICVDGGLTAKAF  267



>ref|XP_006429152.1| hypothetical protein CICLE_v10012433mg [Citrus clementina]
 ref|XP_006493557.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
 ref|XP_006493558.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
 gb|ESR42392.1| hypothetical protein CICLE_v10012433mg [Citrus clementina]
Length=276

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/262 (60%), Positives = 191/262 (73%), Gaps = 0/262 (0%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            QE+ R   +WSL GMTALVTGGTRGIG+A +EELA FGA V+TC+RNQ ++   +  W+ 
Sbjct  4    QELIRRNKRWSLNGMTALVTGGTRGIGHATVEELARFGAIVHTCSRNQIELDARLHEWKN  63

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            KG KV GS CD+SSR QRE+L+E V + F GKLNIL+NNA     K   + TAED + V 
Sbjct  64   KGFKVTGSVCDLSSREQREKLIETVTSIFQGKLNILINNAAIAFVKPTVDITAEDMSTVS  123

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
             TNFE+ FHL QLA+P  KAS  GSIVF SS  G   +   +LY A KGA+NQ+TKNLAC
Sbjct  124  STNFESVFHLSQLAHPLFKASGNGSIVFISSVGGVRGIPSVSLYGAYKGAMNQLTKNLAC  183

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWAKDNIR N+VAPW+I+T ++   E   + S+ ++ + R+TPI R GE  EVSSLVAFL
Sbjct  184  EWAKDNIRTNTVAPWVIKTSMIKPFEEGPEGSEFLDGIARQTPIGRAGEPDEVSSLVAFL  243

Query  820  CLPAASYITGQTICVDGGYTIT  885
            CLPAASYITGQ ICVDGG T+T
Sbjct  244  CLPAASYITGQIICVDGGVTVT  265



>ref|XP_010033103.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Eucalyptus grandis]
Length=282

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/263 (59%), Positives = 199/263 (76%), Gaps = 10/263 (4%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSLQGMTALVTGG++GIG AI+EELAG GA VYTC+R + ++ EC++ W+ KG +VA
Sbjct  20   DNRWSLQGMTALVTGGSKGIGRAIVEELAGLGATVYTCSRTEAELNECLKEWKRKGFQVA  79

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTL-----VPKDATEFTAEDYTIVMG  462
            GSACDVSSR +RE+LM   ++ F+GKLNIL+NN GTL     +P    ++TAED++ +M 
Sbjct  80   GSACDVSSRSEREKLMLAASSLFDGKLNILINNVGTLGTTGGMP--TVDYTAEDFSFIMT  137

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TNFE+++HL QLA+P LKAS  GSIVF SS  G + ++  ++YSA+KGA+NQ+TKNLACE
Sbjct  138  TNFESAYHLSQLAHPLLKASGTGSIVFLSSVCGIVSLSVGSIYSATKGAMNQLTKNLACE  197

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKDNIR NSVAP+ I T L        +   E    I R P+ R G+  EVSSLVAFLC
Sbjct  198  WAKDNIRSNSVAPYFILTPLTEPLLCSEEYHKE---AIARAPLGRTGKPKEVSSLVAFLC  254

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPAASYITGQTICVDGG+T+ GF
Sbjct  255  LPAASYITGQTICVDGGFTVNGF  277



>ref|XP_009611893.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009611894.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Nicotiana tomentosiformis]
Length=265

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/256 (57%), Positives = 196/256 (77%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL G+ ALVTGGT GIG+A++EELAG GA+VYTC++ ++++ E ++ W ++G++V GS
Sbjct  12   RWSLNGLAALVTGGTSGIGHAVVEELAGLGAKVYTCSKTESELNEPMQDWADRGIQVKGS  71

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
            ACDV+ R QR ELM KV++ F+GKLNIL+NN GT + K + ++TAEDY+ +M TN E+SF
Sbjct  72   ACDVTCREQRVELMNKVSSAFDGKLNILINNVGTNIWKPSIKYTAEDYSHMMATNLESSF  131

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLA+P LK+S  GSIVF SS  G + V+ T++Y A+K  + Q+T+NLACEW KD IR
Sbjct  132  HLSQLAHPLLKSSGAGSIVFTSSVAGLVHVSGTSIYGATKAGMIQLTRNLACEWGKDGIR  191

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VN+VAPW  +T LV D   D    DE   +I RTP+ RPGEV EVSS+VA+LCLP ASY+
Sbjct  192  VNAVAPWYTKTPLVKDVLKDKAFLDE---LIARTPLRRPGEVEEVSSVVAYLCLPGASYV  248

Query  844  TGQTICVDGGYTITGF  891
            TGQ I VDGG+T+ GF
Sbjct  249  TGQVIAVDGGFTVYGF  264



>ref|XP_010067433.1| PREDICTED: tropinone reductase homolog At1g07440 [Eucalyptus 
grandis]
Length=272

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 197/258 (76%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +W+L+G TALVTGGTRGIG+AI+EEL+GFGA V+TC+RN  ++ +C++ W  KGL V 
Sbjct  11   ESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKEWEGKGLAVT  70

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+SSR QRE L+++V++ F G+LNIL+NNAG    K   ++T E+++ +M TNF++
Sbjct  71   GSVCDLSSRDQRESLIKEVSSKFGGRLNILINNAGMNFRKPTVDYTVEEFSKIMATNFDS  130

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HLCQ+A+P LKAS  GSI+F SS  G + +   ++Y+A+KGAINQ+TKNLACEWAKDN
Sbjct  131  AYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKNLACEWAKDN  190

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NS+APW IRT LV +   + +  D I   I RTP+ R GE  EV+SL AFLCLPAAS
Sbjct  191  IRSNSIAPWYIRTSLVENLLKNKEFYDGI---IARTPLQRVGEPKEVASLAAFLCLPAAS  247

Query  838  YITGQTICVDGGYTITGF  891
            YITGQ I VDGG T+ GF
Sbjct  248  YITGQVISVDGGMTVNGF  265



>ref|XP_010542627.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Tarenaya hassleriana]
Length=273

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/263 (58%), Positives = 199/263 (76%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E S  + +WSL+GMTALVTGGT+GIGYAI+EELAGFGA V+TCARNQ+ + EC+ +W+ K
Sbjct  5    EKSYRDRRWSLEGMTALVTGGTKGIGYAIVEELAGFGARVHTCARNQSLLNECLRKWQTK  64

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G +V GS CDVSSR +RE+LM+ V++ F+GKL+IL+NN GT + K  TE+TAED++  + 
Sbjct  65   GFQVTGSVCDVSSRSEREKLMQTVSSTFDGKLSILINNVGTSIVKPTTEYTAEDFSFHIT  124

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN E+++HL QLA+P LKAS  G+IVF SS  G +  +  ++ +A+KGA+NQ+ +NLACE
Sbjct  125  TNLESAYHLSQLAHPLLKASGSGNIVFISSIAGIVSTSVGSICNATKGAVNQLARNLACE  184

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WA DNIRVNSVAP  I T +      D    + ++ +I R P+ R GE  EVSS+V FLC
Sbjct  185  WASDNIRVNSVAPGFIATPMAETVLGD---DNFLKAVISRKPLGRVGEPREVSSMVVFLC  241

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPAASYITGQTICVDGG TI GF
Sbjct  242  LPAASYITGQTICVDGGLTINGF  264



>ref|XP_010040250.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW45357.1| hypothetical protein EUGRSUZ_L00973 [Eucalyptus grandis]
Length=289

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/263 (60%), Positives = 198/263 (75%), Gaps = 10/263 (4%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSLQGMTALVTGG++GIG AI+EELAG GA VYTC+R + ++ EC++ W+ KG +VA
Sbjct  20   DNRWSLQGMTALVTGGSKGIGRAIVEELAGLGATVYTCSRTEAELNECLKEWKRKGFQVA  79

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTL-----VPKDATEFTAEDYTIVMG  462
            GSACDVSSR +RE+LM   ++ F+GKLNIL+NN GTL     +P    ++TAED++ +M 
Sbjct  80   GSACDVSSRSEREKLMLAASSLFDGKLNILINNVGTLGTTGGMP--TVDYTAEDFSFIMT  137

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TNFE+++HL QLA+P LKAS  GSIVF SS  G + +   ++YSA+KGA+NQ+TKNLACE
Sbjct  138  TNFESAYHLSQLAHPLLKASGTGSIVFLSSVCGIVSLGLGSIYSATKGAMNQLTKNLACE  197

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKDNIR NSVAP+ I T L        +   E    I R P+ R GE  EVSSLVAFLC
Sbjct  198  WAKDNIRSNSVAPYFILTPLTEPLLCSEEYHKE---AIARAPLGRTGEPKEVSSLVAFLC  254

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPAASYITGQTICVDGG+T+ GF
Sbjct  255  LPAASYITGQTICVDGGFTVNGF  277



>ref|XP_010033102.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW52640.1| hypothetical protein EUGRSUZ_J02016 [Eucalyptus grandis]
Length=282

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/263 (60%), Positives = 198/263 (75%), Gaps = 10/263 (4%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSLQGMTALVTGG++GIG AI+EELAG GA VYTC+R + ++ EC++ W+ KG +VA
Sbjct  20   DNRWSLQGMTALVTGGSKGIGRAIVEELAGLGATVYTCSRTEAELNECLKEWKRKGFQVA  79

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTL-----VPKDATEFTAEDYTIVMG  462
            GSACDVSSR +RE+LM   ++ F+GKLNIL+NN GTL     +P    + TAED++ +M 
Sbjct  80   GSACDVSSRSEREKLMLAASSLFDGKLNILINNVGTLGTTGGMP--TVDCTAEDFSFIMT  137

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TNFE+++HL QLA+P LKAS  GSIVF SS  G + ++  ++YSA+KGA+NQ+TKNLACE
Sbjct  138  TNFESAYHLSQLAHPLLKASGTGSIVFLSSVCGIVSLSVGSIYSATKGAMNQLTKNLACE  197

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKDNIR NSVAP+ I T L        +   E    I R P+ R GE  EVSSLVAFLC
Sbjct  198  WAKDNIRSNSVAPYFILTPLTEPLLCSEEFHKE---AIARAPLGRTGEPKEVSSLVAFLC  254

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPAASYITGQTICVDGG+T+ GF
Sbjct  255  LPAASYITGQTICVDGGFTVNGF  277



>ref|XP_009796888.1| PREDICTED: tropinone reductase homolog [Nicotiana sylvestris]
Length=269

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/251 (60%), Positives = 190/251 (76%), Gaps = 3/251 (1%)
 Frame = +1

Query  139  GMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGSACDVS  318
            G TALVTGGTRGIG+A++EELA  GA VYTC+RNQ ++ E ++ W EKGL+V GS CD S
Sbjct  17   GFTALVTGGTRGIGHAVVEELAELGATVYTCSRNQAELNERLQEWAEKGLQVKGSVCDAS  76

Query  319  SRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASFHLCQL  498
            SR QR +LME V++ F+GKLNILVNN GT + K  T +TAE+Y  ++ TN E+++HLCQL
Sbjct  77   SREQRVQLMENVSSAFDGKLNILVNNVGTNIRKPTTHYTAEEYARLLSTNLESAYHLCQL  136

Query  499  AYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIRVNSVA  678
            A+P LKAS  GS+VF SS  G + ++  ++Y A+KGA+NQ+T+NLACEWAKD+IRVN VA
Sbjct  137  AHPLLKASGNGSVVFISSVAGLVHLSSGSVYGATKGALNQLTRNLACEWAKDSIRVNGVA  196

Query  679  PWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYITGQTI  858
            PW IRT LV     +    D +   I RTP+ RPGE  EVSSLVA+LCLP ASYITGQ I
Sbjct  197  PWYIRTSLVEHLLENKTFLDGV---ISRTPLRRPGESQEVSSLVAYLCLPGASYITGQVI  253

Query  859  CVDGGYTITGF  891
             VDGG+T+ GF
Sbjct  254  AVDGGFTVNGF  264



>gb|KCW65560.1| hypothetical protein EUGRSUZ_G02957 [Eucalyptus grandis]
Length=271

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 197/258 (76%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +W+L+G TALVTGGTRGIG+AI+EEL+GFGA V+TC+RN  ++ +C++ W  KGL V 
Sbjct  10   ESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKEWEGKGLAVT  69

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+SSR QRE L+++V++ F G+LNIL+NNAG    K   ++T E+++ +M TNF++
Sbjct  70   GSVCDLSSRDQRESLIKEVSSKFGGRLNILINNAGMNFRKPTVDYTVEEFSKIMATNFDS  129

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HLCQ+A+P LKAS  GSI+F SS  G + +   ++Y+A+KGAINQ+TKNLACEWAKDN
Sbjct  130  AYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKNLACEWAKDN  189

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NS+APW IRT LV +   + +  D I   I RTP+ R GE  EV+SL AFLCLPAAS
Sbjct  190  IRSNSIAPWYIRTSLVENLLKNKEFYDGI---IARTPLQRVGEPREVASLAAFLCLPAAS  246

Query  838  YITGQTICVDGGYTITGF  891
            YITGQ I VDGG T+ GF
Sbjct  247  YITGQVISVDGGMTVNGF  264



>ref|XP_010414393.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Camelina sativa]
Length=281

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/274 (57%), Positives = 198/274 (72%), Gaps = 8/274 (3%)
 Frame = +1

Query  85   FINNYQEMSRGEG-----KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQND  249
            F++N +    GE      +WSL GMTALVTGG++GIG A++EELA  GA V+TCAR++  
Sbjct  5    FVHNKKMAKTGESLRENPRWSLGGMTALVTGGSKGIGEAVVEELAMLGARVHTCARDETQ  64

Query  250  VKECVERWREKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATE  429
            ++E + +W+ KG +V  S CDVSSR QRE+LME V++ F GKLNILVNN GT + K   +
Sbjct  65   LQESLRKWQAKGFEVTTSVCDVSSRDQREKLMETVSSVFQGKLNILVNNVGTCIVKPTLK  124

Query  430  FTAEDYTIVMGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGA  609
            +T ED+++ M TN E++FHL QLA+P LKAS  GSIV  SS  G + V   ++Y  SKGA
Sbjct  125  YTEEDFSVTMSTNLESAFHLSQLAHPLLKASGSGSIVLISSVSGVVHVNGASIYGVSKGA  184

Query  610  INQMTKNLACEWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEV  789
            +NQ+ +NLACEWA D+IRVNSV PW I T LVN+  S+ +  +E+E    R P+ R GE 
Sbjct  185  MNQLGRNLACEWASDSIRVNSVCPWFIATPLVNEVLSNDEFRNEVE---SRAPMGRVGEA  241

Query  790  GEVSSLVAFLCLPAASYITGQTICVDGGYTITGF  891
             EVSSLVAFLCLP ASYITGQTICVDGG+TI GF
Sbjct  242  NEVSSLVAFLCLPVASYITGQTICVDGGFTINGF  275



>ref|XP_006429149.1| hypothetical protein CICLE_v10012479mg [Citrus clementina]
 ref|XP_006480854.1| PREDICTED: tropinone reductase homolog isoform X1 [Citrus sinensis]
 gb|ESR42389.1| hypothetical protein CICLE_v10012479mg [Citrus clementina]
Length=266

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/255 (60%), Positives = 196/255 (77%), Gaps = 1/255 (0%)
 Frame = +1

Query  115  GEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKV  294
            G+ KWSL+GMTALVTGGTRGIGYAI+EELA FGA V+TC R+QN + + ++ W  KG KV
Sbjct  10   GDKKWSLRGMTALVTGGTRGIGYAIVEELARFGALVHTCGRDQNMINKRIQEWESKGFKV  69

Query  295  AGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFE  474
             GS CD+S   QRE+L+E V++ F+GKLNILVNNA  +V K ATE+T E+Y+ VM TN E
Sbjct  70   TGSVCDLSFGDQREKLIETVSSVFDGKLNILVNNAALVVMKGATEYTLEEYSSVMSTNVE  129

Query  475  ASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKD  654
            +S+HLCQLA+P LKAS   SIVF SS  G + + + + Y+ASKGAINQ+TKNLACEWA D
Sbjct  130  SSYHLCQLAHPLLKASGNASIVFMSSVAGAISIPRLSAYAASKGAINQLTKNLACEWATD  189

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            +IRVN+V+PW + T++     +D  V + + ++I +TPI+R  E  E+S LVAFLCLPAA
Sbjct  190  SIRVNAVSPWAVNTQISPPDLNDLLVQEYV-KLIAKTPIARSAEPNEISPLVAFLCLPAA  248

Query  835  SYITGQTICVDGGYT  879
            SYITGQ I +DGGYT
Sbjct  249  SYITGQVISIDGGYT  263



>ref|XP_004137777.1| PREDICTED: tropinone reductase homolog [Cucumis sativus]
 ref|XP_004169350.1| PREDICTED: tropinone reductase homolog [Cucumis sativus]
 gb|KGN58842.1| hypothetical protein Csa_3G733960 [Cucumis sativus]
Length=270

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/259 (59%), Positives = 190/259 (73%), Gaps = 2/259 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL+GMTALVTGG+RGIG A +EELA FGA V+TC R+Q D+ +C++ W   G KV+GS
Sbjct  8    RWSLKGMTALVTGGSRGIGRATVEELAEFGARVHTCCRSQEDLDKCLKEWEAMGFKVSGS  67

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVP--KDATEFTAEDYTIVMGTNFEA  477
             CDV S+ QR++LME V++ FNG LNILVNNAG  +   K   E T ED + VM TNFE+
Sbjct  68   VCDVQSKEQRKKLMETVSSLFNGTLNILVNNAGRTLSSLKSTVEVTEEDISSVMSTNFES  127

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            SFH  QLAYP LKAS  GSIVF SS  G   +  +T Y+ASK AINQ+TKNLACEWAKDN
Sbjct  128  SFHFSQLAYPLLKASGNGSIVFISSVSGLTALPFSTPYAASKAAINQITKNLACEWAKDN  187

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR N+VAPWII+T+LV  +  D      IE+++  TP+ R GE  EVSS+V FLCLPAAS
Sbjct  188  IRTNAVAPWIIKTRLVERSNDDPMHVKGIEQLLSVTPLKRAGEPHEVSSMVVFLCLPAAS  247

Query  838  YITGQTICVDGGYTITGFP  894
            YITGQ   +DGG+T+  +P
Sbjct  248  YITGQLFVIDGGHTVKAYP  266



>ref|XP_009343858.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=271

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/257 (59%), Positives = 190/257 (74%), Gaps = 3/257 (1%)
 Frame = +1

Query  121  GKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAG  300
             +WSL G  ALVTGGTRGIGYA++EELAGFGA V+TC+RN+ ++ +C+E+W+ KG  V G
Sbjct  11   ARWSLHGGAALVTGGTRGIGYAVVEELAGFGAAVHTCSRNEAELSKCLEQWKAKGFSVTG  70

Query  301  SACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEAS  480
            S CD SS  +RE+LM++VA+ FNGKLNILVNN GT + K  TE+ +E+Y+++M TN E++
Sbjct  71   SVCDTSSTTEREKLMDQVASTFNGKLNILVNNVGTNIRKPTTEYASEEYSLLMATNLEST  130

Query  481  FHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNI  660
            +HL QLA+P LKAS  GSIVF SS  G   +   ++Y ASK AINQ+TKNLACEWAKDNI
Sbjct  131  YHLSQLAHPLLKASGRGSIVFISSVAGVASIASGSIYGASKAAINQLTKNLACEWAKDNI  190

Query  661  RVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASY  840
            R N+V PW  RT LV     + +  +EI     RTP+ R  E  EVSSLVAFLCLPAASY
Sbjct  191  RSNAVCPWYTRTSLVEHLLDNKEFLEEI---TSRTPLERVAEPEEVSSLVAFLCLPAASY  247

Query  841  ITGQTICVDGGYTITGF  891
            ITGQ I VDGG T+  F
Sbjct  248  ITGQVISVDGGMTVNSF  264



>ref|XP_007205718.1| hypothetical protein PRUPE_ppa009959mg [Prunus persica]
 gb|EMJ06917.1| hypothetical protein PRUPE_ppa009959mg [Prunus persica]
Length=270

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/259 (58%), Positives = 193/259 (75%), Gaps = 4/259 (2%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL-KV  294
            + +WSL GMTALVTGGT+GIGYAI+EELAG GA ++TC+RN+  + +C+ +W+ KG  +V
Sbjct  10   DSRWSLHGMTALVTGGTKGIGYAIVEELAGLGATIHTCSRNEVQLNDCLSQWKMKGFDQV  69

Query  295  AGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFE  474
             GS CDV S+ QREEL+ KV++ F+GKLNILVNN GT   K A E T EDY+ +M TN E
Sbjct  70   TGSVCDVVSKAQREELINKVSSLFHGKLNILVNNVGTAEIKPAIENTTEDYSFIMSTNLE  129

Query  475  ASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKD  654
            +++H  QLA+P LKAS  G+I+F SS  G + +   ++Y+A+KGA+NQ+ KNLACEWAKD
Sbjct  130  SAYHFSQLAHPLLKASGAGNIIFMSSVAGVVSLGTASIYAATKGAMNQLAKNLACEWAKD  189

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            NIR NSVAPW IRT L     S+ K    +E +  R P+ R GE  EVS+LVAFLC PAA
Sbjct  190  NIRTNSVAPWFIRTPLTEPLLSNQKF---LEAVNSRCPLGRTGEPKEVSALVAFLCFPAA  246

Query  835  SYITGQTICVDGGYTITGF  891
            SYITGQTICVDGG+T+ G 
Sbjct  247  SYITGQTICVDGGFTVNGL  265



>gb|KCW65561.1| hypothetical protein EUGRSUZ_G02957 [Eucalyptus grandis]
Length=271

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 197/258 (76%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +W+L+G TALVTGGTRGIG+AI+EEL+GFGA V+TC+RN  ++ +C++ W  KGL V 
Sbjct  10   ESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKEWEGKGLAVT  69

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+SSR QRE L+++V++ F G+LNIL+NNAG    K   ++T E+++ +M TNF++
Sbjct  70   GSVCDLSSRDQRESLIKEVSSKFGGRLNILINNAGMNFRKPTVDYTVEEFSKIMATNFDS  129

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HLCQ+A+P LKAS  GSI+F SS  G + +   ++Y+A+KGAINQ+TKNLACEWAKDN
Sbjct  130  AYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKNLACEWAKDN  189

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NS+APW IRT LV +   + +  D I   I RTP+ R GE  EV+SL AFLCLPAAS
Sbjct  190  IRSNSIAPWYIRTSLVENLLKNKEFYDGI---IARTPLQRVGEPKEVASLAAFLCLPAAS  246

Query  838  YITGQTICVDGGYTITGF  891
            YITGQ I VDGG T+ GF
Sbjct  247  YITGQVISVDGGMTVNGF  264



>ref|XP_010910872.1| PREDICTED: tropinone reductase homolog At1g07440-like [Elaeis 
guineensis]
Length=274

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/259 (60%), Positives = 196/259 (76%), Gaps = 3/259 (1%)
 Frame = +1

Query  115  GEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKV  294
            G  KWSL G TALVTGGT+GIG+AI+E LAGFGA V+TC+R++ ++ +C+ERW+   + V
Sbjct  19   GVKKWSLDGTTALVTGGTKGIGHAIVEGLAGFGATVHTCSRDEAELNKCLERWKTLNIHV  78

Query  295  AGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFE  474
             GS CDVSSR QRE+LME V + F GKLNIL+NNAGT + K A +FTAE+Y+ +M TN E
Sbjct  79   TGSVCDVSSRAQREKLMEGVRSIFQGKLNILINNAGTGIVKPALDFTAEEYSFLMATNLE  138

Query  475  ASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKD  654
            ++FHL QLA P LKAS  GSIVF S+  G + +   ++Y+A+KGA+NQ+TKNLACEWA D
Sbjct  139  SAFHLSQLAQPLLKASGAGSIVFISAIAGVVGMPNLSIYAATKGALNQLTKNLACEWAND  198

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            NIRVN VAP  IRT L+  +  D + +    R I R P+ R GE  EV+SLV+FLCLPAA
Sbjct  199  NIRVNCVAPGPIRTPLMQPSLDDKEAT---ARQISRVPMRRIGEPEEVASLVSFLCLPAA  255

Query  835  SYITGQTICVDGGYTITGF  891
            SYITGQ ICVDGG+T +GF
Sbjct  256  SYITGQVICVDGGWTASGF  274



>gb|KDP44893.1| hypothetical protein JCGZ_01393 [Jatropha curcas]
Length=274

 Score =   318 bits (815),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 154/263 (59%), Positives = 192/263 (73%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E S  + +WSLQG+TALVTGGTRGIGYA +EELAG GA V+TC+RN+ ++ +C++ W  K
Sbjct  5    ECSFKDPRWSLQGLTALVTGGTRGIGYATVEELAGLGARVHTCSRNEAELSKCLKEWEAK  64

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G  V GS CD SSR QRE L+ +V + F+G LNILVNN GT + K   E++AE++  +M 
Sbjct  65   GFLVTGSVCDASSREQRENLIREVGSAFSGSLNILVNNVGTNIRKPTIEYSAEEFAKLMT  124

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN E ++HLCQLA+P LKAS +GSIVF SS  G   +   ++Y ASKGAINQ+TKNLACE
Sbjct  125  TNLETTYHLCQLAHPLLKASGVGSIVFISSVGGLAHIGSGSIYGASKGAINQLTKNLACE  184

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKDNIR N VAPW I+T LV +   + +  D++   + RTP+ R GE  EVSSLVAFLC
Sbjct  185  WAKDNIRSNCVAPWYIKTSLVENLLDNKEFLDKV---VSRTPLQRVGEAKEVSSLVAFLC  241

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPAASYITGQ I VDGG T   F
Sbjct  242  LPAASYITGQVIAVDGGMTANAF  264



>ref|XP_002311182.2| tropinone reductase family protein [Populus trichocarpa]
 gb|EEE88549.2| tropinone reductase family protein [Populus trichocarpa]
Length=266

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/258 (59%), Positives = 192/258 (74%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSL GMTALVTGGTRGIG A +EELAGFGA V+TC+RN+ ++ +C++ W  KG  V 
Sbjct  9    DSRWSLHGMTALVTGGTRGIGNATVEELAGFGARVHTCSRNEEELNKCLKEWEAKGFVVT  68

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD SSR QRE+L+E+V + F+GKLN LVNN GT + K  T ++AE+++ ++ TNFE+
Sbjct  69   GSVCDASSRVQREKLIEEVGSVFHGKLNSLVNNVGTNIRKPTTGYSAEEFSNLLATNFES  128

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HL Q+A+P LK S  GS+VF SS  G L +   ++Y ASKGAINQ+TKNLACEWAKDN
Sbjct  129  AYHLSQIAHPLLKESGAGSVVFISSVAGLLHIGSGSIYGASKGAINQLTKNLACEWAKDN  188

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR N VAPW IRT LV     D    D+I   I RTP+ R G+  EVSSLV FLCLPAA+
Sbjct  189  IRTNCVAPWYIRTSLVEHLLDDKVFLDKI---ISRTPLQRVGDPKEVSSLVGFLCLPAAA  245

Query  838  YITGQTICVDGGYTITGF  891
            YITGQ I VDGG+T+ GF
Sbjct  246  YITGQVISVDGGFTVNGF  263



>ref|XP_010510499.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=511

 Score =   326 bits (836),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 157/256 (61%), Positives = 197/256 (77%), Gaps = 4/256 (2%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSLQGMTALVTGG++GIG A++EEL+  GA V+TCAR++  ++E + +W+ KG +V+ S
Sbjct  254  RWSLQGMTALVTGGSKGIGEAVVEELSMLGARVHTCARDETQLQESLRKWQAKGFQVSTS  313

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSSR QRE+L+E V++ F GKLNILVNNAGT + K  T FT E+Y+ +M TN E++F
Sbjct  314  ICDVSSREQREKLIETVSSLFQGKLNILVNNAGTFIDKPTTVFTTEEYSFIMATNLESAF  373

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLA+P LKAS  GSIVF SS  G +  T +++Y A+KGA+NQ+ +NLACEWA DNIR
Sbjct  374  HLSQLAHPLLKASSSGSIVFISSVSGVVH-TGSSIYGATKGAMNQLGRNLACEWASDNIR  432

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VNSV PW+I T LV D   D KV+  +E    RTP+ R GE  EVSSLVAFLCLPAASYI
Sbjct  433  VNSVCPWVIATPLVADMLRDEKVNKAVE---SRTPMGRVGEANEVSSLVAFLCLPAASYI  489

Query  844  TGQTICVDGGYTITGF  891
            TGQT CVDGG+TI GF
Sbjct  490  TGQTNCVDGGFTINGF  505


 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 184/252 (73%), Gaps = 3/252 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSLQGMTALVTGGT+GIG A++EEL+  GA V+TCAR++  ++E +  W+ KG ++  S
Sbjct  4    RWSLQGMTALVTGGTKGIGEAVVEELSMMGARVHTCARDETQLQERLREWQAKGFQLTTS  63

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDV+SR QRE+LME V++ F GKLNILVNN G L  K  T++  ED++  + TN EA+F
Sbjct  64   VCDVTSRDQREKLMETVSSLFQGKLNILVNNVGVLRGKPTTDYVEEDFSFHISTNLEAAF  123

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            H  QL++P LKAS  GSIVF SS  G + V   ++YS +KGA+NQ+T+NLACEWAK+ IR
Sbjct  124  HFSQLSHPLLKASGSGSIVFISSITGIVSVECGSIYSLTKGALNQLTRNLACEWAKEGIR  183

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N+VAP II+T     AES+       E +  RTP+ R GE  EV+SLV FLCLPAASYI
Sbjct  184  ANAVAPNIIKTP---QAESNLNNVGFKEGLFSRTPLGRAGEPNEVASLVVFLCLPAASYI  240

Query  844  TGQTICVDGGYT  879
            TGQTICVDGG T
Sbjct  241  TGQTICVDGGLT  252



>gb|KFK43068.1| hypothetical protein AALP_AA1G074500 [Arabis alpina]
Length=260

 Score =   317 bits (813),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 189/256 (74%), Gaps = 4/256 (2%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSLQGMTALVTGGT+GIGYAI+EELAGFGA V+TC ++Q  + EC+  W+ KG +V  S
Sbjct  5    RWSLQGMTALVTGGTKGIGYAIVEELAGFGARVHTCDKDQTPLDECLSEWQAKGFQVTAS  64

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSSRPQR++LM+ V++ FNGKLNIL+NN G  + +   E T ED++ +M TN E+++
Sbjct  65   VCDVSSRPQRDQLMKTVSSLFNGKLNILINNVGKFILRPTLECTEEDFSSLMSTNLESAY  124

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            H+ QLA+P LKAS  GSIVF SS  G +    +++Y  +KGA+NQ+ +NLACEWA D IR
Sbjct  125  HISQLAHPLLKASGCGSIVFISSVSGIVS-GASSIYGVTKGAMNQLARNLACEWASDGIR  183

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             NSVAPW+  T LV     D K S   E M  RTP+ R  E  EV+SLV FLCLPAASYI
Sbjct  184  ANSVAPWVTATSLVKKYLDDKKFS---EAMFSRTPLGRACEPREVASLVTFLCLPAASYI  240

Query  844  TGQTICVDGGYTITGF  891
            TGQTIC+DGGYT+ GF
Sbjct  241  TGQTICIDGGYTVNGF  256



>ref|XP_010067438.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW65563.1| hypothetical protein EUGRSUZ_G02959 [Eucalyptus grandis]
Length=271

 Score =   318 bits (814),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 197/258 (76%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +W+L+G TALVTGGTRGIG+AI+EEL+GFGA V+TC+RN  ++ +C++ W  KGL V 
Sbjct  10   ESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKEWEGKGLAVT  69

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD+SSR QRE L+++V++ F G+LNIL+NNAGT   K   ++T E+++ +M TNF++
Sbjct  70   GSVCDLSSRDQRENLIKEVSSKFGGRLNILINNAGTNFRKPTVDYTVEEFSKIMATNFDS  129

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HLCQ+A+P LKAS  GSI+F SS  G + +   ++Y+A+KGAINQ+TKNLACEWAKDN
Sbjct  130  AYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKNLACEWAKDN  189

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NS+APW  RT  V +   + ++ D I   I RTP+ R GE  EV+SL AFLCLPAAS
Sbjct  190  IRSNSIAPWYTRTSFVENLLKNKELYDGI---IARTPLQRVGEPKEVASLAAFLCLPAAS  246

Query  838  YITGQTICVDGGYTITGF  891
            YITGQ I VDGG T+ GF
Sbjct  247  YITGQVISVDGGMTVNGF  264



>gb|AAO42159.1| putative tropinone reductase [Arabidopsis thaliana]
Length=312

 Score =   319 bits (818),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 194/256 (76%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GM+ALVTGGTRGIG AI+EELAG GAEV+TCARN+ +++ C+  W   G +VAGS
Sbjct  55   RWSLNGMSALVTGGTRGIGRAIVEELAGLGAEVHTCARNEYELENCLSDWNRSGFRVAGS  114

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVS R QRE LME V++ F GKL+ LVNN GT + K   EFTA +++ +M TNFE+ F
Sbjct  115  VCDVSDRSQREALMETVSSVFEGKLHTLVNNVGTNIRKPMVEFTAGEFSTLMSTNFESVF  174

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HLCQLAYP L+ S+ GS+VF SS  GF+ +   ++ S++KGAINQ+T++LACEWAKDNIR
Sbjct  175  HLCQLAYPLLRESKAGSVVFISSVSGFVSLKNMSVQSSTKGAINQLTRSLACEWAKDNIR  234

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            +N+VAPW I+T +V    S+ +  +E+  +   TP+ R GE  EVSS VAFLCLPA+SYI
Sbjct  235  INAVAPWYIKTSMVEQVLSNKEYLEEVYSV---TPLGRLGEPREVSSAVAFLCLPASSYI  291

Query  844  TGQTICVDGGYTITGF  891
            TGQ +CVDGG +I GF
Sbjct  292  TGQILCVDGGMSINGF  307



>ref|XP_003540716.1| PREDICTED: tropinone reductase homolog [Glycine max]
Length=307

 Score =   318 bits (816),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 148/263 (56%), Positives = 193/263 (73%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
              S  + +W+LQGMTALVTGGTRGIG+AI+EEL GFG  V+TCARN++D+ +C+++W + 
Sbjct  44   HQSTTQHRWTLQGMTALVTGGTRGIGHAIVEELTGFGDRVHTCARNEHDLTKCLKKWNDS  103

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G  V GS CDVS   QRE LME V++ F+GKLNIL+NN GT + K  T+FT+ +++ ++ 
Sbjct  104  GFDVTGSVCDVSVPHQREALMESVSSLFHGKLNILINNVGTNIRKPVTDFTSAEFSTLID  163

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN  + FHLCQLAYP LKAS MG++VF SS  GF  +   ++  A K AINQ+T+NLACE
Sbjct  164  TNLGSVFHLCQLAYPLLKASGMGNVVFISSVSGFFSLKSMSVQGAMKSAINQLTRNLACE  223

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            W KD IR N+VAPW I+T LV    S+    D +E +  RTP+ R G+  EVSSLVAFLC
Sbjct  224  WEKDYIRSNAVAPWYIKTSLVEQVLSN---KDYLEEVYSRTPLRRLGDPAEVSSLVAFLC  280

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPA+SYITGQ IC+DGG ++ GF
Sbjct  281  LPASSYITGQIICIDGGVSVNGF  303



>emb|CDP00133.1| unnamed protein product [Coffea canephora]
Length=274

 Score =   317 bits (813),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 193/256 (75%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL G TALVTGGTRGIG+A++EELA  GA ++TC+RN   + E ++ W  KGLKV GS
Sbjct  12   RWSLAGKTALVTGGTRGIGFAVVEELAELGATIHTCSRNAAQLNERLQEWASKGLKVTGS  71

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSSR  RE+LM+KV++ F+GKLNIL+NN GT + K  T++  E+Y+ +M TN E+++
Sbjct  72   VCDVSSRELREQLMQKVSSVFDGKLNILINNVGTNIRKPTTDYIPEEYSRIMATNLESAY  131

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLAYP LKAS +GS VF SS  G +  +  ++Y A+KGA+NQ+T+NLACEWAKDNIR
Sbjct  132  HLSQLAYPLLKASGVGSTVFVSSISGLVHSSSGSIYGAAKGAMNQLTRNLACEWAKDNIR  191

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VN VAPW IRT LV +  S+ +  D +   I RTP+ RPGE  EVSSLVA+ CLPAASYI
Sbjct  192  VNCVAPWYIRTPLVENLLSNKEFLDMV---ISRTPLQRPGEPKEVSSLVAYFCLPAASYI  248

Query  844  TGQTICVDGGYTITGF  891
            TGQ + VDGG T+ GF
Sbjct  249  TGQVVAVDGGMTVFGF  264



>ref|XP_008777412.1| PREDICTED: tropinone reductase homolog At1g07440-like [Phoenix 
dactylifera]
Length=273

 Score =   317 bits (813),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 151/254 (59%), Positives = 191/254 (75%), Gaps = 3/254 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            KWSL G TALVTGGT+GIG+AI+EELAGFGA V+TC+R + ++ +C+ERW+   + V GS
Sbjct  20   KWSLDGTTALVTGGTKGIGHAIVEELAGFGATVHTCSRTEAELNKCLERWKSLNIHVTGS  79

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSSR +RE+LME V + F GKLNILVNNAGT + K   +FTAE+Y+ +M TN E++F
Sbjct  80   VCDVSSRAEREKLMEDVRSIFQGKLNILVNNAGTAIGKPVVDFTAEEYSFLMATNLESAF  139

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLA+P LKAS  GSIVF SS  G + +   ++++A+KGA+NQ+TKNLACEW +DNIR
Sbjct  140  HLSQLAHPLLKASGAGSIVFISSIAGVVAIRNFSIHAATKGAMNQLTKNLACEWIEDNIR  199

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VN VAP  IRT LV     D + +    R + R P+ R  E  EV+SLVAFLCLPAASYI
Sbjct  200  VNCVAPGFIRTPLVKSVLEDKQAT---ARQVSRIPMRRVAEPEEVASLVAFLCLPAASYI  256

Query  844  TGQTICVDGGYTIT  885
            TGQ ICVDGG T++
Sbjct  257  TGQVICVDGGRTVS  270



>ref|XP_004503172.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cicer 
arietinum]
Length=269

 Score =   317 bits (812),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 190/257 (74%), Gaps = 3/257 (1%)
 Frame = +1

Query  121  GKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAG  300
             +WSL GMTALVTGGTRGIG+AI+ +LA FGA V+TC+R ++++ +C++ W+ +G  V G
Sbjct  9    ARWSLTGMTALVTGGTRGIGHAIVNDLAAFGATVHTCSRTESELNKCLQEWQSQGFLVTG  68

Query  301  SACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEAS  480
            S CDV+SRPQRE L+++V + FNGKLNI VNN GT + K   E+T E+Y+ +M  N +++
Sbjct  69   SVCDVASRPQRENLVQQVTSTFNGKLNIFVNNVGTNIRKPTVEYTGEEYSELMAINLDSA  128

Query  481  FHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNI  660
            FHLCQLAYP LKAS +GSIVF SS  G + +   ++Y+ASK AINQ+TKNLACEWAKDNI
Sbjct  129  FHLCQLAYPLLKASGIGSIVFISSVAGVVSLGTGSVYAASKAAINQLTKNLACEWAKDNI  188

Query  661  RVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASY  840
            R N V PW  RT LV     + K  D+I   + RTP+ R  E  EVSSLV FLCLPAASY
Sbjct  189  RSNCVVPWATRTPLVEHLFQNQKFVDDI---MSRTPLKRIAEPEEVSSLVTFLCLPAASY  245

Query  841  ITGQTICVDGGYTITGF  891
            ITGQ I VDGG T+ GF
Sbjct  246  ITGQVISVDGGLTVFGF  262



>ref|XP_011033874.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=266

 Score =   317 bits (812),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/258 (59%), Positives = 193/258 (75%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSL GMTALVTGGTRGIG A + ELAGFGA V+TC+RN+ ++ +C++ W  KG  V 
Sbjct  9    DSRWSLHGMTALVTGGTRGIGNATVVELAGFGARVHTCSRNEEELNKCLKEWEAKGFVVT  68

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD SS  QRE+L+E+V + F+GKLNILVNN GT + K  T ++AE+++ ++ TNFE+
Sbjct  69   GSVCDASSHVQREKLIEEVDSVFHGKLNILVNNVGTNIRKPTTGYSAEEFSNLLATNFES  128

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HL Q+A+P LKAS  GSIVF SS  G L +   ++Y ASKGAINQ+TKNLACEWAKDN
Sbjct  129  AYHLSQIAHPLLKASGAGSIVFISSVAGLLHIGSGSIYGASKGAINQLTKNLACEWAKDN  188

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR N VAPW I+T LV +   D    D+I   I RTP+ R G+  EVSSLV FLCLPAA+
Sbjct  189  IRTNCVAPWYIKTSLVKNLLDDKVFLDKI---ISRTPLQRIGDPKEVSSLVGFLCLPAAA  245

Query  838  YITGQTICVDGGYTITGF  891
            YITGQ I VDGG+T+ GF
Sbjct  246  YITGQVISVDGGFTVNGF  263



>ref|XP_002314932.1| tropinone reductase family protein [Populus trichocarpa]
 gb|EEF01103.1| tropinone reductase family protein [Populus trichocarpa]
Length=265

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/257 (59%), Positives = 194/257 (75%), Gaps = 4/257 (2%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSLQG TALVTGGT+GIGYA++EELA  GA V+TCAR Q  +  C+ +W+E+GLKV+GS
Sbjct  9    RWSLQGTTALVTGGTKGIGYAVVEELAALGACVHTCARTQGQIDACLRQWKERGLKVSGS  68

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSS+  RE+L+++V++ F GKLNIL+NNAGT V K   E+TAED++ +M TN +++F
Sbjct  69   VCDVSSQADREKLIKEVSSLFGGKLNILINNAGTNVYKPTLEYTAEDFSFLMNTNLQSAF  128

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVT-KTTLYSASKGAINQMTKNLACEWAKDNI  660
            HL QLA+P LKAS  G IVF SS  G   V     +YSASKGAINQ+T+NLACEWAKDNI
Sbjct  129  HLSQLAHPLLKASGAGRIVFVSSICGVTSVNIGYPIYSASKGAINQLTRNLACEWAKDNI  188

Query  661  RVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASY  840
            RVNSVAPW I T +  D+  +  V   ++ +  RTP+ R GE GEVSS+VAFLCLP  S+
Sbjct  189  RVNSVAPWFINTPMNEDSLQNESV---VKELAYRTPMGRAGEPGEVSSVVAFLCLPGPSF  245

Query  841  ITGQTICVDGGYTITGF  891
             TGQ IC+DGG ++ GF
Sbjct  246  TTGQVICIDGGLSVNGF  262



>ref|XP_010067435.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Eucalyptus grandis]
Length=271

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/258 (59%), Positives = 195/258 (76%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +W+L+G TALVTGGTRGIG+AI+EEL GFGA V+TC+ N  ++ +C++ W  KGL V 
Sbjct  10   ESRWTLRGTTALVTGGTRGIGHAIVEELGGFGATVHTCSWNGEELSKCLKEWEGKGLAVT  69

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDVSSR QRE LM++V++ F G LNIL+NNAGT   K   ++T E+++ +M TNF++
Sbjct  70   GSVCDVSSRDQRENLMKEVSSKFGGGLNILINNAGTNFRKPTVDYTVEEFSKIMATNFDS  129

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HLCQ+A+P LKAS  GSI+F SS  G + +   ++Y+A+KGAINQ+TKNLACEWAKDN
Sbjct  130  AYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGNGSVYAAAKGAINQITKNLACEWAKDN  189

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NS+APW IRT LV +   + +  D I   I RTP+ R GE  EV+SL AFLCLPAAS
Sbjct  190  IRSNSIAPWYIRTSLVENLLKNKEFYDGI---IARTPLQRVGEPREVASLAAFLCLPAAS  246

Query  838  YITGQTICVDGGYTITGF  891
            YITGQ I VDGG T+ GF
Sbjct  247  YITGQVISVDGGMTVNGF  264



>ref|XP_007206734.1| hypothetical protein PRUPE_ppa024823mg [Prunus persica]
 gb|EMJ07933.1| hypothetical protein PRUPE_ppa024823mg [Prunus persica]
Length=267

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 195/258 (76%), Gaps = 5/258 (2%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL-KVAG  300
            +WSLQGMTALVTGGT+G+G+AI+EEL+G GA V+TCARNQN + +C+ +W+ KG  +V G
Sbjct  9    RWSLQGMTALVTGGTKGMGHAIVEELSGLGASVHTCARNQNQLNDCLNQWKTKGFHQVTG  68

Query  301  SACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEAS  480
            S CD+SSR QR EL+ +V++ FNGKLNIL+NN GT   K   + TAED+  V  TN E+S
Sbjct  69   SVCDLSSRAQRHELINEVSSQFNGKLNILINNVGTTEAKATLDCTAEDFAFVTSTNLESS  128

Query  481  FHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKT-TLYSASKGAINQMTKNLACEWAKDN  657
            +HL QLA+P LKA+  G+IVF SS  G + V    ++Y+A+KGA+NQ+ ++ ACEW KDN
Sbjct  129  YHLSQLAHPLLKAAGAGNIVFISSVAGSVSVAGIGSIYAATKGAVNQLARSFACEWGKDN  188

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IRVNSVAPW I+T L  D  ++ + S+ +     RTP+ RPGE  EV++LV+FLCLPAAS
Sbjct  189  IRVNSVAPWFIKTSLSVDFLNNEQFSNAVN---SRTPLGRPGEPEEVAALVSFLCLPAAS  245

Query  838  YITGQTICVDGGYTITGF  891
            YITGQTIC DGG T+ GF
Sbjct  246  YITGQTICADGGMTVNGF  263



>ref|XP_004302763.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=260

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 191/258 (74%), Gaps = 7/258 (3%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL+GMTALVTGGT+GIGYAI+EELAG GA V+TCARNQ  + E V  W+ KG +V+GS
Sbjct  8    RWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNQEQIDEWVREWKSKGFQVSGS  67

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD++S+ QREELM  V++ F+GKLNILVNNA T+  +  TE+  ED + +M TN E+ +
Sbjct  68   VCDLTSKSQREELMRTVSSKFDGKLNILVNNAATVTLRSTTEYALEDLSSMMSTNVESPY  127

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HLCQLAYP LKAS  GSIVF +S  G   + + + Y+A+K A+ Q++KNLACEWAKD IR
Sbjct  128  HLCQLAYPLLKASGNGSIVFIASIAGLKALPRLSAYAATKSAVIQISKNLACEWAKDGIR  187

Query  664  VNSVAPWIIRT--KLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
             N+VAPW + T  K+ ND       SD+  R+I RTPI R  E  E+SSLV FLCLPAAS
Sbjct  188  TNTVAPWAVNTGVKVENDDH-----SDDFRRLIGRTPIRRVAEPNEISSLVTFLCLPAAS  242

Query  838  YITGQTICVDGGYTITGF  891
            YI GQ + VDGG+T++GF
Sbjct  243  YINGQVVSVDGGFTVSGF  260



>ref|NP_180497.1| tropinone reductase-like protein [Arabidopsis thaliana]
 gb|AAC95202.1| putative tropinone reductase [Arabidopsis thaliana]
 gb|AAK73971.1| At2g29360/F16P2.26 [Arabidopsis thaliana]
 gb|AAL90994.1| At2g29360/F16P2.26 [Arabidopsis thaliana]
 gb|AEC08242.1| tropinone reductase-like protein [Arabidopsis thaliana]
Length=271

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/263 (58%), Positives = 192/263 (73%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E  R + +WSL GMTALVTGG++GIG A++EELA  GA ++TCAR++  ++E + +W+ K
Sbjct  6    ESLRDKPRWSLVGMTALVTGGSKGIGEAVVEELATLGARIHTCARDETQLQESLRKWQAK  65

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G +V  S CDVSSR +RE+LME V+  F GKLNILVNN GT + K   + TAED++  M 
Sbjct  66   GFQVTTSVCDVSSRDKREKLMETVSTIFEGKLNILVNNVGTCIVKPTLQHTAEDFSFTMA  125

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TN E++FHL QLA+P LKAS  GSIV  SS  G + V   ++Y  SKGA+NQ+ +NLACE
Sbjct  126  TNLESAFHLSQLAHPLLKASGSGSIVLISSVSGVVHVNGASIYGVSKGAMNQLGRNLACE  185

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WA DNIR NSV PW I T LV ++ S+ +   E+E    R P+ R GEV EVSSLVAFLC
Sbjct  186  WASDNIRTNSVCPWFIETPLVTESLSNEEFRKEVE---SRPPMGRVGEVNEVSSLVAFLC  242

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPAASYITGQTICVDGG+T+ GF
Sbjct  243  LPAASYITGQTICVDGGFTVNGF  265



>gb|EYU41758.1| hypothetical protein MIMGU_mgv1a011856mg [Erythranthe guttata]
Length=268

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/264 (57%), Positives = 199/264 (75%), Gaps = 0/264 (0%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            ++ S+ + +W+LQGMTALVTGGT+GIGYAIIEELAGFGA +YTC+RNQ ++ E ++ W +
Sbjct  5    EQSSKRQQRWTLQGMTALVTGGTKGIGYAIIEELAGFGATIYTCSRNQAELSERLKEWED  64

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            KG KV GS CD+SSR QR+EL+  V++ F+GKLNILVNNA   + K A + +AED++ +M
Sbjct  65   KGYKVMGSTCDLSSRTQRQELINNVSSAFHGKLNILVNNAAISMMKRACDHSAEDFSSIM  124

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
             TN EA +H+CQL+YP LKAS +G+IVF SS  G + +   + Y+ASKGAINQ+TKNLAC
Sbjct  125  ETNLEAPYHICQLSYPLLKASGLGNIVFISSVAGGIALPALSAYAASKGAINQLTKNLAC  184

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWAKDNIR N+VAP+ +RT ++   + D  +   +  ++ RT + R  E  E+S LVAFL
Sbjct  185  EWAKDNIRTNTVAPFGVRTTILKLEDIDPSILQMLFPIMARTQLGRVAEADEISPLVAFL  244

Query  820  CLPAASYITGQTICVDGGYTITGF  891
            CLPAASYITGQ I VDGG+T   F
Sbjct  245  CLPAASYITGQVIYVDGGFTAGCF  268



>ref|XP_004294665.1| PREDICTED: tropinone reductase homolog At1g07440-like [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 199/262 (76%), Gaps = 4/262 (2%)
 Frame = +1

Query  115  GEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL-K  291
            G  +WSL+GMTALVTGGT+GIGYAI+EELAG GA VYTC+RN+  + EC+ +W++KG  +
Sbjct  6    GGRRWSLEGMTALVTGGTKGIGYAIVEELAGLGASVYTCSRNEAQLHECLNQWKKKGYHQ  65

Query  292  VAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLV-PKDATEFTAEDYTIVMGTN  468
            V GS CDV+S+ QREEL+ KV++ F+GKLNILVNN GT   P   TE TAE+Y+ +M TN
Sbjct  66   VTGSVCDVASKIQREELIHKVSSLFHGKLNILVNNVGTSHGPTPTTECTAEEYSSIMNTN  125

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPV-TKTTLYSASKGAINQMTKNLACEW  645
             E++++LCQLA+P LK S  G+IVF SS  G +      ++Y  +KGA+NQ+ KNLACEW
Sbjct  126  LESTYNLCQLAHPLLKTSGAGNIVFMSSVAGVVSTWGGGSVYGVTKGAMNQLAKNLACEW  185

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR+NSVAPW++RT L     +D   S  +E +I RTP+ R GE  EVS+LVAFLCL
Sbjct  186  AKDNIRINSVAPWVVRTPLAEPMFTDDGKS-LLEAVISRTPLGRIGEPEEVSALVAFLCL  244

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQT CVDGG TI GF
Sbjct  245  PAASYITGQTFCVDGGMTINGF  266



>ref|XP_008442511.1| PREDICTED: tropinone reductase homolog [Cucumis melo]
Length=270

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/259 (59%), Positives = 190/259 (73%), Gaps = 2/259 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL+G TALVTGG+RGIG A +EELA FGA V+TC R+Q D+ +C++ W E G +V+GS
Sbjct  8    RWSLKGKTALVTGGSRGIGRATVEELAEFGARVHTCCRSQEDLDKCLKEWEEMGFEVSGS  67

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVP--KDATEFTAEDYTIVMGTNFEA  477
             CDV S+ QR++LME V++ FNG LNILVNNAG  +   K   E T E+ + VM TNFEA
Sbjct  68   VCDVQSKEQRKKLMETVSSLFNGTLNILVNNAGRTLSSLKSTVEVTEEEISSVMSTNFEA  127

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            S H  QLAYP LKAS  GSIVF SS  G + +  +T Y+ASK AINQMTKNLACEWAKDN
Sbjct  128  SLHFSQLAYPLLKASGNGSIVFISSVSGLMALPFSTPYAASKAAINQMTKNLACEWAKDN  187

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR N+VAPWII+T+ V  +  D      +E+++  TP+ R GE  EVSS+VAFLCLPAAS
Sbjct  188  IRTNAVAPWIIKTRFVESSNDDPMHVKGMEQILSVTPLKRAGEPHEVSSMVAFLCLPAAS  247

Query  838  YITGQTICVDGGYTITGFP  894
            YITGQ   +DGG+T+  +P
Sbjct  248  YITGQLFVIDGGHTVKAYP  266



>gb|ABW81165.1| TRL5 [Capsella rubella]
Length=271

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/264 (58%), Positives = 194/264 (73%), Gaps = 3/264 (1%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            +E  R + +WSL GMTALVTGG++G+G A++EELA  GA V+TCAR++  ++E +  W+ 
Sbjct  5    EENLRDKTRWSLGGMTALVTGGSKGLGEAVVEELAMLGARVHTCARDKTQLQERLREWQA  64

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            KG  V  S CDVSS  QRE+LME V++ F GKLNILVNN GT + K  TE+TA DY+  M
Sbjct  65   KGFHVTTSVCDVSSHDQREKLMEAVSSLFQGKLNILVNNVGTCITKPTTEYTAHDYSFQM  124

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
             TN E++FHL QLA+P LKAS  GSIV  SSA G + +   ++Y A+KGA+NQ+ +NLAC
Sbjct  125  ATNLESTFHLSQLAHPLLKASGSGSIVLMSSASGVVHINVGSIYGATKGAMNQLGRNLAC  184

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWA DNIRVNSV PW I T L ++  +D    +E+E   ++TP+ R G+  EVSSLVAFL
Sbjct  185  EWASDNIRVNSVCPWFIATPLADNFLNDEDWKEEVE---KKTPMGRVGKANEVSSLVAFL  241

Query  820  CLPAASYITGQTICVDGGYTITGF  891
            C PAASYITGQTICVDGG+TI GF
Sbjct  242  CFPAASYITGQTICVDGGFTINGF  265



>ref|XP_010469962.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Camelina sativa]
Length=271

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/264 (58%), Positives = 194/264 (73%), Gaps = 3/264 (1%)
 Frame = +1

Query  100  QEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWRE  279
            +E  R   +WSL GMTALVTGG++GIG A++EELA  GA ++TCAR++  ++E + +W+ 
Sbjct  5    RESLRENPRWSLGGMTALVTGGSKGIGEAVVEELAMLGARIHTCARDETQLQESLRKWQA  64

Query  280  KGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVM  459
            KG +V  S  DVSSR QRE+LME V++ F GKLNILVNN GT + K   ++T ED+++ M
Sbjct  65   KGFQVTTSVYDVSSRDQREKLMETVSSVFQGKLNILVNNVGTCIVKPTLKYTEEDFSVTM  124

Query  460  GTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLAC  639
             TN E+SFHL QLA+P LKAS  GSIV  SS  G + V   ++Y  SKGA+NQ+ +NLAC
Sbjct  125  ATNLESSFHLSQLAHPLLKASGSGSIVLISSVSGVVHVNGASIYGVSKGAMNQLGRNLAC  184

Query  640  EWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFL  819
            EWA D+IRVNSV PW I T LVN+  S+ +  +E+E    R P+ R GE  EVSSLVAFL
Sbjct  185  EWASDSIRVNSVCPWFIATPLVNEVLSNDEFRNEVE---SRAPVGRVGEANEVSSLVAFL  241

Query  820  CLPAASYITGQTICVDGGYTITGF  891
            CLPAASYITGQTICVDGG+TI GF
Sbjct  242  CLPAASYITGQTICVDGGFTINGF  265



>emb|CDX98899.1| BnaC09g49360D [Brassica napus]
Length=262

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 195/256 (76%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL G  ALVTGGTRGIG AI+EELA  GA+V+TC+RNQ ++K C++ W+  GL V+GS
Sbjct  6    RWSLAGKAALVTGGTRGIGRAIVEELARLGAKVHTCSRNQEELKACLDDWKSNGLVVSGS  65

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD S R QRE+L+++V++ F+GKLNILVNN GT V K   E+T+EDY  +M TN E++F
Sbjct  66   VCDASDRDQREKLIQEVSSAFSGKLNILVNNVGTSVRKPTVEYTSEDYAKIMSTNLESAF  125

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            H+ Q+A+P LKAS +GSIVF SS  G + ++  ++Y A+KGA+NQ+T+NLACEWA DNIR
Sbjct  126  HISQIAHPLLKASGVGSIVFISSVAGLVRLSTASIYGATKGALNQLTRNLACEWAGDNIR  185

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             NSVAPW I+T LV   E   +    ++ ++ RTP+ R GE  EV+SLVAFLCLPAASYI
Sbjct  186  TNSVAPWYIKTSLV---EPLLEKKGFVDAVVDRTPLGRVGEPEEVASLVAFLCLPAASYI  242

Query  844  TGQTICVDGGYTITGF  891
            TGQ I VDGG+T+ GF
Sbjct  243  TGQVIAVDGGFTVNGF  258



>gb|AFK36242.1| unknown [Medicago truncatula]
Length=275

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 190/261 (73%), Gaps = 3/261 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            SRG  +WSL GMTALVTGGTRGIG+AI+ +L  FGA V+TC+R ++++ +C++ W+ KG 
Sbjct  11   SRGGQRWSLTGMTALVTGGTRGIGHAIVNDLVAFGAAVHTCSRTESELSKCLQEWQSKGF  70

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
             V GS CDVSSR QRE L+++VA+ FNGKLNI VNN G+   K   E+TAE+Y+ +M  N
Sbjct  71   SVTGSVCDVSSRSQRESLVQEVASTFNGKLNIFVNNVGSNFRKPTIEYTAEEYSELMTIN  130

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
             ++SFHLCQL++P LK S  GSIVF SS  G + +   ++Y+ASK AINQ+TKNLACEWA
Sbjct  131  LDSSFHLCQLSHPLLKESGNGSIVFISSVAGVVSLGTGSVYTASKAAINQLTKNLACEWA  190

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
             DNIR N V PW  RT LV     + K  D+I   + RTP+ R  E  EVSSLV FLCLP
Sbjct  191  IDNIRSNCVVPWATRTPLVEHLFQNQKFVDDI---LSRTPLKRIAEPEEVSSLVTFLCLP  247

Query  829  AASYITGQTICVDGGYTITGF  891
            AASYITGQ ICVDGG T+ GF
Sbjct  248  AASYITGQVICVDGGLTVFGF  268



>ref|XP_011010114.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=265

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/257 (60%), Positives = 193/257 (75%), Gaps = 4/257 (2%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSLQG TALVTGGT+GIGYA++EELA  GA V+TCAR+Q  +  C+ +W+E+GLKV+GS
Sbjct  9    RWSLQGTTALVTGGTKGIGYAVVEELAALGACVHTCARSQGQIDACLRQWKERGLKVSGS  68

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSS+  RE L+++V++ F GKLNIL+NNAGT V K   E+TAED++ +M TN +++F
Sbjct  69   VCDVSSQADRENLIKEVSSLFGGKLNILINNAGTNVYKPTLEYTAEDFSFMMNTNLQSAF  128

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVT-KTTLYSASKGAINQMTKNLACEWAKDNI  660
            HL QLA+P LKAS  G IVF SS  G   V     +YSASKGAINQ+T+NLACEWAKDNI
Sbjct  129  HLSQLAHPLLKASGAGRIVFVSSICGVTSVNIGYPIYSASKGAINQLTRNLACEWAKDNI  188

Query  661  RVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASY  840
            RVNSVAPW I T +  D+  +  V  E+     RTP+ R GE GEVSS+VAFLCLP  S+
Sbjct  189  RVNSVAPWFINTPMNEDSLKNESVVKELG---YRTPMGRAGEPGEVSSVVAFLCLPGPSF  245

Query  841  ITGQTICVDGGYTITGF  891
             TGQ IC+DGG ++ GF
Sbjct  246  TTGQVICIDGGMSVNGF  262



>gb|KEH34749.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=275

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 190/261 (73%), Gaps = 3/261 (1%)
 Frame = +1

Query  109  SRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL  288
            SRG  +WSL GMTALVTGGTRGIG+AI+ +L  FGA V+TC+R ++++ +C++ W+ KG 
Sbjct  11   SRGGQRWSLTGMTALVTGGTRGIGHAIVNDLVAFGAAVHTCSRTESELSKCLQEWQSKGF  70

Query  289  KVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTN  468
             V GS CDVSSR QRE L+++VA+ FNGKLNI VNN G+   K   E+TAE+Y+ +M  N
Sbjct  71   SVTGSVCDVSSRSQRESLVQEVASTFNGKLNIFVNNVGSNFRKPTIEYTAEEYSELMTIN  130

Query  469  FEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWA  648
             ++SFHLCQL++P LK S  GSIVF SS  G + +   ++Y+ASK AINQ+TKNLACEWA
Sbjct  131  LDSSFHLCQLSHPLLKESGNGSIVFISSVAGVVSLGTGSVYAASKAAINQLTKNLACEWA  190

Query  649  KDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLP  828
             DNIR N V PW  RT LV     + K  D+I   + RTP+ R  E  EVSSLV FLCLP
Sbjct  191  IDNIRSNCVVPWATRTPLVEHLFQNQKFVDDI---LSRTPLKRIAEPEEVSSLVTFLCLP  247

Query  829  AASYITGQTICVDGGYTITGF  891
            AASYITGQ ICVDGG T+ GF
Sbjct  248  AASYITGQVICVDGGLTVFGF  268



>ref|XP_007026940.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY07442.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=348

 Score =   318 bits (816),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/250 (63%), Positives = 192/250 (77%), Gaps = 1/250 (0%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSLQGMTALVTGGTRGIGYAI+EELA  GA V+TC+RNQ ++ E ++ W+ KG KV+GS
Sbjct  12   RWSLQGMTALVTGGTRGIGYAIVEELAALGAVVHTCSRNQTEINERLQEWQSKGFKVSGS  71

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD+SSR QRE+LME V++ F GKLNILVNNAG  + K   E T EDY+ VM TN EA +
Sbjct  72   VCDLSSREQREKLMETVSSVFYGKLNILVNNAGITMLKPCVEHTLEDYSTVMSTNVEAPY  131

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLA+P+LKAS  GSIVF SS  G L + + + YSASKGAINQ+TKNLACEWAKDNIR
Sbjct  132  HLSQLAHPFLKASGNGSIVFISSVAGSLALPRLSAYSASKGAINQITKNLACEWAKDNIR  191

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N+V+PW ++T ++   + D+   +E  R+I  T + R GE  E+SSLVAFLCLPAASYI
Sbjct  192  TNTVSPWGVKTTIM-IPKPDSPYVEEFIRLIAGTAMPRTGEPEEISSLVAFLCLPAASYI  250

Query  844  TGQTICVDGG  873
            TGQ I VDGG
Sbjct  251  TGQVISVDGG  260



>emb|CBI30509.3| unnamed protein product [Vitis vinifera]
Length=250

 Score =   315 bits (807),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/250 (59%), Positives = 190/250 (76%), Gaps = 0/250 (0%)
 Frame = +1

Query  142  MTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGSACDVSS  321
            MTAL+TGGTRGIGYAI+EELA  GA V+TC+RNQ ++ E ++ W  KG +V+GS CD++S
Sbjct  1    MTALITGGTRGIGYAIVEELAELGAIVHTCSRNQTELNERLQEWEGKGFRVSGSVCDLTS  60

Query  322  RPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASFHLCQLA  501
            R QRE+L E V++ F GKLNILVNNA T+  K  T +TAED + ++ TNFE+ +HLCQLA
Sbjct  61   RAQREKLTETVSSLFEGKLNILVNNAATVALKAPTNYTAEDCSSILQTNFESPYHLCQLA  120

Query  502  YPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIRVNSVAP  681
            +P LKAS  GSI+F SS  G + +   ++Y+A+KGAINQ+TKNLACEWAKDNIR N+VAP
Sbjct  121  HPLLKASGRGSIIFISSVAGLISLPHMSVYAATKGAINQVTKNLACEWAKDNIRTNAVAP  180

Query  682  WIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYITGQTIC  861
            W +RT +    E D  ++    +++ RTP+ R  E  EVS LVAFLCLPAASYITGQ IC
Sbjct  181  WTVRTSVRPILEPDNPMATAYPQLLARTPLHRIAEPDEVSPLVAFLCLPAASYITGQVIC  240

Query  862  VDGGYTITGF  891
            VDGG+++ GF
Sbjct  241  VDGGFSVNGF  250



>gb|KDP42205.1| hypothetical protein JCGZ_02935 [Jatropha curcas]
Length=320

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 196/275 (71%), Gaps = 3/275 (1%)
 Frame = +1

Query  67   SFVVWFFINNYQEMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQN  246
            S ++     +   +S  + +W+L G TALVTGGTRGIG AI+EEL G GA V+TC RN N
Sbjct  44   SLLILKLAQSRNSISTRDNRWTLHGKTALVTGGTRGIGRAIVEELVGLGARVHTCCRNGN  103

Query  247  DVKECVERWREKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDAT  426
            ++K C+E W   G  + GS CDVS   QREEL+E V++ F+GKLNILVNN GT + K   
Sbjct  104  ELKNCLEEWDGIGFAINGSLCDVSVADQREELLETVSSLFDGKLNILVNNVGTNIRKPMV  163

Query  427  EFTAEDYTIVMGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKG  606
            EFT+E+++ +M TNFE+ FHL QLAYP LK+S  GSIVF SS  GF+ +   +++ A+KG
Sbjct  164  EFTSEEFSTLMATNFESGFHLSQLAYPLLKSSGEGSIVFTSSVSGFVSLKSMSVHGATKG  223

Query  607  AINQMTKNLACEWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGE  786
            AINQ+TKNLACEWAKDNIR N+VAPW I+T +V    S       +E +  RTP+ R G+
Sbjct  224  AINQLTKNLACEWAKDNIRSNAVAPWYIKTSMVEQVLSSEAY---LEEVYSRTPLRRLGD  280

Query  787  VGEVSSLVAFLCLPAASYITGQTICVDGGYTITGF  891
              EVSS+VAFLCLPA+SY+TGQ ICVDGG ++ GF
Sbjct  281  AKEVSSVVAFLCLPASSYVTGQIICVDGGMSVNGF  315



>ref|XP_010256816.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Nelumbo nucifera]
Length=340

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/258 (59%), Positives = 199/258 (77%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSL+GMTALVTGGTRGIG+AI+EELAG GA V+TC+RN++++  C+  W  KG +V 
Sbjct  82   DARWSLKGMTALVTGGTRGIGHAIVEELAGLGAIVHTCSRNEDELNCCLGDWMTKGFQVT  141

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
             S CDVS++ QR++LME V++ F+GKLNIL+NNAGT + K   E+TAE+++ ++ TNFE+
Sbjct  142  ESVCDVSAQLQRKDLMETVSSVFSGKLNILINNAGTNIRKPTIEYTAEEFSTIITTNFES  201

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            +FHL QLAYP LK+S  GS+VF SS  G + +   T  +A KGAINQ+T++LACEWAKDN
Sbjct  202  AFHLSQLAYPLLKSSGKGSVVFISSVAGLVALGIGTASAACKGAINQLTRDLACEWAKDN  261

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR N+VAPW I+T LV   E   K  + +E++  RTP+ RPGE  EVSSLVAFLCLPA+S
Sbjct  262  IRTNAVAPWYIKTSLV---EHVLKNKELLEKITYRTPLQRPGEPKEVSSLVAFLCLPASS  318

Query  838  YITGQTICVDGGYTITGF  891
            YITGQ I VDGG T+ GF
Sbjct  319  YITGQVIPVDGGLTVNGF  336



>ref|XP_006294815.1| hypothetical protein CARUB_v10023866mg [Capsella rubella]
 gb|ABW81154.1| TRL17 [Capsella rubella]
 gb|EOA27713.1| hypothetical protein CARUB_v10023866mg [Capsella rubella]
Length=263

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 194/256 (76%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSLQGMTALVTGGT+GIG A++EEL+  GA V+TCAR++  ++E +  W+ KG +V+ S
Sbjct  4    RWSLQGMTALVTGGTKGIGEAVVEELSMLGARVHTCARDETQLQERLREWQAKGFQVSTS  63

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDV+SR QRE+LME V++ F GKLNILVNN GT + K  TE+T E+Y+++M TN E++F
Sbjct  64   TCDVTSREQREKLMETVSSLFQGKLNILVNNVGTFIVKPTTEYTGEEYSLIMATNLESAF  123

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QL++P LKAS  GSIV  SS  G +     ++Y  +KGA+NQ+ +NLACEWA+D+IR
Sbjct  124  HLSQLSHPLLKASGSGSIVLMSSIAGLVHANVGSIYGITKGAMNQLARNLACEWARDSIR  183

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N+V PW I T LVND   + ++   I+ ++ RTP+ R GE  EV+SLVAFLCLPAASYI
Sbjct  184  TNAVCPWYIATPLVNDLLKEGEI---IKEVVSRTPLGRVGEPNEVASLVAFLCLPAASYI  240

Query  844  TGQTICVDGGYTITGF  891
            TGQ+IC+DGG T+ GF
Sbjct  241  TGQSICIDGGLTVNGF  256



>ref|XP_008221978.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=270

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/259 (58%), Positives = 193/259 (75%), Gaps = 4/259 (2%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL-KV  294
            + +WSL+GMTALVTGGT+GIGYAI+EELAG GA ++TC+RN+  + +C+ +W+ KG  +V
Sbjct  10   DSRWSLRGMTALVTGGTKGIGYAIVEELAGLGATIHTCSRNEVQLNDCLSQWKMKGFDQV  69

Query  295  AGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFE  474
             GS CDV S+ QREEL+ KV++ FNGKLNIL+NN GT   K A E T EDY+ +M TN E
Sbjct  70   TGSVCDVVSKAQREELINKVSSLFNGKLNILINNVGTAEIKPAIESTTEDYSFIMSTNLE  129

Query  475  ASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKD  654
            +++H  QLA+P LKAS  G+I+F SS  G + +   ++Y+A+KGA+NQ+ KNLACEWAKD
Sbjct  130  SAYHFSQLAHPLLKASGAGNIIFMSSVAGVVSLGTASIYAATKGAMNQLAKNLACEWAKD  189

Query  655  NIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAA  834
            NIR NSVAPW IRT L     S+    + +E +  R P+ R GE  EVS+LVAFLC PAA
Sbjct  190  NIRTNSVAPWFIRTPLTEPLLSN---QNFLEAVNSRCPLGRTGEPKEVSALVAFLCFPAA  246

Query  835  SYITGQTICVDGGYTITGF  891
            SYITGQ ICVDGG+T+ G 
Sbjct  247  SYITGQIICVDGGFTVNGL  265



>ref|XP_008777422.1| PREDICTED: tropinone reductase homolog At1g07440-like [Phoenix 
dactylifera]
Length=275

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/255 (60%), Positives = 191/255 (75%), Gaps = 3/255 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            KWSL G TALVTGGT+GIG+AI+EELAGFGA V+TC+R + ++ +C+ERW+   + V GS
Sbjct  22   KWSLDGTTALVTGGTKGIGHAIVEELAGFGATVHTCSRTEAELNKCLERWKSLNIHVTGS  81

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSS  +RE+LME V + F GKLNILVNNAGT + K A +FTAE+Y+ +M TN E++F
Sbjct  82   VCDVSSLAEREKLMEDVRSIFQGKLNILVNNAGTYIWKPAQDFTAEEYSFLMATNLESAF  141

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLA+P LKAS  GSIVF SS  G + + K ++Y+A+KGAINQ+TKNLACEW +DNIR
Sbjct  142  HLSQLAHPLLKASGAGSIVFISSIAGVVALRKISIYAATKGAINQLTKNLACEWIEDNIR  201

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VN V P  IRT LV     D + +    R + R P+ R GE  EV+SLV+FLCLPAASYI
Sbjct  202  VNCVVPGFIRTPLVKSVLEDKEAT---ARELSRIPMRRVGEPEEVASLVSFLCLPAASYI  258

Query  844  TGQTICVDGGYTITG  888
            TGQ  CVDGG T+ G
Sbjct  259  TGQVTCVDGGRTVCG  273



>ref|XP_008777402.1| PREDICTED: tropinone reductase homolog At1g07440-like [Phoenix 
dactylifera]
Length=275

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/255 (60%), Positives = 191/255 (75%), Gaps = 3/255 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            KWSL G TALVTGGT+GIG+AI+EELAGFGA V+TC+R + ++ +C+ERW+   + V GS
Sbjct  22   KWSLDGTTALVTGGTKGIGHAIVEELAGFGATVHTCSRTEAELNKCLERWKSLNIHVTGS  81

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSSR +RE+LME + + F GKLNILVNNAGT + K A +FTAE+Y+ +M TN E++F
Sbjct  82   VCDVSSRTEREKLMEDIRSIFQGKLNILVNNAGTGIGKPALDFTAEEYSFLMATNLESAF  141

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLA+P LKAS  GSIVF SS  G + +   ++Y+A+KGAINQ+TKNLACEW +DNIR
Sbjct  142  HLSQLAHPLLKASGAGSIVFISSIAGVVAIGNLSIYAATKGAINQLTKNLACEWIEDNIR  201

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VN V P  IRT LV     D + +    R + R P+ R GE  EV+SLV+FLCLPAASYI
Sbjct  202  VNCVVPGFIRTPLVKSVLEDKEAT---ARELSRIPMRRVGEPEEVASLVSFLCLPAASYI  258

Query  844  TGQTICVDGGYTITG  888
            TGQ  CVDGG T+ G
Sbjct  259  TGQVTCVDGGRTVCG  273



>ref|XP_002881032.1| hypothetical protein ARALYDRAFT_481835 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57291.1| hypothetical protein ARALYDRAFT_481835 [Arabidopsis lyrata subsp. 
lyrata]
Length=266

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/260 (59%), Positives = 195/260 (75%), Gaps = 5/260 (2%)
 Frame = +1

Query  112  RGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLK  291
            R + +WSL+GMTALVTGG++G+G A++EELA FGA V+TCAR++  ++E +  W+ KG +
Sbjct  9    RDKSRWSLEGMTALVTGGSKGLGEAVVEELAMFGARVHTCARDETQLQERLREWQAKGFQ  68

Query  292  VAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNF  471
            V  S CDVSSR QRE+LME VA+ F GKLNILVNNAGT + K   E+T +DY+  M TN 
Sbjct  69   VTTSVCDVSSRDQREKLMETVASLFQGKLNILVNNAGTGILKPTIEYTEQDYSFQMATNL  128

Query  472  EASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAK  651
            E++FHL QLA+P LKAS +GSIVF SS  G +  T  ++Y A+KGA+NQ+ ++LACEWA 
Sbjct  129  ESAFHLSQLAHPLLKASNLGSIVFMSSVAGLVH-TGASIYGATKGAMNQLGRDLACEWAS  187

Query  652  DNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPA  831
            DNIRVNSV PW+I T L +   SD K+   +E    +TP+ R GE  EVSSLVAFLC PA
Sbjct  188  DNIRVNSVCPWVITTPLTSFI-SDEKLRKAVE---DKTPMGRVGEANEVSSLVAFLCFPA  243

Query  832  ASYITGQTICVDGGYTITGF  891
            ASYITGQTICVDGG ++ GF
Sbjct  244  ASYITGQTICVDGGVSVNGF  263



>ref|XP_006435623.1| hypothetical protein CICLE_v10032389mg [Citrus clementina]
 ref|XP_006486406.1| PREDICTED: tropinone reductase homolog At1g07440-like [Citrus 
sinensis]
 gb|ESR48863.1| hypothetical protein CICLE_v10032389mg [Citrus clementina]
Length=272

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 196/263 (75%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E S    +WSL+GMTALVTGGTRGIG A +EELAG GA V+TC+RN+ ++ +C++ W+ K
Sbjct  5    ESSFKSSRWSLKGMTALVTGGTRGIGQATVEELAGLGAVVHTCSRNEVELNKCLKEWQSK  64

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G  V+GS CD +S  QRE+L+++V + FNGKLNILVNN GT + K   E++AE+Y+ +M 
Sbjct  65   GFVVSGSVCDAASPDQREKLIQEVGSKFNGKLNILVNNVGTNIRKPTIEYSAEEYSKIMT  124

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TNFE+++HLCQL YP LKAS +GSIVF SS  G   +   ++Y A+K A+NQ+T+NLACE
Sbjct  125  TNFESTYHLCQLVYPLLKASGVGSIVFISSVGGLSHIGSGSIYGATKAAMNQLTRNLACE  184

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKDNIR NSVAPW  +T LV     + +  D++   I RTP+ R GE  EV+SLVA+LC
Sbjct  185  WAKDNIRTNSVAPWYTKTSLVEHLLENKEFVDKV---IARTPLQRVGEPEEVASLVAYLC  241

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPAASYITGQ I VDGG+T  GF
Sbjct  242  LPAASYITGQIISVDGGFTANGF  264



>gb|KDO69163.1| hypothetical protein CISIN_1g024125mg [Citrus sinensis]
Length=272

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/263 (58%), Positives = 198/263 (75%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  EMSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREK  282
            E S    +WSL+GMTALVTGGTRGIG A +EELAG GA V+TC+RN+ ++ +C++ W+ K
Sbjct  5    ESSFKSSRWSLKGMTALVTGGTRGIGQATVEELAGLGAVVHTCSRNEVELNKCLKEWQSK  64

Query  283  GLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMG  462
            G  V+GS CD +S  QRE+L+++V + FNGKLNILVNN GT + K   E++AE+Y+ +M 
Sbjct  65   GFVVSGSVCDAASPDQREKLIQEVGSKFNGKLNILVNNVGTNIRKPTIEYSAEEYSKIMT  124

Query  463  TNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACE  642
            TNFE+++HLCQL YP LKAS +GSIVF SS  G   V   ++Y A+K A+NQ+T+NLACE
Sbjct  125  TNFESTYHLCQLVYPLLKASGVGSIVFISSVGGLSHVGSGSIYGATKAAMNQLTRNLACE  184

Query  643  WAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLC  822
            WAKDNIR NSVAPW  +T LV   E   +  + ++++I RTP+ R GE  EV+SLVA+LC
Sbjct  185  WAKDNIRTNSVAPWYTKTSLV---ERLLENKEFVDKVIARTPLQRVGEPEEVASLVAYLC  241

Query  823  LPAASYITGQTICVDGGYTITGF  891
            LPAASYITGQ I VDGG+T  GF
Sbjct  242  LPAASYITGQIISVDGGFTANGF  264



>ref|XP_010469988.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=265

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/257 (59%), Positives = 190/257 (74%), Gaps = 4/257 (2%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GMTALVTGG++GIG A++EEL+  GA+V+TCAR++  ++E +  W+ KG +V  S
Sbjct  6    RWSLGGMTALVTGGSKGIGEAVVEELSMMGAKVHTCARDETQLQERLREWQAKGFQVTTS  65

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSSR QRE+LME V+  F GKLNILVNNAGT + K  TE+TAEDY+ +M TN E++F
Sbjct  66   VCDVSSRDQREKLMETVSTLFQGKLNILVNNAGTFIVKPTTEYTAEDYSFIMATNIESAF  125

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKT-TLYSASKGAINQMTKNLACEWAKDNI  660
            HL QLA+P LKAS  GSIV  SS  G + +    ++Y A+KGA+NQ+ +NLACEWA D+I
Sbjct  126  HLSQLAHPLLKASGSGSIVLMSSTAGIVHINNVGSIYGATKGAMNQLARNLACEWASDSI  185

Query  661  RVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASY  840
            R N+V PW I T LVND  +D +   E E   +RT + R GE  EVS LVAFLCLPAASY
Sbjct  186  RANAVCPWFITTPLVNDCLNDKEFKKEAE---KRTAVGRIGEANEVSPLVAFLCLPAASY  242

Query  841  ITGQTICVDGGYTITGF  891
            ITGQ ICVDGG TI GF
Sbjct  243  ITGQAICVDGGVTINGF  259



>ref|XP_010414424.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Camelina sativa]
Length=265

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/257 (59%), Positives = 189/257 (74%), Gaps = 4/257 (2%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GMTALVTGG++GIG A++EEL+  GA+V+TCAR++  ++E +  W+ KG +V  S
Sbjct  6    RWSLSGMTALVTGGSKGIGEAVVEELSMMGAKVHTCARDETQLQERLREWQAKGFQVTIS  65

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSSR QRE+LME V+  F GKLNILVNNAGT + K  TE+TAEDY+ +M TN E++F
Sbjct  66   VCDVSSRDQREKLMETVSTLFQGKLNILVNNAGTFIVKPTTEYTAEDYSFIMATNLESAF  125

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKT-TLYSASKGAINQMTKNLACEWAKDNI  660
            HL QLA+P LKAS  GSIV  SS  G + +    ++Y A+KGA+NQ+ +NLACEWA D I
Sbjct  126  HLSQLAHPLLKASGSGSIVLMSSTAGIVHINNVGSIYGATKGAMNQLARNLACEWASDRI  185

Query  661  RVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASY  840
            R N+V PW I T LVND  +D +   E E   +RT + R GE  EVS LVAFLCLPAASY
Sbjct  186  RANAVCPWFITTPLVNDCLNDKEFKKEAE---KRTAVGRIGEANEVSPLVAFLCLPAASY  242

Query  841  ITGQTICVDGGYTITGF  891
            ITGQ ICVDGG TI GF
Sbjct  243  ITGQAICVDGGVTINGF  259



>gb|AIX10937.1| putative tropinone reductase [Gardenia jasminoides]
Length=274

 Score =   315 bits (807),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 193/256 (75%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL G TALVTGGTRGIG A++EELA  GA ++TC+RN+ ++ E ++ W  KG KV GS
Sbjct  12   RWSLAGKTALVTGGTRGIGLAVVEELAELGATIHTCSRNEVELNERLQEWASKGFKVTGS  71

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD SSR QRE+LM KV++ F+GKLN+L+NN GT + K  T++TAE+Y  +M TN E+++
Sbjct  72   VCDASSREQREQLMGKVSSVFDGKLNLLINNVGTNIRKPTTDYTAEEYCRIMATNLESAY  131

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLAYP LKAS +GS VF SS  G + ++  ++Y A+KGA+NQ+T+NLACEWAKDNIR
Sbjct  132  HLSQLAYPLLKASGVGSTVFISSVAGLVHLSSGSIYGATKGAMNQLTRNLACEWAKDNIR  191

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VN VAPW IRT LV +  ++ +  D +   I RTP+ RPGE  EVSSLVA+ CLPAASYI
Sbjct  192  VNCVAPWYIRTSLVENLLNNKEFLDMV---ISRTPLGRPGEPKEVSSLVAYFCLPAASYI  248

Query  844  TGQTICVDGGYTITGF  891
            TGQ + VDGG T+ G 
Sbjct  249  TGQVVAVDGGMTVFGL  264



>ref|XP_009140979.1| PREDICTED: tropinone reductase homolog At1g07440 [Brassica rapa]
Length=300

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 192/256 (75%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GM+ALVTGGTRGIG AI+EEL G GA+V+TCARN+ ++K+C+  W   G +V GS
Sbjct  43   RWSLHGMSALVTGGTRGIGRAIVEELVGLGAKVHTCARNETELKDCLRDWNRSGFQVDGS  102

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVS R QRE LME V++ F+GKL+ILVNN GT + K   +FT E+++ ++ TNFE+ F
Sbjct  103  VCDVSDRAQRESLMETVSSLFHGKLHILVNNVGTNIRKPMVDFTPEEFSTLLSTNFESVF  162

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HLCQLAYP L+A+E G +V  SS  GF+ +   ++ SA+KGAINQ+T+NLACEWAKDNIR
Sbjct  163  HLCQLAYPILRATEAGCVVSISSVSGFVSLKNMSVQSATKGAINQLTRNLACEWAKDNIR  222

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
            VN+VAPW I+T +V    S+    DE+  +   TP+ R GE  EVSS VAFLCLPA+SYI
Sbjct  223  VNAVAPWYIKTSMVEQVLSNKDYLDEVYSV---TPLGRLGEPREVSSAVAFLCLPASSYI  279

Query  844  TGQTICVDGGYTITGF  891
            TGQ + VDGG +I GF
Sbjct  280  TGQIVRVDGGMSINGF  295



>ref|XP_007140482.1| hypothetical protein PHAVU_008G116300g [Phaseolus vulgaris]
 gb|ESW12476.1| hypothetical protein PHAVU_008G116300g [Phaseolus vulgaris]
Length=266

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 153/254 (60%), Positives = 191/254 (75%), Gaps = 1/254 (0%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            KWSL GMTALVTGGTRGIGYA+ EELA FGA V+ CAR Q D+ +C+E W  KG  + GS
Sbjct  13   KWSLHGMTALVTGGTRGIGYAVAEELAEFGASVHICARKQQDIDKCLEEWNRKGFSITGS  72

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
            +CDV SR QRE LM  VA+ F+GKLNIL+NNAGT VPK+  ++TAED + +MGTNFE+S+
Sbjct  73   SCDVLSRDQRENLMRDVASIFDGKLNILINNAGTTVPKNLIDYTAEDISTIMGTNFESSY  132

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HLCQLA+P LKAS  G+IVF SS  G      +++Y++SKGA+NQ TKN+A EWAKDNIR
Sbjct  133  HLCQLAHPLLKASGYGNIVFISSIAGLKSFPFSSVYASSKGAMNQFTKNVALEWAKDNIR  192

Query  664  VNSVAPWIIRTKLVN-DAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASY  840
             N+VAP  ++T+L++   ES  + S  IE    +T   R GE  ++S +VAFLCLPAASY
Sbjct  193  ANAVAPGFVKTELLDFILESLDEGSKIIEATKAKTMAGRIGEPKDISGMVAFLCLPAASY  252

Query  841  ITGQTICVDGGYTI  882
            ITGQ I +DGGYTI
Sbjct  253  ITGQIITIDGGYTI  266



>ref|XP_010521558.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Tarenaya hassleriana]
Length=262

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 191/258 (74%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            E +WSLQG TALVTGG RG+G+AI+EELAG GA V+ C +++  + + +  W EKGL+V+
Sbjct  2    EPRWSLQGKTALVTGGARGLGHAIVEELAGLGAIVHMCDKSEAHLNQSLREWEEKGLQVS  61

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CDVSSRP RE+LM+ V++ F GKLNIL+NN G  V K   E TAED++  M  NFE+
Sbjct  62   GSLCDVSSRPAREKLMQTVSSLFGGKLNILINNVGICVAKPTVEMTAEDFSFQMAMNFES  121

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            ++HLCQLA+P LKAS  GSIVFNSS  G +     ++Y A+KGA+NQ+ KNLACEWA+DN
Sbjct  122  AYHLCQLAHPLLKASGYGSIVFNSSIGGVVSCILGSIYGATKGAMNQLAKNLACEWARDN  181

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NSVAP ++ T +    E+     +  E ++ RTP+ R GE  EVSSLVAFLC+PAAS
Sbjct  182  IRTNSVAPGVVETPMT---ETFLGYEEFTETVVSRTPLGRLGEAKEVSSLVAFLCMPAAS  238

Query  838  YITGQTICVDGGYTITGF  891
            YITGQT+CVDGG TI GF
Sbjct  239  YITGQTVCVDGGLTINGF  256



>ref|XP_002873234.1| hypothetical protein ARALYDRAFT_487407 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49493.1| hypothetical protein ARALYDRAFT_487407 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 195/256 (76%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL G TALVTGGTRGIG A++EELA FGA+V+TC+RNQ ++  C+  W+  GL V+GS
Sbjct  6    RWSLAGKTALVTGGTRGIGRAVVEELAKFGAKVHTCSRNQEELNACLNDWKSNGLVVSGS  65

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD S R QRE+L+++ ++ F+GKLNILVNN GT V K   E+++E+Y  +M TN E++F
Sbjct  66   VCDASVRDQREKLIQEASSAFSGKLNILVNNVGTNVRKPTVEYSSEEYAKIMTTNLESAF  125

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL Q+A+P LKAS +GSIVF SS  G + +   ++Y A+KGA+NQ+T+NLACEWA+DNIR
Sbjct  126  HLSQIAHPLLKASGVGSIVFISSVAGLVHLQSGSIYGATKGALNQLTRNLACEWARDNIR  185

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N VAPW I+T LV   E+  +  D +E ++ RTP+ R GE  EV+SLVAFLCLPAASYI
Sbjct  186  TNCVAPWYIKTSLV---ETLLEKKDFVEAVVSRTPLGRVGEPEEVASLVAFLCLPAASYI  242

Query  844  TGQTICVDGGYTITGF  891
            TGQ I VDGG+T+ GF
Sbjct  243  TGQVISVDGGFTVNGF  258



>ref|XP_010510510.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Camelina sativa]
Length=310

 Score =   316 bits (810),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 155/281 (55%), Positives = 200/281 (71%), Gaps = 8/281 (3%)
 Frame = +1

Query  85   FINNYQEMSRGEG-----KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQND  249
            F++N +    GE      +WSL GMTALVTGG++GIG A++EELA  GA ++TCAR++  
Sbjct  5    FVHNQKMAKTGESLRENPRWSLGGMTALVTGGSKGIGEAVVEELAMLGARIHTCARDETQ  64

Query  250  VKECVERWREKGLKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATE  429
            ++E + +W+ KG +V  S CDVSSR QRE+LME V++ F GKLNILVNN G  + K   +
Sbjct  65   LQESLRKWQAKGFQVTTSVCDVSSREQREKLMETVSSVFQGKLNILVNNVGACIVKPTLK  124

Query  430  FTAEDYTIVMGTNFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGA  609
            +T ED+++ M TN E++FHL QLA+P LKAS  GSIV  SS  G + V   ++Y  SKGA
Sbjct  125  YTEEDFSVTMATNLESAFHLSQLAHPLLKASGSGSIVLISSVSGVVHVNGASIYGVSKGA  184

Query  610  INQMTKNLACEWAKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEV  789
            +NQ+ +NLACEWA D+IRVNSV PW I T LVND  S+ +  +E+E    R P+ R GE 
Sbjct  185  MNQLGRNLACEWASDSIRVNSVCPWFIATPLVNDVLSNDEFRNEVE---SRAPMGRVGEA  241

Query  790  GEVSSLVAFLCLPAASYITGQTICVDGGYTITGFP*NNKLL  912
             EVSSLVAFLCLPAASYITGQTI VDGG+TI GF    ++L
Sbjct  242  NEVSSLVAFLCLPAASYITGQTISVDGGFTINGFSYKPQIL  282



>emb|CDX70101.1| BnaA10g24500D [Brassica napus]
Length=262

 Score =   314 bits (805),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 151/258 (59%), Positives = 191/258 (74%), Gaps = 3/258 (1%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVA  297
            + +WSL G TALVTGGTRGIG AI+EELA FGA V+TC+RNQ ++K C++ WR  GL  +
Sbjct  4    DKRWSLAGKTALVTGGTRGIGRAIVEELARFGATVHTCSRNQEELKACLDDWRSNGLTES  63

Query  298  GSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEA  477
            GS CD S R +RE+LM++V++ F+GKLNILVNN GT V K   E+T+EDY  VM TNFE+
Sbjct  64   GSVCDASDRDEREKLMQQVSSAFSGKLNILVNNVGTNVWKPTVEYTSEDYAKVMSTNFES  123

Query  478  SFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDN  657
            +FH  Q+A+P LKAS +GSIVF SS  G +  +   +Y A+KGA+NQ+T+NLACEWA DN
Sbjct  124  AFHFSQIAHPLLKASGVGSIVFVSSVAGLVYASAGPIYGATKGALNQLTRNLACEWACDN  183

Query  658  IRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAAS  837
            IR NSVAPW I+T  V     + +  D +   + RTP+ R GE  EV+SLVAFLCLPAAS
Sbjct  184  IRTNSVAPWYIKTSFVEPVLENKEFMDAV---VNRTPLGRVGEPEEVASLVAFLCLPAAS  240

Query  838  YITGQTICVDGGYTITGF  891
            YITGQ I  DGG+T+ GF
Sbjct  241  YITGQVIVADGGFTVNGF  258



>ref|XP_003537468.1| PREDICTED: tropinone reductase homolog At1g07440-like [Glycine 
max]
Length=277

 Score =   315 bits (806),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 152/262 (58%), Positives = 192/262 (73%), Gaps = 4/262 (2%)
 Frame = +1

Query  106  MSRGEGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKG  285
            ++RG  +WSL GMTALVTGGTRGIG+AI+ +LA FGA V+TC+RNQ ++ +C++ W+ +G
Sbjct  13   INRG-ARWSLNGMTALVTGGTRGIGHAIVNDLAAFGAAVHTCSRNQTELNKCLQEWQSQG  71

Query  286  LKVAGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGT  465
             +V GS CDVSS PQRE+L+++ A+ FNGKLNI VNN G    K   E++AE+Y+ +M  
Sbjct  72   FEVTGSVCDVSSPPQREKLIQEAASTFNGKLNIYVNNVGVNYRKPTIEYSAEEYSEMMTV  131

Query  466  NFEASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEW  645
            N  ++FHLCQLAYP LKAS  GSIVF SS  G   +   ++Y+ASK AINQ+TKNLACEW
Sbjct  132  NLNSAFHLCQLAYPLLKASGKGSIVFLSSVAGVTSMGTGSVYAASKAAINQLTKNLACEW  191

Query  646  AKDNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCL  825
            AKDNIR N V PW  RT L+   E   +    +E ++ RTP+ R  E  EVSSLVAFLCL
Sbjct  192  AKDNIRSNCVVPWTTRTPLI---EHLLQNQTFVEDVMSRTPLKRIAEPEEVSSLVAFLCL  248

Query  826  PAASYITGQTICVDGGYTITGF  891
            PAASYITGQ IC DGG T+ GF
Sbjct  249  PAASYITGQVICADGGVTVNGF  270



>ref|XP_007205714.1| hypothetical protein PRUPE_ppa009944mg [Prunus persica]
 gb|EMJ06913.1| hypothetical protein PRUPE_ppa009944mg [Prunus persica]
Length=271

 Score =   315 bits (806),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 152/260 (58%), Positives = 195/260 (75%), Gaps = 5/260 (2%)
 Frame = +1

Query  118  EGKWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGL-KV  294
            + +WSL GMTALVTGGT+GIGYAI+EELAG GA ++TC+RN+  + +C+ +W+ KG  +V
Sbjct  10   DSRWSLHGMTALVTGGTKGIGYAIVEELAGLGATIHTCSRNEVQLNDCLSQWKMKGFDQV  69

Query  295  AGSACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFE  474
             GS CDV S+ QREEL+ KV++ F+GKLNIL+NN GT   K A E T EDY+ +M TN E
Sbjct  70   TGSVCDVVSKAQREELINKVSSLFHGKLNILINNVGTTDLKPAIESTTEDYSFIMSTNLE  129

Query  475  ASFHLCQLAYPYLKASEMGSIVFNSSAVGFLPVTK-TTLYSASKGAINQMTKNLACEWAK  651
            +++H  QLA+P LKAS  G+I+F SS  G + V +  ++Y+A+KGAINQ+ KNLACEWAK
Sbjct  130  SAYHFSQLAHPLLKASGAGNIIFLSSVAGVVSVGEGGSIYAATKGAINQLAKNLACEWAK  189

Query  652  DNIRVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPA  831
            DNIR NSVAPW IRT LV    S+    + +E +  R P+ R GE  EVS+LVAFLC PA
Sbjct  190  DNIRTNSVAPWFIRTPLVEPLLSN---QNFLEAVNSRCPLGRTGEPKEVSALVAFLCFPA  246

Query  832  ASYITGQTICVDGGYTITGF  891
            ASYITGQTICVDGG+T+ G 
Sbjct  247  ASYITGQTICVDGGFTVNGL  266



>gb|KFK24998.1| hypothetical protein AALP_AA8G053200 [Arabis alpina]
Length=262

 Score =   314 bits (805),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 193/256 (75%), Gaps = 3/256 (1%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL G TALVTGGTRGIG A++EELA FGA+VYTC+RN+ ++K C+  W+  GL V GS
Sbjct  6    RWSLAGKTALVTGGTRGIGRAVVEELARFGAKVYTCSRNEEELKACLADWKSNGLVVYGS  65

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CD S + QRE+LM++V+  F+GKLNILVNN GT + K   ++++E+Y  +M TN E++F
Sbjct  66   VCDASVKDQREQLMQEVSAMFSGKLNILVNNVGTNIRKPTVDYSSEEYAKIMSTNLESAF  125

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKTTLYSASKGAINQMTKNLACEWAKDNIR  663
            HL QLA+P LKAS +GS+VF SS  G + V   ++Y A+KGA+NQ+T+NLACEWA DNIR
Sbjct  126  HLSQLAHPLLKASGVGSVVFISSVAGLVHVRTGSIYGATKGALNQLTRNLACEWAGDNIR  185

Query  664  VNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASYI  843
             N VAPW I+T LV   E   +  D +E ++ RTP+ R GE  EVSSLVAFLCLPA+SYI
Sbjct  186  TNCVAPWYIKTSLV---EPLLEKKDFVEAVVSRTPLGRVGEPEEVSSLVAFLCLPASSYI  242

Query  844  TGQTICVDGGYTITGF  891
            TGQ I VDGG+T+ GF
Sbjct  243  TGQVISVDGGFTVNGF  258



>ref|XP_010510526.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=265

 Score =   314 bits (805),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 152/257 (59%), Positives = 188/257 (73%), Gaps = 4/257 (2%)
 Frame = +1

Query  124  KWSLQGMTALVTGGTRGIGYAIIEELAGFGAEVYTCARNQNDVKECVERWREKGLKVAGS  303
            +WSL GMTALVTGG++GIG A++EEL+  GA V+TCAR++  ++E +  W+ KG  V  S
Sbjct  6    RWSLGGMTALVTGGSKGIGEAVVEELSMMGARVHTCARDETQLQERLREWQAKGFHVTTS  65

Query  304  ACDVSSRPQREELMEKVANHFNGKLNILVNNAGTLVPKDATEFTAEDYTIVMGTNFEASF  483
             CDVSSR QRE+LME V+  F GKLNILVNNAGT + K  TE+TAEDY+ +M TN E++F
Sbjct  66   VCDVSSREQREKLMETVSTLFQGKLNILVNNAGTFIVKPTTEYTAEDYSFIMATNLESAF  125

Query  484  HLCQLAYPYLKASEMGSIVFNSSAVGFLPVTKT-TLYSASKGAINQMTKNLACEWAKDNI  660
            HL QLA+P LKAS  GSIV  SS  G + +    ++Y A+KGA+NQ+ +NLACEWA D+I
Sbjct  126  HLSQLAHPLLKASGSGSIVLMSSTAGIVHINNVGSIYGATKGAMNQLARNLACEWASDSI  185

Query  661  RVNSVAPWIIRTKLVNDAESDAKVSDEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASY  840
            R N+V PW I T LVND  +D +   E E   +RT + R GE  EVS LVAFLCLPAASY
Sbjct  186  RANAVCPWFITTPLVNDCLNDKEFKKEAE---KRTAVGRIGEANEVSPLVAFLCLPAASY  242

Query  841  ITGQTICVDGGYTITGF  891
            ITGQ ICVDGG TI GF
Sbjct  243  ITGQAICVDGGVTINGF  259



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2924309455998