BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24040_g8_i1 len=2523 path=[1313:0-2110 3424:2111-2111
3425:2112-2151 34369:2152-2155 3469:2156-2421 3735:2422-2522]

Length=2523
                                                                      Score     E

ref|XP_009626094.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...   1013   0.0      
ref|XP_009791442.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...   1009   0.0      
emb|CDO99749.1|  unnamed protein product                                961   0.0      
ref|XP_011076970.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    956   0.0      
ref|XP_006354684.1|  PREDICTED: uncharacterized protein LOC102602856    956   0.0      
ref|XP_011084323.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    945   0.0      
ref|XP_011076971.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    932   0.0      
ref|XP_010651179.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    924   0.0      
gb|KDP44038.1|  hypothetical protein JCGZ_05505                         915   0.0      
ref|XP_010264664.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    907   0.0      
ref|XP_010067309.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    903   0.0      
gb|EYU39609.1|  hypothetical protein MIMGU_mgv1a002168mg                902   0.0      
ref|XP_007016766.1|  Pleckstrin (PH) and lipid-binding START doma...    901   0.0      
ref|XP_007016768.1|  Pleckstrin (PH) and lipid-binding START doma...    899   0.0      
ref|XP_010253703.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    897   0.0      
ref|XP_007206425.1|  hypothetical protein PRUPE_ppa001967mg             894   0.0      
ref|XP_010043759.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    890   0.0      
ref|XP_011089926.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    889   0.0      
gb|KCW85749.1|  hypothetical protein EUGRSUZ_B02509                     888   0.0      
gb|KCW65419.1|  hypothetical protein EUGRSUZ_G02842                     887   0.0      
ref|XP_006340183.1|  PREDICTED: uncharacterized protein LOC102585665    886   0.0      
ref|XP_008245285.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    882   0.0      
ref|XP_006488076.1|  PREDICTED: uncharacterized protein LOC102622614    882   0.0      
gb|KDO73326.1|  hypothetical protein CISIN_1g004508mg                   880   0.0      
ref|XP_008233315.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    879   0.0      
ref|XP_009621797.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    879   0.0      
ref|XP_006424553.1|  hypothetical protein CICLE_v10027876mg             879   0.0      
ref|XP_007220231.1|  hypothetical protein PRUPE_ppa002022mg             879   0.0      
ref|XP_004251144.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    879   0.0      
ref|XP_011031731.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    878   0.0      
ref|XP_011044394.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    877   0.0      
ref|XP_002311087.2|  pleckstrin homology domain-containing family...    877   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011031732.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    876   0.0      
gb|KHG27546.1|  PCTP-like protein                                       869   0.0      
ref|XP_007150192.1|  hypothetical protein PHAVU_005G134300g             869   0.0      
gb|KHG05026.1|  PCTP-like protein                                       868   0.0      
ref|XP_007009855.1|  Pleckstrin (PH) and lipid-binding START doma...    867   0.0      
ref|XP_004149918.1|  PREDICTED: uncharacterized protein LOC101207368    867   0.0      
emb|CDP07099.1|  unnamed protein product                                866   0.0      
ref|XP_002316372.1|  pleckstrin homology domain-containing family...    866   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011041015.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    863   0.0      
ref|XP_006592703.1|  PREDICTED: uncharacterized protein LOC100779206    863   0.0      
ref|XP_004291708.1|  PREDICTED: uncharacterized protein LOC101295593    863   0.0      
gb|KDO73324.1|  hypothetical protein CISIN_1g004508mg                   862   0.0      
ref|XP_010920448.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    859   0.0      
ref|XP_009344767.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    859   0.0      
ref|XP_009103673.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    858   0.0      
ref|XP_008367183.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    858   0.0      
ref|XP_010557338.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    858   0.0      
ref|XP_002314279.1|  pleckstrin homology domain-containing family...    857   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006409857.1|  hypothetical protein EUTSA_v10016308mg             857   0.0      
gb|KDO73325.1|  hypothetical protein CISIN_1g004508mg                   857   0.0      
emb|CDX71361.1|  BnaC04g15960D                                          856   0.0      
ref|XP_010557337.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    857   0.0      
emb|CDY04553.1|  BnaA07g13790D                                          855   0.0      
ref|XP_010322400.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    855   0.0      
ref|XP_010920447.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    855   0.0      
ref|XP_010920444.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    855   0.0      
ref|XP_002529938.1|  conserved hypothetical protein                     852   0.0      Ricinus communis
ref|XP_008367239.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    853   0.0      
ref|XP_010906506.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    853   0.0      
ref|XP_002274053.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    853   0.0      Vitis vinifera
ref|XP_004982841.1|  PREDICTED: uncharacterized protein LOC101786041    853   0.0      
ref|XP_008456489.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    852   0.0      
gb|AAK21344.1|AC024594_8  unknown protein                               853   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002880934.1|  hypothetical protein ARALYDRAFT_901677             851   0.0      
ref|XP_008678703.1|  PREDICTED: uncharacterized protein LOC100192...    852   0.0      
ref|XP_006436438.1|  hypothetical protein CICLE_v10030795mg             851   0.0      
ref|XP_008678750.1|  PREDICTED: uncharacterized protein LOC100192...    852   0.0      
ref|XP_003541992.1|  PREDICTED: uncharacterized protein LOC100812931    850   0.0      
ref|XP_010521754.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    850   0.0      
emb|CBI31451.3|  unnamed protein product                                848   0.0      
ref|XP_006365757.1|  PREDICTED: uncharacterized protein LOC102579740    848   0.0      
gb|KFK32307.1|  hypothetical protein AALP_AA6G225400                    848   0.0      
gb|AES67511.2|  pleckstrin-like (PH) and lipid-binding START doma...    847   0.0      
ref|XP_010089970.1|  hypothetical protein L484_008048                   848   0.0      
ref|NP_180399.2|  pleckstrin homology (PH) and lipid-binding STAR...    847   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293758.1|  hypothetical protein CARUB_v10022718mg             846   0.0      
ref|XP_010510641.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    846   0.0      
ref|XP_009589980.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    845   0.0      
ref|XP_010521753.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    845   0.0      
ref|XP_010920449.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    845   0.0      
gb|KFK32308.1|  hypothetical protein AALP_AA6G225400                    843   0.0      
ref|XP_006589423.1|  PREDICTED: uncharacterized protein LOC100802...    842   0.0      
gb|KHN21511.1|  hypothetical protein glysoja_021091                     842   0.0      
ref|XP_009396972.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    840   0.0      
ref|XP_010470101.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    840   0.0      
ref|XP_004487249.1|  PREDICTED: uncharacterized protein LOC101507747    840   0.0      
ref|XP_006589424.1|  PREDICTED: uncharacterized protein LOC100802...    839   0.0      
ref|XP_010555822.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    838   0.0      
ref|XP_009770311.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    838   0.0      
gb|KDO73323.1|  hypothetical protein CISIN_1g004508mg                   837   0.0      
ref|XP_006662447.1|  PREDICTED: uncharacterized protein LOC102718305    836   0.0      
ref|XP_010414549.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    837   0.0      
ref|XP_008791557.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    837   0.0      
ref|XP_004308785.1|  PREDICTED: uncharacterized protein LOC101295576    836   0.0      
ref|XP_009396971.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    840   0.0      
dbj|BAK01993.1|  predicted protein                                      837   0.0      
ref|XP_010234829.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    836   0.0      
ref|XP_008377573.1|  PREDICTED: LOW QUALITY PROTEIN: protein ENHA...    835   0.0      
ref|XP_006846792.1|  hypothetical protein AMTR_s00148p00054510          836   0.0      
ref|XP_004496270.1|  PREDICTED: uncharacterized protein LOC101513040    833   0.0      
ref|XP_007143713.1|  hypothetical protein PHAVU_007G095400g             833   0.0      
ref|XP_008791555.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    832   0.0      
gb|KDO73327.1|  hypothetical protein CISIN_1g004508mg                   832   0.0      
ref|XP_008807473.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    829   0.0      
ref|XP_009103932.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    827   0.0      
emb|CDX67608.1|  BnaA07g16480D                                          826   0.0      
ref|XP_006292259.1|  hypothetical protein CARUB_v10018468mg             826   0.0      
ref|XP_010234828.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    825   0.0      
ref|XP_010920450.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    820   0.0      
ref|XP_010516021.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    820   0.0      
ref|XP_002876269.1|  hypothetical protein ARALYDRAFT_485890             816   0.0      
ref|XP_010504305.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    816   0.0      
ref|XP_010427199.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    814   0.0      
ref|XP_006403534.1|  hypothetical protein EUTSA_v10010151mg             814   0.0      
emb|CDY07523.1|  BnaC06g15410D                                          813   0.0      
ref|XP_009400818.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    812   0.0      
ref|NP_191040.2|  Pleckstrin homology (PH) and lipid-binding STAR...    810   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010319624.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    807   0.0      
ref|XP_009344768.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    808   0.0      
ref|XP_009116156.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    808   0.0      
ref|XP_010689525.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    807   0.0      
emb|CDY02892.1|  BnaC04g25940D                                          807   0.0      
ref|XP_003597260.1|  hypothetical protein MTR_2g094620                  810   0.0      
dbj|BAC42639.1|  unknown protein                                        806   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX78263.1|  BnaA09g34580D                                          806   0.0      
emb|CDX73448.1|  BnaC08g25550D                                          804   0.0      
ref|XP_009139208.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    803   0.0      
ref|XP_003591887.1|  hypothetical protein MTR_1g094890                  803   0.0      
ref|XP_008456490.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    800   0.0      
ref|XP_010689526.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    798   0.0      
gb|EYU39844.1|  hypothetical protein MIMGU_mgv1a003058mg                793   0.0      
gb|KHN17142.1|  hypothetical protein glysoja_011616                     790   0.0      
ref|XP_008791558.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    783   0.0      
ref|XP_010906507.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    779   0.0      
ref|XP_010906508.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    779   0.0      
gb|KDO73328.1|  hypothetical protein CISIN_1g004508mg                   773   0.0      
ref|XP_010920451.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    774   0.0      
gb|KEH39334.1|  pleckstrin-like (PH) and lipid-binding START doma...    770   0.0      
ref|XP_010689527.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    759   0.0      
emb|CAB77600.1|  putative protein                                       759   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHG25367.1|  Homeobox-leucine zipper ATHB-14 -like protein           756   0.0      
gb|KEH39335.1|  pleckstrin-like (PH) and lipid-binding START doma...    746   0.0      
ref|XP_011044395.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    740   0.0      
ref|XP_009421353.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    739   0.0      
ref|XP_007016767.1|  Pleckstrin (PH) and lipid-binding START doma...    730   0.0      
ref|XP_007016769.1|  Pleckstrin and lipid-binding START domains-c...    730   0.0      
ref|XP_008807464.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    728   0.0      
ref|XP_009621798.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    723   0.0      
gb|EMS46709.1|  hypothetical protein TRIUR3_29071                       726   0.0      
ref|XP_011041016.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    720   0.0      
gb|EYU36177.1|  hypothetical protein MIMGU_mgv1a003017mg                711   0.0      
gb|KDP44376.1|  hypothetical protein JCGZ_20056                         709   0.0      
ref|XP_006599998.1|  PREDICTED: uncharacterized protein LOC100794533    711   0.0      
ref|XP_002534384.1|  conserved hypothetical protein                     688   0.0      Ricinus communis
ref|XP_002467069.1|  hypothetical protein SORBIDRAFT_01g019140          685   0.0      Sorghum bicolor [broomcorn]
ref|XP_008385406.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    674   0.0      
gb|EMT33197.1|  hypothetical protein F775_21642                         671   0.0      
ref|XP_010264665.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    664   0.0      
gb|KHN32782.1|  hypothetical protein glysoja_024141                     632   0.0      
ref|XP_010906510.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    618   0.0      
ref|XP_010092610.1|  hypothetical protein L484_002656                   614   0.0      
ref|XP_001759959.1|  predicted protein                                  578   0.0      
ref|XP_009400820.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    573   0.0      
ref|XP_001764317.1|  predicted protein                                  564   0.0      
ref|XP_002969204.1|  hypothetical protein SELMODRAFT_146206             556   0.0      
ref|XP_001755631.1|  predicted protein                                  555   0.0      
ref|XP_002961222.1|  hypothetical protein SELMODRAFT_74418              555   0.0      
ref|XP_008362690.1|  PREDICTED: LOW QUALITY PROTEIN: protein ENHA...    506   4e-167   
gb|AAD20693.1|  unknown protein                                         498   1e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001767644.1|  predicted protein                                  507   3e-164   
ref|XP_001782866.1|  predicted protein                                  496   8e-160   
gb|KDO44676.1|  hypothetical protein CISIN_1g0045762mg                  479   5e-157   
gb|EPS61698.1|  hypothetical protein M569_13096                         473   7e-155   
gb|AAP54296.2|  pleckstriny domain-containing protein, putative, ...    469   9e-154   Oryza sativa Japonica Group [Japonica rice]
dbj|BAE98675.1|  hypothetical protein                                   457   2e-149   Arabidopsis thaliana [mouse-ear cress]
emb|CDY69875.1|  BnaAnng31850D                                          457   1e-148   
gb|EEC67181.1|  hypothetical protein OsI_34049                          442   4e-140   Oryza sativa Indica Group [Indian rice]
gb|EEE51149.1|  hypothetical protein OsJ_31910                          441   1e-139   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006415101.1|  hypothetical protein EUTSA_v10008155mg             424   7e-138   
ref|XP_009345389.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    414   7e-133   
ref|NP_001131246.1|  hypothetical protein                               393   2e-126   Zea mays [maize]
gb|KDO44678.1|  hypothetical protein CISIN_1g0045761mg                  390   2e-125   
emb|CDY64695.1|  BnaA04g27680D                                          382   1e-121   
dbj|BAD94447.1|  hypothetical protein                                   369   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007151874.1|  hypothetical protein PHAVU_004G082900g             362   7e-113   
ref|XP_004173884.1|  PREDICTED: uncharacterized LOC101207368            355   1e-110   
ref|XP_008349774.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    356   3e-109   
ref|XP_009396700.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    358   1e-107   
gb|EEE64990.1|  hypothetical protein OsJ_19910                          355   1e-106   Oryza sativa Japonica Group [Japonica rice]
emb|CDP11764.1|  unnamed protein product                                353   1e-105   
ref|XP_010677463.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    352   7e-105   
ref|NP_193639.2|  protein ENHANCED DISEASE RESISTANCE 2                 351   7e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009785636.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    351   8e-105   
ref|XP_008648200.1|  PREDICTED: uncharacterized protein LOC100384...    352   1e-104   
ref|XP_002865237.1|  hypothetical protein ARALYDRAFT_494427             351   1e-104   
ref|XP_009785635.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    350   2e-104   
gb|EEC79883.1|  hypothetical protein OsI_21390                          350   3e-104   Oryza sativa Indica Group [Indian rice]
ref|NP_001119010.1|  protein ENHANCED DISEASE RESISTANCE 2              349   6e-104   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28575.1|  hypothetical protein AALP_AA7G014500                    349   6e-104   
ref|NP_001190769.1|  protein ENHANCED DISEASE RESISTANCE 2              348   7e-104   
ref|NP_199369.2|  ENHANCED DISEASE RESISTANCE 2-like protein            348   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003557176.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    349   2e-103   
ref|XP_010441699.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    347   2e-103   
ref|XP_010494667.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    347   2e-103   
ref|XP_011074904.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    347   2e-103   
ref|XP_009114402.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    347   2e-103   
emb|CDY13045.1|  BnaA09g17720D                                          347   3e-103   
ref|NP_001170545.1|  uncharacterized protein LOC100384563               348   3e-103   Zea mays [maize]
gb|KHG05863.1|  StAR-related lipid transfer 5                           347   4e-103   
ref|XP_010481558.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    347   4e-103   
ref|XP_009630335.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    346   4e-103   
ref|XP_006398233.1|  hypothetical protein EUTSA_v10000794mg             346   5e-103   
ref|XP_008448607.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    346   6e-103   
ref|XP_006398234.1|  hypothetical protein EUTSA_v10000794mg             346   7e-103   
ref|XP_006646762.1|  PREDICTED: uncharacterized protein LOC102699927    347   7e-103   
ref|XP_009630333.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    345   9e-103   
ref|XP_010434468.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    345   1e-102   
ref|XP_008680038.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    347   1e-102   
gb|KGN55699.1|  hypothetical protein Csa_3G006610                       346   1e-102   
emb|CDX99399.1|  BnaC01g11530D                                          345   1e-102   
ref|XP_006361253.1|  PREDICTED: uncharacterized protein LOC102580683    345   1e-102   
ref|XP_006279863.1|  hypothetical protein CARUB_v10028530mg             345   1e-102   
ref|XP_010439773.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    345   1e-102   
ref|XP_010449418.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    345   2e-102   
ref|XP_004958589.1|  PREDICTED: uncharacterized protein LOC101775477    347   2e-102   
ref|NP_001045600.1|  Os02g0102800                                       347   2e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010439772.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    344   3e-102   
ref|XP_006342495.1|  PREDICTED: uncharacterized protein LOC102592298    344   3e-102   
ref|XP_004146115.1|  PREDICTED: uncharacterized protein LOC101209463    343   7e-102   
ref|XP_002867959.1|  hypothetical protein ARALYDRAFT_492951             343   7e-102   
emb|CAN74297.1|  hypothetical protein VITISV_018694                     326   7e-102   Vitis vinifera
emb|CDY23114.1|  BnaC09g18680D                                          343   1e-101   
ref|XP_004964369.1|  PREDICTED: uncharacterized protein LOC101766909    343   1e-101   
ref|XP_010529240.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    342   2e-101   
gb|AFW69707.1|  hypothetical protein ZEAMMB73_145444                    344   2e-101   
ref|XP_002304367.1|  pleckstrin homology domain-containing family...    342   2e-101   Populus trichocarpa [western balsam poplar]
ref|XP_009132490.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    342   2e-101   
ref|XP_002453121.1|  hypothetical protein SORBIDRAFT_04g000380          341   4e-101   Sorghum bicolor [broomcorn]
ref|XP_003570763.2|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    342   7e-101   
ref|XP_008645141.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    343   7e-101   
ref|XP_010518854.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    340   8e-101   
emb|CDX98603.1|  BnaA03g43880D                                          340   1e-100   
ref|XP_009776801.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    340   1e-100   
gb|EEC72292.1|  hypothetical protein OsI_05467                          341   1e-100   Oryza sativa Indica Group [Indian rice]
gb|EEE56130.1|  hypothetical protein OsJ_05003                          341   2e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010661302.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    341   2e-100   
ref|XP_002436375.1|  hypothetical protein SORBIDRAFT_10g001380          338   2e-100   Sorghum bicolor [broomcorn]
ref|XP_011092598.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    339   3e-100   
ref|XP_004253088.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    339   3e-100   
ref|XP_009601910.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    339   3e-100   
ref|XP_009136985.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    338   7e-100   
ref|XP_008238112.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    337   1e-99    
ref|XP_009136984.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    337   1e-99    
ref|XP_009365730.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    337   2e-99    
ref|XP_010054083.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    336   4e-99    
ref|XP_002467413.1|  hypothetical protein SORBIDRAFT_01g027640          336   5e-99    Sorghum bicolor [broomcorn]
ref|XP_010677461.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    337   5e-99    
ref|XP_008373446.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    335   5e-99    
ref|XP_009365728.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    335   6e-99    
ref|XP_008238111.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    336   6e-99    
gb|AFW69055.1|  hypothetical protein ZEAMMB73_502219                    330   7e-99    
ref|XP_008813630.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    335   9e-99    
ref|XP_004300154.1|  PREDICTED: uncharacterized protein LOC101306049    335   1e-98    
ref|XP_008645142.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    336   1e-98    
emb|CDY01578.1|  BnaC07g35680D                                          334   1e-98    
ref|XP_002519855.1|  lipid binding protein, putative                    334   2e-98    Ricinus communis
ref|XP_009396597.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    333   3e-98    
ref|XP_008802967.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    333   5e-98    
emb|CAH10188.1|  START domain-containing protein                        333   5e-98    Poa pratensis
ref|XP_008802966.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    333   5e-98    
ref|XP_008802965.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    333   8e-98    
gb|KDP29586.1|  hypothetical protein JCGZ_19352                         332   1e-97    
ref|XP_010661303.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    332   1e-97    
emb|CAH10187.1|  START domain-containing protein                        332   2e-97    Poa pratensis
ref|XP_010278841.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    332   2e-97    
ref|XP_010664750.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    330   5e-97    
ref|XP_010906232.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    330   5e-97    
ref|XP_004173695.1|  PREDICTED: uncharacterized protein LOC101227255    312   7e-97    
ref|XP_010906231.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    330   9e-97    
ref|XP_010439774.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    329   9e-97    
gb|AES95593.2|  pleckstrin-like (PH) and lipid-binding START doma...    330   1e-96    
gb|EPS60685.1|  hypothetical protein M569_14116                         314   1e-96    
ref|XP_004983507.1|  PREDICTED: uncharacterized protein LOC101785910    330   1e-96    
gb|EMT20912.1|  hypothetical protein F775_52417                         330   2e-96    
ref|XP_006587626.1|  PREDICTED: uncharacterized protein LOC100808...    329   2e-96    
ref|XP_007158193.1|  hypothetical protein PHAVU_002G132000g             329   2e-96    
ref|XP_008680039.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    330   2e-96    
ref|XP_007040789.1|  Enhanced disease resistance 2 isoform 1            328   3e-96    
ref|XP_011028070.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    328   3e-96    
gb|EEE51070.1|  hypothetical protein OsJ_31765                          326   4e-96    
ref|XP_010234787.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    328   6e-96    
ref|XP_004512421.1|  PREDICTED: uncharacterized protein LOC101490...    327   7e-96    
ref|XP_003517072.1|  PREDICTED: uncharacterized protein LOC100806...    327   1e-95    
ref|XP_009401233.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    327   1e-95    
ref|XP_002463332.1|  hypothetical protein SORBIDRAFT_02g041955          328   1e-95    
ref|XP_009384747.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    327   2e-95    
ref|XP_003612635.1|  Kinase-START                                       326   2e-95    
ref|XP_006587625.1|  PREDICTED: uncharacterized protein LOC100808...    325   3e-95    
dbj|BAD95241.1|  hypothetical protein                                   320   4e-95    
emb|CBI37373.3|  unnamed protein product                                324   6e-95    
gb|KHG10869.1|  Steroidogenic acute regulatory protein, mitochond...    326   8e-95    
ref|XP_009776802.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    323   1e-94    
ref|XP_006854205.1|  hypothetical protein AMTR_s00048p00211630          324   1e-94    
gb|EYU29082.1|  hypothetical protein MIMGU_mgv1a002092mg                324   1e-94    
ref|XP_004512420.1|  PREDICTED: uncharacterized protein LOC101490...    323   2e-94    
ref|XP_006573467.1|  PREDICTED: uncharacterized protein LOC100806...    323   2e-94    
ref|XP_009601911.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    322   4e-94    
gb|ACN31350.1|  unknown                                                 314   2e-93    
ref|XP_010314821.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    319   2e-93    
ref|XP_006587627.1|  PREDICTED: uncharacterized protein LOC100808...    318   1e-92    
gb|EEC67085.1|  hypothetical protein OsI_33873                          319   1e-92    
ref|XP_009384749.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    318   2e-92    
gb|ABB47745.1|  pleckstriny domain-containing protein, putative, ...    318   2e-92    
gb|KHG30650.1|  StAR-related lipid transfer 5                           317   3e-92    
ref|XP_010494670.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    315   3e-92    
ref|XP_010481559.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    315   3e-92    
ref|XP_010441700.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    315   4e-92    
ref|XP_007209042.1|  hypothetical protein PRUPE_ppa002681mg             313   2e-91    
ref|XP_010918068.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    311   1e-90    
gb|EPS70366.1|  hypothetical protein M569_04394                         311   1e-90    
gb|KCW78456.1|  hypothetical protein EUGRSUZ_D026091                    310   2e-90    
ref|XP_009384752.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    308   3e-90    
ref|XP_010054081.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    310   3e-90    
ref|XP_008777364.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    306   9e-90    
ref|XP_008777360.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    306   1e-89    
ref|XP_004973540.1|  PREDICTED: uncharacterized protein LOC101779643    311   1e-89    
ref|XP_009384751.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    308   1e-89    
ref|XP_009136986.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    306   4e-89    
ref|XP_001780427.1|  predicted protein                                  309   7e-89    
ref|XP_009384748.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    308   8e-89    
ref|XP_003574547.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    309   9e-89    
ref|XP_002444409.1|  hypothetical protein SORBIDRAFT_07g021510          307   5e-88    
ref|XP_010110435.1|  hypothetical protein L484_022841                   305   6e-88    
ref|XP_010918070.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    299   1e-87    
gb|KHG10870.1|  Steroidogenic acute regulatory protein, mitochond...    304   3e-87    
ref|XP_001784821.1|  predicted protein                                  301   2e-86    
ref|XP_007040790.1|  Enhanced disease resistance 2 isoform 2            296   2e-85    
ref|XP_002262861.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    299   3e-85    
ref|XP_010664779.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    298   4e-85    
ref|NP_001061897.1|  Os08g0439100                                       298   7e-85    
ref|XP_003549700.1|  PREDICTED: uncharacterized protein LOC100780...    296   3e-84    
ref|XP_006659442.1|  PREDICTED: uncharacterized protein LOC102718013    296   5e-84    
gb|KHN18589.1|  hypothetical protein glysoja_007002                     295   7e-84    
ref|XP_001767276.1|  predicted protein                                  295   1e-83    
ref|XP_006848773.1|  hypothetical protein AMTR_s00026p00072550          294   2e-83    
ref|XP_003542620.1|  PREDICTED: uncharacterized protein LOC100801...    294   2e-83    
gb|KHN22102.1|  hypothetical protein glysoja_033416                     294   3e-83    
ref|XP_010092609.1|  hypothetical protein L484_002655                   275   3e-83    
gb|EMT14669.1|  hypothetical protein F775_00627                         289   2e-82    
ref|XP_010918069.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    286   1e-81    
ref|XP_010687749.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    289   1e-81    
ref|XP_009771482.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    289   2e-81    
gb|KEH32165.1|  pleckstrin-like (PH) and lipid-binding START doma...    287   6e-81    
ref|XP_010687748.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    287   9e-81    
ref|XP_010664771.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    286   1e-80    
ref|XP_004488257.1|  PREDICTED: uncharacterized protein LOC101499...    285   3e-80    
ref|XP_009623347.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    285   5e-80    
ref|XP_002975423.1|  hypothetical protein SELMODRAFT_415477             284   7e-80    
gb|EEE68762.1|  hypothetical protein OsJ_27461                          285   2e-79    
emb|CDP10522.1|  unnamed protein product                                284   2e-79    
gb|EEC83635.1|  hypothetical protein OsI_29366                          284   2e-79    
ref|XP_004508389.1|  PREDICTED: uncharacterized protein LOC101503113    281   8e-79    
gb|KEH37839.1|  pleckstrin-like (PH) and lipid-binding START doma...    281   1e-78    
ref|XP_009358499.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    281   1e-78    
ref|XP_009338431.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    281   2e-78    
ref|XP_010265691.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    280   2e-78    
gb|KDP38628.1|  hypothetical protein JCGZ_03981                         281   2e-78    
ref|XP_009417437.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    279   5e-78    
ref|XP_009338430.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    279   5e-78    
ref|XP_009358498.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    279   6e-78    
ref|XP_008806307.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    278   1e-77    
ref|XP_009358500.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    278   2e-77    
ref|XP_009338432.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    278   2e-77    
ref|XP_009760467.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    277   3e-77    
ref|XP_008361102.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    277   3e-77    
ref|XP_007204631.1|  hypothetical protein PRUPE_ppa002030mg             275   1e-76    
ref|XP_010245531.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    275   1e-76    
ref|XP_008242887.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    276   1e-76    
ref|XP_008361103.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    275   1e-76    
ref|XP_002993106.1|  hypothetical protein SELMODRAFT_431226             275   1e-76    
ref|XP_010049876.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    274   4e-76    
ref|XP_010049875.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    274   5e-76    
ref|XP_010265692.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    273   9e-76    
ref|XP_010656555.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    272   3e-75    
ref|XP_004242555.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    271   8e-75    
ref|XP_002325156.2|  hypothetical protein POPTR_0018s12110g             271   1e-74    
ref|XP_008806306.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    270   1e-74    
ref|XP_002523536.1|  lipid binding protein, putative                    270   3e-74    
ref|XP_011084030.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    270   3e-74    
ref|XP_011084029.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    269   4e-74    
ref|XP_011017957.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    269   4e-74    
ref|XP_009601912.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    266   5e-74    
ref|XP_008777361.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    261   2e-73    
ref|XP_010929462.1|  PREDICTED: LOW QUALITY PROTEIN: protein ENHA...    265   6e-73    
ref|XP_010450356.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    265   9e-73    
ref|XP_006343695.1|  PREDICTED: uncharacterized protein LOC102603249    263   3e-72    
ref|XP_008348097.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    260   4e-71    
ref|XP_008456782.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    258   2e-70    
ref|XP_004139274.1|  PREDICTED: uncharacterized protein LOC101212304    257   4e-70    
ref|XP_009372765.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    257   5e-70    
ref|XP_011078691.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    256   1e-69    
emb|CBI38216.3|  unnamed protein product                                253   2e-69    
ref|XP_010245530.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    251   5e-69    
ref|XP_010245529.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    251   6e-69    
ref|NP_001119310.1|  uncharacterized protein                            254   7e-69    
ref|NP_568526.1|  uncharacterized protein                               254   9e-69    
ref|XP_001768121.1|  predicted protein                                  254   1e-68    
dbj|BAB11194.1|  unnamed protein product                                251   1e-68    
ref|XP_010533085.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    252   5e-68    
dbj|BAA98203.1|  unnamed protein product                                251   5e-68    
ref|XP_010533084.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    252   5e-68    
gb|EMS68050.1|  hypothetical protein TRIUR3_09587                       246   3e-67    
gb|EPS71915.1|  hypothetical protein M569_02843                         243   4e-67    
gb|KCW82684.1|  hypothetical protein EUGRSUZ_C040621                    244   2e-65    
gb|KHN41720.1|  hypothetical protein glysoja_003460                     239   2e-64    
ref|XP_008231688.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    241   2e-64    
ref|XP_008231686.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    241   2e-64    
ref|XP_003056584.1|  predicted protein                                  233   2e-64    
emb|CAA16761.1|  hypothetical protein                                   238   9e-64    
ref|NP_001154747.1|  uncharacterized protein                            240   9e-64    
gb|KHG05244.1|  Heat-inducible transcription repressor HrcA             219   2e-63    
ref|NP_001064871.1|  Os10g0479800                                       214   2e-61    
ref|XP_006598487.1|  PREDICTED: uncharacterized protein LOC100786048    228   1e-60    
ref|XP_008337206.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    224   2e-60    
ref|XP_008647481.1|  PREDICTED: uncharacterized protein LOC100502...    221   2e-60    
gb|EMS54329.1|  hypothetical protein TRIUR3_20085                       228   5e-60    
ref|XP_010434469.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    226   5e-60    
ref|XP_010661304.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    227   6e-60    
gb|AAM98241.1|  unknown protein                                         215   9e-60    
ref|XP_010434467.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    226   2e-59    
ref|XP_006285256.1|  hypothetical protein CARUB_v10006627mg             223   2e-58    
ref|XP_006414020.1|  hypothetical protein EUTSA_v10024539mg             222   3e-58    
gb|EYU24297.1|  hypothetical protein MIMGU_mgv1a010003mg                212   4e-58    
ref|NP_001183606.1|  uncharacterized protein LOC100502200               207   4e-58    
ref|XP_010677464.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    221   5e-58    
ref|XP_010056185.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    220   2e-57    
ref|NP_001142021.1|  uncharacterized protein LOC100274175               210   2e-57    
ref|XP_006661824.1|  PREDICTED: uncharacterized protein LOC102710...    219   6e-57    
ref|XP_009605745.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    217   7e-57    
ref|XP_006368312.1|  pleckstrin homology domain-containing family...    218   1e-56    
ref|XP_007138431.1|  hypothetical protein PHAVU_009G208400g             210   1e-56    
ref|XP_009605742.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    217   2e-56    
ref|XP_009605741.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    217   2e-56    
ref|XP_006471537.1|  PREDICTED: uncharacterized protein LOC102619961    207   2e-56    
ref|XP_009605739.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    217   2e-56    
ref|XP_007138432.1|  hypothetical protein PHAVU_009G208400g             209   3e-56    
ref|XP_009384750.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    213   2e-55    
gb|AGV54816.1|  kinase start                                            214   2e-55    
ref|XP_011018434.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    213   3e-55    
ref|XP_002960563.1|  hypothetical protein SELMODRAFT_74959              212   9e-55    
ref|XP_002969451.1|  hypothetical protein SELMODRAFT_91721              212   1e-54    
ref|XP_004307096.1|  PREDICTED: uncharacterized protein LOC101301...    210   6e-54    
ref|XP_010940820.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    210   7e-54    
ref|XP_004488258.1|  PREDICTED: uncharacterized protein LOC101499...    207   8e-54    
ref|XP_004307095.1|  PREDICTED: uncharacterized protein LOC101301...    209   8e-54    
ref|XP_002979816.1|  hypothetical protein SELMODRAFT_57295              196   1e-53    
ref|XP_006380218.1|  pleckstrin homology domain-containing family...    208   1e-53    
ref|XP_002985462.1|  hypothetical protein SELMODRAFT_47243              196   1e-53    
gb|EYU23271.1|  hypothetical protein MIMGU_mgv1a001973mg                208   2e-53    
gb|EYU31802.1|  hypothetical protein MIMGU_mgv1a023986mg                204   3e-53    
ref|XP_006471434.1|  PREDICTED: uncharacterized protein LOC102631125    192   7e-53    
ref|XP_001768988.1|  predicted protein                                  194   1e-52    
emb|CCH47229.1|  hypothetical protein                                   207   1e-52    
ref|XP_010242519.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    205   1e-52    
ref|XP_010242523.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    205   1e-52    
ref|XP_007012014.1|  Uncharacterized protein isoform 1                  206   2e-52    
ref|XP_007136927.1|  hypothetical protein PHAVU_009G085700g             194   2e-52    
ref|XP_008445284.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    195   2e-52    
emb|CDY41766.1|  BnaA08g07210D                                          205   2e-52    
emb|CDY58454.1|  BnaC08g47190D                                          205   2e-52    
ref|XP_009108058.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    205   3e-52    
ref|XP_009108057.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    205   3e-52    
ref|XP_002971596.1|  hypothetical protein SELMODRAFT_67228              192   3e-52    
ref|XP_004287222.1|  PREDICTED: uncharacterized protein LOC101292535    204   4e-52    
ref|XP_008647483.1|  PREDICTED: uncharacterized protein LOC100502...    194   7e-52    
ref|XP_001771663.1|  predicted protein                                  203   9e-52    
gb|AGV54849.1|  hypothetical protein                                    192   1e-51    
gb|KCW72795.1|  hypothetical protein EUGRSUZ_E012431                    187   2e-51    
ref|XP_008777362.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    197   2e-51    
ref|XP_010435404.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    202   2e-51    
ref|XP_007012015.1|  Uncharacterized protein isoform 2                  202   2e-51    
ref|XP_010435403.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    202   2e-51    
ref|XP_010435406.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    202   3e-51    
ref|XP_004138692.1|  PREDICTED: uncharacterized protein LOC101208308    192   3e-51    
gb|KDO59374.1|  hypothetical protein CISIN_1g0042401mg                  195   5e-51    
ref|XP_002324934.2|  hypothetical protein POPTR_0018s03050g             191   5e-51    
ref|XP_006403060.1|  hypothetical protein EUTSA_v10003438mg             198   2e-50    
ref|XP_004291985.1|  PREDICTED: uncharacterized protein LOC101306113    189   2e-50    
ref|XP_002991637.1|  hypothetical protein SELMODRAFT_448504             191   3e-50    
ref|XP_006285758.1|  hypothetical protein CARUB_v10007232mg             199   3e-50    
ref|XP_006450236.1|  hypothetical protein CICLE_v10009090mg             188   4e-50    
gb|KDP33480.1|  hypothetical protein JCGZ_07051                         189   4e-50    
ref|XP_006403059.1|  hypothetical protein EUTSA_v10003438mg             198   4e-50    
ref|XP_010049846.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    189   4e-50    
ref|XP_001783766.1|  predicted protein                                  198   4e-50    
ref|XP_006403058.1|  hypothetical protein EUTSA_v10003438mg             198   4e-50    
ref|XP_002868410.1|  hypothetical protein ARALYDRAFT_330172             198   4e-50    
ref|XP_006403057.1|  hypothetical protein EUTSA_v10003438mg             198   5e-50    



>ref|XP_009626094.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Nicotiana 
tomentosiformis]
Length=729

 Score =  1013 bits (2619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/730 (70%), Positives = 596/730 (82%), Gaps = 20/730 (3%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  ++G MEGWLYL+RLNR GLQY RKRYFILEDNCLKS+K++P + +EEP+RSAIID
Sbjct  1     MGLQETEGKMEGWLYLMRLNRFGLQYSRKRYFILEDNCLKSFKSIPTSPKEEPIRSAIID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN  533
             SCI V DNGRE+FHRKVFF FTL NTS+H+DQLK GA+SPEEAARWI CL+DAA+NPE++
Sbjct  61    SCIRVTDNGRESFHRKVFFIFTLYNTSDHNDQLKLGASSPEEAARWIHCLKDAALNPERS  120

Query  534   LRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRI  695
             L AP+ RKWQPFRLSVS RMA       T ASS  VDAMTSDV+ P PWKIFG QNGLR+
Sbjct  121   LHAPSRRKWQPFRLSVSKRMAHKSSMDSTAASSMHVDAMTSDVLAPSPWKIFGCQNGLRL  180

Query  696   FKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHL  875
             FKEAKD+ PNGKH DG PA+MAVGVI+GTSEAIF+ LM LGPSRSEWDF F RG VVEHL
Sbjct  181   FKEAKDKGPNGKHRDGSPAVMAVGVIEGTSEAIFRTLMCLGPSRSEWDFSFYRGCVVEHL  240

Query  876   DGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRA  1055
             DGHTDI+H+QL  HWLPWG KRRDLLLRRYWRREDDGTYVILYHSVIHSKCPPQ GYVRA
Sbjct  241   DGHTDIVHIQLYNHWLPWGSKRRDLLLRRYWRREDDGTYVILYHSVIHSKCPPQNGYVRA  300

Query  1056  TVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKA  1226
              +KSGGHVITP   GK S VKHML++DWK    YL+K  S S+TI +L  IAALREMF+A
Sbjct  301   CIKSGGHVITPTKHGKPSIVKHMLAIDWKFWKPYLKKGASVSITIRVLERIAALREMFRA  360

Query  1227  KSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEED--TTEKYPSACSSIVELDD  1400
             K G+YF + +   LT DI+LPVSEKEEIK EV   + I++D  T +    A S+++ LDD
Sbjct  361   KGGNYFSELSPAALTRDIELPVSEKEEIKTEV-DYKMIKDDKVTNDGKNPASSNLMGLDD  419

Query  1401  VADEFFDVPEASDDEHSDHGWPRSTTPEY--HETPRPKLSSAACFVRKLQDLAVQK----  1562
              ADEF+DVPE SDDEHSDH W  + +PE    ++   KL++A   V+KL DLAVQK    
Sbjct  420   AADEFYDVPEPSDDEHSDHAWTSNASPEVGCMDSYHTKLTTAN-IVKKLHDLAVQKKGYV  478

Query  1563  NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTL  1742
             + QE+   EE    CYG TLPKD ++NMP SWAAAD SSFLIR E YL D  K+ +K TL
Sbjct  479   DLQEM-AREESVSLCYGATLPKDQNFNMPCSWAAADPSSFLIRAESYLADQEKVKAKSTL  537

Query  1743  TQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLK  1922
              Q+V ADWL+S+ RED+LA RPG IVQ+YAAQ RPEFFF++NIQVPGAT Y+LALYYML+
Sbjct  538   MQMVAADWLRSDRREDDLAGRPGGIVQRYAAQGRPEFFFIINIQVPGATTYNLALYYMLR  597

Query  1923  TPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQ  2102
             +PL E PLLERFVNGDD+FRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE++YF+G+
Sbjct  598   SPLEETPLLERFVNGDDSFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEVHYFRGK  657

Query  2103  NYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDA  2282
             NYLEL +DVGSSTVARGV++LVLGYLNNLVIEMAFL+Q +T EELPE LLGTCRLNHLD 
Sbjct  658   NYLELGIDVGSSTVARGVVSLVLGYLNNLVIEMAFLIQGNTPEELPEFLLGTCRLNHLDV  717

Query  2283  SKAVHTNSIS  2312
             SK++ T+S+S
Sbjct  718   SKSIPTDSVS  727



>ref|XP_009791442.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Nicotiana 
sylvestris]
Length=729

 Score =  1009 bits (2609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/724 (70%), Positives = 591/724 (82%), Gaps = 20/724 (3%)
 Frame = +3

Query  192   DGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQ  371
             +G MEGWLYL+RLNR GLQY RKRYFIL+DNCLKS+K++P + +EEP+RSAIIDSCI V 
Sbjct  7     EGKMEGWLYLMRLNRFGLQYSRKRYFILQDNCLKSFKSIPTSPKEEPIRSAIIDSCIRVT  66

Query  372   DNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAI  551
             DNGRE+FHRKVFF FTL NTS+H+DQLK GA+SPEEAARWI CL+DAA+N E++L AP+ 
Sbjct  67    DNGRESFHRKVFFIFTLYNTSDHNDQLKLGASSPEEAARWIHCLKDAALNLERSLHAPSR  126

Query  552   RKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKD  713
             RKWQPFRLSVS RMA       T ASS  VDAMTSDV+ P PWKIFG QNGLR+FKE KD
Sbjct  127   RKWQPFRLSVSKRMAHKSSIDSTAASSMHVDAMTSDVLAPSPWKIFGCQNGLRLFKEGKD  186

Query  714   RNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDI  893
             + PNGKH DG PA+MAVGVI+GTSEAIF+ LM LGPSRSEWDF F RG VVEHLDGHTDI
Sbjct  187   KGPNGKHRDGSPAVMAVGVIEGTSEAIFRTLMCLGPSRSEWDFSFYRGCVVEHLDGHTDI  246

Query  894   IHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGG  1073
             +H+QL  HWLPWG KRRDLLLRRYWRREDDGTYVILYHSVIHSKCPPQ GYVRA +KSGG
Sbjct  247   VHIQLYNHWLPWGSKRRDLLLRRYWRREDDGTYVILYHSVIHSKCPPQNGYVRACIKSGG  306

Query  1074  HVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYF  1244
             HVITP   GK S VKHML++DWK    YL+K  S S+TI +L  IAALREMF+AK G+YF
Sbjct  307   HVITPTKHGKPSIVKHMLAIDWKFWKPYLKKGASVSITIRVLERIAALREMFRAKEGNYF  366

Query  1245  PDPAMNELTIDIQLPVSEKEEIKNEVVATERIEED--TTEKYPSACSSIVELDDVADEFF  1418
              + +   LT DI LPVSEKEEIK EV   + IE+D  T +    A S++  LDD ADEF+
Sbjct  367   SELSPAALTRDIDLPVSEKEEIKTEV-DYKMIEDDKVTNDGKNPASSNLTGLDDAADEFY  425

Query  1419  DVPEASDDEHSDHGWPRSTTPE--YHETPRPKLSSAACFVRKLQDLAVQK----NFQEIV  1580
             DVPE SDDEHSDH W  + +PE  + ++   KL++A   V+KL DLAVQK    + QE+ 
Sbjct  426   DVPEPSDDEHSDHAWTSNASPEVGFMDSFHTKLTTAN-IVKKLHDLAVQKKGYMDLQEM-  483

Query  1581  GGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGA  1760
               EE    CYG TLPKD S+NMP SWAAAD SSFLIR E YL D  K+ +K TL Q+V A
Sbjct  484   AREESVSLCYGATLPKDQSFNMPCSWAAADPSSFLIRAESYLADQEKVKAKSTLMQMVAA  543

Query  1761  DWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAEN  1940
             DWL+S+ RED+LA RPGSIVQ+YAAQ RPEFFF++NIQVPGAT Y+LALYYML++PL E 
Sbjct  544   DWLRSDRREDDLAGRPGSIVQRYAAQGRPEFFFIINIQVPGATTYNLALYYMLRSPLEET  603

Query  1941  PLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELD  2120
             PLLERF++GDD+FRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE++YF+G+NYLEL 
Sbjct  604   PLLERFISGDDSFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEVHYFRGRNYLELG  663

Query  2121  VDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAVHT  2300
             +DVGSSTVARGV++LVLGYLNNLVIEMAFL+Q +T EELPE LLGTCRLNHLD SK++ T
Sbjct  664   IDVGSSTVARGVVSLVLGYLNNLVIEMAFLIQGNTPEELPEFLLGTCRLNHLDVSKSIPT  723

Query  2301  NSIS  2312
             +S+S
Sbjct  724   DSVS  727



>emb|CDO99749.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   961 bits (2484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/733 (67%), Positives = 583/733 (80%), Gaps = 23/733 (3%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M  P S+  MEGWLYLIR NR GLQY RKRYFILED CLKS+K+VP + REEP+R AIID
Sbjct  1     MESPQSEERMEGWLYLIRFNRFGLQYSRKRYFILEDYCLKSFKSVPTSEREEPVRRAIID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN  533
             SCI V DNGRE+ H +VFF FTL NTSNH+DQLK GA+S EEAA WIR L+D A+NP   
Sbjct  61    SCIRVTDNGRESHHGRVFFIFTLYNTSNHNDQLKLGASSSEEAANWIRSLQDVALNPVNG  120

Query  534   LRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRI  695
             + A + RKWQPFRLSVS R A       T  +  PVDAMTSDVI P PWKIFG QNGLR+
Sbjct  121   VVASSKRKWQPFRLSVSKRTASKNFMDGTYVTHMPVDAMTSDVIAPSPWKIFGCQNGLRL  180

Query  696   FKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHL  875
             FKE+ +++P GK WD HPAIMAVGV++GTSEAIF+ +MS+GPSRSEWDFC  +G+VVEHL
Sbjct  181   FKESNNQDPGGKAWDDHPAIMAVGVVEGTSEAIFRTIMSVGPSRSEWDFCIYKGNVVEHL  240

Query  876   DGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRA  1055
             DGHTDI+H++L +HWL WG+KRRDLL+RRYWRREDDGTYVILYHSV+H KCPPQ GYVRA
Sbjct  241   DGHTDILHIKLYSHWLSWGMKRRDLLVRRYWRREDDGTYVILYHSVVHRKCPPQPGYVRA  300

Query  1056  TVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKA  1226
              +KSGG VI+P+NQGK S VKHML+VDWK    Y RK +++S+TI +LG IAALRE+F+A
Sbjct  301   CLKSGGFVISPLNQGKESVVKHMLAVDWKFWKLYRRKASARSITIRLLGRIAALRELFRA  360

Query  1227  KSGSYFPDPAMNELTIDIQLPVSEKEEIKNEV----VATERIEEDTTEKYPSACSSIVEL  1394
             K+G +  + ++ E T DI LP +E EEIK EV    +  ++IE +  E   S  SS+VEL
Sbjct  361   KAGKFSYEFSLGESTRDIGLPQNEFEEIKKEVDLKMIQEDKIENEV-ENPRSGSSSLVEL  419

Query  1395  DDVADEFFDVPEASDDEHSDHGWPRSTTPEY---HETPRPKLSSAACFVRKLQDLAVQK-  1562
             +D ADEFFDVPE SDD+  +HGW  +T+P+     ET  PKLSSAA FV+   DLAVQK 
Sbjct  420   NDAADEFFDVPEPSDDD-LEHGWGMNTSPDLRYLQETYPPKLSSAANFVKIFHDLAVQKK  478

Query  1563  ---NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSK  1733
                +  E +  E+     YG TL KD++ +MP SWAA D SSFLIRG  YL+DH KI +K
Sbjct  479   GYMDLHETIW-EDNISCHYGATLAKDSNCSMPCSWAAGDPSSFLIRGSTYLEDHQKIKAK  537

Query  1734  GTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYY  1913
              TL Q+V ADW++S+ RED+L  RPG IVQKYAAQ  PEFFF++NIQVPG T+YSLALYY
Sbjct  538   STLMQMVAADWIRSDKREDDLGGRPGGIVQKYAAQGGPEFFFIINIQVPGTTQYSLALYY  597

Query  1914  MLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYF  2093
             ML +PL E PLLERFVNGDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE++YF
Sbjct  598   MLTSPLEEAPLLERFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEVHYF  657

Query  2094  KGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNH  2273
             +G+NYLEL +DVGSSTVARGV++LVLGYLNNLVIEMAFL+QADTEEELPE LLGTCRLNH
Sbjct  658   RGKNYLELGIDVGSSTVARGVVSLVLGYLNNLVIEMAFLIQADTEEELPEFLLGTCRLNH  717

Query  2274  LDASKAVHTNSIS  2312
             LDASK+V T+SI+
Sbjct  718   LDASKSVSTDSIT  730



>ref|XP_011076970.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Sesamum indicum]
Length=728

 Score =   956 bits (2472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/728 (66%), Positives = 579/728 (80%), Gaps = 19/728 (3%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M M  S+G MEGWLYLIR +R GLQ+ RKRYF+LEDNCL+S+K++P +  EEPLRSAIID
Sbjct  1     MGMAESEGKMEGWLYLIRFDRFGLQFSRKRYFVLEDNCLRSFKSIPTSETEEPLRSAIID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN  533
             SCI V DNGR N H+++FF FTL NTSNH+D LK  A S EEAA+WI  L+ AA +P  N
Sbjct  61    SCIRVVDNGRGNHHKRLFFVFTLYNTSNHNDTLKLAATSSEEAAKWIHSLQ-AAADPGNN  119

Query  534   LRAPAIRKWQPFRLSVSSRMAR-----TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIF  698
             L + + RK+QPF L+VS R A+     +  SS  VDAMTSDVI   PWKIFG Q+GLR+F
Sbjct  120   LMSCSRRKYQPFSLTVSRREAKACIDWSSLSSWHVDAMTSDVIAASPWKIFGSQHGLRLF  179

Query  699   KEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLD  878
             KEAKD +PNGKHWD HPAIMA+G IDGTSEA+F  LMSLG SR+EWDFCF +G+VVEHLD
Sbjct  180   KEAKDEDPNGKHWDDHPAIMAIGAIDGTSEAVFHTLMSLGTSRTEWDFCFYKGTVVEHLD  239

Query  879   GHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRAT  1058
             GHTDIIH+QL  HWLPW  KRRD LLRRYWRREDDGTYVILYHSV+H KCPPQ GYVRA 
Sbjct  240   GHTDIIHVQLYNHWLPWATKRRDFLLRRYWRREDDGTYVILYHSVVHKKCPPQSGYVRAC  299

Query  1059  VKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAK  1229
             +KSGG+VITP+ QG+   +KHML+VDWK   SYLRK +++S+TI MLG +AAL EMF+AK
Sbjct  300   LKSGGYVITPIKQGRECVIKHMLAVDWKFWRSYLRKASARSITIQMLGRVAALSEMFRAK  359

Query  1230  SGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYP---SACSSIVELDD  1400
             +G+        +L +DI +P SEKEEIK EV +  RI++ T+ + P   S  SS+V L+D
Sbjct  360   AGNLSHGFLSGDLPMDIGIPESEKEEIKTEV-SLNRIQKKTSNETPRQRSGASSLVGLND  418

Query  1401  VADEFFDVPEASDDEHSDHGWPRSTTPE--YHETPRPKLSSAACFVRKLQDLAVQKNFQE  1574
              ADEFFDVPE +DD+  ++GW  +T PE  Y +  +PKLSSAA  V+KLQ LAVQK    
Sbjct  419   -ADEFFDVPEPADDDLLENGWSLNTVPESCYVDKYQPKLSSAASLVKKLQGLAVQKKGYV  477

Query  1575  IVGG---EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLT  1745
              + G   EE    CYG TLPKD ++N P SW+A+D SSFLIRG  YL+DH KIT+KGTL 
Sbjct  478   DLQGISWEESVLSCYGSTLPKDTTFNTPCSWSASDPSSFLIRGANYLEDHQKITAKGTLM  537

Query  1746  QIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKT  1925
             Q+V ADWL+S+ RED+LA R GSIVQKYAA+  PEFFF++NIQVPG+  Y+LALYYMLKT
Sbjct  538   QMVAADWLRSDKREDDLAGRSGSIVQKYAARGGPEFFFIINIQVPGSITYNLALYYMLKT  597

Query  1926  PLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQN  2105
             PL E PLLERFVNGD+AFRNS+FKLIPYISKGSWIVKQSVG+K+CL+GQ+LE+NYF+G N
Sbjct  598   PLHETPLLERFVNGDNAFRNSRFKLIPYISKGSWIVKQSVGRKACLVGQALEINYFRGTN  657

Query  2106  YLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDAS  2285
             YLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFL+Q +T EELPE LLGTCRLNHLDA+
Sbjct  658   YLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQGNTPEELPEFLLGTCRLNHLDAA  717

Query  2286  KAVHTNSI  2309
             KAV T+S+
Sbjct  718   KAVSTDSV  725



>ref|XP_006354684.1| PREDICTED: uncharacterized protein LOC102602856 [Solanum tuberosum]
Length=721

 Score =   956 bits (2472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/723 (67%), Positives = 566/723 (78%), Gaps = 25/723 (3%)
 Frame = +3

Query  195   GNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQD  374
             G MEGWL L+RLNR GLQY RKRYFILEDNCLKS+K +P +  EEP+RSAIIDSCI V D
Sbjct  5     GKMEGWLCLMRLNRFGLQYSRKRYFILEDNCLKSFKFIPTSPTEEPVRSAIIDSCIRVTD  64

Query  375   NGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIR  554
             NGRE FHRKV F FTL NTS+H+DQLK GA SPEEAA WI CL+DAA+N E++L AP+ R
Sbjct  65    NGRETFHRKVLFIFTLYNTSDHNDQLKLGATSPEEAANWIHCLKDAALNTERSLNAPSRR  124

Query  555   KWQPFRLSVS------SRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDR  716
             KWQPFRLSVS      S M    AS   VDAMT DVI P PWKIFG QNGLR+FKEAKD+
Sbjct  125   KWQPFRLSVSKSIAHKSSMDMAAASFMHVDAMTFDVIAPSPWKIFGCQNGLRLFKEAKDK  184

Query  717   NPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDII  896
               NGK  DG PAIMAVGVI+GTSEAIF+ LM LGPSR EWDF F RG VVEHLDGHTDI+
Sbjct  185   GSNGKQRDGSPAIMAVGVIEGTSEAIFRTLMCLGPSRIEWDFSFYRGCVVEHLDGHTDIV  244

Query  897   HMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGH  1076
             H+QL  HWLPWG KRRDLLLRRYWRRE+DGTYVILYHSVIHSKCPPQ GYVRA +KSGGH
Sbjct  245   HIQLYNHWLPWGTKRRDLLLRRYWRREEDGTYVILYHSVIHSKCPPQNGYVRACIKSGGH  304

Query  1077  VITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFP  1247
             VITP    K S +KHM+++DWK    Y++K  + S+TI  L  IAALREMFKAK G+YF 
Sbjct  305   VITPTKHDKPSIIKHMIAIDWKLWKPYMKKGATVSMTIRFLERIAALREMFKAKEGNYFS  364

Query  1248  DPAMNELTIDIQLPVSEKEEIKNEV----VATERIEEDTTEKYPSACSSIVELDDVADEF  1415
             + +   LT DI LPVSEKEEIK EV    +  ER++ +   K P + S++  LDD ADEF
Sbjct  365   ELSPTVLTRDIDLPVSEKEEIKTEVDYKMITDERVKNEA--KNPVS-SNLTRLDDAADEF  421

Query  1416  FDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK----NFQEIVG  1583
             +DVPE SD+EH  H W  + +PE  E+   KL++A   V+KL DL VQK    + QE+  
Sbjct  422   YDVPEPSDNEH--HAWASNASPE--ESYHTKLTTAN-IVKKLHDLTVQKRGYMDLQEMAW  476

Query  1584  GEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGAD  1763
              +E    CYG TL KD S+ MP SWAAAD SSFLIR + YL D  K+ +K TL Q+V AD
Sbjct  477   DQECVSFCYGATLQKDQSFGMPCSWAAADPSSFLIRADSYLADQEKVKAKSTLMQMVAAD  536

Query  1764  WLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENP  1943
             WL+S  RED+LA+RPG I Q+YA+Q RPEFFF++NIQVPGAT Y+LALYYML +PL E P
Sbjct  537   WLRSNRREDDLASRPGGIAQRYASQGRPEFFFIINIQVPGATTYNLALYYMLTSPLEETP  596

Query  1944  LLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDV  2123
             LLERFVN DD+FRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE++YF+G+NYLEL +
Sbjct  597   LLERFVNEDDSFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEVHYFRGRNYLELGI  656

Query  2124  DVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             DVGSSTVARGV+NLVLGYLNNLVIEMAFL+Q +T EELPE LLGTCRLNHLD SK++ T+
Sbjct  657   DVGSSTVARGVVNLVLGYLNNLVIEMAFLIQGNTPEELPEFLLGTCRLNHLDVSKSIQTD  716

Query  2304  SIS  2312
             S+S
Sbjct  717   SVS  719



>ref|XP_011084323.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Sesamum indicum]
Length=725

 Score =   945 bits (2442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/721 (65%), Positives = 566/721 (79%), Gaps = 18/721 (2%)
 Frame = +3

Query  192   DGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQ  371
             +  M GWLYL+R NR GLQY RKRYF LEDNCLKS+K++P +  EEP+RSAIIDSCI V 
Sbjct  5     ESKMTGWLYLMRHNRFGLQYSRKRYFTLEDNCLKSFKSIPASETEEPVRSAIIDSCIRVV  64

Query  372   DNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAI  551
             DNGRE  HRK+FFTFTL NTSNH+D+LK G  S EEAARWI  L+D A+NP K+  + ++
Sbjct  65    DNGRETHHRKLFFTFTLYNTSNHNDRLKLGVTSSEEAARWIHALQDTALNPGKDFMSDSV  124

Query  552   RKWQPFRLSVSSRMAR-------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAK  710
             RKWQPF +SV  R +        T ASS  V+AMTSDVI P PWKIFG ++GLR+FKEAK
Sbjct  125   RKWQPFSMSVKRRSSNKRSDVNLTAASSLHVNAMTSDVIAPSPWKIFGCKDGLRLFKEAK  184

Query  711   DRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
             DR+ NG+HWD HPAIMAVG ID +SEA+F+ LMSLG SR+EWDFCF RGSVVE+LDGHTD
Sbjct  185   DRDSNGRHWDDHPAIMAVGTIDASSEAVFRTLMSLGTSRTEWDFCFYRGSVVENLDGHTD  244

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             IIH+QL  HWLPW +KRRDLLLRRYWRRE+DGTYVILYHSV+H KCPPQ+GY+RA +KSG
Sbjct  245   IIHIQLYNHWLPWAMKRRDLLLRRYWRREEDGTYVILYHSVVHRKCPPQDGYIRACLKSG  304

Query  1071  GHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSY  1241
             G++ITP+ QGK   +KHML+VDWK   SYL+K +++S+TI MLG +AALRE+FKA +G+ 
Sbjct  305   GYLITPMQQGKECVIKHMLAVDWKVWRSYLKKESARSITIRMLGKVAALRELFKANAGNT  364

Query  1242  FPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFD  1421
              P+    E  ID+       E  K E+       ED   +  +  SS+  L D ADEFFD
Sbjct  365   SPEYITGERKIDM---ARNHESGKQEINRIHNEPEDEVMRLQTVSSSLTALSDAADEFFD  421

Query  1422  VPEASDDEHSDHGWPRSTTPE--YHETPRPKLSSAACFVRKLQDLAV-QKNFQEI--VGG  1586
             VPE SDDE  ++GW    +PE  Y +  +PKLSSAA FV+KL DLAV +K + ++  +  
Sbjct  422   VPEPSDDEALENGWTSEMSPEISYLDNYQPKLSSAANFVKKLHDLAVPKKGYTDLQDISR  481

Query  1587  EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADW  1766
             EE    CYGCTLPKD+S+NMP SWA AD SSFLIRG  YL D+ K+ +KGTL Q+VGADW
Sbjct  482   EEAVSPCYGCTLPKDSSFNMPCSWATADPSSFLIRGPNYLVDNQKVKAKGTLLQMVGADW  541

Query  1767  LQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPL  1946
             L+SE RED++A R GSIVQKYAA    EFFFV+NIQVPG + Y LALYYMLK+PL E PL
Sbjct  542   LRSEKREDDIAGRYGSIVQKYAACGGSEFFFVINIQVPGTSTYHLALYYMLKSPLEETPL  601

Query  1947  LERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVD  2126
             LERFVNGDDAFRNS+FKLIPYISKGSWIVKQSVGKKSCLIGQ+LE+NYF+G+NYLELD+D
Sbjct  602   LERFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKKSCLIGQALEVNYFRGKNYLELDID  661

Query  2127  VGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAVHTNS  2306
             VGSSTVARGV++LVLGYLNNLVIEMAF++Q +T +ELPE LLGTCRLN+LD  K+V T+S
Sbjct  662   VGSSTVARGVVSLVLGYLNNLVIEMAFMIQGNTADELPEFLLGTCRLNNLDVLKSVCTDS  721

Query  2307  I  2309
             +
Sbjct  722   M  722



>ref|XP_011076971.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Sesamum indicum]
Length=711

 Score =   932 bits (2408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/728 (65%), Positives = 568/728 (78%), Gaps = 36/728 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M M  S+G MEGWLYLIR +R GLQ+ RKRYF+LEDNCL+S+K++P +  EEPLRSAIID
Sbjct  1     MGMAESEGKMEGWLYLIRFDRFGLQFSRKRYFVLEDNCLRSFKSIPTSETEEPLRSAIID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN  533
             SCI V DNGR N H+++FF FTL NTSNH+D LK                  AA +P  N
Sbjct  61    SCIRVVDNGRGNHHKRLFFVFTLYNTSNHNDTLK------------------AAADPGNN  102

Query  534   LRAPAIRKWQPFRLSVSSRMAR-----TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIF  698
             L + + RK+QPF L+VS R A+     +  SS  VDAMTSDVI   PWKIFG Q+GLR+F
Sbjct  103   LMSCSRRKYQPFSLTVSRREAKACIDWSSLSSWHVDAMTSDVIAASPWKIFGSQHGLRLF  162

Query  699   KEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLD  878
             KEAKD +PNGKHWD HPAIMA+G IDGTSEA+F  LMSLG SR+EWDFCF +G+VVEHLD
Sbjct  163   KEAKDEDPNGKHWDDHPAIMAIGAIDGTSEAVFHTLMSLGTSRTEWDFCFYKGTVVEHLD  222

Query  879   GHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRAT  1058
             GHTDIIH+QL  HWLPW  KRRD LLRRYWRREDDGTYVILYHSV+H KCPPQ GYVRA 
Sbjct  223   GHTDIIHVQLYNHWLPWATKRRDFLLRRYWRREDDGTYVILYHSVVHKKCPPQSGYVRAC  282

Query  1059  VKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAK  1229
             +KSGG+VITP+ QG+   +KHML+VDWK   SYLRK +++S+TI MLG +AAL EMF+AK
Sbjct  283   LKSGGYVITPIKQGRECVIKHMLAVDWKFWRSYLRKASARSITIQMLGRVAALSEMFRAK  342

Query  1230  SGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYP---SACSSIVELDD  1400
             +G+        +L +DI +P SEKEEIK EV +  RI++ T+ + P   S  SS+V L+D
Sbjct  343   AGNLSHGFLSGDLPMDIGIPESEKEEIKTEV-SLNRIQKKTSNETPRQRSGASSLVGLND  401

Query  1401  VADEFFDVPEASDDEHSDHGWPRSTTPE--YHETPRPKLSSAACFVRKLQDLAVQKNFQE  1574
              ADEFFDVPE +DD+  ++GW  +T PE  Y +  +PKLSSAA  V+KLQ LAVQK    
Sbjct  402   -ADEFFDVPEPADDDLLENGWSLNTVPESCYVDKYQPKLSSAASLVKKLQGLAVQKKGYV  460

Query  1575  IVGG---EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLT  1745
              + G   EE    CYG TLPKD ++N P SW+A+D SSFLIRG  YL+DH KIT+KGTL 
Sbjct  461   DLQGISWEESVLSCYGSTLPKDTTFNTPCSWSASDPSSFLIRGANYLEDHQKITAKGTLM  520

Query  1746  QIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKT  1925
             Q+V ADWL+S+ RED+LA R GSIVQKYAA+  PEFFF++NIQVPG+  Y+LALYYMLKT
Sbjct  521   QMVAADWLRSDKREDDLAGRSGSIVQKYAARGGPEFFFIINIQVPGSITYNLALYYMLKT  580

Query  1926  PLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQN  2105
             PL E PLLERFVNGD+AFRNS+FKLIPYISKGSWIVKQSVG+K+CL+GQ+LE+NYF+G N
Sbjct  581   PLHETPLLERFVNGDNAFRNSRFKLIPYISKGSWIVKQSVGRKACLVGQALEINYFRGTN  640

Query  2106  YLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDAS  2285
             YLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFL+Q +T EELPE LLGTCRLNHLDA+
Sbjct  641   YLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQGNTPEELPEFLLGTCRLNHLDAA  700

Query  2286  KAVHTNSI  2309
             KAV T+S+
Sbjct  701   KAVSTDSV  708



>ref|XP_010651179.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Vitis 
vinifera]
 emb|CBI16325.3| unnamed protein product [Vitis vinifera]
Length=734

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/732 (64%), Positives = 579/732 (79%), Gaps = 27/732 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWL+LIR NR GLQY RKRYF+LED+ LKS+K+VPI+  E P+RSAIID
Sbjct  1     MGVSQNDGRMEGWLFLIRSNRFGLQYSRKRYFVLEDHYLKSFKSVPISKDEVPVRSAIID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN  533
             SCI   DNGRE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAARW++  ++AA+    N
Sbjct  61    SCIRATDNGRESIHRKVFFIFTLYNTSNHNDQLKLGASSPEEAARWMQSFQEAALKAGPN  120

Query  534   LRAPAI----RKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQN  683
              R   +     KW  FRL  S+R+ RT++      SST +D MTSDVI P PW IFG QN
Sbjct  121   TRGGGVGCSKSKWPSFRLICSNRIHRTNSIDWTLCSSTHMDPMTSDVIAPSPWTIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEAKDR  +GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +G+V
Sbjct  181   GLRLFKEAKDRGSHGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNV  239

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDI+H QL   WLPWG+KRRDLLLRRYWRREDDGTYVILYHSVIH KCPPQ G
Sbjct  240   VEHLDGHTDIVHKQLYRDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVIHKKCPPQRG  299

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG+V++PVNQGK S VKHML++DWK   SYL+ ++++S+TI MLG +AALRE
Sbjct  300   YVRACLKSGGYVVSPVNQGKQSVVKHMLAIDWKFWRSYLQTSSARSITIRMLGRVAALRE  359

Query  1215  MFKAKSGSY-FPDPAMNELTIDIQLPVSEKE-EIKNEVVATERIEEDT----TEKYPSAC  1376
             +F+AK G+Y   D +  ELT +++LP SE++ + + + +A E+ EED      +K PS  
Sbjct  360   LFRAKLGNYPSSDFSSGELTSNVRLPQSEQDVKTEAQTLAEEKTEEDIEDREVDKTPSEH  419

Query  1377  SSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDL  1550
             +S+V L+D ADEFFDVPE SD + +++GWP     E +  +   PKLS+AA FV+KL DL
Sbjct  420   ASLVGLNDAADEFFDVPEPSDSDLAENGWPSDFGSEMYSQDIRHPKLSTAAGFVKKLHDL  479

Query  1551  AVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHS  1718
             A+QK    + QE V  E+    CYG TLPKD + N+  SW  AD S+FLIRG+ YL+DH 
Sbjct  480   AIQKRGYMDLQE-VAREDRIPCCYGATLPKDPTCNLACSWTEADPSTFLIRGKNYLEDHQ  538

Query  1719  KITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYS  1898
             K+ +KGTL ++V ADWL+S+ RED+L  RP SIVQKYAAQ  PEFFF+VNIQVPG+T YS
Sbjct  539   KVKAKGTLMKMVAADWLRSDKREDDLGGRPESIVQKYAAQGGPEFFFIVNIQVPGSTTYS  598

Query  1899  LALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSL  2078
             LALYYM+ TP+ ++PLLE F+ GDDA+RNS+FKLIPYIS+GSWIVKQSVGKK+CL+GQ+L
Sbjct  599   LALYYMMNTPVEDSPLLESFIKGDDAYRNSRFKLIPYISQGSWIVKQSVGKKACLVGQAL  658

Query  2079  EMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGT  2258
             E+NYF G+NYLEL +D+GSSTVARGV++LVLGYLNNLVIEM FL+QA+T EELPE+LLGT
Sbjct  659   EINYFHGKNYLELGIDIGSSTVARGVVSLVLGYLNNLVIEMTFLIQANTPEELPEYLLGT  718

Query  2259  CRLNHLDASKAV  2294
             CRLNHLDASK+V
Sbjct  719   CRLNHLDASKSV  730



>gb|KDP44038.1| hypothetical protein JCGZ_05505 [Jatropha curcas]
Length=714

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/718 (66%), Positives = 567/718 (79%), Gaps = 20/718 (3%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR+GLQY RKRYF+LED+ LKS+K+ P +  E+P+RSAI+DSCI V DNG
Sbjct  1     MEGWLYLIRSNRIGLQYSRKRYFVLEDHVLKSFKSAPASKDEDPVRSAIVDSCIRVTDNG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW  560
             RE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAARWI  +++AA+   +N+   +   W
Sbjct  61    RESIHRKVFFIFTLYNTSNHNDQLKLGASSPEEAARWIHSIQEAALKGGQNVVGCSKSSW  120

Query  561   QPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNP  722
             Q F+LS SSR++       T  S T  D++T DVI P  W IFG QNGLR+FKEAKDR+ 
Sbjct  121   QSFKLSGSSRVSHNKPIDWTLCSLTHSDSVT-DVIAPSTWTIFGCQNGLRLFKEAKDRDS  179

Query  723   NGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHM  902
             +GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +GSVVEHLDGHTDIIH 
Sbjct  180   HGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIIHK  238

Query  903   QLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVI  1082
              L   WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCPPQ+GYVR+ +KSGG+VI
Sbjct  239   MLYNDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRSCLKSGGYVI  298

Query  1083  TPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSY-FPD  1250
             +PVNQGK S VKHML++DWK   SYLR ++++S+TI MLG +AALRE+F+AK G+    D
Sbjct  299   SPVNQGKRSVVKHMLAIDWKFWKSYLRTSSARSITIRMLGRVAALRELFRAKLGNCPSSD  358

Query  1251  PAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPE  1430
              +  ELT +++L + E E+   E    +  + +  EK PS  +S+V LDD ADEFFDVPE
Sbjct  359   FSSGELTRNVKLHLGE-EDTMVEDGKIKGYQSEEVEKTPSEHASLVGLDDAADEFFDVPE  417

Query  1431  ASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK----NFQEIVGGEE  1592
              +D E S++GW      E +  E  +P+LS+AA FV+KL DLAVQK    + QE+   E+
Sbjct  418   PTDHELSENGWSYDFGHETYTQEIRQPRLSTAAGFVKKLHDLAVQKRGYVDLQEM-ARED  476

Query  1593  GAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQ  1772
                 CYG TLPKD +  MP SW AAD SSFLIRG+ YL+D  K+ +KGTL Q+V ADWL+
Sbjct  477   SISCCYGTTLPKDPACTMPSSWTAADPSSFLIRGKNYLEDQKKVKAKGTLMQMVAADWLR  536

Query  1773  SEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLE  1952
             S+ RED+LA RPGSIVQKYAAQ  PEFFF++NIQVPG+T YSLALYYM+  PL + PLLE
Sbjct  537   SDKREDDLAGRPGSIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYMMTIPLEKAPLLE  596

Query  1953  RFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVG  2132
             RFV GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+G NYLEL VD+G
Sbjct  597   RFVKGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGNNYLELGVDIG  656

Query  2133  SSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAVHTNS  2306
             SSTVARGV++LVLGYL+NLVIEMAFLVQ +T EELPE+LLGTCRLNHLDASKAV  NS
Sbjct  657   SSTVARGVVSLVLGYLSNLVIEMAFLVQGNTSEELPEYLLGTCRLNHLDASKAVLLNS  714



>ref|XP_010264664.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Nelumbo nucifera]
Length=738

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/738 (63%), Positives = 570/738 (77%), Gaps = 29/738 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +   DG MEGWLYLIR NR+GLQY RKRYFIL+D+CL S+K+ PI+ +E+P+RSAIID
Sbjct  1     MGISQKDGTMEGWLYLIRSNRIGLQYSRKRYFILQDHCLTSFKSTPISRKEDPVRSAIID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPE--  527
             SCI V DNGRE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAARWI   ++AA+     
Sbjct  61    SCIRVTDNGRESIHRKVFFIFTLYNTSNHNDQLKLGASSPEEAARWISSFQEAALKERPD  120

Query  528   --KNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQN  683
               +N+ A    KWQ FRL+ S R         T  SS  +D MTSDV  P PW IFG QN
Sbjct  121   QGENVVAFPKSKWQSFRLTRSKRTGHMSSIDWTLCSSMQMDRMTSDVDAPSPWTIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEAKD + + K+ D HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFC  RGSV
Sbjct  181   GLRLFKEAKDCDFHRKYRDDHPAIMAVGVVDGTSEAIFRTLMSLGPSRSEWDFCIYRGSV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDIIH QL  +WLPWG+++RDLLL+RYWRREDDGTYVILYHSV   KC PQ+G
Sbjct  241   VEHLDGHTDIIHKQLNDNWLPWGMRKRDLLLKRYWRREDDGTYVILYHSVFQKKCQPQKG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDW---KSYLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG+VI+PVNQGK S VKHML++DW   K Y+R ++++S+TI MLG IAALRE
Sbjct  301   YVRACLKSGGYVISPVNQGKQSVVKHMLAIDWRFWKCYIRTSSARSITIRMLGRIAALRE  360

Query  1215  MFKAKSGSYFP-DPAMNELTIDIQLPVSEKEEIKNEV------VATERIE--EDTTEKYP  1367
              FKAK G+Y   + +  ELT  I LP +E E++K EV      + T+ ++  ++  EK  
Sbjct  361   FFKAKVGNYPSFEFSSGELTQCIGLPQNEIEDLKVEVQTPSENIMTKEVDLMKEEVEKQS  420

Query  1368  SACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKL  1541
             S  +S++ L+DVADEFFDVPE SD + S++GW  + +PE H  +   PKLS+A  FV+KL
Sbjct  421   SKSASLLVLNDVADEFFDVPEPSDFDPSENGWSSNMSPEIHPQDLRHPKLSTATGFVKKL  480

Query  1542  QDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQ  1709
              DLAVQK    + QE+   E+    CYG TLPKD+  N+  SW  AD S+FLIRG+ YL 
Sbjct  481   HDLAVQKRGYMDLQEM-AREDSISCCYGATLPKDSCCNLACSWTTADPSTFLIRGDNYLI  539

Query  1710  DHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGAT  1889
             DH K+ +KGTL Q+VGADWL+S+ RED+L  RPG IVQ+ A +  PEFFF+VNIQVPG+T
Sbjct  540   DHQKMKAKGTLMQMVGADWLKSDKREDDLGGRPGGIVQQSATKGGPEFFFIVNIQVPGST  599

Query  1890  RYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIG  2069
             +YSL LYYM+ TPL + PLLE FVNGDD +RNS+FK+IPYISKGSWIVKQSVGKK+CL+G
Sbjct  600   KYSLVLYYMMSTPLEDTPLLESFVNGDDTYRNSRFKIIPYISKGSWIVKQSVGKKACLVG  659

Query  2070  QSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHL  2249
             Q+L++NYF G+NYLEL +D+GSS+VARGV++LVLGYLNNLVIEMAFL+QA+T+EELPE L
Sbjct  660   QALKINYFHGKNYLELGIDIGSSSVARGVVSLVLGYLNNLVIEMAFLIQANTQEELPEFL  719

Query  2250  LGTCRLNHLDASKAVHTN  2303
             LGTCRLNHLDASK+V  N
Sbjct  720   LGTCRLNHLDASKSVLVN  737



>ref|XP_010067309.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Eucalyptus 
grandis]
Length=731

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/726 (64%), Positives = 552/726 (76%), Gaps = 30/726 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQY R+RYF+L++N LKS+K +PI   EEP+RSA IDSCI V DNG
Sbjct  4     MEGWLYLIRSNRFGLQYSRRRYFVLKENSLKSFKNLPIDDDEEPIRSAAIDSCIRVIDNG  63

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----NPEKNLRAPA  548
             RE+ HRKV F FTL NT+NH+DQLK GA+S E+AARWI  L+DAA     NP  N  + +
Sbjct  64    RESIHRKVVFIFTLYNTANHNDQLKLGADSSEDAARWIHSLQDAAAKENPNPATNFVSCS  123

Query  549   IRKWQPFRLSVSSRMAR-------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEA  707
              RKW  FR+   S+          T  SS   +AM SDVI P PWKIFG QNGLR+FKEA
Sbjct  124   KRKWLTFRICTPSKRTSSKHSVDWTVFSSMQTEAMKSDVIAPSPWKIFGCQNGLRLFKEA  183

Query  708   KDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHT  887
             KD +  G HWD HPAIMAVGV+DGTSEAIF+ LMSLG SRSEWDFCF RGSVVEHLDGHT
Sbjct  184   KDWDSRGGHWDDHPAIMAVGVVDGTSEAIFRCLMSLGSSRSEWDFCFYRGSVVEHLDGHT  243

Query  888   DIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKS  1067
             DIIHMQL + WLPWG++RRDLLLRRYWRREDDGTYVILYHSV H KC PQ GYVRA +KS
Sbjct  244   DIIHMQLYSDWLPWGMRRRDLLLRRYWRREDDGTYVILYHSVFHKKCRPQRGYVRACLKS  303

Query  1068  GGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS  1238
             GG+VI+P+NQGK S VKHMLS+DWK    YLR ++++S TI ML  +AALREMFK+K+G+
Sbjct  304   GGYVISPINQGKQSMVKHMLSIDWKFWKMYLRPSSARSTTIRMLERVAALREMFKSKAGN  363

Query  1239  YFPDPAMNELTIDIQLPVSEKEEIKNEVVATERI--------EEDTTEKYPSACSSIVEL  1394
             +  D +  +L  DI LP   KE++K EV   E+I         ED +E+ PS  SS++ L
Sbjct  364   FSSDYSCGDLMRDIGLPQIVKEDVKTEVEDHEKIVKIQEVKFTEDQSERPPSQSSSLMGL  423

Query  1395  DDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK--  1562
             +D  DEFFDVPE +D +  ++ W     PE H     +PKLSS A FV+KL DLAVQK  
Sbjct  424   NDADDEFFDVPEPTDYDQLEN-WSSELIPELHAPNMYQPKLSSTAIFVKKLHDLAVQKKG  482

Query  1563  --NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKG  1736
               + QE+   E+     YG TL  D S N+P SW   D S+FLIRGE YL+DH KI +KG
Sbjct  483   YMDLQEL-AREDSIACTYGSTLQCDPSCNLPCSWTTTDPSTFLIRGENYLKDHRKIKAKG  541

Query  1737  TLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYM  1916
             TL Q+VGADWL+S+ RED+LA RPG +VQ+YAA   PEFFF+VNIQVPG+T Y+LALYYM
Sbjct  542   TLMQMVGADWLRSDKREDDLAGRPGGVVQEYAALGGPEFFFIVNIQVPGSTTYNLALYYM  601

Query  1917  LKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFK  2096
             +KTPL ENPLL RFVNGDD FRNS+FKLIPYISKGSWIVKQSVGKK CL+GQ+L +NYF+
Sbjct  602   MKTPLEENPLLHRFVNGDDTFRNSRFKLIPYISKGSWIVKQSVGKKVCLVGQALAINYFR  661

Query  2097  GQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHL  2276
             G+NYLEL VDVGSSTVARGV++LVLGYLNNLVIEMAFL+Q +T +ELPE LLGTCRLNHL
Sbjct  662   GKNYLELGVDVGSSTVARGVVSLVLGYLNNLVIEMAFLIQGNTPDELPEVLLGTCRLNHL  721

Query  2277  DASKAV  2294
             D SK+V
Sbjct  722   DISKSV  727



>gb|EYU39609.1| hypothetical protein MIMGU_mgv1a002168mg [Erythranthe guttata]
Length=706

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/714 (64%), Positives = 546/714 (76%), Gaps = 23/714 (3%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M M   +G MEGWLYLI LNRLG Q  RKRYFILEDNCL S+K++P    ++P+RSAIID
Sbjct  1     MGMAEKEGKMEGWLYLIGLNRLGFQNSRKRYFILEDNCLNSFKSIPTPHTDQPIRSAIID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN  533
             SC+ V DNGR     ++FF FTLCNTSNH DQLK GA S EEA+RWIR L++ AINP K+
Sbjct  61    SCVRVVDNGRARHRMRLFFVFTLCNTSNHKDQLKLGATSSEEASRWIRSLQNTAINPRKS  120

Query  534   LRAPAIRKWQPFRLSVSSRMART--DASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEA  707
               + + RK+QPF LSV+ R ++   D SS    AMTSDVI P PWKIFG QNGLR+FKEA
Sbjct  121   FISCSERKYQPFSLSVTKRTSKNSIDLSS----AMTSDVIAPSPWKIFGCQNGLRLFKEA  176

Query  708   KDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHT  887
             KDR+ NG+HWD HPAIMAVGV++G SE +F  LM+LG SR+EWDFC  +G+VVE LDGHT
Sbjct  177   KDRDSNGRHWDNHPAIMAVGVVNGDSETVFHTLMNLGHSRTEWDFCIYKGNVVEQLDGHT  236

Query  888   DIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKS  1067
             DIIH+QL  HWLPW +KRRDLLLRRYWRREDDGTYVILYHSV H KCPPQ GYVRA +KS
Sbjct  237   DIIHLQLYNHWLPWAMKRRDLLLRRYWRREDDGTYVILYHSVFHEKCPPQNGYVRACLKS  296

Query  1068  GGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS  1238
             GG+VITP NQGK   VKHMLS+DWK   SY+RK  S+S+TI M+G +AALRE+ +AKSG+
Sbjct  297   GGYVITPTNQGKECVVKHMLSIDWKFWKSYVRKAASRSITIRMVGRVAALRELLRAKSGN  356

Query  1239  YFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFF  1418
                D    ELTIDI +P      I  EV+  E  +E+      S   S+  L D ADEFF
Sbjct  357   TSQDFLSGELTIDIGVP-----RIGKEVIKREATQENDKSGELSGTYSLAGLSDAADEFF  411

Query  1419  DVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQKNFQ---EIVGGE  1589
             DVPE SDD+      P      Y E  +PKLSSAA FV+KL DLAVQK      + +  E
Sbjct  412   DVPEPSDDD------PFDNESCYVEKYQPKLSSAANFVKKLHDLAVQKKGYVDLQAISWE  465

Query  1590  EGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWL  1769
             E     YG TL KD S+ +P SW+ ++ SSFLIRG+ YL+D  KIT+ GTL Q+VGADW+
Sbjct  466   ESISYYYGATLTKDTSFKIPCSWSISEPSSFLIRGDNYLEDRQKITANGTLMQMVGADWI  525

Query  1770  QSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLL  1949
             +S+ RED+L  R G IV+KYAA+  PEFFF++NIQVPG+T Y+LALYYMLKTPL + PLL
Sbjct  526   KSDKREDDLGGRFGGIVEKYAAKGGPEFFFIINIQVPGSTTYNLALYYMLKTPLKDTPLL  585

Query  1950  ERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDV  2129
             E FVNGD++FRNS+FKLIPYISKGSWIVKQSVG+K+CLIGQ+L++NYF+G+NYLEL +D+
Sbjct  586   EHFVNGDNSFRNSRFKLIPYISKGSWIVKQSVGRKACLIGQALQINYFRGKNYLELGIDI  645

Query  2130  GSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKA  2291
             GSSTVARGV++LVLGYLNNLVIEMAFL+Q +T EELPE LLGTCRLNHLDASKA
Sbjct  646   GSSTVARGVVSLVLGYLNNLVIEMAFLIQGNTAEELPEILLGTCRLNHLDASKA  699



>ref|XP_007016766.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
isoform 1 [Theobroma cacao]
 gb|EOY34385.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
isoform 1 [Theobroma cacao]
Length=760

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/731 (63%), Positives = 571/731 (78%), Gaps = 28/731 (4%)
 Frame = +3

Query  192   DGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQ  371
             D  MEGWLY+IR NR+GLQY RKRYF+LED+ LKS+K++PI+  +EP RSAIIDSCI V 
Sbjct  8     DLKMEGWLYIIRSNRIGLQYSRKRYFVLEDHLLKSFKSIPISNLQEPGRSAIIDSCIRVT  67

Query  372   DNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----PEKNLR  539
             DNGRE+ HRKVFF FTL N+SNH+DQLK GA+SPEEAARWI   + AA+     P  ++ 
Sbjct  68    DNGRESIHRKVFFIFTLYNSSNHNDQLKLGASSPEEAARWIHSFQQAALKGGPYPANDV-  126

Query  540   APAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
             A +  +WQ FR S SS     ++      SST +D +TSDV+ P  W IFG QNGLR+FK
Sbjct  127   ACSKSRWQSFRSSGSSHEIHNNSIDWTLYSSTKMDRVTSDVVAPSSWTIFGCQNGLRLFK  186

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             EAKDR+ +GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +GSVVEHLDG
Sbjct  187   EAKDRDSHGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDG  245

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDI+H QL + WLPWG++RRDLLLRRYWRREDDGTYVILYHSV H KCPPQ+  VRA +
Sbjct  246   HTDIVHKQLYSDWLPWGMRRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKSCVRACL  305

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+PVN+GK S VKHML++DWK   SYLR + ++S+TI ML  +AALRE+FKAK 
Sbjct  306   KSGGYVISPVNEGKHSVVKHMLAIDWKFWKSYLRTSAARSITIRMLERVAALRELFKAKQ  365

Query  1233  GSY-FPDPAMNELTIDIQLPVSEKEEIKNEVVATE--RIEE---DTTEKYPSACSSIVEL  1394
             G Y   D +  EL  +++L  SE++ + +     E  +I+E   +  E+ PS  SS+V L
Sbjct  366   GKYPSADLSSRELIRNVRLHQSEEDGMVDMCTQIEAGKIKENMCEVMERAPSEHSSLVGL  425

Query  1395  DDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK--  1562
             +D ADEFFDVPE +D + S+ GW     PE +  +T  PKLS+AA FV+KL DLAVQK  
Sbjct  426   NDAADEFFDVPEPTDYDQSEDGWASDFGPEGYSQDTRHPKLSTAAVFVKKLHDLAVQKRG  485

Query  1563  --NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKG  1736
               + Q+++  E+G    YG TLPKD +  +P SW AA+ S+FLIRGE YL+D  K  + G
Sbjct  486   YVDLQDMMR-EDGIFCSYGNTLPKDPTCTLPCSWTAAEPSTFLIRGENYLEDRKKFKATG  544

Query  1737  TLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYM  1916
             TL Q+V ADWL+S+ RED+L  RPG IVQKYAAQ  PEFFF++NIQVPG+T YSLALYYM
Sbjct  545   TLMQMVAADWLRSDKREDDLGGRPGGIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYM  604

Query  1917  LKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFK  2096
             + TP+ ++PLL+ F+NGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+
Sbjct  605   MNTPVEDSPLLQNFINGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFR  664

Query  2097  GQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHL  2276
             G+NYLEL +D+GSSTVARGV+NLVLGYLNNLVIEMAFL+QA+TEEELPE+LLGTCRLNHL
Sbjct  665   GKNYLELGIDIGSSTVARGVVNLVLGYLNNLVIEMAFLIQANTEEELPEYLLGTCRLNHL  724

Query  2277  DASKAVHTNSI  2309
             DA+K++   +I
Sbjct  725   DATKSIPVKAI  735



>ref|XP_007016768.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
isoform 3 [Theobroma cacao]
 gb|EOY34387.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
isoform 3 [Theobroma cacao]
Length=734

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/726 (63%), Positives = 569/726 (78%), Gaps = 28/726 (4%)
 Frame = +3

Query  192   DGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQ  371
             D  MEGWLY+IR NR+GLQY RKRYF+LED+ LKS+K++PI+  +EP RSAIIDSCI V 
Sbjct  8     DLKMEGWLYIIRSNRIGLQYSRKRYFVLEDHLLKSFKSIPISNLQEPGRSAIIDSCIRVT  67

Query  372   DNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----PEKNLR  539
             DNGRE+ HRKVFF FTL N+SNH+DQLK GA+SPEEAARWI   + AA+     P  ++ 
Sbjct  68    DNGRESIHRKVFFIFTLYNSSNHNDQLKLGASSPEEAARWIHSFQQAALKGGPYPANDV-  126

Query  540   APAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
             A +  +WQ FR S SS     ++      SST +D +TSDV+ P  W IFG QNGLR+FK
Sbjct  127   ACSKSRWQSFRSSGSSHEIHNNSIDWTLYSSTKMDRVTSDVVAPSSWTIFGCQNGLRLFK  186

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             EAKDR+ +GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +GSVVEHLDG
Sbjct  187   EAKDRDSHGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDG  245

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDI+H QL + WLPWG++RRDLLLRRYWRREDDGTYVILYHSV H KCPPQ+  VRA +
Sbjct  246   HTDIVHKQLYSDWLPWGMRRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKSCVRACL  305

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+PVN+GK S VKHML++DWK   SYLR + ++S+TI ML  +AALRE+FKAK 
Sbjct  306   KSGGYVISPVNEGKHSVVKHMLAIDWKFWKSYLRTSAARSITIRMLERVAALRELFKAKQ  365

Query  1233  GSY-FPDPAMNELTIDIQLPVSEKEEIKNEVVATE--RIEE---DTTEKYPSACSSIVEL  1394
             G Y   D +  EL  +++L  SE++ + +     E  +I+E   +  E+ PS  SS+V L
Sbjct  366   GKYPSADLSSRELIRNVRLHQSEEDGMVDMCTQIEAGKIKENMCEVMERAPSEHSSLVGL  425

Query  1395  DDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK--  1562
             +D ADEFFDVPE +D + S+ GW     PE +  +T  PKLS+AA FV+KL DLAVQK  
Sbjct  426   NDAADEFFDVPEPTDYDQSEDGWASDFGPEGYSQDTRHPKLSTAAVFVKKLHDLAVQKRG  485

Query  1563  --NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKG  1736
               + Q+++  E+G    YG TLPKD +  +P SW AA+ S+FLIRGE YL+D  K  + G
Sbjct  486   YVDLQDMMR-EDGIFCSYGNTLPKDPTCTLPCSWTAAEPSTFLIRGENYLEDRKKFKATG  544

Query  1737  TLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYM  1916
             TL Q+V ADWL+S+ RED+L  RPG IVQKYAAQ  PEFFF++NIQVPG+T YSLALYYM
Sbjct  545   TLMQMVAADWLRSDKREDDLGGRPGGIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYM  604

Query  1917  LKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFK  2096
             + TP+ ++PLL+ F+NGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+
Sbjct  605   MNTPVEDSPLLQNFINGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFR  664

Query  2097  GQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHL  2276
             G+NYLEL +D+GSSTVARGV+NLVLGYLNNLVIEMAFL+QA+TEEELPE+LLGTCRLNHL
Sbjct  665   GKNYLELGIDIGSSTVARGVVNLVLGYLNNLVIEMAFLIQANTEEELPEYLLGTCRLNHL  724

Query  2277  DASKAV  2294
             DA+K++
Sbjct  725   DATKSI  730



>ref|XP_010253703.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Nelumbo 
nucifera]
Length=735

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/732 (63%), Positives = 563/732 (77%), Gaps = 26/732 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +   DG MEGWLYLIR NR+GLQY RKRYFIL++NCLK++K++P +  E+PLRSAIID
Sbjct  1     MGISQKDGKMEGWLYLIRSNRIGLQYSRKRYFILQNNCLKNFKSMPTSEEEDPLRSAIID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN--PE  527
             SCI V DNGREN  RKVFF FTL NTSNH D+LK GA+SPEEAARWIR  ++AA+   P 
Sbjct  61    SCIRVTDNGRENISRKVFFIFTLYNTSNHSDRLKLGASSPEEAARWIRSFQEAALKEYPG  120

Query  528   KNLRAPAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGL  689
             +++ +    +WQ FRL+ S R++R ++      SS   D + SDV+ P  W IFG QNGL
Sbjct  121   EHVTSFPDGQWQSFRLTGSKRVSRMNSIDWTLCSSMQTDPVASDVVAPSSWTIFGCQNGL  180

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEAKD++ + K+ D HPA MAVG++DGTSEAIF+ALM LGPSRSEWDFC  +GSV+E
Sbjct  181   RLFKEAKDKDSDKKYRDEHPATMAVGIVDGTSEAIFRALMCLGPSRSEWDFCVYQGSVIE  240

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDIIH +LT  WLPWG++RRDLLLRRYWRRE+DGTYVILYHSV H KC PQ+GYV
Sbjct  241   HLDGHTDIIHKELTGDWLPWGVRRRDLLLRRYWRREEDGTYVILYHSVFHKKCLPQKGYV  300

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMF  1220
             RA +KSGG+VI+PVNQG  S VKHMLS+DWK   SY+  ++++S+TI ML  +AALRE F
Sbjct  301   RACLKSGGYVISPVNQGNQSVVKHMLSIDWKFWKSYVNTSSARSITIQMLERVAALREFF  360

Query  1221  KAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEV---VATERIEEDTT-----EKYPSAC  1376
             +AK G+   + +  ELT DI L  S KE+IK E+   + + R E D +     EK     
Sbjct  361   QAKEGNCPSEFSSGELTRDIGLSRSLKEDIKVEIQTPMKSRRGENDDSMVEKVEKQFPKP  420

Query  1377  SSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDL  1550
             +S++ELDDVADEFFDVPE S+ + SD GWP   + + H  +   PKLS+A CFV+KL DL
Sbjct  421   ASLIELDDVADEFFDVPEPSEYDLSDTGWPADESQDMHPQDLCHPKLSTATCFVKKLHDL  480

Query  1551  AVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHS  1718
             AVQK    + QE    E+    CYG TLPKD   N+  SW   D S+FLIRG+ YL D+ 
Sbjct  481   AVQKRGYIDLQETTR-EDNIPCCYGDTLPKDPCCNLACSWTTPDPSTFLIRGDNYLVDNQ  539

Query  1719  KITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYS  1898
             KI +KGTL Q+V ADWL+S+ RED+L  RPGSIVQKYA +  PEFFF+VNIQVPG T YS
Sbjct  540   KIKAKGTLMQMVAADWLRSDKREDDLGGRPGSIVQKYAQKGGPEFFFIVNIQVPGMTTYS  599

Query  1899  LALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSL  2078
             LALYYML TPL ++PLLE FV GDD +RNS+FKLIPYISKG WIVKQSVGKK+CL+GQ+L
Sbjct  600   LALYYMLSTPLEDSPLLESFVKGDDTYRNSRFKLIPYISKGPWIVKQSVGKKACLVGQAL  659

Query  2079  EMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGT  2258
             E+NYF+G NYLEL +D+GSSTVARGV+NLVLGYLNNLVIEMAFL+QA+T+EELPE LLGT
Sbjct  660   EINYFRGNNYLELGIDIGSSTVARGVVNLVLGYLNNLVIEMAFLIQANTQEELPEVLLGT  719

Query  2259  CRLNHLDASKAV  2294
             CRLNHLDASK+V
Sbjct  720   CRLNHLDASKSV  731



>ref|XP_007206425.1| hypothetical protein PRUPE_ppa001967mg [Prunus persica]
 gb|EMJ07624.1| hypothetical protein PRUPE_ppa001967mg [Prunus persica]
Length=735

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/736 (63%), Positives = 570/736 (77%), Gaps = 35/736 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M M  +D  MEGWLYL+R NR+GLQY RKRYF+LE + LKS+K+VP++  E+P+RSAIID
Sbjct  1     MDMSQTDQRMEGWLYLVRSNRIGLQYSRKRYFVLEGHLLKSFKSVPVSNNEDPVRSAIID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN  533
             SCI V DNGRE+  RKVFF FTL NTSNH+DQLK GA+SPEEAARWI   ++ A+    +
Sbjct  61    SCIRVTDNGRESIQRKVFFIFTLYNTSNHNDQLKLGASSPEEAARWIHSFQEVALKGGPD  120

Query  534   LRAPAI----RKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQN  683
             L    +      WQ FRL+ SSR +R ++      SST  DA+TSDVI P PW IFG QN
Sbjct  121   LGDNFVDCSNNIWQSFRLAGSSRRSRINSIDWSLCSSTQTDAVTSDVIAPSPWTIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEAKDR+ +GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +G+V
Sbjct  181   GLRLFKEAKDRDSHGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNV  239

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCPPQ+G
Sbjct  240   VEHLDGHTDIIHKQLYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKG  299

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG+VI+PVNQGK S VKHML++DWK   SYL+ ++++S+TI MLG +AALRE
Sbjct  300   YVRACLKSGGYVISPVNQGKQSVVKHMLAIDWKFWKSYLQTSSARSMTIKMLGRVAALRE  359

Query  1215  MFKAKSGSYFPDP-AMNELTIDIQLPVSEKEEIKN--EVVATERIEEDT---TEKYPSAC  1376
             +F+AK G+Y     +  EL  + +L  +E +   +   +   ER +E+     EK PS  
Sbjct  360   LFRAKLGNYSSSEFSSGELRRNFRLHQNEGDGEADVPTLTGNERTKENIAEEVEKSPSEH  419

Query  1377  SSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEY------HETPRPKLSSAACFVRK  1538
             +S++ L+D +DEFFDVPE    + S+  W    TP++       +T  PKLS+AA FV++
Sbjct  420   ASLISLNDASDEFFDVPEPPYSDQSETDW----TPDFGSEMYSQDTHHPKLSTAAGFVKR  475

Query  1539  LQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYL  1706
             L DLAVQK    + QE+   E+     YG TLPKD++ N+  SW A+D S+FLIRG+ YL
Sbjct  476   LHDLAVQKRGYVDLQEM-AREDNMSCYYGSTLPKDSTCNLACSWTASDPSTFLIRGKNYL  534

Query  1707  QDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGA  1886
             +D+ K+ +KGTL Q+V ADWL+S+ RED+L  RPGSIVQKYAAQ   EFFF+VNIQVPG+
Sbjct  535   EDNKKVKAKGTLMQMVAADWLRSDKREDDLGGRPGSIVQKYAAQGGREFFFIVNIQVPGS  594

Query  1887  TRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLI  2066
             T YSLALYYM+ +P+ + PLLE F+ GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLI
Sbjct  595   TTYSLALYYMMNSPVEDAPLLESFIKGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLI  654

Query  2067  GQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEH  2246
             GQ+LE+NYF G+NYLEL +D+GSSTVARGV++LVLGYLNNLVIEMAFL+QA+T EELPE+
Sbjct  655   GQALEINYFHGKNYLELGIDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQANTPEELPEY  714

Query  2247  LLGTCRLNHLDASKAV  2294
             LLGTCRLNHLDASK+V
Sbjct  715   LLGTCRLNHLDASKSV  730



>ref|XP_010043759.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Eucalyptus 
grandis]
Length=826

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/732 (63%), Positives = 559/732 (76%), Gaps = 23/732 (3%)
 Frame = +3

Query  153   DFSANIIMVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEP  332
             D S     V   SD  MEGWLYLIR NRLGLQ+ RKRYF+L+D+CLK +K+ P +  E+P
Sbjct  96    DLSEECERVFRRSD-RMEGWLYLIRSNRLGLQFSRKRYFVLDDHCLKCFKSAPPSPDEDP  154

Query  333   LRSAIIDSCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDA  512
             +RSAIID CI V DNGRE+ HRKVF+ FTL NTSNH+DQLK GA  PEEAARWI   ++A
Sbjct  155   VRSAIIDCCIRVVDNGRESIHRKVFYIFTLYNTSNHNDQLKLGAYRPEEAARWIHSFQEA  214

Query  513   AINPEKNLRAPAI----RKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPW  662
             AI    +L A A+      WQ  RL+ S+R++       T  +S   D + SDV+ P PW
Sbjct  215   AIKGSPDLGASALDCSTTSWQSLRLNGSNRVSHAIPVDWTRGTSNHTDLVASDVVAPSPW  274

Query  663   KIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDF  842
              IFG QNGLR+FKEAKDR+  GK WD HPA+MAVGV+DGTSEAIF+ LMSLGPSRSEWDF
Sbjct  275   TIFGCQNGLRLFKEAKDRDSRGK-WDDHPAVMAVGVVDGTSEAIFQTLMSLGPSRSEWDF  333

Query  843   CFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHS  1022
             CF +G+VVEHLDGHTDIIH QL + WLPWG+K RDLLLRRYWRREDDGTYVILYHSV H 
Sbjct  334   CFYKGTVVEHLDGHTDIIHKQLYSDWLPWGMKCRDLLLRRYWRREDDGTYVILYHSVFHK  393

Query  1023  KCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLG  1193
             KC PQ+G+VRA +KSGG+VITPVNQG+ S VKHML++DWK   SY+R ++ +S+TI MLG
Sbjct  394   KCLPQKGFVRACLKSGGYVITPVNQGEQSVVKHMLAIDWKYWKSYIRTSSGRSITIKMLG  453

Query  1194  GIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSA  1373
              +AALRE+F AK G++  + +  EL+ ++ L      +   +  A E +  D + K PS 
Sbjct  454   RVAALRELFLAKIGNFCSNFSSGELSRNVMLHDDRLVQSLRDGRAAEEMS-DGSAKAPSE  512

Query  1374  CSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPR-PKLSSAACFVRKLQDL  1550
              +S+V L+D ADEFFDVPE SDD+ S+  W     PE     R P+LS+AA FVRKL DL
Sbjct  513   HASLVSLNDAADEFFDVPEPSDDQ-SESSWSHDFVPEISPQGRHPRLSTAAGFVRKLHDL  571

Query  1551  AVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHS  1718
             AVQK    + QE+V  E+    CYG TLPKD +  +  SW AAD S+FLIRG+ YL+DH 
Sbjct  572   AVQKRGYVDLQEMVI-EDIVSCCYGTTLPKDPTCMLTSSWTAADPSTFLIRGKNYLKDHQ  630

Query  1719  KITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYS  1898
             K+ +KGTL Q+V ADWL+S+ RED+L  RPGSIVQKYAAQ   EFFF+VNIQVPG+T YS
Sbjct  631   KVKAKGTLMQMVAADWLRSDKREDDLGGRPGSIVQKYAAQGGAEFFFIVNIQVPGSTTYS  690

Query  1899  LALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSL  2078
             LALYYM+ TPL + PLLE FV GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+L
Sbjct  691   LALYYMMSTPLKDAPLLENFVKGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQAL  750

Query  2079  EMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGT  2258
             ++NYF G NYLEL +D+GSSTVARGV++LVLGYLNNLVIEMAFLVQA+TE+ELPE+LLGT
Sbjct  751   QINYFYGSNYLELGIDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQANTEDELPEYLLGT  810

Query  2259  CRLNHLDASKAV  2294
             CRLNHLDA+++V
Sbjct  811   CRLNHLDAARSV  822



>ref|XP_011089926.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Sesamum indicum]
Length=730

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/721 (63%), Positives = 562/721 (78%), Gaps = 24/721 (3%)
 Frame = +3

Query  195   GNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQD  374
             G MEGWLYLIR NR+GLQY RKRYF+L+D+ LKS+K+VP++  E+P+RSAIIDSCI V D
Sbjct  9     GRMEGWLYLIRSNRIGLQYSRKRYFVLQDHLLKSFKSVPLSPHEDPVRSAIIDSCIRVTD  68

Query  375   NGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLR--APA  548
             NGRE+ HRKV F FTL NTSNH+DQLK GANSPEEAA+WI+  +++A+ P +N      A
Sbjct  69    NGRESIHRKVIFIFTLYNTSNHNDQLKLGANSPEEAAKWIQSFQESALKPNQNQGDFEFA  128

Query  549   IRKWQPFRLSVSSRMAR----TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDR  716
              R+ +  RL+ SS+ +     T  SS+  DAMTSDV+ P PWKIFG +NGLR+FKEAKD+
Sbjct  129   TREPESLRLNCSSKHSHSIDWTAYSSSVSDAMTSDVVAPSPWKIFGCRNGLRLFKEAKDK  188

Query  717   NPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDII  896
               +GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +GSV+EHLDGHTDI+
Sbjct  189   EHHGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVIEHLDGHTDIV  247

Query  897   HMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGH  1076
             H  L  HWLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCPP+ GYVRA +KSGG+
Sbjct  248   HKILYRHWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHQKCPPKRGYVRACLKSGGY  307

Query  1077  VITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFP  1247
             VI+PVNQGK S VKHML++DWK   SYL+ ++++S+TI MLG +AALRE+FKAK     P
Sbjct  308   VISPVNQGKRSVVKHMLAIDWKFWRSYLQTSSARSITISMLGRLAALRELFKAKVDCSSP  367

Query  1248  DPAMNELTIDIQLPVSEKE---EIKNEVVATERIE--EDTTEKYPSACSSIVELDDVADE  1412
             D +  EL  +  +   +KE   E++  V   +  E  E+ T K PS  SS+V L D +DE
Sbjct  368   DFSSGELMSNNSIQQCKKELKVEVQTRVENGQNWEDVEEETVKTPSERSSLVGLHDASDE  427

Query  1413  FFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK----NFQE  1574
             FFDV E  D + S++GWP     E +  +  +PKLS+AA FV++L +LAVQK    +  E
Sbjct  428   FFDVSEPLDYDQSENGWPSDFGSEVYSQDARQPKLSTAAVFVKRLHELAVQKKGYVDLHE  487

Query  1575  IVGGEEGAKGC-YGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQI  1751
             +    E +  C YGCTLPKD + N+  SW   D S+FLIRG+ YL D  KI +KGTL ++
Sbjct  488   M--AREDSLSCKYGCTLPKDPTCNLLCSWTETDPSTFLIRGKTYLDDRKKIKAKGTLMEM  545

Query  1752  VGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPL  1931
             VGADWL+S+ RED+L  RPG IVQKYAA+  PEFFF+VNIQVPG+T Y+LALYYM+ TP+
Sbjct  546   VGADWLRSDKREDDLGGRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYNLALYYMMSTPI  605

Query  1932  AENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYL  2111
              + PLLE FV GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF G+NYL
Sbjct  606   EDAPLLESFVKGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFHGKNYL  665

Query  2112  ELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKA  2291
             EL +D+GSSTVARGV++LVLGYLNNLVIEMAFLVQA+T EELPE+L+GTCRLNHLD SK+
Sbjct  666   ELGIDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQANTPEELPEYLIGTCRLNHLDVSKS  725

Query  2292  V  2294
             V
Sbjct  726   V  726



>gb|KCW85749.1| hypothetical protein EUGRSUZ_B02509 [Eucalyptus grandis]
 gb|KCW85750.1| hypothetical protein EUGRSUZ_B02509 [Eucalyptus grandis]
Length=716

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/716 (64%), Positives = 554/716 (77%), Gaps = 22/716 (3%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NRLGLQ+ RKRYF+L+D+CLK +K+ P +  E+P+RSAIID CI V DNG
Sbjct  1     MEGWLYLIRSNRLGLQFSRKRYFVLDDHCLKCFKSAPPSPDEDPVRSAIIDCCIRVVDNG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAI---  551
             RE+ HRKVF+ FTL NTSNH+DQLK GA  PEEAARWI   ++AAI    +L A A+   
Sbjct  61    RESIHRKVFYIFTLYNTSNHNDQLKLGAYRPEEAARWIHSFQEAAIKGSPDLGASALDCS  120

Query  552   -RKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAK  710
                WQ  RL+ S+R++       T  +S   D + SDV+ P PW IFG QNGLR+FKEAK
Sbjct  121   TTSWQSLRLNGSNRVSHAIPVDWTRGTSNHTDLVASDVVAPSPWTIFGCQNGLRLFKEAK  180

Query  711   DRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
             DR+  GK WD HPA+MAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +G+VVEHLDGHTD
Sbjct  181   DRDSRGK-WDDHPAVMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGTVVEHLDGHTD  239

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             IIH QL + WLPWG+K RDLLLRRYWRREDDGTYVILYHSV H KC PQ+G+VRA +KSG
Sbjct  240   IIHKQLYSDWLPWGMKCRDLLLRRYWRREDDGTYVILYHSVFHKKCLPQKGFVRACLKSG  299

Query  1071  GHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSY  1241
             G+VITPVNQG+ S VKHML++DWK   SY+R ++ +S+TI MLG +AALRE+F AK G++
Sbjct  300   GYVITPVNQGEQSVVKHMLAIDWKYWKSYIRTSSGRSITIKMLGRVAALRELFLAKIGNF  359

Query  1242  FPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFD  1421
               + +  EL+ ++ L      +   +  A E +  D + K PS  +S+V L+D ADEFFD
Sbjct  360   CSNFSSGELSRNVMLHDDRLVQSLRDGRAAEEMS-DGSAKAPSEHASLVSLNDAADEFFD  418

Query  1422  VPEASDDEHSDHGWPRSTTPEYHETPR-PKLSSAACFVRKLQDLAVQK----NFQEIVGG  1586
             VPE SDD+ S+  W     PE     R P+LS+AA FVRKL DLAVQK    + QE+V  
Sbjct  419   VPEPSDDQ-SESSWSHDFVPEISPQGRHPRLSTAAGFVRKLHDLAVQKRGYVDLQEMVI-  476

Query  1587  EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADW  1766
             E+    CYG TLPKD +  +  SW AAD S+FLIRG+ YL+DH K+ +KGTL Q+V ADW
Sbjct  477   EDIVSCCYGTTLPKDPTCMLTSSWTAADPSTFLIRGKNYLKDHQKVKAKGTLMQMVAADW  536

Query  1767  LQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPL  1946
             L+S+ RED+L  RPGSIVQKYAAQ   EFFF+VNIQVPG+T YSLALYYM+ TPL + PL
Sbjct  537   LRSDKREDDLGGRPGSIVQKYAAQGGAEFFFIVNIQVPGSTTYSLALYYMMSTPLKDAPL  596

Query  1947  LERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVD  2126
             LE FV GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+L++NYF G NYLEL +D
Sbjct  597   LENFVKGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALQINYFYGSNYLELGID  656

Query  2127  VGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             +GSSTVARGV++LVLGYLNNLVIEMAFLVQA+TE+ELPE+LLGTCRLNHLDA+++V
Sbjct  657   IGSSTVARGVVSLVLGYLNNLVIEMAFLVQANTEDELPEYLLGTCRLNHLDAARSV  712



>gb|KCW65419.1| hypothetical protein EUGRSUZ_G02842 [Eucalyptus grandis]
Length=723

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/718 (65%), Positives = 545/718 (76%), Gaps = 22/718 (3%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQY R+RYF+L++N LKS+K +PI   EEP+RSA IDSCI V DNG
Sbjct  4     MEGWLYLIRSNRFGLQYSRRRYFVLKENSLKSFKNLPIDDDEEPIRSAAIDSCIRVIDNG  63

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAI--R  554
             RE+ HRKV F FTL NT+NH+DQLK GA+S E+AARWI  L+DAA      L       R
Sbjct  64    RESIHRKVVFIFTLYNTANHNDQLKLGADSSEDAARWIHSLQDAAAKLFDILLVACFCDR  123

Query  555   KWQPF-RLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGK  731
                P  R S    +  T  SS   +AM SDVI P PWKIFG QNGLR+FKEAKD +  G 
Sbjct  124   ICTPSKRTSSKHSVDWTVFSSMQTEAMKSDVIAPSPWKIFGCQNGLRLFKEAKDWDSRGG  183

Query  732   HWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLT  911
             HWD HPAIMAVGV+DGTSEAIF+ LMSLG SRSEWDFCF RGSVVEHLDGHTDIIHMQL 
Sbjct  184   HWDDHPAIMAVGVVDGTSEAIFRCLMSLGSSRSEWDFCFYRGSVVEHLDGHTDIIHMQLY  243

Query  912   THWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV  1091
             + WLPWG++RRDLLLRRYWRREDDGTYVILYHSV H KC PQ GYVRA +KSGG+VI+P+
Sbjct  244   SDWLPWGMRRRDLLLRRYWRREDDGTYVILYHSVFHKKCRPQRGYVRACLKSGGYVISPI  303

Query  1092  NQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMN  1262
             NQGK S VKHMLS+DWK    YLR ++++S TI ML  +AALREMFK+K+G++  D +  
Sbjct  304   NQGKQSMVKHMLSIDWKFWKMYLRPSSARSTTIRMLERVAALREMFKSKAGNFSSDYSCG  363

Query  1263  ELTIDIQLPVSEKEEIKNEVVATERI--------EEDTTEKYPSACSSIVELDDVADEFF  1418
             +L  DI LP   KE++K EV   E+I         ED +E+ PS  SS++ L+D  DEFF
Sbjct  364   DLMRDIGLPQIVKEDVKTEVEDHEKIVKIQEVKFTEDQSERPPSQSSSLMGLNDADDEFF  423

Query  1419  DVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK----NFQEIV  1580
             DVPE +D +  ++ W     PE H     +PKLSS A FV+KL DLAVQK    + QE+ 
Sbjct  424   DVPEPTDYDQLEN-WSSELIPELHAPNMYQPKLSSTAIFVKKLHDLAVQKKGYMDLQEL-  481

Query  1581  GGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGA  1760
               E+     YG TL  D S N+P SW   D S+FLIRGE YL+DH KI +KGTL Q+VGA
Sbjct  482   AREDSIACTYGSTLQCDPSCNLPCSWTTTDPSTFLIRGENYLKDHRKIKAKGTLMQMVGA  541

Query  1761  DWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAEN  1940
             DWL+S+ RED+LA RPG +VQ+YAA   PEFFF+VNIQVPG+T Y+LALYYM+KTPL EN
Sbjct  542   DWLRSDKREDDLAGRPGGVVQEYAALGGPEFFFIVNIQVPGSTTYNLALYYMMKTPLEEN  601

Query  1941  PLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELD  2120
             PLL RFVNGDD FRNS+FKLIPYISKGSWIVKQSVGKK CL+GQ+L +NYF+G+NYLEL 
Sbjct  602   PLLHRFVNGDDTFRNSRFKLIPYISKGSWIVKQSVGKKVCLVGQALAINYFRGKNYLELG  661

Query  2121  VDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             VDVGSSTVARGV++LVLGYLNNLVIEMAFL+Q +T +ELPE LLGTCRLNHLD SK+V
Sbjct  662   VDVGSSTVARGVVSLVLGYLNNLVIEMAFLIQGNTPDELPEVLLGTCRLNHLDISKSV  719



>ref|XP_006340183.1| PREDICTED: uncharacterized protein LOC102585665 [Solanum tuberosum]
Length=732

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/725 (63%), Positives = 553/725 (76%), Gaps = 32/725 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQY RKRYFIL+D  LKSYK+VP+   E+P+RSA++DSCI V DNG
Sbjct  13    MEGWLYLIRSNRFGLQYSRKRYFILQDQYLKSYKSVPVPENEDPIRSAVVDSCIRVTDNG  72

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAI---  551
             RE+  RKVFF FTL NTSNH+DQLK GA+SPEEAARWI+ +++AA+  + N R   +   
Sbjct  73    RESIQRKVFFIFTLYNTSNHNDQLKLGASSPEEAARWIQAVQEAALKADVN-RGNEVDFS  131

Query  552   -RKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAK  710
                 QP R + S++  R      T  SS+  D MTSDV+ P PW IFG +NGLR+FKEAK
Sbjct  132   SSGSQPLRFNCSNKSYRLNSIDWTVCSSSVTDVMTSDVVAPSPWTIFGCENGLRLFKEAK  191

Query  711   DRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
             DR   GK WD HPAIMAVG++DGTSEAIF+ LMSLGPSRSEWDFC+ +GSV+EHLDGHTD
Sbjct  192   DRESLGK-WDDHPAIMAVGIVDGTSEAIFQTLMSLGPSRSEWDFCYYKGSVIEHLDGHTD  250

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             I+H  L   WLPWG+ RRDLLL+RYWRREDDGTYVILYHSV H KC PQ+GYVRA +KSG
Sbjct  251   IVHKLLNQDWLPWGMTRRDLLLQRYWRREDDGTYVILYHSVFHQKCAPQKGYVRACLKSG  310

Query  1071  GHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSY  1241
             G+VI+PVNQGK S VKHML++DWK   SY+R + ++S+TI MLG +AALRE+F AK G+Y
Sbjct  311   GYVISPVNQGKGSVVKHMLAIDWKFWKSYVRTSAARSITIRMLGRLAALRELFSAKIGNY  370

Query  1242  FPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEE-----DTTEKYPSACSSIVELDDVA  1406
              P     EL    +L   E EEIK EV    R+E      D  E+     SS++ L+D +
Sbjct  371   LPSDVSGELVKSKRLCQVE-EEIKLEV--QTRLENGNNVADLEEEAVKTPSSLLGLNDAS  427

Query  1407  DEFFDVPEASDDEHSDHGWPRSTTPE-YHETPR-PKLSSAACFVRKLQDLAVQK----NF  1568
             DEFFDV E  D + S++GW     PE Y +  R PKLS+AA FV+KL DLAVQK    + 
Sbjct  428   DEFFDVSEPLDYDQSENGWSSDFGPETYSQDARHPKLSTAAVFVKKLHDLAVQKKGYVDL  487

Query  1569  QEIVGGEEGAKGC-YGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLT  1745
              E+   +E A  C YG TLPKD++ N+P SW   D S+FLIRGE YL D  KI +KGTL 
Sbjct  488   HEM--AKEDASFCHYGSTLPKDSTCNLPCSWTETDPSTFLIRGETYLDDRKKIKAKGTLM  545

Query  1746  QIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKT  1925
             Q+VGADWL+S+ RED+L  RPG IVQKYAA+  PEFFF+VNIQVPG T Y+LALYYM+ T
Sbjct  546   QMVGADWLKSDKREDDLGGRPGGIVQKYAAKGGPEFFFIVNIQVPGLTTYTLALYYMMDT  605

Query  1926  PLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQN  2105
             PL ++PLLE FV GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+G+N
Sbjct  606   PLEDSPLLESFVKGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGKN  665

Query  2106  YLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDAS  2285
             Y+EL +D+GSSTVARGV++LV+GYLNNLVIEMAFLVQA+T EELPE+LLGTCRLNHLD S
Sbjct  666   YIELGIDIGSSTVARGVVSLVVGYLNNLVIEMAFLVQANTPEELPEYLLGTCRLNHLDIS  725

Query  2286  KAVHT  2300
             KAV  
Sbjct  726   KAVQV  730



>ref|XP_008245285.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Prunus mume]
Length=738

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/740 (62%), Positives = 568/740 (77%), Gaps = 42/740 (6%)
 Frame = +3

Query  180   MPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSC  359
             M  +D  MEGWLYL+R NR+GLQY RKRYF+LE + LKS+K+VP++  E+P+RSAIIDSC
Sbjct  1     MSQTDQRMEGWLYLVRSNRIGLQYSRKRYFVLEGHLLKSFKSVPVSNNEDPVRSAIIDSC  60

Query  360   IHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLR  539
             I V DNGRE+  RKVFF FTL NTSNH+DQLK GA+SPEEAARWI   ++ A+    +L 
Sbjct  61    IRVTDNGRESIQRKVFFIFTLYNTSNHNDQLKLGASSPEEAARWIHSFQEVALKGGPDLG  120

Query  540   APAI----RKWQPF-----RLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFG  674
                +      WQ F     RL  SSR +R ++      SST  DA+TSDVI P PW IFG
Sbjct  121   DNFVDCSNNIWQSFSIHARRLGGSSRRSRINSIDWSLCSSTQTDAVTSDVIAPSPWTIFG  180

Query  675   IQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCR  854
              QNGLR+FKEAKDR+ +GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +
Sbjct  181   CQNGLRLFKEAKDRDSHGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYK  239

Query  855   GSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPP  1034
             G+VVEHLDGHTDIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCPP
Sbjct  240   GNVVEHLDGHTDIIHKQLYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPP  299

Query  1035  QEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAA  1205
             Q+GYVRA +KSGG+VI+PVNQGK S VKHML++DWK   SYL+ ++++S+TI MLG +AA
Sbjct  300   QKGYVRACLKSGGYVISPVNQGKQSVVKHMLAIDWKFWKSYLQTSSARSMTIKMLGRVAA  359

Query  1206  LREMFKAKSGSYFPDP-AMNELTIDIQLPVSEKEEIKN--EVVATERIEEDT---TEKYP  1367
             LRE+F+AK G+Y     +  EL  + +L  +E +   +   ++  ER +E+     EK P
Sbjct  360   LRELFRAKLGNYSSSEFSSGELRRNFRLHQNEGDGEADVPTLMGNERTKENIAEEVEKSP  419

Query  1368  SACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEY------HETPRPKLSSAACF  1529
             S  +S++ L+D +DEFFDVPE    + S+  W    TP++       +   PKLS+AA F
Sbjct  420   SEHASLISLNDASDEFFDVPEPPYSDQSETDW----TPDFGSEMYSQDMHHPKLSTAAGF  475

Query  1530  VRKLQDLAVQK----NFQEIVGGEEGAKGCY-GCTLPKDASYNMPGSWAAADTSSFLIRG  1694
             V++L DLAVQK    + QE+    E +  CY G TLPKD++ N+  SW A+D S+FLIRG
Sbjct  476   VKRLHDLAVQKRGYVDLQEM--AREDSMSCYYGSTLPKDSTCNLACSWTASDPSTFLIRG  533

Query  1695  EKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQ  1874
             + YL+D+ K+ +KGTL Q+V ADWL+S+ RED+L  RPGSIVQKYAAQ   EFFF+VNIQ
Sbjct  534   KNYLEDNKKVKAKGTLMQMVAADWLRSDKREDDLGGRPGSIVQKYAAQGGREFFFIVNIQ  593

Query  1875  VPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKK  2054
             VPG+T YSL LYYM+ +P+ + PLLE F+ GDDA+RNS+FKLIPYISKGSW+VKQSVGKK
Sbjct  594   VPGSTTYSLVLYYMMNSPVEDAPLLESFIKGDDAYRNSRFKLIPYISKGSWLVKQSVGKK  653

Query  2055  SCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEE  2234
             +CLIGQ+LE+NYF G+NYLEL +D+GSSTVARGV++LVLGYLNNLVIEMAFL+QA+T EE
Sbjct  654   ACLIGQALEINYFHGKNYLELGIDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQANTPEE  713

Query  2235  LPEHLLGTCRLNHLDASKAV  2294
             LPE+LLGTCRLNHLDASK+V
Sbjct  714   LPEYLLGTCRLNHLDASKSV  733



>ref|XP_006488076.1| PREDICTED: uncharacterized protein LOC102622614 [Citrus sinensis]
Length=748

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/733 (63%), Positives = 564/733 (77%), Gaps = 41/733 (6%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S G MEGWL+LIR NR+GLQY RKRYF+LED+ LKS+K+VP +  E+P+RSAIIDSCI V
Sbjct  8     SQGRMEGWLHLIRSNRIGLQYSRKRYFLLEDHFLKSFKSVPHSKNEDPVRSAIIDSCIRV  67

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI--NPEK----  530
              DNGRE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAA+WI  L++AA+   P +    
Sbjct  68    TDNGRESIHRKVFFIFTLYNTSNHNDQLKLGASSPEEAAKWIHSLQEAALKGGPHQGVGD  127

Query  531   NLRAPAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLR  692
             ++  P    W+ FRLS SSR + T +      S T ++ +T+DVI P PW IFG QNGLR
Sbjct  128   HIGCPN-SPWESFRLSGSSRASHTKSIDWTLCSGTQMEQVTADVIAPSPWTIFGCQNGLR  186

Query  693   IFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEH  872
             +FKE KDR   GK WD HPAIMAVGV+DGTSEAIF+ LMSLG SRSEWDFCF RG VVEH
Sbjct  187   LFKEGKDRGSRGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGASRSEWDFCFYRGCVVEH  245

Query  873   LDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVR  1052
             LDGHTDIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCP Q+G VR
Sbjct  246   LDGHTDIIHKQLYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVR  305

Query  1053  ATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFK  1223
             A +KSGG+VITP+N GK S VKHML++DWK   SYL+ ++++S+TI MLG +AALRE+F+
Sbjct  306   ACLKSGGYVITPMNHGKISVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFR  365

Query  1224  AKSGSYF-PDPAMNELTID----------IQLPVSEKEEIKNEVVATERIEEDTTEKYPS  1370
             AK G+Y  P+    ELT +          +Q+P  +    KN    +E +++ ++E    
Sbjct  366   AKQGNYSSPEFLSGELTRNMRMHQTDGNMVQMPTEDGNSKKN---TSEEVDQVSSEH---  419

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQ  1544
               +S+V L+D ADEFFDVPE SD + S++GW     PE +  +T  PK+S+AA FVRKL 
Sbjct  420   --ASLVGLNDAADEFFDVPEPSDYDDSENGWTSDFGPEMNSQDTRHPKISTAAGFVRKLH  477

Query  1545  DLAVQK-NFQEIVGG--EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDH  1715
             DLAVQK  + ++ G   E+    CYG TL KD +  +P SW + D S+FLIRG+ YLQD 
Sbjct  478   DLAVQKRGYVDLQGTAKEDNFSCCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDR  537

Query  1716  SKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRY  1895
              K+ +KGTL Q+V ADWL+S+ RED+L  RPG IVQKYA Q  PEFFF++NIQVPG+T Y
Sbjct  538   QKVKAKGTLMQMVAADWLKSDKREDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTY  597

Query  1896  SLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQS  2075
             SLALYYM+ TP+ + PLLE F+NGDDA+RNS+FKLIPYIS+GSWIVKQSVGKK+CLIGQ+
Sbjct  598   SLALYYMMTTPVKDAPLLESFINGDDAYRNSRFKLIPYISEGSWIVKQSVGKKACLIGQA  657

Query  2076  LEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLG  2255
             LE+NYF G+NYLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFL+QA+TEEELPE LLG
Sbjct  658   LEINYFHGKNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQANTEEELPEFLLG  717

Query  2256  TCRLNHLDASKAV  2294
             TCRLNHLDA+KAV
Sbjct  718   TCRLNHLDAAKAV  730



>gb|KDO73326.1| hypothetical protein CISIN_1g004508mg [Citrus sinensis]
Length=748

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/733 (63%), Positives = 563/733 (77%), Gaps = 41/733 (6%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S G MEGWL+LIR NR+GLQY RKRYF+LED+ LKS+K+VP +  E+P+RSAIIDSCI V
Sbjct  8     SQGRMEGWLHLIRSNRIGLQYSRKRYFLLEDHFLKSFKSVPHSKNEDPVRSAIIDSCIRV  67

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI--NPEK----  530
              DNGRE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAA+WI  L++AA+   P +    
Sbjct  68    TDNGRESIHRKVFFIFTLYNTSNHNDQLKLGASSPEEAAKWIHSLQEAALKGGPHQGVGD  127

Query  531   NLRAPAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLR  692
             ++  P    W+ FRLS SSR + T +      S T ++ +T+DVI P PW IFG QNGLR
Sbjct  128   HIGCPN-SPWESFRLSGSSRASHTKSIDWTLCSGTHMEQVTADVIAPSPWTIFGCQNGLR  186

Query  693   IFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEH  872
             +FKE KDR   GK WD HPAIMAVGV+DGTSEAIF+ LMSLG SRS WDFCF RG VVEH
Sbjct  187   LFKEGKDRGSRGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGASRSVWDFCFYRGCVVEH  245

Query  873   LDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVR  1052
             LDGHTDIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCP Q+G VR
Sbjct  246   LDGHTDIIHKQLYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVR  305

Query  1053  ATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFK  1223
             A +KSGG+VITP+N GK S VKHML++DWK   SYL+ ++++S+TI MLG +AALRE+F+
Sbjct  306   ACLKSGGYVITPMNHGKKSVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFR  365

Query  1224  AKSGSYF-PDPAMNELTID----------IQLPVSEKEEIKNEVVATERIEEDTTEKYPS  1370
             AK G+Y  P+    ELT +          +Q+P  +    KN    +E +++ ++E    
Sbjct  366   AKQGNYSSPEFLSGELTRNMRMHQTDGNMVQMPTEDGNSKKN---TSEEVDQVSSEH---  419

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQ  1544
               +S+V L+D ADEFFDVPE SD + S++GW     PE +  +T  PK+S+AA FVRKL 
Sbjct  420   --ASLVGLNDAADEFFDVPEPSDYDDSENGWTSDFGPEMNSQDTRHPKISTAAGFVRKLH  477

Query  1545  DLAVQK-NFQEIVGG--EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDH  1715
             DLAVQK  + ++ G   E+    CYG TL KD +  +P SW + D S+FLIRG+ YLQD 
Sbjct  478   DLAVQKRGYVDLQGTAKEDNFSCCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDR  537

Query  1716  SKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRY  1895
              K+ +KGTL Q+V ADWL+S+ RED+L  RPG IVQKYA Q  PEFFF++NIQVPG+T Y
Sbjct  538   HKVKAKGTLMQMVAADWLKSDKREDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTY  597

Query  1896  SLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQS  2075
             SLALYYM+ TP+ + PLLE F+NGDDA+RNS+FKLIPYIS+GSWIVKQSVGKK+CLIGQ+
Sbjct  598   SLALYYMMTTPVKDAPLLESFINGDDAYRNSRFKLIPYISEGSWIVKQSVGKKACLIGQA  657

Query  2076  LEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLG  2255
             LE+NYF G+NYLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFL+QA+TEEELPE LLG
Sbjct  658   LEINYFHGKNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQANTEEELPEFLLG  717

Query  2256  TCRLNHLDASKAV  2294
             TCRLNHLDA+KAV
Sbjct  718   TCRLNHLDAAKAV  730



>ref|XP_008233315.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Prunus 
mume]
Length=736

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/734 (62%), Positives = 553/734 (75%), Gaps = 29/734 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLY+I  NRLGLQY RKRYFIL+DNCL+S+KA P +  EEP+RSA+ID
Sbjct  1     MGISQNDGTMEGWLYIIGSNRLGLQYSRKRYFILKDNCLRSFKAKPSSDSEEPVRSAVID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             SCI V DNG+ + HRK FF FTL NTSNH+DQLK GA+SPEEAA+W+R L+DAA+    +
Sbjct  61    SCIRVTDNGKASIHRKGFFIFTLYNTSNHNDQLKLGASSPEEAAKWMRSLKDAALKECPD  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQN  683
                   A +  +W  F    S R  R      T  S T  ++MTSDVI P PWKIFG QN
Sbjct  121   TANGFVACSKSRWPSFIRGGSRRAERKISVDWTLGSLTHTESMTSDVIAPSPWKIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEAKD +  G+HWD HPAIMA+G++DGTSEAIF+ L+SLGPSRSEWDFCF RGSV
Sbjct  181   GLRLFKEAKDWDSRGRHWDDHPAIMAIGLVDGTSEAIFRTLLSLGPSRSEWDFCFYRGSV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDI+H +L + WLPWG++RRDLL+RRYWRREDDGTYVILYHSV H KCPP+ G
Sbjct  241   VEHLDGHTDIVHQKLYSDWLPWGMQRRDLLVRRYWRREDDGTYVILYHSVSHKKCPPKRG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG+VITPVNQGK S V+HML++DWK    YLR ++++S+TI ML  +AALRE
Sbjct  301   YVRACLKSGGYVITPVNQGKQSLVRHMLAIDWKFWKLYLRPSSARSITIRMLERVAALRE  360

Query  1215  MFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVV---ATERIEE-----DTTEKYPS  1370
             +F AK+G+   + +  + T D++L  S K  IK EV       +IEE     D  EK P 
Sbjct  361   LFGAKTGNCSSEFSSGDFTGDVRLSQSGKNNIKTEVQHPGEVRKIEEGLLVEDEVEK-PE  419

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHET--PRPKLSSAACFVRKLQ  1544
               +S+  L D ADEFFDVPE ++ +  ++ W    + E H T    PKLSSAA  V+KL 
Sbjct  420   GRASLKGLHDAADEFFDVPEPTEYDQFENEWSADLSMEQHSTNIQHPKLSSAAVLVKKLH  479

Query  1545  DLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQD  1712
             +L VQK    + QE V  EE     YG TL KD S  +P SW +AD SSFLIRG  YLQD
Sbjct  480   ELRVQKKGYMDLQE-VSREENISCSYGATLQKDPSCALPCSWGSADPSSFLIRGPSYLQD  538

Query  1713  HSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATR  1892
               KI +K TL Q+VG DWL+S+ RED+L +R G IVQKYA +   EFFF+VNIQVPG T 
Sbjct  539   RQKIKAKNTLMQLVGVDWLRSDKREDDLGSRYGGIVQKYAERGGSEFFFIVNIQVPGTTL  598

Query  1893  YSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQ  2072
             Y+LA YYMLKTPL ENPLL  FVNGDD++RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ
Sbjct  599   YTLAFYYMLKTPLEENPLLYNFVNGDDSYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQ  658

Query  2073  SLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLL  2252
             +LE++YF+G+NYLEL +DVGSSTVARGV+NLVLGYLNNLVIEMAFL+QA+TEEELPE LL
Sbjct  659   ALEVHYFRGKNYLELGIDVGSSTVARGVVNLVLGYLNNLVIEMAFLIQANTEEELPEVLL  718

Query  2253  GTCRLNHLDASKAV  2294
             GTCR+NHLDASK+V
Sbjct  719   GTCRINHLDASKSV  732



>ref|XP_009621797.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Nicotiana tomentosiformis]
Length=730

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/725 (63%), Positives = 551/725 (76%), Gaps = 32/725 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYL+R NR GLQY RKRYFIL+D+ L+SYK+ P++  E+P+RSA+IDSCI V DNG
Sbjct  11    MEGWLYLVRSNRFGLQYSRKRYFILQDHFLQSYKSTPVSSNEDPIRSAVIDSCIRVTDNG  70

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAI---  551
             RE+  RKVFF FTL NTSNH+DQLK GA+SPEEAARWI+  ++AA+  + N R   +   
Sbjct  71    RESIQRKVFFIFTLYNTSNHNDQLKLGASSPEEAARWIQAFQEAALKADMN-RGNQVDFP  129

Query  552   -RKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAK  710
                    RL+ S++  R      T  SS+  DAMTSDV+ P PW IFG QNGLR+FKEAK
Sbjct  130   RSDSHTLRLNCSNKSYRLSSIDWTVCSSSVTDAMTSDVVAPSPWAIFGCQNGLRLFKEAK  189

Query  711   DRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
             DR   GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +GSV+EHLDGHTD
Sbjct  190   DRESLGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVIEHLDGHTD  248

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             I+H  L   WLPWG+ RRDLLL+RYWRREDDGTYVILYHSV H KCPPQ+GY+RA +KSG
Sbjct  249   IVHKLLNRDWLPWGMGRRDLLLQRYWRREDDGTYVILYHSVFHQKCPPQKGYIRACLKSG  308

Query  1071  GHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSY  1241
             G+VI+PVNQ K S VKHML++DWK   SY+R + ++S+TI MLG +AALRE+F AK G+Y
Sbjct  309   GYVISPVNQEKRSVVKHMLAIDWKFWKSYVRTSAARSITICMLGRLAALRELFSAKIGNY  368

Query  1242  FPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEE-----DTTEKYPSACSSIVELDDVA  1406
              P     EL    +L   E EEIK EV    R+E      D  E+     SS++ L+D A
Sbjct  369   LPSDVSGELVKSKRLRQVE-EEIKLEV--QTRLENGKNLADLEEEVVKTPSSLMGLNDAA  425

Query  1407  DEFFDVPEASDDEHSDHGWPRSTTPE-YHETPR-PKLSSAACFVRKLQDLAVQK----NF  1568
             DEFFDV E  D + S++GWP    PE Y +  R PKLSSAA FV+KL DLAVQK    + 
Sbjct  426   DEFFDVSEPLDYDQSENGWPSDFGPETYSQDARHPKLSSAAVFVKKLHDLAVQKRGYVDL  485

Query  1569  QEIVGGEEGAKGC-YGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLT  1745
              E+   +E    C YG TLPKD++ ++P SW   D S+FLIRG  YL D  KI +KGTL 
Sbjct  486   HEM--AKEDTSSCHYGSTLPKDSTCSLPCSWTETDPSTFLIRGLTYLDDRKKIKAKGTLM  543

Query  1746  QIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKT  1925
             Q+VGADWL+S+ RED+L  RPG IVQKYAA+  PEFFF+V+IQVPG T YSLALYYM+ T
Sbjct  544   QMVGADWLKSDKREDDLGGRPGGIVQKYAAKGGPEFFFIVHIQVPGTTTYSLALYYMMDT  603

Query  1926  PLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQN  2105
             PL ++PLLE FV GDDA+RNS+FKLIPYISKG WIVKQSVGKK+CLIGQ+LE+NYF+G+N
Sbjct  604   PLEDSPLLESFVKGDDAYRNSRFKLIPYISKGPWIVKQSVGKKACLIGQALEINYFRGKN  663

Query  2106  YLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDAS  2285
             Y+EL +D+GSSTVARGV++LV+GYL+NLVIEMAFLVQA+T EELPE+LLGTCRLNHLD +
Sbjct  664   YIELGIDIGSSTVARGVVSLVVGYLSNLVIEMAFLVQANTPEELPEYLLGTCRLNHLDVT  723

Query  2286  KAVHT  2300
             KAV  
Sbjct  724   KAVQV  728



>ref|XP_006424553.1| hypothetical protein CICLE_v10027876mg [Citrus clementina]
 gb|ESR37793.1| hypothetical protein CICLE_v10027876mg [Citrus clementina]
Length=748

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/728 (63%), Positives = 565/728 (78%), Gaps = 31/728 (4%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S G MEGWL+LIR NR+GLQY RKRYF+LED+ LKS+K+VP +  E+P+RSAIIDSCI V
Sbjct  8     SQGRMEGWLHLIRSNRIGLQYSRKRYFLLEDHFLKSFKSVPHSKNEDPVRSAIIDSCIRV  67

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI--NPEK----  530
              DNGRE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAA+WI  L++AA+   P +    
Sbjct  68    TDNGRESIHRKVFFIFTLYNTSNHNDQLKLGASSPEEAAKWIHSLQEAALKGGPHQGVGD  127

Query  531   NLRAPAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLR  692
             ++  P    W+ FRLS SSR + T +      S T ++ +T+DVI P PW IFG QNGLR
Sbjct  128   HIGCPN-SPWESFRLSGSSRASHTKSIDWTLCSGTHMEQVTADVIAPSPWTIFGCQNGLR  186

Query  693   IFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEH  872
             +FKE KDR   GK WD HPAIMAVGV+DGTSEAIF+ LMSLG SRS WDFCF RG VVEH
Sbjct  187   LFKEGKDRGSRGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGASRSVWDFCFYRGCVVEH  245

Query  873   LDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVR  1052
             LDGHTDIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCP Q+G VR
Sbjct  246   LDGHTDIIHKQLYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVR  305

Query  1053  ATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFK  1223
             A +KSGG+VITP+N GK S VKHML++DWK   SYL+ ++++S+TI MLG +AALRE+F+
Sbjct  306   ACLKSGGYVITPMNHGKKSVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFR  365

Query  1224  AKSGSYF-PDPAMNELTIDIQLPVSEKEEIKNEVVATE--RIEEDTTEKYPSACS---SI  1385
             AK G+Y  P+    ELT ++++  ++   ++   + TE    +E+T+E+     S   S+
Sbjct  366   AKQGNYSSPEFLSGELTRNMRMHQTDGNMVQ---MPTEDGNSKENTSEEVDQVSSEHASL  422

Query  1386  VELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQ  1559
             V L+D ADEFFDVPE SD + S++GW     PE +  +T  PK+S+AA FVRKL DLAVQ
Sbjct  423   VGLNDAADEFFDVPEPSDYDDSENGWTSDFGPEMNSQDTRHPKISTAAGFVRKLHDLAVQ  482

Query  1560  K-NFQEIVGG--EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITS  1730
             K  + ++ G   E+    CYG TL KD +  +P SW + D S+FLIRG+ YLQD  K+ +
Sbjct  483   KRGYVDLQGTAKEDNFSCCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDRHKVKA  542

Query  1731  KGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALY  1910
             KGTL Q+V ADWL+S+ RED+L  RPG IVQKYA Q  PEFFF++NIQVPG+T YSLALY
Sbjct  543   KGTLMQMVAADWLKSDKREDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTYSLALY  602

Query  1911  YMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNY  2090
             YM+ TP+ + PLLE F+NGDDA+RNS+FKLIPYIS+GSWIVKQSVGKK+CLIGQ+LE+NY
Sbjct  603   YMMTTPVKDAPLLESFINGDDAYRNSRFKLIPYISEGSWIVKQSVGKKACLIGQALEINY  662

Query  2091  FKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLN  2270
             F G+NYLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFL+QA+TEEELPE LLGTCRLN
Sbjct  663   FHGKNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQANTEEELPEFLLGTCRLN  722

Query  2271  HLDASKAV  2294
             HLDA+KAV
Sbjct  723   HLDAAKAV  730



>ref|XP_007220231.1| hypothetical protein PRUPE_ppa002022mg [Prunus persica]
 gb|EMJ21430.1| hypothetical protein PRUPE_ppa002022mg [Prunus persica]
Length=727

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/725 (63%), Positives = 549/725 (76%), Gaps = 29/725 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLY+I  NRLGLQY RKRYFIL+DNCL+S+KA P +  EEP+RSA+IDSCI V DNG
Sbjct  1     MEGWLYIIGSNRLGLQYSRKRYFILKDNCLRSFKAKPSSDSEEPVRSAVIDSCIRVTDNG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----NPEKNLRAPA  548
             + + HRK FF FTL NTSNH+DQLK GA+SPEEAA+W+R L+DAA+    +      A +
Sbjct  61    KASIHRKGFFIFTLYNTSNHNDQLKLGASSPEEAAKWMRSLKDAALKECPDTANGFVACS  120

Query  549   IRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAK  710
               +W  F    S R         T  S T  ++MTSDVI P PWKIFG QNGLR+FKEAK
Sbjct  121   KSRWPSFIRGGSRRAESKISVDWTLGSLTHTESMTSDVIAPSPWKIFGCQNGLRLFKEAK  180

Query  711   DRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
             D +  G+HWD HPAIMA+G++DGTSEAIF+ L+SLGPSRSEWDFCF RGSVVEHLDGHTD
Sbjct  181   DWDSRGRHWDDHPAIMAIGLVDGTSEAIFRTLLSLGPSRSEWDFCFYRGSVVEHLDGHTD  240

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             I+H +L + WLPWG++RRDLL+RRYWRREDDGTYVILYHSV H KCPP+ GYVRA +KSG
Sbjct  241   IVHQKLYSDWLPWGMQRRDLLVRRYWRREDDGTYVILYHSVSHKKCPPKRGYVRACLKSG  300

Query  1071  GHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSGSY  1241
             G+VITPVNQGK S V+HML++DWK    YLR ++++S+TI ML  +AALRE+F AK+G+ 
Sbjct  301   GYVITPVNQGKQSLVRHMLAIDWKFWKLYLRPSSARSITIRMLERVAALRELFGAKTGNC  360

Query  1242  FPDPAMNELTIDIQLPVSEKEEIKNEVV---ATERIE-----EDTTEKYPSACSSIVELD  1397
               + +  +LT DI+L  S K  IK EV       +IE     ED  EK P   +S+  L 
Sbjct  361   SSEFSSGDLTRDIRLSQSGKNNIKTEVQHPGEVRKIEDGLLVEDEVEK-PEGRASLKGLH  419

Query  1398  DVADEFFDVPEASDDEHSDHGWPRSTTPEYHET--PRPKLSSAACFVRKLQDLAVQK---  1562
             D ADEFFDVPE ++ +  ++ WP   + E H T    PKLSSAA  V+KL +L VQK   
Sbjct  420   DAADEFFDVPEPTEYDQFENEWPADLSMEQHSTNIQHPKLSSAAVLVKKLHELRVQKKGY  479

Query  1563  -NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGT  1739
              + QE V  EE     YG TL KD S  +P SW +AD SSFLIRG  YLQD  KI +K T
Sbjct  480   MDLQE-VSREENISCSYGATLQKDPSCALPCSWGSADPSSFLIRGPSYLQDRQKIKAKNT  538

Query  1740  LTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYML  1919
             L Q+VG DWL+S+ RED+L +R G IVQKYA +   EFFF+VNIQVPG T Y+LA YYML
Sbjct  539   LMQLVGVDWLRSDKREDDLGSRYGGIVQKYAERGGSEFFFIVNIQVPGTTMYTLAFYYML  598

Query  1920  KTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKG  2099
             KTPL ENPLL  FVNGDD++RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE++YF+G
Sbjct  599   KTPLEENPLLHNFVNGDDSYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEVHYFRG  658

Query  2100  QNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLD  2279
             +NYLEL +DVGSSTVARGV+NLVLGYLNNLVIEMAFL+QA+TEEELPE LLGTCR+NHLD
Sbjct  659   KNYLELGIDVGSSTVARGVVNLVLGYLNNLVIEMAFLIQANTEEELPEVLLGTCRINHLD  718

Query  2280  ASKAV  2294
             ASK+V
Sbjct  719   ASKSV  723



>ref|XP_004251144.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Solanum 
lycopersicum]
Length=730

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/725 (63%), Positives = 551/725 (76%), Gaps = 32/725 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQY RKRYFIL+D  LKSYK+VP+   E+P+RSA++DSCI V DNG
Sbjct  11    MEGWLYLIRSNRFGLQYSRKRYFILQDQFLKSYKSVPVPENEDPIRSAVVDSCIRVTDNG  70

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAI---  551
             RE+  RKVFF FTL NTSNH+DQLK GA+SPEEAARWI+ +++AA+  + N R   +   
Sbjct  71    RESIQRKVFFIFTLYNTSNHNDQLKLGASSPEEAARWIQAVQEAALKVDVN-RGKEVDFS  129

Query  552   -RKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAK  710
                 Q  RL+ S++  R      T  SS+  DAMTSDV+ P PW IFG +NGLR+FKEAK
Sbjct  130   SSGSQSLRLNCSNKSNRLNSIDWTVCSSSVTDAMTSDVVAPSPWTIFGCENGLRLFKEAK  189

Query  711   DRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
             DR   GK WD HPAIMAVGV+DGTSEAIF+ LMSLG SRSEWDFCF +GSV+EHLDGHTD
Sbjct  190   DRESLGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYKGSVIEHLDGHTD  248

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             I+H  L   WLPWG+ RRDLLL+RYWRREDDGTYVILYHSV H KC PQ+GYVRA +KSG
Sbjct  249   IVHKLLNQDWLPWGMTRRDLLLQRYWRREDDGTYVILYHSVFHQKCAPQKGYVRACLKSG  308

Query  1071  GHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSY  1241
             G+VI+PVNQGK S VKHML++DWK   SY+R + ++S+TI MLG +AALRE+F AK G+Y
Sbjct  309   GYVISPVNQGKGSVVKHMLAIDWKFWKSYVRTSAARSITIRMLGRLAALRELFSAKIGNY  368

Query  1242  FPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEE-----DTTEKYPSACSSIVELDDVA  1406
              P     EL    +L   E EEIK EV    R+E      D  E+     SS++ L+D A
Sbjct  369   LPSDVSGELIKSKRLCQVE-EEIKLEV--QTRLENGKSVADLEEEVVKTPSSLMGLNDAA  425

Query  1407  DEFFDVPEASDDEHSDHGWPRSTTPE-YHETPR-PKLSSAACFVRKLQDLAVQK----NF  1568
             DEFFDV E  D + +++ W      E Y +  R PKLS+AA  V++L DLAVQK    + 
Sbjct  426   DEFFDVSEPLDYDQTENDWSSDFGLETYSQDARHPKLSTAAVIVKRLHDLAVQKKGYVDL  485

Query  1569  QEIVGGEEGAKGC-YGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLT  1745
              E+V  +E A  C YG TLPKD++ N+P SW   D S+FLIRGE YL D  KI +KGTL 
Sbjct  486   HEMV--KEDASFCHYGSTLPKDSTCNLPCSWTETDPSTFLIRGETYLDDRKKIKAKGTLM  543

Query  1746  QIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKT  1925
             Q+VGADWL+S+ RED+L  RPG IVQKYAA+  PEFFF+VNIQVPG T Y+LALYYM+ T
Sbjct  544   QMVGADWLKSDKREDDLGGRPGGIVQKYAAKGGPEFFFIVNIQVPGLTTYTLALYYMMDT  603

Query  1926  PLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQN  2105
             PL ++PLLE FV GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+G+N
Sbjct  604   PLEDSPLLESFVKGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGKN  663

Query  2106  YLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDAS  2285
             Y+EL +D+GSSTVARGV++LV+GYLNNLVIEMAFLVQA+T EELPE+LLGTCRLNHLD S
Sbjct  664   YIELGIDIGSSTVARGVVSLVVGYLNNLVIEMAFLVQANTPEELPEYLLGTCRLNHLDVS  723

Query  2286  KAVHT  2300
             KAV  
Sbjct  724   KAVQV  728



>ref|XP_011031731.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Populus euphratica]
Length=734

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/733 (61%), Positives = 564/733 (77%), Gaps = 27/733 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             MV+P +DG MEGWL++IR +R GLQ+ R+RYFIL++N L+ YK +PI+  EEPLRSA ID
Sbjct  1     MVVPPNDGKMEGWLFIIRSHRFGLQFSRRRYFILQENYLRCYKTMPISQEEEPLRSAKID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             S I + DNGRE+ +RKVFF FTL N  N +D LK GA+  E+A RWIR L++A +    N
Sbjct  61    SYIRITDNGRESINRKVFFIFTLYNILNENDHLKLGASGSEDAGRWIRSLQNAVLKECPN  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMARTDA----SSTPVDAMTSDVIGPCPWKIFGIQNGL  689
             PEK   + + + W P R   + R  R  +    S    +A+TSDVI P PWKIFG +NGL
Sbjct  121   PEKEFMSFSKKNWLPSRFGSAKRAHRQRSIDYYSFLHNEAVTSDVIAPSPWKIFGCRNGL  180

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEAKD +  G+HWD HPAIMAVGV++GT EAIF  LMSLG SRSEWDFCF RGSVVE
Sbjct  181   RLFKEAKDWDSRGRHWDDHPAIMAVGVLNGTPEAIFHTLMSLGASRSEWDFCFYRGSVVE  240

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDI+H +L ++WLPWG+ RRD LLRRYWRRE+DGTYVILYHSVIH KCPPQ GYV
Sbjct  241   HLDGHTDILHAKLYSNWLPWGMMRRDFLLRRYWRREEDGTYVILYHSVIHKKCPPQNGYV  300

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMF  1220
             RA +KSGG+VITPVN+G+ S VKHML+V+WK    YLR+ + +SLTI ML  +AALREMF
Sbjct  301   RACLKSGGYVITPVNKGRESLVKHMLAVNWKFWKVYLRQPSGRSLTIRMLERLAALREMF  360

Query  1221  KAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATER------IEEDTTEKYPSACSS  1382
             +AK+G+Y  D +  +  + I LP  E E+IK+E  + ++      +EED  EK  S   S
Sbjct  361   QAKAGNYPSDFSSADSEVKIMLPQDEVEDIKSEDKSQQKFELNADLEEDEAEKTTSGRRS  420

Query  1383  IVELDDVADEFFDVPEASDD---EHSDHGWPRSTTPEY--HETPRPKLSSAACFVRKLQD  1547
             ++ L+D +DEFFDVP++ +    +H ++GW    + E+      +P+LSSAA FV+KL D
Sbjct  421   LMSLNDASDEFFDVPDSGEMIAFDHLENGWFPEVSQEWPASNMSQPRLSSAAVFVKKLHD  480

Query  1548  LAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDH  1715
             LAVQK    +FQE+   EE     +G TL KD++ ++P SWA AD ++FLIRGE Y +D+
Sbjct  481   LAVQKKGYMDFQEL-AKEENVVTSFGNTLQKDSACSLPCSWAPADPTTFLIRGENYFEDN  539

Query  1716  SKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRY  1895
              KI ++GTL Q+VGADWL+S+ RED+L +R  SIVQK+AA+ RPEFFF+VNIQVPG T++
Sbjct  540   QKIKAEGTLMQMVGADWLRSDRREDDLGSRAESIVQKFAARGRPEFFFIVNIQVPGVTQH  599

Query  1896  SLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQS  2075
             +LALYYMLKTPL E PLL  FVNGDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+
Sbjct  600   TLALYYMLKTPLEETPLLHSFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQA  659

Query  2076  LEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLG  2255
             LEMNYF+G+NYLELD+DVGSSTVARGV++LVLGYLN+LVIEMAF++Q +TE+ELPE LLG
Sbjct  660   LEMNYFRGKNYLELDIDVGSSTVARGVVSLVLGYLNHLVIEMAFVIQGNTEDELPEVLLG  719

Query  2256  TCRLNHLDASKAV  2294
             TCRLN+LDASK+V
Sbjct  720   TCRLNNLDASKSV  732



>ref|XP_011044394.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X1 [Populus 
euphratica]
Length=746

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/720 (63%), Positives = 560/720 (78%), Gaps = 26/720 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR+GLQY RKRYF+L+ + L+S+K+VP++  ++P+RSAIIDSCI V DNG
Sbjct  27    MEGWLYLIRSNRIGLQYSRKRYFVLQHHLLQSFKSVPLSKNQDPVRSAIIDSCIRVTDNG  86

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW  560
             RE+ HRKVFF FT+ NTSNH+DQLK GA+SPEEAARWI  +++AA+    ++   +    
Sbjct  87    RESIHRKVFFIFTVYNTSNHNDQLKLGASSPEEAARWIHSIQEAALKGAHSIVGCSRSSC  146

Query  561   QPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNP  722
             Q FRLS  S +        T  SS   D +T DVI P PW IFG QNGLR+FKEAKDR+ 
Sbjct  147   QSFRLSGPSWVNHNKPIDWTHCSSAHTDLVT-DVIAPSPWTIFGCQNGLRLFKEAKDRDS  205

Query  723   NGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHM  902
             +GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRS+WDFCF +GSVVEHLDGH DIIH 
Sbjct  206   HGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSKWDFCFYKGSVVEHLDGHMDIIHK  264

Query  903   QLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVI  1082
             +L   WLPWG+KRRD LLRRYWRREDDGTYVILYHSV H KCPPQ+GYVRA +KSGG+VI
Sbjct  265   ELYNDWLPWGMKRRDFLLRRYWRREDDGTYVILYHSVYHKKCPPQKGYVRACLKSGGYVI  324

Query  1083  TPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSGSY-FPD  1250
             +PVN  + S VKHML+VDWKS   YLR ++++S+TI MLG +AALRE+FKAK G+    D
Sbjct  325   SPVNHERRSVVKHMLAVDWKSWKSYLRTSSARSITIRMLGRVAALRELFKAKLGNCPSSD  384

Query  1251  PAMNELTIDIQLPVSEKEEI------KNEVVATERIEEDTTEKYPSACSSIVELDDVADE  1412
              +  EL  +++L   E ++        N+ +  E + E+  +K PS  +S+V L+D ADE
Sbjct  385   FSSGELVGNMRLHQIEGDQRIDAQTPTNDGMTKECMNEEV-DKTPSEYASLVGLNDPADE  443

Query  1413  FFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK----NFQE  1574
             FFDVPE SD +  ++ W     PE +  +  +PKLS+AA FV+KL +LAVQK    + QE
Sbjct  444   FFDVPEPSDYDQLENDWSSDFDPEMYSQDARQPKLSTAAGFVKKLHELAVQKRGYMDLQE  503

Query  1575  IVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIV  1754
             +V  E+    CYG TL KD ++ +P SWA AD SSFLIRG+ YL+D  K  + GTL Q+V
Sbjct  504   MVR-EDSISCCYGTTLLKDPTFTLPSSWAMADPSSFLIRGKNYLEDQKKFKANGTLMQMV  562

Query  1755  GADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLA  1934
              ADW++S+ RED+LA RPGSIVQKYAAQ  PEFFF+VNIQVPG+T YSLALYYM+ TP+ 
Sbjct  563   AADWIRSDKREDDLAGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVE  622

Query  1935  ENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLE  2114
             + PLLE F+ GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LEMNYF+G+NYLE
Sbjct  623   DAPLLESFIKGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEMNYFRGKNYLE  682

Query  2115  LDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             L VD+GSSTVARGV++LVLGYL+NLVIEMAFL+QA+T+EELPE+LLGTCRLNHLDASKAV
Sbjct  683   LGVDIGSSTVARGVVSLVLGYLSNLVIEMAFLIQANTDEELPEYLLGTCRLNHLDASKAV  742



>ref|XP_002311087.2| pleckstrin homology domain-containing family protein [Populus 
trichocarpa]
 gb|EEE88454.2| pleckstrin homology domain-containing family protein [Populus 
trichocarpa]
Length=734

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/733 (61%), Positives = 560/733 (76%), Gaps = 27/733 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +P +DG MEGWL++IR +R GLQ+ R+RYFIL++N L+ YK  PI+  EEPLRSA ID
Sbjct  1     MGVPPNDGKMEGWLFIIRSHRFGLQFSRRRYFILQENYLRCYKTKPISQEEEPLRSAKID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             S I + DNGRE+ +RKVFF F L N  N +D LK GA+  E+A RWIR L++A +    N
Sbjct  61    SYIRITDNGRESINRKVFFIFALYNILNENDHLKLGASGSEDAGRWIRSLQNAVLKECPN  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMARTDA----SSTPVDAMTSDVIGPCPWKIFGIQNGL  689
             PEK   + + + W P R   + R  R  +    S    +A+TSDVI P PWKIFG QNGL
Sbjct  121   PEKEFMSFSKKNWLPSRFGSAKRAQRQRSIDYYSFLHNEAVTSDVIAPSPWKIFGCQNGL  180

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEAKD +  G+HWD HPAIMAVGV++GT EAIF  LMSLG SRSEWDFCF RGSVVE
Sbjct  181   RLFKEAKDWDSRGRHWDDHPAIMAVGVLNGTPEAIFHTLMSLGASRSEWDFCFYRGSVVE  240

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDI+H +L ++WLPWG+ RRD LLRRYWRRE+DGTYVILYHSVIH KCPPQ GYV
Sbjct  241   HLDGHTDILHAKLYSNWLPWGMMRRDFLLRRYWRREEDGTYVILYHSVIHKKCPPQNGYV  300

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMF  1220
             RA +KSGG+VITPVN+G+ S VKHML+V+WK    YLR+ + +S+TI ML  +AALREMF
Sbjct  301   RACLKSGGYVITPVNKGRESLVKHMLAVNWKFWKVYLRQPSGRSITIRMLERLAALREMF  360

Query  1221  KAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATER------IEEDTTEKYPSACSS  1382
             +AK+G+Y  D +  +  + I LP  E E+IK+E  + ++      +EED  EK  S   S
Sbjct  361   QAKAGNYPSDFSSADSEVKIMLPQDEVEDIKSEDKSQQKFELNADLEEDEAEKTTSGRRS  420

Query  1383  IVELDDVADEFFDVPEASDD---EHSDHGWPRSTTPEY--HETPRPKLSSAACFVRKLQD  1547
             ++ L+D +DEFFDVP++ +    +H ++GW    + E+      +P+LSSAA FV+KL D
Sbjct  421   LMSLNDASDEFFDVPDSGEVIAFDHLENGWFPEVSQEWPASNMSQPRLSSAAVFVKKLHD  480

Query  1548  LAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDH  1715
             LAVQK    +FQE+   EE     +G TL KD++ ++P SWA AD ++FLIRGE Y +D+
Sbjct  481   LAVQKKGYMDFQEL-AKEENVATSFGNTLQKDSACSLPCSWATADPTTFLIRGENYFKDN  539

Query  1716  SKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRY  1895
              KI + GTL Q+VGADWL+S+ RED+L +R  SIVQK+AAQ RPEFFF+VNIQVPG T++
Sbjct  540   LKIKATGTLMQMVGADWLRSDRREDDLGSRAESIVQKFAAQGRPEFFFIVNIQVPGVTQH  599

Query  1896  SLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQS  2075
             +LALYYMLKTPL E PLL  FVNGDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+
Sbjct  600   TLALYYMLKTPLEETPLLHSFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQA  659

Query  2076  LEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLG  2255
             LEMNYF+G+NYLELD+DVGSSTVARGV++LVLGYLN+LVIEMAF++Q +TEEELPE LLG
Sbjct  660   LEMNYFRGKNYLELDIDVGSSTVARGVVSLVLGYLNHLVIEMAFVIQGNTEEELPEVLLG  719

Query  2256  TCRLNHLDASKAV  2294
             TCRLN+LDASK+V
Sbjct  720   TCRLNNLDASKSV  732



>ref|XP_011031732.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Populus euphratica]
Length=726

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/731 (61%), Positives = 563/731 (77%), Gaps = 31/731 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             MV+P +DG MEGWL++IR +R GLQ+ R+RYFIL++N L+ YK +PI+  EEPLRSA ID
Sbjct  1     MVVPPNDGKMEGWLFIIRSHRFGLQFSRRRYFILQENYLRCYKTMPISQEEEPLRSAKID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             S I + DNGRE+ +RKVFF FTL N  N +D LK GA+  E+A RWIR L++A +    N
Sbjct  61    SYIRITDNGRESINRKVFFIFTLYNILNENDHLKLGASGSEDAGRWIRSLQNAVLKECPN  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMARTDA----SSTPVDAMTSDVIGPCPWKIFGIQNGL  689
             PEK   + + + W P R   + R  R  +    S    +A+TSDVI P PWKIFG +NGL
Sbjct  121   PEKEFMSFSKKNWLPSRFGSAKRAHRQRSIDYYSFLHNEAVTSDVIAPSPWKIFGCRNGL  180

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEAKD +  G+HWD HPAIMAVGV++GT EAIF  LMSLG SRSEWDFCF RGSVVE
Sbjct  181   RLFKEAKDWDSRGRHWDDHPAIMAVGVLNGTPEAIFHTLMSLGASRSEWDFCFYRGSVVE  240

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDI+H +L ++WLPWG+ RRD LLRRYWRRE+DGTYVILYHSVIH KCPPQ GYV
Sbjct  241   HLDGHTDILHAKLYSNWLPWGMMRRDFLLRRYWRREEDGTYVILYHSVIHKKCPPQNGYV  300

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMF  1220
             RA +KSGG+VITPVN+G+ S VKHML+V+WK    YLR+ + +SLTI ML  +AALREMF
Sbjct  301   RACLKSGGYVITPVNKGRESLVKHMLAVNWKFWKVYLRQPSGRSLTIRMLERLAALREMF  360

Query  1221  KAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATER------IEEDTTEKYPSACSS  1382
             +AK+G+Y  D +  +  + I LP  E E+IK+E  + ++      +EED  EK  S   S
Sbjct  361   QAKAGNYPSDFSSADSEVKIMLPQDEVEDIKSEDKSQQKFELNADLEEDEAEKTTSGRRS  420

Query  1383  IVELDDVADEFFDVPEASDD---EHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLA  1553
             ++ L+D +DEFFDVP++ +    +H ++GW     PE     +P+LSSAA FV+KL DLA
Sbjct  421   LMSLNDASDEFFDVPDSGEMIAFDHLENGW----FPE--NMSQPRLSSAAVFVKKLHDLA  474

Query  1554  VQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSK  1721
             VQK    +FQE+   EE     +G TL KD++ ++P SWA AD ++FLIRGE Y +D+ K
Sbjct  475   VQKKGYMDFQEL-AKEENVVTSFGNTLQKDSACSLPCSWAPADPTTFLIRGENYFEDNQK  533

Query  1722  ITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSL  1901
             I ++GTL Q+VGADWL+S+ RED+L +R  SIVQK+AA+ RPEFFF+VNIQVPG T+++L
Sbjct  534   IKAEGTLMQMVGADWLRSDRREDDLGSRAESIVQKFAARGRPEFFFIVNIQVPGVTQHTL  593

Query  1902  ALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLE  2081
             ALYYMLKTPL E PLL  FVNGDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE
Sbjct  594   ALYYMLKTPLEETPLLHSFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALE  653

Query  2082  MNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTC  2261
             MNYF+G+NYLELD+DVGSSTVARGV++LVLGYLN+LVIEMAF++Q +TE+ELPE LLGTC
Sbjct  654   MNYFRGKNYLELDIDVGSSTVARGVVSLVLGYLNHLVIEMAFVIQGNTEDELPEVLLGTC  713

Query  2262  RLNHLDASKAV  2294
             RLN+LDASK+V
Sbjct  714   RLNNLDASKSV  724



>gb|KHG27546.1| PCTP-like protein [Gossypium arboreum]
Length=736

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/723 (62%), Positives = 559/723 (77%), Gaps = 28/723 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLY+IR NR+GLQY RKRYF+LE + L  +K++PI+  +E  RSAIIDS I V DNG
Sbjct  13    MEGWLYIIRSNRIGLQYSRKRYFVLEAHLLNCFKSMPISSLQESGRSAIIDSSIRVTDNG  72

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----PEKNLRAPA  548
             RE+ HRKVFF FTL N+SNH+DQLK GA+SPEEAARWI   ++AA+     P  ++ A +
Sbjct  73    RESIHRKVFFIFTLYNSSNHNDQLKLGASSPEEAARWIHSFQEAALKGGPRPGSDV-ACS  131

Query  549   IRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAK  710
               +WQ FRLS SS          T   +T +D +TSDV+ P PW IFG QNGLR+FKEAK
Sbjct  132   KSRWQSFRLSSSSDSNHNNSIDWTLYPTTKMDRVTSDVVAPSPWTIFGCQNGLRLFKEAK  191

Query  711   DRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
             DR+ +GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +GSVVEHLDGHTD
Sbjct  192   DRDSHGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTD  250

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             I+H QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV+H KCPPQ+ YVRA++KSG
Sbjct  251   IVHKQLYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVVHKKCPPQKSYVRASLKSG  310

Query  1071  GHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSY  1241
             G+VI+PV +GK S VKHML++DWK   SYLR +  +S+TI ML  +AALRE+FKAK G+Y
Sbjct  311   GYVISPVTEGKHSVVKHMLAIDWKFWKSYLRTSAVRSITIRMLERVAALRELFKAKQGNY  370

Query  1242  -FPDPAMNELTIDIQLPVSEKEEIKN-----EVVATERIEEDTTEKYPSACSSIVELDDV  1403
                D +  EL  +++L  SE++ I +     E   T+    +  E+  S  SS+V L+D 
Sbjct  371   PTADLSSGELMRNVRLHQSEEDGIVDMCTEIEAGKTKENMNEAMERASSEHSSLVGLNDA  430

Query  1404  ADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK----N  1565
             ADEFFDVPE ++ + ++ GW     PE +  +T + KLS+AA FV+K+ DLAVQK    +
Sbjct  431   ADEFFDVPEPTEHDRAEDGWASDFGPEVYSQDTRQLKLSTAAVFVKKIHDLAVQKRGYMD  490

Query  1566  FQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLT  1745
              Q++   E+G    YG TL KD +  +P SW AA+ S+FLIRG+ YL+D  K  +KGTL 
Sbjct  491   LQDMTR-EDGVCCSYGNTLSKDPTCTLPCSWTAAEPSTFLIRGKNYLEDQKKFKAKGTLM  549

Query  1746  QIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKT  1925
             Q+V ADWL+S+ RED+L  RPG IVQKYAA+  PEFFF+VNIQVPG+T YSLALYYM+ T
Sbjct  550   QMVAADWLRSDKREDDLGGRPGGIVQKYAARGGPEFFFIVNIQVPGSTTYSLALYYMMNT  609

Query  1926  PLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQN  2105
             P+ ++PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIG +LEMNYF G+N
Sbjct  610   PVEDSPLLHNFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGHALEMNYFHGKN  669

Query  2106  YLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDAS  2285
             YLEL +D+GSSTVARGV+NLVLGYLNNLVIEMAFL+QA+TE+ELPE+LLGTCRLNHLDA+
Sbjct  670   YLELGIDIGSSTVARGVVNLVLGYLNNLVIEMAFLIQANTEDELPEYLLGTCRLNHLDAA  729

Query  2286  KAV  2294
             K++
Sbjct  730   KSI  732



>ref|XP_007150192.1| hypothetical protein PHAVU_005G134300g [Phaseolus vulgaris]
 gb|ESW22186.1| hypothetical protein PHAVU_005G134300g [Phaseolus vulgaris]
Length=734

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/717 (62%), Positives = 553/717 (77%), Gaps = 22/717 (3%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR+GLQ+ RKRYF+L+DN L+S+K+VP++  ++P+RSAI+DSCI V DNG
Sbjct  17    MEGWLYLIRFNRIGLQFSRKRYFVLDDNHLRSFKSVPLSNNQDPVRSAIVDSCIRVMDNG  76

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAI---  551
             RE+ +RKVFF FTL NTSNH+DQLK GA+ PEEAARWI+   +A++    +    A+   
Sbjct  77    RESVNRKVFFIFTLYNTSNHNDQLKLGASRPEEAARWIQSFHEASLKGAPDGGDDAVGCS  136

Query  552   -RKWQPFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNG  728
              R+WQ FRLS  S  +R+  +S      ++DVI P PW IFG QNGLR+FKEAKDR+  G
Sbjct  137   KRRWQSFRLSGCS--SRSHPNSVDWTLSSADVIAPSPWTIFGCQNGLRLFKEAKDRDSGG  194

Query  729   KHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQL  908
             K WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +G VVEHLDGHTDIIH QL
Sbjct  195   KKWDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGIVVEHLDGHTDIIHKQL  254

Query  909   TTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITP  1088
              + WLPWG++RRDLLLRRYWRREDDGTYVILYHSV H KCPPQ+GYVRA +KSGG+VI+P
Sbjct  255   FSDWLPWGMQRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISP  314

Query  1089  VNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YFPDPA  1256
             VN+GK S VKHML++DWK   SYL+ +++ S+TI MLG +AALRE+FKAK G+    D +
Sbjct  315   VNKGKQSVVKHMLAIDWKCWRSYLKSSSAHSITIQMLGRVAALRELFKAKLGNCSSSDYS  374

Query  1257  MNELTIDIQLPVSEKEEIKN---EVVATERIEEDTTE---KYPSACSSIVELDDVADEFF  1418
               ELT   +L   E E I N   E+ A E   +++ E   +  S  +S+V L+D  DEF+
Sbjct  375   SGELTTKSELHGKE-EGITNSDTEIQADENNHDNSVEEVDQTQSEHASLVTLNDADDEFY  433

Query  1419  DVPEASDDEHSDHGWPRSTTPEYHETPR-PKLSSAACFVRKLQDLAVQK----NFQEIVG  1583
             DVPE SD + S++GW    + +  +  R  KLS+AA FV++L DLAVQK    + QE+V 
Sbjct  434   DVPEPSDYDESENGWMTECSHQKSQDIRHQKLSTAANFVKRLHDLAVQKRGYVDLQEMVR  493

Query  1584  GEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGAD  1763
              +      YG TLP+D +  +P S   AD S+FLIRGE YL D  KI +KGTL Q+V AD
Sbjct  494   EDSSITCSYGSTLPQDPTCTLPCSLTEADPSTFLIRGENYLDDRLKIKAKGTLMQMVAAD  553

Query  1764  WLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENP  1943
             W++S+ RED+L  RPGSIVQKYAAQ  PEFFF+VNIQVPG+T YSLALYYM+ TP+ + P
Sbjct  554   WVRSDKREDDLGGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAP  613

Query  1944  LLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDV  2123
             LLE F+ GDD FRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G+NYLEL V
Sbjct  614   LLESFIKGDDTFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFQGKNYLELGV  673

Query  2124  DVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
              +GSSTVARGV++LVLGYLN+LVIEMAFL+Q +T EELPE LLGTCRLNHLDA+KAV
Sbjct  674   GIGSSTVARGVVSLVLGYLNHLVIEMAFLIQGNTREELPEFLLGTCRLNHLDATKAV  730



>gb|KHG05026.1| PCTP-like protein [Gossypium arboreum]
Length=734

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/722 (62%), Positives = 558/722 (77%), Gaps = 26/722 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWL++IR NR+GLQY RKRYF+LED+ LKS+K++P++  +EP RS IIDSCI V DNG
Sbjct  11    MEGWLHIIRSNRIGLQYSRKRYFVLEDHLLKSFKSMPVSNLQEPDRSVIIDSCIRVTDNG  70

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEK---NLRAPAI  551
             RE+ H  VFF FTL N+SNH+DQLK GA+SPEEAARWI+  ++AA+       N  A + 
Sbjct  71    RESIHSNVFFIFTLYNSSNHNDQLKLGASSPEEAARWIQSFQEAALKGGTYPGNDVACSK  130

Query  552   RKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKD  713
              +WQ FR + SS     ++      SST +D +TSDV+ P PW IFG QNGLR+FKEAKD
Sbjct  131   SRWQSFRSTGSSNTNHNNSIDWTLCSSTKMDRVTSDVVAPSPWTIFGCQNGLRLFKEAKD  190

Query  714   RNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDI  893
             R+ +GK WD HPAIMAVGVIDGTSEAIF+ LMSLGPSRSEWDFCF +GSV+EHLDGHTDI
Sbjct  191   RDSHGK-WDDHPAIMAVGVIDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVIEHLDGHTDI  249

Query  894   IHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGG  1073
             IH +L   WLP G+KRRDLLLRRYWRREDDGTYVILYHSV H KCPPQ+ Y+RA +KSGG
Sbjct  250   IHKRLYGDWLPMGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKSYIRACLKSGG  309

Query  1074  HVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSGSY-  1241
             +VI+P+N+ K S VKHML++DWK    YL+ + ++S+TI ML  +AALRE+FKAK G Y 
Sbjct  310   YVISPLNEEKHSVVKHMLAIDWKFWKFYLKTSAARSITIRMLERVAALRELFKAKQGKYP  369

Query  1242  FPDPAMNELTIDIQLPVSEKEEIKNEVVATE--RIEEDTTE---KYPSACSSIVELDDVA  1406
               D +  EL   ++L  SE++ + +     E  + +E+ +E   K  S  SS+V L+D A
Sbjct  370   SADISSGELIQAVRLQRSEEDCVVDMCTQIEAGKSKENLSEGMEKASSEHSSLVGLNDAA  429

Query  1407  DEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK----NF  1568
             DEFFDVPE +D + S  GW     PE +  +T + KLS+AA FV+KL DLAVQK    + 
Sbjct  430   DEFFDVPEPTDYDQSTDGWDSDYAPEVYSQDTRQTKLSTAAVFVKKLHDLAVQKRGYMDL  489

Query  1569  QEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQ  1748
             Q++   E+G    YG TLPKD +  +P SW AA+ S+FLIRGE YL+D  K  +KGTL Q
Sbjct  490   QDMTK-EDGICCSYGNTLPKDPTCTLPCSWTAAEPSTFLIRGENYLEDCKKFKAKGTLMQ  548

Query  1749  IVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTP  1928
             +V ADWL+S+ RED+L  RPG IVQKYAAQ  PEFFF+VNIQVPG+  YSLALYY++ TP
Sbjct  549   MVAADWLRSDKREDDLGGRPGGIVQKYAAQGGPEFFFIVNIQVPGSATYSLALYYIMNTP  608

Query  1929  LAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNY  2108
             + ++PLL  F+NGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+G+NY
Sbjct  609   VEDSPLLYNFINGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGKNY  668

Query  2109  LELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASK  2288
             LEL +D+GSSTVARGV++LVLGYLNNLVIEMAFL+QA+TEEELPE+LLGTCRLNHLDASK
Sbjct  669   LELGIDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQANTEEELPEYLLGTCRLNHLDASK  728

Query  2289  AV  2294
             ++
Sbjct  729   SI  730



>ref|XP_007009855.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
[Theobroma cacao]
 gb|EOY18665.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
[Theobroma cacao]
Length=735

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/731 (62%), Positives = 549/731 (75%), Gaps = 33/731 (5%)
 Frame = +3

Query  192   DGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQ  371
             +  MEGWLY IR NR GLQ+ RKRYFIL +N LKSYKA+PI+ +EEP+RSA+IDSCI V 
Sbjct  2     EAKMEGWLYTIRSNRFGLQFSRKRYFILHNNVLKSYKAIPISDKEEPVRSAMIDSCIRVT  61

Query  372   DNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPE----KNLR  539
             D+GRE+ H+KVFF FTL +T +H+DQLK GA S EEAA WIRCL+DAA+       KN  
Sbjct  62    DDGRESIHKKVFFIFTLHSTLDHNDQLKLGARSSEEAAIWIRCLKDAALKESRGQAKNFV  121

Query  540   APAIRKWQPFRLSVSSRMARTD-------ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIF  698
             A   ++W   RL  S++ A+          SS   +AMTSDVI P PWKIFG QNGLR+F
Sbjct  122   AFPKKRWPSLRLG-SAKTAQIKNFVDWPFRSSVHAEAMTSDVIAPSPWKIFGCQNGLRLF  180

Query  699   KEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLD  878
             KEAKD +  G HWD HPAIMAVGV+DGTSE IF+A+MSLGP+RSEWDFC  RGSVVEHLD
Sbjct  181   KEAKDGDSRGGHWDDHPAIMAVGVVDGTSETIFRAVMSLGPARSEWDFCLYRGSVVEHLD  240

Query  879   GHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRAT  1058
             GHTDIIH QL + WLPWG+KRRDLLL+RYWRREDDGTYVILYHSV H KC PQ GYVRA 
Sbjct  241   GHTDIIHKQLYSDWLPWGMKRRDLLLQRYWRREDDGTYVILYHSVFHKKCLPQSGYVRAR  300

Query  1059  VKSGGHVITPVNQGKSSTVKHMLSVDW---KSYLRKTTSKSLTIDMLGGIAALREMFKAK  1229
             +KSGG+VITPVNQGK S VKHML++DW   K YLR + ++SLTI ML  +AALRE+ KAK
Sbjct  301   LKSGGYVITPVNQGKQSLVKHMLAIDWRFWKLYLRPSAARSLTIRMLERVAALRELLKAK  360

Query  1230  SGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATE---RIEEDT-----TEKYPSACSSI  1385
              G+Y  +    E   DI L   E+E+ K E+ + +   +IEED       EK  S   S+
Sbjct  361   QGNYSSECLAGERRRDIDLHQIEREDFKMEIQSPKEIIKIEEDVLIENEVEKQASGRISL  420

Query  1386  VELDDVADEFFDVPEAS---DDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDL  1550
             + L++  DEFFDVPEAS   D +  +  WP   + E       +PKL+SAA  VRKL DL
Sbjct  421   MSLNEAPDEFFDVPEASEFTDYDPLESEWPPEPSSELRPPNIQQPKLTSAAGLVRKLHDL  480

Query  1551  AVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHS  1718
             A+QK    + QE V  E+     YG +L KD +  +P SW+A D S+FLIRG+ YL+DH 
Sbjct  481   AIQKKGYMDLQE-VAREDSIMCSYGTSLQKDPTCTLPCSWSAGDPSAFLIRGKNYLKDHQ  539

Query  1719  KITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYS  1898
             KI +KGTL Q+VGADWL S+ RED+L +R G IVQKYAA+  PEFFF+VN+Q+PGA  Y+
Sbjct  540   KIKAKGTLMQMVGADWLISDKREDDLGSRLGGIVQKYAARGGPEFFFIVNMQIPGAPMYT  599

Query  1899  LALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSL  2078
             LA+YYM+KTPL ++PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIG SL
Sbjct  600   LAMYYMIKTPLEDHPLLYNFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGHSL  659

Query  2079  EMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGT  2258
             E++YF+GQNYLE++VDVGSSTVARGV NLVLGYLNNLVIE+AF++Q +T+EELPE LLGT
Sbjct  660   EIHYFRGQNYLEVEVDVGSSTVARGVSNLVLGYLNNLVIELAFVIQGNTQEELPETLLGT  719

Query  2259  CRLNHLDASKA  2291
             CRLN LD SKA
Sbjct  720   CRLNRLDLSKA  730



>ref|XP_004149918.1| PREDICTED: uncharacterized protein LOC101207368 [Cucumis sativus]
 gb|KGN47831.1| hypothetical protein Csa_6G405930 [Cucumis sativus]
Length=733

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/729 (61%), Positives = 559/729 (77%), Gaps = 22/729 (3%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M  P+ DG MEGWLYLIR NR GLQY +KRYF+L+D+CLKS+K+VP++G EEP RSA+ID
Sbjct  1     MGAPIEDGKMEGWLYLIRSNRFGLQYSQKRYFVLQDDCLKSFKSVPVSGNEEPNRSAVID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             S I V DNGRE+ HRKVFF FTL NT N +D+LK GA+SPE+AARWIR L D  +    +
Sbjct  61    SYIRVTDNGRESIHRKVFFIFTLHNTVNQNDRLKLGASSPEDAARWIRSLLDTTLKGCSD  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRM---ARTD---ASSTPVDAMTSDVIGPCPWKIFGIQN  683
             P +N R  + R++   R   S RM   A  D    SS  ++AMTSDVI P PWKIFG QN
Sbjct  121   PTRNFRDRSKRQYPVLRFRGSKRMDWKASIDWTVCSSVQMEAMTSDVIAPSPWKIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEAKD + + + WD HPAIMAVG++ GTSE IF+ LMSLGPSRSEWDFCF RGS+
Sbjct  181   GLRLFKEAKDNDSHRRQWDDHPAIMAVGMVCGTSEEIFRTLMSLGPSRSEWDFCFLRGSL  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDIIHMQL   WLPWG+K+RD LLRRYWRREDDGTYV+LYHSV H K PPQ+G
Sbjct  241   VEHLDGHTDIIHMQLYRDWLPWGMKKRDFLLRRYWRREDDGTYVLLYHSVFHMKFPPQKG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG+V+TPVNQGK S VKHML+VDWK    YLR ++++++TI M+  +AALRE
Sbjct  301   YVRACLKSGGYVVTPVNQGKHSLVKHMLAVDWKFWKLYLRPSSARAITIRMVERLAALRE  360

Query  1215  MFKAKSGSYFPDPAMNELTI-DIQLPVSEKEEIKNEVVATE---RIEEDTTEKYPSAC--  1376
             +F+AK G    + + +   +   +LP SE +EIK E+ + E   +I+E  +++  +    
Sbjct  361   LFRAKVGDSSSEFSSSSRDLRHFELPQSEMDEIKTEIQSPETMRKIKEAFSKENEAEMPR  420

Query  1377  SSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAV  1556
             +S++ L+D  DEFFDVPE S+ +  ++ W    T +     + KLS+AA FV+KL DLAV
Sbjct  421   ASLIGLNDAVDEFFDVPEPSELDLYENEWTSDLTLQQLNMSQNKLSTAAVFVKKLHDLAV  480

Query  1557  QKN-FQEI--VGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKIT  1727
             QK  + E+  +  EE     YG TLPKD +++ P S A+AD S FLIRGE YL+D  KI 
Sbjct  481   QKKGYAELPELPREESMAYSYGSTLPKDLNFSTPCSVASADPSLFLIRGENYLKDSQKIK  540

Query  1728  SKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLAL  1907
             + GTL Q+VGADWL+S+ REDNL  RPGSIVQKYA +  PEFFFVVNIQVPG T Y+LA+
Sbjct  541   ANGTLMQLVGADWLRSDRREDNLGGRPGSIVQKYAERGGPEFFFVVNIQVPGTTMYTLAM  600

Query  1908  YYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMN  2087
             YYM++TPL  +PLL+ FV GDDAFRNS+FKLIPYIS+GSWIVKQSVGKK+CL+G +LE++
Sbjct  601   YYMMRTPLESSPLLKNFVEGDDAFRNSRFKLIPYISQGSWIVKQSVGKKACLVGHALEVH  660

Query  2088  YFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRL  2267
             YF+G+NYLE+++DVGSSTVARGV++LVLGYLNNLVIEMAF++Q +T+EELPE LLGTCRL
Sbjct  661   YFRGKNYLEVEIDVGSSTVARGVVSLVLGYLNNLVIEMAFVIQGNTQEELPEILLGTCRL  720

Query  2268  NHLDASKAV  2294
             NHLD +K++
Sbjct  721   NHLDVAKSL  729



>emb|CDP07099.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/725 (63%), Positives = 551/725 (76%), Gaps = 32/725 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQY RKRYF+L+D+ LKS+K++P    E+PLRSAIIDSCI   DNG
Sbjct  1     MEGWLYLIRSNRFGLQYSRKRYFVLQDHLLKSFKSIPPAHDEDPLRSAIIDSCIRAADNG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW  560
             RE+  R+VFF FTL NTSNH DQLK GA+SPEEAARW+  +++AA+  ++N     I   
Sbjct  61    RESIQRRVFFIFTLYNTSNHSDQLKLGASSPEEAARWMHSIQEAALKVDQN--QVVIDSS  118

Query  561   QP----FRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAK  710
             +P     RL  SS+   +++      SS  +DAMTSDV+ P PWKIFG +NGLR+FKEAK
Sbjct  119   EPDAKSLRLDCSSKTHYSNSIDWTLRSSRVIDAMTSDVVAPSPWKIFGCENGLRLFKEAK  178

Query  711   DRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
             DR  + K WD HPAIMAVGVIDG+SEAIF+ LMSLGPSRSEWDFC  +GSV+EHLDGHTD
Sbjct  179   DRESHAK-WDDHPAIMAVGVIDGSSEAIFQTLMSLGPSRSEWDFCLYKGSVIEHLDGHTD  237

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             I+H  L  +WLPWG+K RDLLLRRYWRREDDGTYVILYHSV H +CPPQ GYVRA +KSG
Sbjct  238   IVHKLLYRNWLPWGMKPRDLLLRRYWRREDDGTYVILYHSVFHQRCPPQVGYVRACLKSG  297

Query  1071  GHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS-  1238
             G VI+PVNQGK S V+HML++DWK   SYL+ ++++S+TI MLG +AALRE+F+AK G+ 
Sbjct  298   GFVISPVNQGKQSVVRHMLAIDWKFWKSYLQTSSARSITIRMLGRLAALRELFRAKLGNN  357

Query  1239  YFPDPAMNELTIDIQL-PVSEKEEIKNEVVATERIEEDTTE-----KYPSACSSIVELDD  1400
                D +  ELT + +L  + E   I+       R   D  E     K PS  +S++ L+D
Sbjct  358   SVSDFSSGELTKESRLHQIGEGLRIEVPTRLETRKSIDDAEGEEVVKTPSEHASLLGLND  417

Query  1401  VADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK----  1562
              ADEFFDVPE  D + S++GW    + E +  +T  PKLS+AA FV+KL DLAVQK    
Sbjct  418   AADEFFDVPEPLDYDQSENGWSSDFSSETYSQDTRTPKLSTAAVFVKKLHDLAVQKRGYV  477

Query  1563  NFQEIVGGEEGAKGC-YGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGT  1739
             + QE+    E +  C YG TLPKD + N+  SW   D S+FLIRG+ YL DH KI + GT
Sbjct  478   DLQEM--AREDSMSCNYGFTLPKDQTCNLLSSWTETDPSTFLIRGKTYLDDHKKIKANGT  535

Query  1740  LTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYML  1919
             L Q+V ADWL+S+ RED+LA RPGSIVQKYAA+  PEFFF+VNIQVPG+T Y+LALYYM+
Sbjct  536   LMQMVAADWLRSDKREDDLAGRPGSIVQKYAAKGGPEFFFIVNIQVPGSTTYNLALYYMM  595

Query  1920  KTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKG  2099
              + L + PLLERFV GDDA RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF G
Sbjct  596   SSSLEDAPLLERFVKGDDADRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFHG  655

Query  2100  QNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLD  2279
             +NY+EL VD+GSSTVARGV+NLVLGYLNNLVIEMAFLVQA+T +ELPE LLGTCRLNHLD
Sbjct  656   KNYIELGVDIGSSTVARGVVNLVLGYLNNLVIEMAFLVQANTTDELPEFLLGTCRLNHLD  715

Query  2280  ASKAV  2294
             ASKA+
Sbjct  716   ASKAI  720



>ref|XP_002316372.1| pleckstrin homology domain-containing family protein [Populus 
trichocarpa]
 gb|EEF02543.1| pleckstrin homology domain-containing family protein [Populus 
trichocarpa]
Length=725

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/724 (62%), Positives = 558/724 (77%), Gaps = 27/724 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLY+IR NR GLQ+ RKRYFIL++N LK YK  PI+  EEPLRSA IDS I + DNG
Sbjct  1     MEGWLYVIRSNRFGLQFSRKRYFILQENYLKCYKTRPISQEEEPLRSANIDSYIRITDNG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----NPEKNLRAPA  548
             RE+ +RKVFF FTL NT   +DQLK GA+S E+A +WIR L++A +    NPEK   + +
Sbjct  61    RESINRKVFFIFTLYNTLKDNDQLKLGASSSEDAGKWIRSLQNAVVKECPNPEKEFMSFS  120

Query  549   IRKWQPFRLSVSSRM-ARTDASSTPV---DAMTSDVIGPCPWKIFGIQNGLRIFKEAKDR  716
              + W P R   S R  ++      P    +A+TSDVI P  WKIFG QNGLR+FKEAKD 
Sbjct  121   KKNWPPSRFGSSKRAGSKRSVGYYPFLQNEAVTSDVIAPSTWKIFGCQNGLRLFKEAKDW  180

Query  717   NPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDII  896
             +  G+HWD HPAIMAVGV+DGT EAIF+ LMSLG SRSEWDFCF RGSVVEHLDGHTDI+
Sbjct  181   DSRGRHWDDHPAIMAVGVVDGTPEAIFRTLMSLGASRSEWDFCFYRGSVVEHLDGHTDIL  240

Query  897   HMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGH  1076
             H +L ++WLPWG++RRDLLLRRYWRRE+DGTYVILYHSVIH KCPPQ+GYVRA +KSGG+
Sbjct  241   HKKLYSNWLPWGMRRRDLLLRRYWRREEDGTYVILYHSVIHKKCPPQKGYVRACLKSGGY  300

Query  1077  VITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFP  1247
             VITPVNQG+ S VKHML++DWK    YLR  +++S+TI ML  IAALRE+F+AKSG++  
Sbjct  301   VITPVNQGRESLVKHMLAIDWKFWKVYLRPPSARSITIRMLERIAALRELFRAKSGNHPS  360

Query  1248  DPAMNELTIDIQLPVSEKEEIKNEVVATERIE------EDTTEKYPSACSSIVELDDVAD  1409
             D + ++ ++   LP    E+I++E    ++ E      E+  EK  S   S++ L+D +D
Sbjct  361   DFSSSDSSVKTMLPQDGMEDIESEDKGQQKFEQNADLKENEAEKTNSGRRSLMSLNDASD  420

Query  1410  EFFDVPEASDDEHSD---HGW--PRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK----  1562
             EFFD P++++D   D   +GW   +S         + +LSSAA FV+KL DLAVQK    
Sbjct  421   EFFDFPDSNEDIDFDLLENGWYPEKSQEQPTSHICQHRLSSAAVFVKKLHDLAVQKKGYI  480

Query  1563  NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTL  1742
             +FQE+   EE     YG TL KD++Y++P SWA A+ S+FLIRGE YL+D+ KI +KG+L
Sbjct  481   DFQEL-PKEENVATSYGNTLQKDSTYSLPCSWATAEPSTFLIRGENYLKDNQKIKAKGSL  539

Query  1743  TQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLK  1922
              Q+VGADWL+S+ RED+L +RP SI+QKYAAQ RPEFFFV+NIQVPGAT+Y++ALYYMLK
Sbjct  540   MQMVGADWLRSDHREDDLGSRPESIIQKYAAQGRPEFFFVINIQVPGATQYTIALYYMLK  599

Query  1923  TPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQ  2102
             TPL E PLL  FV+GDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE++YF+G+
Sbjct  600   TPLEETPLLHSFVHGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEIHYFRGK  659

Query  2103  NYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDA  2282
             NYLELD+DVGSSTVARGV++LVLGYLNNLVIEMAFLVQ + EEELPE LLGTCRLN+LD 
Sbjct  660   NYLELDIDVGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNNEEELPEILLGTCRLNNLDV  719

Query  2283  SKAV  2294
             SK+V
Sbjct  720   SKSV  723



>ref|XP_011041015.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Populus euphratica]
Length=734

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/733 (61%), Positives = 558/733 (76%), Gaps = 27/733 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +D  MEGWLY+IR NR GLQ+ RKRYFIL+D+ LK YK  PI+  EEPLRSA ID
Sbjct  1     MGVSQNDCKMEGWLYVIRSNRFGLQFSRKRYFILQDSYLKCYKTRPISQEEEPLRSANID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             S I + DNGRE+ +RKVFF FTL NT   +DQLK GA+S E+A +WIR L++A +    N
Sbjct  61    SYIRITDNGRESINRKVFFIFTLYNTLKDNDQLKLGASSSEDAGKWIRSLQNAVVKECPN  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRM-ARTDASSTPV---DAMTSDVIGPCPWKIFGIQNGL  689
             PEK   + + + W P R   S R  ++      P    +A+TSDVI P  WKIFG QNGL
Sbjct  121   PEKEFMSFSKKNWPPSRFGSSKRADSKRSVGYYPFLQNEAVTSDVIAPSTWKIFGCQNGL  180

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEAKD +  G+HWD HPAIMAVGV+DGT EAIF+ LMSLG SRSEWDFCF RGSVVE
Sbjct  181   RLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTPEAIFRTLMSLGASRSEWDFCFYRGSVVE  240

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDI+H +L ++WLPWG++RRDLLLRRYWRRE+DGTYVILYHSVI  KCPPQ+GYV
Sbjct  241   HLDGHTDILHKKLYSNWLPWGMRRRDLLLRRYWRREEDGTYVILYHSVIQKKCPPQKGYV  300

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMF  1220
             RA +KSGG+VITPVNQG+ S VKHML++DWK    YLR  +++S+TI ML  IAALRE+F
Sbjct  301   RACLKSGGYVITPVNQGRESLVKHMLAIDWKFWKVYLRPPSARSITIRMLERIAALRELF  360

Query  1221  KAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIE------EDTTEKYPSACSS  1382
             +AKSG++  D + ++ ++   LP +  E+I++E    ++ E      E+  EK  S   S
Sbjct  361   RAKSGNHPSDFSSSDSSVKTMLPKAGMEDIESEDKGQQKFEQNADLKENEAEKKNSGRRS  420

Query  1383  IVELDDVADEFFDVPEASDDEHSD---HGW--PRSTTPEYHETPRPKLSSAACFVRKLQD  1547
             ++ L+D +DEFFD P++++D   D   +GW   +S           +LSSAA FV KL D
Sbjct  421   LMSLNDASDEFFDFPDSNEDMDFDLLENGWYPEKSQEQPASHICLHRLSSAAVFVNKLHD  480

Query  1548  LAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDH  1715
             LAVQK    +FQE+   +      YG TL KD++Y++P SWA A+ S+FLIRGE YL+D 
Sbjct  481   LAVQKKGYIDFQEL-PKDANVATSYGNTLQKDSTYSLPCSWATAEPSTFLIRGENYLKDS  539

Query  1716  SKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRY  1895
              KI +KG+L Q+VGADWL+S+ RED+L +RP SI+QKYAAQ RPEFFFV+NIQVPGAT+Y
Sbjct  540   QKIKAKGSLMQMVGADWLRSDHREDDLGSRPESIIQKYAAQGRPEFFFVINIQVPGATQY  599

Query  1896  SLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQS  2075
             +LALYYMLKTPL E PLL  FV+GDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+
Sbjct  600   TLALYYMLKTPLEETPLLHSFVHGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQA  659

Query  2076  LEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLG  2255
             LEM+YF+G+NYLELD+DVGSSTVARGV++LVLGYLNNLVIEMAFLVQ + EEELPE LLG
Sbjct  660   LEMHYFRGKNYLELDIDVGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNNEEELPEMLLG  719

Query  2256  TCRLNHLDASKAV  2294
             TCRLN+LD SK+V
Sbjct  720   TCRLNNLDVSKSV  732



>ref|XP_006592703.1| PREDICTED: uncharacterized protein LOC100779206 [Glycine max]
 gb|KHN11217.1| hypothetical protein glysoja_034446 [Glycine soja]
Length=736

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/716 (62%), Positives = 555/716 (78%), Gaps = 20/716 (3%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR+GLQ+ RKRYF+L+ N L+S+K+VP++  ++P+RSAI+DSCI V DNG
Sbjct  19    MEGWLYLIRFNRIGLQFSRKRYFVLDGNLLRSFKSVPVSNNQDPVRSAIVDSCIRVMDNG  78

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAI---  551
             RE+ +RKVFF FTL NTSNH+DQLKFGA+ PEEAARWI+   +A++    +    A+   
Sbjct  79    RESVNRKVFFIFTLYNTSNHNDQLKFGASRPEEAARWIQSFHEASLRGAPDGGDDAVGCS  138

Query  552   -RKWQPFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNG  728
              R+WQ FRLS SS    +  +S      ++DVI P PW IFG QNGLR+FKEAKDR+ NG
Sbjct  139   KRRWQSFRLSGSSSSI-SHPNSVDWTLSSADVIAPSPWTIFGCQNGLRLFKEAKDRDSNG  197

Query  729   KHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQL  908
             K WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +G+VVEHLDGHTDIIH QL
Sbjct  198   KKWDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQL  257

Query  909   TTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITP  1088
              + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCPPQ+GYVRA +KSGG+VI+P
Sbjct  258   FSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISP  317

Query  1089  VNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YFPDPA  1256
             VN+GK S VKHML++DWK   SYL+ +++ S+TI MLG +AALRE+FKA+ G+    D +
Sbjct  318   VNKGKQSVVKHMLAIDWKCWRSYLKSSSAHSITIRMLGRVAALRELFKARLGNCSSSDYS  377

Query  1257  MNELTIDIQLPVSEKEEIKN--EVVATERIEEDTT---EKYPSACSSIVELDDVADEFFD  1421
               ELT + +L + E+  I +  E+ A E   +++    ++  S  + +V L+D  DEF+D
Sbjct  378   SGELTRNSELHIKEEVIINSDTEIQADENNHDNSVGEVDQTQSEHACLVTLNDADDEFYD  437

Query  1422  VPEASDDEHSDHGWPRSTTPEYHETPR-PKLSSAACFVRKLQDLAVQK----NFQEIVGG  1586
             VPE SD + S++GW    + +  +  R  KLS+AA FV++L DLAVQK    + QE+V  
Sbjct  438   VPEPSDCDESENGWMTECSQQKSQDIRHQKLSTAANFVKRLHDLAVQKRGYVDLQEMVR-  496

Query  1587  EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADW  1766
             E+     YG TLP+D +  +P S    D  +FLIRGE YL+D  K+ +KGTL ++V ADW
Sbjct  497   EDSITCSYGSTLPQDPTCTLPCSLTETDPYTFLIRGENYLEDRQKVKAKGTLMKMVAADW  556

Query  1767  LQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPL  1946
             ++S+ RED+L  RPGSI QKYAAQ  PEFFF+VNIQVPG+T YSLALYYM+ TP+ + PL
Sbjct  557   VRSDKREDDLGGRPGSIAQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPL  616

Query  1947  LERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVD  2126
             LE F+ GDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G NYLEL VD
Sbjct  617   LESFIKGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFQGSNYLELGVD  676

Query  2127  VGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             +GSSTVARGV++LVLGYLN+LVIEMAFL+Q +T EELPE LLGTCRLNHLDASKAV
Sbjct  677   IGSSTVARGVVSLVLGYLNHLVIEMAFLIQGNTREELPEFLLGTCRLNHLDASKAV  732



>ref|XP_004291708.1| PREDICTED: uncharacterized protein LOC101295593 [Fragaria vesca 
subsp. vesca]
Length=734

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/727 (61%), Positives = 555/727 (76%), Gaps = 27/727 (4%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             +D  MEGWLYLIR NR+GLQY RKRYF+L+ + L+S+K+VP++G E P+RSA+ID+CI V
Sbjct  6     NDQTMEGWLYLIRSNRIGLQYSRKRYFVLQGHLLQSFKSVPVSGNEVPVRSAVIDACIRV  65

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPA  548
              D+GRE+  RKVFF FTL NTSNH+DQLK GA+SPEEAARWI   ++ A+    +L +  
Sbjct  66    TDDGRESISRKVFFIFTLYNTSNHNDQLKLGASSPEEAARWIHSFQELALKGSPDLGSNV  125

Query  549   IR----KWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIF  698
             +      W+ FRL  S+R +R      T  SST  DA+TSDVI P PW IFG QNGLR+F
Sbjct  126   LECSSSMWKSFRLGGSNRGSRITSIDWTLCSSTQTDAVTSDVIAPSPWTIFGCQNGLRLF  185

Query  699   KEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLD  878
             KEAKDR+ +GK WD HPAIMAVGV+ GTSEAIF+ LMSLGPSRSEWDFCF  GSVVEHLD
Sbjct  186   KEAKDRDSHGK-WDDHPAIMAVGVVGGTSEAIFQTLMSLGPSRSEWDFCFYNGSVVEHLD  244

Query  879   GHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRAT  1058
             GHTDIIH QL + WLPWG+K RDLLLRRYWRREDDGTYVILYHSV H KCP Q+GYVRA 
Sbjct  245   GHTDIIHKQLYSDWLPWGMKPRDLLLRRYWRREDDGTYVILYHSVFHKKCPSQKGYVRAC  304

Query  1059  VKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAK  1229
             +KSGG+VI+PVNQGK S VKHML++DWK   SYL+ ++S+++TI MLG +AALRE+FK K
Sbjct  305   LKSGGYVISPVNQGKHSVVKHMLAIDWKYWKSYLQTSSSRAMTIKMLGRVAALRELFKTK  364

Query  1230  SGSYFPDP-AMNELTIDIQLPVSEKEEIKNEVVAT------ERIEEDTTEKYPSACSSIV  1388
              G+Y     +  EL I+  +  ++     + +  T      E + E+  E+ PS  +S+V
Sbjct  365   VGNYSSSEFSSGELRINFGVHQNDGYGEADALTLTGDESTNEHVSEEV-ERSPSEHASLV  423

Query  1389  ELDDVADEFFDVPEASDDEHSDHGW-PRSTTPEYHETPR-PKLSSAACFVRKLQDLAVQK  1562
              L+D +DEFFDVPE  + + S+  W P   +  Y +  R PKLS+AA FV++L DLAVQK
Sbjct  424   SLNDASDEFFDVPEPPNHDESETDWTPDFGSDIYSQDIRHPKLSTAAGFVKRLHDLAVQK  483

Query  1563  N--FQEIVGGEEGAKGCY-GCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSK  1733
                   +   +E +  CY G TLPKD++  +  SW   D S+FLIR + YL+D  K+ +K
Sbjct  484   RGYVDLLEMAKEDSMSCYYGSTLPKDSTCFLACSWTETDPSTFLIRSKSYLEDRKKVKAK  543

Query  1734  GTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYY  1913
             GTL Q+V ADWL+S+ RED+L  RPGSIVQKYAA+   EFFF+VNIQVPG+T YSLALYY
Sbjct  544   GTLMQMVAADWLRSDKREDDLGRRPGSIVQKYAAKGGSEFFFIVNIQVPGSTTYSLALYY  603

Query  1914  MLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYF  2093
             M+ +P+ + PLLE F+ GDDA+RNS+FKLIPYIS+GSWIVKQSVGKK+CLIGQ+LE+NYF
Sbjct  604   MMSSPIEDAPLLENFIKGDDAYRNSRFKLIPYISQGSWIVKQSVGKKACLIGQALEINYF  663

Query  2094  KGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNH  2273
              G+NYLEL +D+GSSTVARGV++LVLGYLNNLVIEMAFL+QA+T EELPE+LLGTCRLNH
Sbjct  664   HGKNYLELGIDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQANTPEELPEYLLGTCRLNH  723

Query  2274  LDASKAV  2294
             LDASKA+
Sbjct  724   LDASKAI  730



>gb|KDO73324.1| hypothetical protein CISIN_1g004508mg [Citrus sinensis]
Length=742

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/733 (62%), Positives = 557/733 (76%), Gaps = 47/733 (6%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S G MEGWL+LIR NR+GLQY RKRYF+LED+ LKS+K+VP +  E+P+RSAIIDSCI V
Sbjct  8     SQGRMEGWLHLIRSNRIGLQYSRKRYFLLEDHFLKSFKSVPHSKNEDPVRSAIIDSCIRV  67

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI--NPEK----  530
              DNGRE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAA+WI  L++AA+   P +    
Sbjct  68    TDNGRESIHRKVFFIFTLYNTSNHNDQLKLGASSPEEAAKWIHSLQEAALKGGPHQGVGD  127

Query  531   NLRAPAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLR  692
             ++  P    W+ FRLS SSR + T +      S T ++ +T+DVI P PW IFG QN   
Sbjct  128   HIGCPN-SPWESFRLSGSSRASHTKSIDWTLCSGTHMEQVTADVIAPSPWTIFGCQN---  183

Query  693   IFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEH  872
                E KDR   GK WD HPAIMAVGV+DGTSEAIF+ LMSLG SRS WDFCF RG VVEH
Sbjct  184   ---EGKDRGSRGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGASRSVWDFCFYRGCVVEH  239

Query  873   LDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVR  1052
             LDGHTDIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCP Q+G VR
Sbjct  240   LDGHTDIIHKQLYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVR  299

Query  1053  ATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFK  1223
             A +KSGG+VITP+N GK S VKHML++DWK   SYL+ ++++S+TI MLG +AALRE+F+
Sbjct  300   ACLKSGGYVITPMNHGKKSVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFR  359

Query  1224  AKSGSYF-PDPAMNELTID----------IQLPVSEKEEIKNEVVATERIEEDTTEKYPS  1370
             AK G+Y  P+    ELT +          +Q+P  +    KN    +E +++ ++E    
Sbjct  360   AKQGNYSSPEFLSGELTRNMRMHQTDGNMVQMPTEDGNSKKN---TSEEVDQVSSEH---  413

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQ  1544
               +S+V L+D ADEFFDVPE SD + S++GW     PE +  +T  PK+S+AA FVRKL 
Sbjct  414   --ASLVGLNDAADEFFDVPEPSDYDDSENGWTSDFGPEMNSQDTRHPKISTAAGFVRKLH  471

Query  1545  DLAVQK-NFQEIVGG--EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDH  1715
             DLAVQK  + ++ G   E+    CYG TL KD +  +P SW + D S+FLIRG+ YLQD 
Sbjct  472   DLAVQKRGYVDLQGTAKEDNFSCCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDR  531

Query  1716  SKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRY  1895
              K+ +KGTL Q+V ADWL+S+ RED+L  RPG IVQKYA Q  PEFFF++NIQVPG+T Y
Sbjct  532   HKVKAKGTLMQMVAADWLKSDKREDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTY  591

Query  1896  SLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQS  2075
             SLALYYM+ TP+ + PLLE F+NGDDA+RNS+FKLIPYIS+GSWIVKQSVGKK+CLIGQ+
Sbjct  592   SLALYYMMTTPVKDAPLLESFINGDDAYRNSRFKLIPYISEGSWIVKQSVGKKACLIGQA  651

Query  2076  LEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLG  2255
             LE+NYF G+NYLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFL+QA+TEEELPE LLG
Sbjct  652   LEINYFHGKNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQANTEEELPEFLLG  711

Query  2256  TCRLNHLDASKAV  2294
             TCRLNHLDA+KAV
Sbjct  712   TCRLNHLDAAKAV  724



>ref|XP_010920448.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X3 [Elaeis 
guineensis]
Length=738

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/734 (61%), Positives = 540/734 (74%), Gaps = 28/734 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +   D  MEGWLYLIR NRLGLQY RKRYF+LEDN L  YKAVP + RE+P+RSA+ID
Sbjct  1     MGITEGDRRMEGWLYLIRSNRLGLQYSRKRYFVLEDNALNCYKAVPASRREDPIRSALID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             SCI V DNGR + HR VF+ FTL +++NH+D+LK GA S EEAA WIR L +AA+    N
Sbjct  61    SCIRVTDNGRASIHRSVFYIFTLYSSANHNDRLKLGARSSEEAASWIRSLMEAALKECPN  120

Query  522   PEKNLRAPAIRKWQPFRLS---VSSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQN  683
              E+N  A + R+ Q FRLS     S M   D    SS   D M SDVI P PW IFG +N
Sbjct  121   KEENFVACSKRRRQSFRLSRTKARSLMHSIDWTVYSSVHADPMASDVIAPSPWTIFGCKN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKE+ + + +GK WD HPAIMAVGV+D TSEAIF+ +MSLGPSRSEWDF    G V
Sbjct  181   GLRLFKESNEGDFHGKQWDDHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDIIH +L   WLPWG+K+RDLLLRRYWRREDDGTYVILYHSV H  C P+ G
Sbjct  241   VEHLDGHTDIIHKKLRGDWLPWGMKKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALRE  1214
             Y+RA +KSGG+VI+PVNQGK S VKHML++DWK   SY+  +++K +TI MLG +A LRE
Sbjct  301   YIRACLKSGGYVISPVNQGKRSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAGLRE  360

Query  1215  MFKAKSGS-YFPDPAMNELTIDIQLPVSEKEEIKNEV---------VATERIEEDTTEKY  1364
              F+AK G+    D +  ELT +I LP  EKE IK EV         V +    + +  ++
Sbjct  361   FFRAKLGNCTCSDYSSGELTREIGLPYGEKEHIKVEVQTTGENNKSVDSAEAPQQSPSRH  420

Query  1365  PSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQ  1544
                  S ++L+D ADEFFDV + SD++ ++  WP        E  +P+LS+AA FV+KL 
Sbjct  421   ADTNGSFLQLNDAADEFFDVIDESDNDQTESLWPSDEGMHSQEQRQPRLSTAAVFVKKLH  480

Query  1545  DLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQD  1712
             D AVQK    + QE   G+  A   YG TLPKD S  MP SWA AD++SFLIRGE YL+D
Sbjct  481   DFAVQKKGYIDLQEASMGDM-APCSYGATLPKDTSCTMPCSWAMADSTSFLIRGESYLRD  539

Query  1713  HSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATR  1892
             H KI +  TL Q+V ADWL S+ RED+L  RPG IVQKYAAQ   EFFF+VNIQVPG+T 
Sbjct  540   HQKIKANSTLMQMVAADWLNSDKREDDLGGRPGGIVQKYAAQGGSEFFFIVNIQVPGSTT  599

Query  1893  YSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQ  2072
             YSLALYYM+ TPL   PLLE FV GD+A+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ
Sbjct  600   YSLALYYMMDTPLENVPLLESFVKGDNAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQ  659

Query  2073  SLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLL  2252
             +LE++YF+G NYLEL +DVGSSTVARGV++LVLGYLNNLVIE+AFL+Q +T+EELPE LL
Sbjct  660   ALEIHYFRGSNYLELGIDVGSSTVARGVVSLVLGYLNNLVIELAFLIQGNTQEELPEFLL  719

Query  2253  GTCRLNHLDASKAV  2294
             GTCRLNHLDASK+V
Sbjct  720   GTCRLNHLDASKSV  733



>ref|XP_009344767.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Pyrus x bretschneideri]
Length=735

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/734 (61%), Positives = 548/734 (75%), Gaps = 30/734 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLY+I  NR GLQY RKRYFIL+DNCL+S+KA P +  EEP+RSA+ID
Sbjct  1     MGISQNDGKMEGWLYIIGSNRFGLQYSRKRYFILKDNCLRSFKAKPSSDSEEPVRSAVID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             +CI   DNGR + HRK FF FTL NTSN+ DQLK GA+S EEAA+WIR L+DAA+    N
Sbjct  61    TCIRATDNGRASIHRKGFFVFTLYNTSNNSDQLKLGASSSEEAAKWIRSLQDAALKACPN  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQN  683
               ++  A +  +W  FRL  S R  R      T +S    + MTSDVI P PWKIFG QN
Sbjct  121   ATRDFVACSKSRWPSFRLVGSRRTERKNSVDWTFSSLMHTEGMTSDVIAPSPWKIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEAKD +  G+HWD HPAIMAVGV+DGTSEAIF+ L+SLGPSRSEWDFC+ RGSV
Sbjct  181   GLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFRTLLSLGPSRSEWDFCYYRGSV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VE LDGHTDIIH QL + WLPWG++RRDLL+RRYWRREDDGTYVILYHSV H KC P+ G
Sbjct  241   VERLDGHTDIIHQQLYSDWLPWGMQRRDLLIRRYWRREDDGTYVILYHSVSHKKCRPKRG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG VITP NQGK S V+HML++DWK    YLR ++++ +TI ML  +AALRE
Sbjct  301   YVRACLKSGGFVITPANQGKQSLVRHMLAIDWKFWKLYLRPSSARCITIRMLERVAALRE  360

Query  1215  MFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIE--------EDTTEKYPS  1370
             +F+AK+G+  P+ +  +++ +I+   S ++ IK EV     ++        ED  EK P 
Sbjct  361   LFRAKAGTSSPEFSSGDMSSEIKFSQSGQQNIKTEVQHPGEVKKMEEGVLMEDEVEK-PE  419

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETP--RPKLSSAACFVRKLQ  1544
               +S+  L D ADEFFDVPE ++ +  ++ WP   + E + T    PKLSSAA  V+KL 
Sbjct  420   GRASLKGLHDAADEFFDVPEPTEYDQFENEWPSDVSMEQNPTSIQHPKLSSAAVLVKKLH  479

Query  1545  DLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQD  1712
             +L VQK    + QE+   +E +   YG TL KD S  +P SW +AD SSFLIRG  YL+D
Sbjct  480   ELRVQKKGYMDLQEV--SKEDSVCPYGATLQKDPSCALPCSWGSADPSSFLIRGPNYLRD  537

Query  1713  HSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATR  1892
               KI +K TL Q+VG DWL+S+ RED+L +R GSIVQK A +   EFFF+VNIQVPG T 
Sbjct  538   RQKIKAKSTLMQLVGVDWLRSDKREDDLGSRYGSIVQKSAERGGSEFFFIVNIQVPGTTM  597

Query  1893  YSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQ  2072
             Y+LA YYM+KTPL E PLL  FVNGDD++RNS+FKLIPYISKGSWIVKQ VG+K+CL+GQ
Sbjct  598   YTLAFYYMIKTPLEETPLLHDFVNGDDSYRNSRFKLIPYISKGSWIVKQRVGEKACLVGQ  657

Query  2073  SLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLL  2252
             +LE++YF+G+NYLEL VDVGSSTVARGV+NLVLGYLNNLVIEMAFL+QA+TEEELPE LL
Sbjct  658   ALEVHYFRGKNYLELGVDVGSSTVARGVVNLVLGYLNNLVIEMAFLIQANTEEELPEMLL  717

Query  2253  GTCRLNHLDASKAV  2294
             GTCR+N LDASK+V
Sbjct  718   GTCRINQLDASKSV  731



>ref|XP_009103673.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Brassica 
rapa]
Length=733

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/726 (60%), Positives = 551/726 (76%), Gaps = 28/726 (4%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S+  MEGWLY+IR NR GL + +KRYFIL D+ LKS+K++  +  ++  RSA+IDSCI V
Sbjct  6     SEAKMEGWLYIIRSNRFGLHFSKKRYFILADHLLKSFKSISDSKTKDGGRSAVIDSCIRV  65

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN---LR  539
              DNGRE+ HRK FF FTL NTSNH+DQLK GA+SPE+AARWI  +++ A+    N   + 
Sbjct  66    TDNGRESVHRKAFFIFTLYNTSNHNDQLKLGASSPEDAARWINLIKEEALKGSSNPGDVF  125

Query  540   APAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTS-DVIGPCPWKIFGIQNGLRIF  698
             + +  +W   RLS S R   +++      SS  VD +T+ DV+ P PW IFG QNGLR+F
Sbjct  126   SCSRSRWDSLRLSSSVREHHSNSIDWTLRSSARVDPVTTTDVVAPSPWTIFGCQNGLRLF  185

Query  699   KEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLD  878
             KEAK+R+  G+ WD HPAIMAVGV+DGTSE IF+ L+SLGPSRSEWDFCF +GSVVEHLD
Sbjct  186   KEAKERDSLGR-WDDHPAIMAVGVVDGTSENIFQTLLSLGPSRSEWDFCFFQGSVVEHLD  244

Query  879   GHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRAT  1058
             GHTDIIH QL + WLPWG+KRRD  LRRYWRREDDGTYVILYHSV H KCPPQ+GY+RA 
Sbjct  245   GHTDIIHKQLYSDWLPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYIRAC  304

Query  1059  VKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAK  1229
             +KSGG+VI+P++ GK S VKHML+VDWKS   Y++ + ++S+T+ MLG I+ALRE+F+AK
Sbjct  305   LKSGGYVISPIDNGKQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAK  364

Query  1230  SGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATE-RIEEDTT----EKYPSACSSIVEL  1394
              GS+   P+  EL+   +L  +E+         TE  + +D      +K+PS  SS+V+L
Sbjct  365   HGSF---PSSGELSRSARLNQNEESGFGESSSLTECEMYKDPANEERDKFPSERSSLVDL  421

Query  1395  DDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK--  1562
             +D  DEFFDVPE SD++H D  W      + +  +T +PKL+SA+  VRK+ DLAVQK  
Sbjct  422   NDGVDEFFDVPEPSDNDHLDDNWASDFDSDTYSQDTRQPKLNSASSLVRKIHDLAVQKRG  481

Query  1563  --NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKG  1736
               +  E    E     CYG TLP D +  +P SW   D+S+FLIRG+ YL D  K+T+KG
Sbjct  482   YVDLHERAREESSTPCCYGTTLPTDPTCALPCSWTTTDSSTFLIRGKTYLSDQKKVTAKG  541

Query  1737  TLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYM  1916
             TL Q+V ADWL+S+ RED+L +RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL LYYM
Sbjct  542   TLMQMVAADWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYM  601

Query  1917  LKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFK  2096
             + TP+ E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+
Sbjct  602   MSTPIEEHPLLVSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFR  661

Query  2097  GQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHL  2276
             G+NY+EL VD+GSSTVARGV++LVLGYLN LVIEMAFLVQA+TEEELPE+LLGTCRLNHL
Sbjct  662   GKNYIELGVDIGSSTVARGVVSLVLGYLNKLVIEMAFLVQANTEEELPEYLLGTCRLNHL  721

Query  2277  DASKAV  2294
             DASK+V
Sbjct  722   DASKSV  727



>ref|XP_008367183.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Malus domestica]
Length=735

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/734 (61%), Positives = 550/734 (75%), Gaps = 30/734 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +P +DG MEGWLY+I  NR GLQY RKRYFIL+DNCL+S+KA P +  EEP+RSA+ID
Sbjct  1     MGIPQNDGKMEGWLYIIGSNRFGLQYSRKRYFILKDNCLRSFKAKPSSDSEEPVRSAVID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             +CI   DNGR + HRK FF FTL NTSN+ DQLK GA+S EEAA+WIR L+DAA+    N
Sbjct  61    TCIRATDNGRASIHRKGFFVFTLYNTSNNSDQLKLGASSSEEAAKWIRSLQDAALKACPN  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR---TDASSTPV---DAMTSDVIGPCPWKIFGIQN  683
               ++  A +  +W  FRL  S R  R    D + +P+   + MTSDVI P PWKIFG QN
Sbjct  121   ATQDFVACSKSRWPSFRLVGSRRTERKNSVDWTFSPLMHTEGMTSDVIAPSPWKIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEAKD +  G+HWD HPAIMAVGV+DGTSEAIF+ L+SLGPSRSEWDFC+ +GSV
Sbjct  181   GLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFRTLLSLGPSRSEWDFCYYQGSV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VE LDGHTDIIH QL + WLPWG++RRDLL+RRYWRREDDGTYVILYHSV H KCPP+ G
Sbjct  241   VERLDGHTDIIHQQLYSDWLPWGMQRRDLLIRRYWRREDDGTYVILYHSVSHKKCPPKRG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG VITP NQGK S V+HML++DWK    YLR ++++ +TI ML  +AALRE
Sbjct  301   YVRACLKSGGFVITPANQGKQSLVRHMLAIDWKFWKLYLRPSSARCITIRMLERVAALRE  360

Query  1215  MFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIE--------EDTTEKYPS  1370
             +F AK+G+  P+    +++ +I+   S ++ IK EV     ++        ED  EK P 
Sbjct  361   LFGAKAGTSSPEFXSGDMSSEIKFSQSGQQNIKTEVQHPGEVKKMEEGVLVEDEVEK-PE  419

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETP--RPKLSSAACFVRKLQ  1544
               +S+  L D ADEFFDVPE ++ +  ++ WP   + E + T     KLSSAA  V+KL 
Sbjct  420   GRASLKGLHDAADEFFDVPEPTEYDQFENEWPSDVSMEQNPTSIQHHKLSSAAVLVKKLH  479

Query  1545  DLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQD  1712
             +L VQK    + QE+   +E +   YG TL KD S  +P SW +AD SSFLIRG  YL+D
Sbjct  480   ELRVQKKGYMDLQEVC--KEDSVCPYGATLQKDPSCALPCSWGSADPSSFLIRGPNYLRD  537

Query  1713  HSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATR  1892
               KI +K TL Q+VG DWL+S+ RED+L +R G+IVQK A +   EFFF+VNIQVPG T 
Sbjct  538   RQKIKAKSTLMQLVGVDWLRSDKREDDLGSRYGNIVQKSAERGGSEFFFIVNIQVPGTTM  597

Query  1893  YSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQ  2072
             Y+LA YYM+KTPL E PLL  FVNGDD++RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ
Sbjct  598   YTLAFYYMIKTPLEETPLLHAFVNGDDSYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQ  657

Query  2073  SLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLL  2252
             +LE++YF+G+NYLEL VDVGSSTVARGV+NLVLGYLNNLVIEMAFL+QA+TEEELPE LL
Sbjct  658   ALEVHYFRGKNYLELGVDVGSSTVARGVVNLVLGYLNNLVIEMAFLIQANTEEELPEVLL  717

Query  2253  GTCRLNHLDASKAV  2294
             GTCR+N LDASK+V
Sbjct  718   GTCRINQLDASKSV  731



>ref|XP_010557338.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Tarenaya hassleriana]
Length=735

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/730 (61%), Positives = 549/730 (75%), Gaps = 29/730 (4%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             SD  MEGWLY+IR NR GLQ+ RKRYF+L+D+ L S+K+   +  +   RSA+IDSCI V
Sbjct  9     SDTKMEGWLYIIRSNRFGLQFSRKRYFVLQDHLLNSFKSASESKTKGSGRSAVIDSCIRV  68

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEK---NLR  539
              DNGRE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAARWI  +++AA+  E    +L 
Sbjct  69    TDNGRESVHRKVFFIFTLYNTSNHNDQLKLGASSPEEAARWIHSIKEAALKGEPFPGDLF  128

Query  540   APAIRKWQPFRLSVSSR------MARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
             + +  +W   RLS S R      +  T  SS  VD +T+DVI P PW IFG QNGLR+FK
Sbjct  129   SCSRSRWDSLRLSSSVRDHHSISIDWTVRSSARVDPVTTDVIAPSPWTIFGCQNGLRLFK  188

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             EAK+R+    HWD HPA+MAVGV+DGTSEAIF+ LMSLG SRSEWDFCF +G VVEHLDG
Sbjct  189   EAKERD---SHWDDHPAVMAVGVVDGTSEAIFQTLMSLGTSRSEWDFCFYKGCVVEHLDG  245

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             H+DIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCPPQ+GY+RA +
Sbjct  246   HSDIIHKQLYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYIRACL  305

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+PV+ GK S VKHML+VDWKS   YL+   ++S+T+ MLG I+ALRE+F+AK 
Sbjct  306   KSGGYVISPVSNGKHSVVKHMLAVDWKSWRSYLKPALARSITVRMLGRISALRELFRAKH  365

Query  1233  GSYFPDPAM--NELTIDIQLPVS-EKEEIKN----EVVATERIEEDTTEKYPSACSSIVE  1391
             G  FP   M   E +  ++L  S E   I N    E    +    + T+K PS  SS+V 
Sbjct  366   GG-FPSSDMPSGEFSRSVRLNSSLEDRAIANSSRRECGRFKETANEETDKLPSEHSSLVG  424

Query  1392  LDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK-  1562
             L+D ADEFFDVPE SD++  +  W      + +  E+ +PKL+ AA  V+KL DLAVQK 
Sbjct  425   LNDAADEFFDVPEPSDNDCPNDSWTSDFDLDTYCQESHQPKLTGAAGLVKKLHDLAVQKR  484

Query  1563  ---NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSK  1733
                +  E+   E     CYG TLP D + N+P SW   D S+FLIRG+ YL+D  K+ +K
Sbjct  485   GYVDLHEMTREESSTPCCYGTTLPNDPTCNVPCSWTETDPSTFLIRGKTYLEDRKKVKAK  544

Query  1734  GTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYY  1913
             GTL +++ ADWL+S+ RED+L +RPG IVQKYA +  PEFFF+VNIQVPG+T YSL LYY
Sbjct  545   GTLMKMIAADWLKSDKREDDLGSRPGGIVQKYAEKGGPEFFFIVNIQVPGSTTYSLVLYY  604

Query  1914  MLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYF  2093
             ++ TP+ E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+L+MNYF
Sbjct  605   VMSTPIEEHPLLYSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALDMNYF  664

Query  2094  KGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNH  2273
             +G+NY+EL VD+GSSTVARGV++LVLGYLNNLVIEMAFLVQA+TEEELPE+LLGTCRLNH
Sbjct  665   RGKNYIELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQANTEEELPEYLLGTCRLNH  724

Query  2274  LDASKAVHTN  2303
             LDASK+V  N
Sbjct  725   LDASKSVSVN  734



>ref|XP_002314279.1| pleckstrin homology domain-containing family protein [Populus 
trichocarpa]
 gb|EEE88234.1| pleckstrin homology domain-containing family protein [Populus 
trichocarpa]
Length=675

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/708 (63%), Positives = 546/708 (77%), Gaps = 47/708 (7%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR+GLQY RKRYF+L+ + L+S+K+VP++  ++P+RSAIIDSCI V DNG
Sbjct  1     MEGWLYLIRSNRIGLQYSRKRYFVLQHHLLQSFKSVPLSKNQDPVRSAIIDSCIRVTDNG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI---NPEKNLRAPAI  551
             RE+ HRKVFF FT+ NTSNH+DQLK GA+SPEEAARWI  +++AA+   N   NL+    
Sbjct  61    RESIHRKVFFIFTVYNTSNHNDQLKLGASSPEEAARWIHSIQEAALKVANCFCNLQLSG-  119

Query  552   RKWQPFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGK  731
                 P  ++ +  +  T  SST  D +T DVI P PW IFG QNGLR+FKEAKDR+ +GK
Sbjct  120   ----PSWVNHNKPIDWTHCSSTHTDLVT-DVIAPSPWTIFGCQNGLRLFKEAKDRDSHGK  174

Query  732   HWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLT  911
              WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRS+WDFCF +GSVVEHLDGH DIIH +L 
Sbjct  175   -WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSKWDFCFYKGSVVEHLDGHMDIIHKELY  233

Query  912   THWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV  1091
               WLPWG+KRRD LLRRYWRREDDGTYVILYHSV H KCPPQ+GYVRA +KSGG+VI+PV
Sbjct  234   NDWLPWGMKRRDFLLRRYWRREDDGTYVILYHSVYHKKCPPQKGYVRACLKSGGYVISPV  293

Query  1092  NQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMN  1262
             N  + S VKHML+VDWKS   YLR ++++S+TI ML  +AALRE+FKAK G+        
Sbjct  294   NHERRSVVKHMLAVDWKSWKSYLRTSSARSITIRMLERVAALRELFKAKLGN--------  345

Query  1263  ELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDD  1442
                     P S+    + E +  E       +K PS  +S+V L+D ADEFFDVPE SD 
Sbjct  346   -------CPSSDFSSGELECMNEE------VDKTPSEHASLVGLNDPADEFFDVPEPSDY  392

Query  1443  EHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAKGCY  1610
             +  ++        E+ +  +PKLS+AA FV+KL +LAVQK    + QE+V  E+    CY
Sbjct  393   DQLEN--------EFQDARQPKLSTAAGFVKKLHELAVQKRGYVDLQEMVR-EDSISCCY  443

Query  1611  GCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIRED  1790
             G TL KD ++ +P SWA AD SSFLIRG+ YL+D  K  + GTL Q+V ADWL+S+ RED
Sbjct  444   GTTLLKDPTFTLPSSWATADPSSFLIRGKNYLEDQKKFKANGTLMQMVAADWLRSDKRED  503

Query  1791  NLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGD  1970
             +LA RPGSIVQKYAAQ  PEFFF+VNIQVPG+T YSLALYYM+ TP+ + PLLE F+ GD
Sbjct  504   DLAGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPLLESFIEGD  563

Query  1971  DAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVAR  2150
             DA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LEMNYF+G+NYLEL VD+GSSTVAR
Sbjct  564   DAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEMNYFRGKNYLELGVDIGSSTVAR  623

Query  2151  GVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             GV++LVLGYL+NLVIEMAFL+QA+T+EELPE+LLGTCRLNHLDASKAV
Sbjct  624   GVVSLVLGYLSNLVIEMAFLIQANTDEELPEYLLGTCRLNHLDASKAV  671



>ref|XP_006409857.1| hypothetical protein EUTSA_v10016308mg [Eutrema salsugineum]
 gb|ESQ51310.1| hypothetical protein EUTSA_v10016308mg [Eutrema salsugineum]
Length=735

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/724 (60%), Positives = 546/724 (75%), Gaps = 23/724 (3%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S+  MEGWLY+IR NR GL + +KRYF+L D+ LKS+K++P +  ++  RSA+IDSCI V
Sbjct  9     SETKMEGWLYIIRSNRFGLHFSKKRYFVLRDHLLKSFKSIPDSKTKDAGRSAVIDSCIRV  68

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEK---NLR  539
              DNGRE+ HRK FF FTL NTSNH+DQLK GA+SPE+AARWI  +++ A+       ++ 
Sbjct  69    TDNGRESVHRKAFFIFTLYNTSNHNDQLKLGASSPEDAARWINSIKETALKVASFPGDVF  128

Query  540   APAIRKWQPFRLSVSSR------MARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
             + +  +W   RLS S R      +  T  SS  VD +T+DV+ P PW IFG QNGLR+FK
Sbjct  129   SCSRSRWDSLRLSSSVRDHHASSIDWTLRSSARVDPVTTDVVAPSPWTIFGCQNGLRLFK  188

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             EAK+R+  GK WD HPAIMAVGV+DGTSE IF+ L+SLGPSRSEWDFCF +GSVVEHLDG
Sbjct  189   EAKERDSLGK-WDDHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDG  247

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDIIH QL + WLPWG+KRRD  LRRYWRREDDGTYVILYHSV H KCPPQ+GY+RA +
Sbjct  248   HTDIIHKQLYSDWLPWGMKRRDFSLRRYWRREDDGTYVILYHSVYHKKCPPQKGYIRACL  307

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+P++ GK S VKHML+VDWKS   Y++ + ++S+T+ MLG I+ALRE+F+AK 
Sbjct  308   KSGGYVISPIDNGKQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAKH  367

Query  1233  GSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTT----EKYPSACSSIVELDD  1400
             GS+  + ++ E +    L  +E     +  +    + +DT     +K+PS  SS+V+L+D
Sbjct  368   GSFPSNLSLGESSRSALLNQNEDGVFGDSSLRESELFKDTANDERDKFPSERSSLVDLND  427

Query  1401  VADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK----  1562
               DEFFDVPE SD++  D  W      + +  E+ +PKL+SA   V+KL DLAVQK    
Sbjct  428   GVDEFFDVPEPSDNDQLDESWTSDFDSDTYSQESRQPKLNSATSLVKKLHDLAVQKRGYV  487

Query  1563  NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTL  1742
             +  E    E     CYG TLP D +  +P SW   D S+FLIRG+ YL D  K+ +KGTL
Sbjct  488   DLHEKAREESSTPCCYGTTLPTDPTCALPCSWTTTDPSTFLIRGKTYLSDQKKVKAKGTL  547

Query  1743  TQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLK  1922
              ++V ADWL+S+ RED+L +RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL LYYM+ 
Sbjct  548   MEMVAADWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMS  607

Query  1923  TPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQ  2102
             TP+ E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+G+
Sbjct  608   TPIEEHPLLVSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGK  667

Query  2103  NYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDA  2282
             NY+EL VD+GSSTVARGV++LVLGYLN LVIEMAFLVQA+TEEELPE+LLGTCRLNHLDA
Sbjct  668   NYIELGVDIGSSTVARGVVSLVLGYLNKLVIEMAFLVQANTEEELPEYLLGTCRLNHLDA  727

Query  2283  SKAV  2294
             SK+V
Sbjct  728   SKSV  731



>gb|KDO73325.1| hypothetical protein CISIN_1g004508mg [Citrus sinensis]
Length=741

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/733 (62%), Positives = 557/733 (76%), Gaps = 48/733 (7%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S G MEGWL+LIR NR+GLQY RKRYF+LED+ LKS+K+VP +  E+P+RSAIIDSCI V
Sbjct  8     SQGRMEGWLHLIRSNRIGLQYSRKRYFLLEDHFLKSFKSVPHSKNEDPVRSAIIDSCIRV  67

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI--NPEK----  530
              DNGRE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAA+WI  L++AA+   P +    
Sbjct  68    TDNGRESIHRKVFFIFTLYNTSNHNDQLKLGASSPEEAAKWIHSLQEAALKGGPHQGVGD  127

Query  531   NLRAPAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLR  692
             ++  P    W+ FRLS SSR + T +      S T ++ +T+DVI P PW IFG QNGLR
Sbjct  128   HIGCPN-SPWESFRLSGSSRASHTKSIDWTLCSGTHMEQVTADVIAPSPWTIFGCQNGLR  186

Query  693   IFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEH  872
             +FKE KDR   GK WD HPAIMAVGV+DGTSEAIF+ LMSLG SRS        G VVEH
Sbjct  187   LFKEGKDRGSRGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGASRSV-------GCVVEH  238

Query  873   LDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVR  1052
             LDGHTDIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCP Q+G VR
Sbjct  239   LDGHTDIIHKQLYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVR  298

Query  1053  ATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFK  1223
             A +KSGG+VITP+N GK S VKHML++DWK   SYL+ ++++S+TI MLG +AALRE+F+
Sbjct  299   ACLKSGGYVITPMNHGKKSVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFR  358

Query  1224  AKSGSYF-PDPAMNELTID----------IQLPVSEKEEIKNEVVATERIEEDTTEKYPS  1370
             AK G+Y  P+    ELT +          +Q+P  +    KN    +E +++ ++E    
Sbjct  359   AKQGNYSSPEFLSGELTRNMRMHQTDGNMVQMPTEDGNSKKN---TSEEVDQVSSEH---  412

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQ  1544
               +S+V L+D ADEFFDVPE SD + S++GW     PE +  +T  PK+S+AA FVRKL 
Sbjct  413   --ASLVGLNDAADEFFDVPEPSDYDDSENGWTSDFGPEMNSQDTRHPKISTAAGFVRKLH  470

Query  1545  DLAVQK-NFQEIVGG--EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDH  1715
             DLAVQK  + ++ G   E+    CYG TL KD +  +P SW + D S+FLIRG+ YLQD 
Sbjct  471   DLAVQKRGYVDLQGTAKEDNFSCCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDR  530

Query  1716  SKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRY  1895
              K+ +KGTL Q+V ADWL+S+ RED+L  RPG IVQKYA Q  PEFFF++NIQVPG+T Y
Sbjct  531   HKVKAKGTLMQMVAADWLKSDKREDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTY  590

Query  1896  SLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQS  2075
             SLALYYM+ TP+ + PLLE F+NGDDA+RNS+FKLIPYIS+GSWIVKQSVGKK+CLIGQ+
Sbjct  591   SLALYYMMTTPVKDAPLLESFINGDDAYRNSRFKLIPYISEGSWIVKQSVGKKACLIGQA  650

Query  2076  LEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLG  2255
             LE+NYF G+NYLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFL+QA+TEEELPE LLG
Sbjct  651   LEINYFHGKNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQANTEEELPEFLLG  710

Query  2256  TCRLNHLDASKAV  2294
             TCRLNHLDA+KAV
Sbjct  711   TCRLNHLDAAKAV  723



>emb|CDX71361.1| BnaC04g15960D [Brassica napus]
Length=733

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/726 (60%), Positives = 550/726 (76%), Gaps = 28/726 (4%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S+  MEGWLY+IR NR GL + +KRYFIL D+ LKS+K++  +  ++  RSA+IDSCI V
Sbjct  6     SEAKMEGWLYIIRSNRFGLHFSKKRYFILGDHLLKSFKSISDSKTKDGGRSAVIDSCIRV  65

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN---LR  539
              DNGRE+ HRK FF FTL NTSNH+DQLK GA+SPE+AARWI  +++ A+    N   + 
Sbjct  66    TDNGRESVHRKAFFIFTLYNTSNHNDQLKLGASSPEDAARWINLIKEEALKGSSNPGDVF  125

Query  540   APAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTS-DVIGPCPWKIFGIQNGLRIF  698
             + +  +W   RLS S R   +++      SS  VD +T+ DV+ P PW IFG QNGLR+F
Sbjct  126   SCSRSRWDSLRLSSSVREHHSNSIDWTLRSSARVDPVTTTDVVAPSPWTIFGCQNGLRLF  185

Query  699   KEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLD  878
             KEAK+R+  G+ WD HPAIMAVGV+DGTSE IF+ L+SLGPSRSEWDFCF +GSVVEHLD
Sbjct  186   KEAKERDSLGR-WDDHPAIMAVGVVDGTSENIFQTLLSLGPSRSEWDFCFFQGSVVEHLD  244

Query  879   GHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRAT  1058
             GHTDIIH QL + WLPWG+KRRD  LRRYWRREDDGTYVILYHSV H KCPPQ+GY+RA 
Sbjct  245   GHTDIIHKQLYSDWLPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYIRAC  304

Query  1059  VKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAK  1229
             +KSGG+VI+P++ GK S VKHML+VDWKS   Y++ + ++S+T+ MLG I+ALRE+F+AK
Sbjct  305   LKSGGYVISPIDNGKQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAK  364

Query  1230  SGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATE-RIEEDTT----EKYPSACSSIVEL  1394
              GS+   P+  EL+   +L  +E+         TE  + +D      +K+PS  SS+V+L
Sbjct  365   HGSF---PSSGELSRSARLNQNEESGFGESSSLTECEMYKDPANEERDKFPSERSSLVDL  421

Query  1395  DDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK--  1562
             +D  DEFFDVPE SD++H D  W      + +  +T +PKL+SA+  VRK+ DLAVQK  
Sbjct  422   NDGVDEFFDVPEPSDNDHLDDNWASDFDSDTYSQDTRQPKLNSASSLVRKIHDLAVQKRG  481

Query  1563  --NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKG  1736
               +  E    E     CYG TLP D +  +P SW   D S+FLIRG+ YL D  K+T+KG
Sbjct  482   YVDLHERAREESSTPCCYGTTLPTDPTCALPCSWTTTDPSTFLIRGKTYLSDQKKVTAKG  541

Query  1737  TLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYM  1916
             TL Q+V ADWL+S+ RED+L +RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL LYYM
Sbjct  542   TLMQMVAADWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYM  601

Query  1917  LKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFK  2096
             + TP+ E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+
Sbjct  602   MSTPIEEHPLLVSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFR  661

Query  2097  GQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHL  2276
             G+NY+EL VD+GSSTVARGV++LVLGYLN LVIEMAFLVQA+TEEELPE+LLGTCRLNHL
Sbjct  662   GKNYIELGVDIGSSTVARGVVSLVLGYLNKLVIEMAFLVQANTEEELPEYLLGTCRLNHL  721

Query  2277  DASKAV  2294
             DASK+V
Sbjct  722   DASKSV  727



>ref|XP_010557337.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Tarenaya hassleriana]
Length=737

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/730 (61%), Positives = 550/730 (75%), Gaps = 27/730 (4%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             SD  MEGWLY+IR NR GLQ+ RKRYF+L+D+ L S+K+   +  +   RSA+IDSCI V
Sbjct  9     SDTKMEGWLYIIRSNRFGLQFSRKRYFVLQDHLLNSFKSASESKTKGSGRSAVIDSCIRV  68

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEK---NLR  539
              DNGRE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAARWI  +++AA+  E    +L 
Sbjct  69    TDNGRESVHRKVFFIFTLYNTSNHNDQLKLGASSPEEAARWIHSIKEAALKGEPFPGDLF  128

Query  540   APAIRKWQPFRLSVSSR------MARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
             + +  +W   RLS S R      +  T  SS  VD +T+DVI P PW IFG QNGLR+FK
Sbjct  129   SCSRSRWDSLRLSSSVRDHHSISIDWTVRSSARVDPVTTDVIAPSPWTIFGCQNGLRLFK  188

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             EAK+R+ + + WD HPA+MAVGV+DGTSEAIF+ LMSLG SRSEWDFCF +G VVEHLDG
Sbjct  189   EAKERDSHVR-WDDHPAVMAVGVVDGTSEAIFQTLMSLGTSRSEWDFCFYKGCVVEHLDG  247

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             H+DIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCPPQ+GY+RA +
Sbjct  248   HSDIIHKQLYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYIRACL  307

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+PV+ GK S VKHML+VDWKS   YL+   ++S+T+ MLG I+ALRE+F+AK 
Sbjct  308   KSGGYVISPVSNGKHSVVKHMLAVDWKSWRSYLKPALARSITVRMLGRISALRELFRAKH  367

Query  1233  GSYFPDPAM--NELTIDIQLPVS-EKEEIKN----EVVATERIEEDTTEKYPSACSSIVE  1391
             G  FP   M   E +  ++L  S E   I N    E    +    + T+K PS  SS+V 
Sbjct  368   GG-FPSSDMPSGEFSRSVRLNSSLEDRAIANSSRRECGRFKETANEETDKLPSEHSSLVG  426

Query  1392  LDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK-  1562
             L+D ADEFFDVPE SD++  +  W      + +  E+ +PKL+ AA  V+KL DLAVQK 
Sbjct  427   LNDAADEFFDVPEPSDNDCPNDSWTSDFDLDTYCQESHQPKLTGAAGLVKKLHDLAVQKR  486

Query  1563  ---NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSK  1733
                +  E+   E     CYG TLP D + N+P SW   D S+FLIRG+ YL+D  K+ +K
Sbjct  487   GYVDLHEMTREESSTPCCYGTTLPNDPTCNVPCSWTETDPSTFLIRGKTYLEDRKKVKAK  546

Query  1734  GTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYY  1913
             GTL +++ ADWL+S+ RED+L +RPG IVQKYA +  PEFFF+VNIQVPG+T YSL LYY
Sbjct  547   GTLMKMIAADWLKSDKREDDLGSRPGGIVQKYAEKGGPEFFFIVNIQVPGSTTYSLVLYY  606

Query  1914  MLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYF  2093
             ++ TP+ E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+L+MNYF
Sbjct  607   VMSTPIEEHPLLYSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALDMNYF  666

Query  2094  KGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNH  2273
             +G+NY+EL VD+GSSTVARGV++LVLGYLNNLVIEMAFLVQA+TEEELPE+LLGTCRLNH
Sbjct  667   RGKNYIELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQANTEEELPEYLLGTCRLNH  726

Query  2274  LDASKAVHTN  2303
             LDASK+V  N
Sbjct  727   LDASKSVSVN  736



>emb|CDY04553.1| BnaA07g13790D [Brassica napus]
Length=731

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/724 (60%), Positives = 547/724 (76%), Gaps = 26/724 (4%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S+  MEGWLY+IR NR GL + +KRYFIL D+ LKS+K++  +  ++  RSA+IDSCI V
Sbjct  6     SEAKMEGWLYIIRSNRFGLHFSKKRYFILADHLLKSFKSISDSKTKDGGRSAVIDSCIRV  65

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN---LR  539
              DNGRE+ HRK FF FTL NTSNH+DQLK GA+SPE+AARWI  +++ A+    N   + 
Sbjct  66    TDNGRESVHRKAFFIFTLYNTSNHNDQLKLGASSPEDAARWINLIKEEALKGSSNPGDVF  125

Query  540   APAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTS-DVIGPCPWKIFGIQNGLRIF  698
             + +  +W   RLS S R   +++      SS  VD +T+ DV+ P PW IFG QNGLR+F
Sbjct  126   SCSRSRWDSLRLSSSVREHHSNSIDWTLRSSARVDPVTTTDVVAPSPWTIFGCQNGLRLF  185

Query  699   KEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLD  878
             KEAK+R+  G+ WD HPAIMAVGV+DGTSE IF+ L+SLGPSRSEWDFCF +GSVVEHLD
Sbjct  186   KEAKERDSLGR-WDDHPAIMAVGVVDGTSENIFQTLLSLGPSRSEWDFCFFQGSVVEHLD  244

Query  879   GHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRAT  1058
             GHTDIIH QL + WLPWG+KRRD  LRRYWRREDDGTYVILYHSV H KCPPQ+GY+RA 
Sbjct  245   GHTDIIHKQLYSDWLPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYIRAC  304

Query  1059  VKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAK  1229
             +KSGG+VI+P++ GK S VKHML+VDWKS   Y++ + ++S+T+ MLG I+ALRE+F+AK
Sbjct  305   LKSGGYVISPIDNGKQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAK  364

Query  1230  SGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTE---KYPSACSSIVELDD  1400
              GS+   P+  EL+   +L         + +   E  ++   E   K+PS  SS+V+L+D
Sbjct  365   HGSF---PSSGELSRSARLNQESGFGESSSLTECEMYKDPANEERDKFPSERSSLVDLND  421

Query  1401  VADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK----  1562
               DEFFDVPE SD++H D  W      + +  +T +PKL+SA+  VRK+ DLAVQK    
Sbjct  422   GVDEFFDVPEPSDNDHLDDNWASDFDSDTYSQDTRQPKLNSASSLVRKIHDLAVQKRGYV  481

Query  1563  NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTL  1742
             +  E    E     CYG TLP D +  +P SW   D S+FLIRG+ YL D  K+T+KGTL
Sbjct  482   DLHERAREESSTPCCYGTTLPTDPTCALPCSWTTTDPSTFLIRGKTYLSDQKKVTAKGTL  541

Query  1743  TQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLK  1922
              Q+V ADWL+S+ RED+L +RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL LYYM+ 
Sbjct  542   MQMVAADWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMS  601

Query  1923  TPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQ  2102
             TP+ E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G+
Sbjct  602   TPIEEHPLLVSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFRGK  661

Query  2103  NYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDA  2282
             NY+EL VD+GSSTVARGV++LVLGYLN LVIEMAFLVQA+TEEELPE+LLGTCRLNHLDA
Sbjct  662   NYIELGVDIGSSTVARGVVSLVLGYLNKLVIEMAFLVQANTEEELPEYLLGTCRLNHLDA  721

Query  2283  SKAV  2294
             SK+V
Sbjct  722   SKSV  725



>ref|XP_010322400.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Solanum 
lycopersicum]
Length=732

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/725 (62%), Positives = 541/725 (75%), Gaps = 34/725 (5%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQY RKRYF+L D  LKSYK+ P+T  E+P+RSA+IDSCI V DNG
Sbjct  11    MEGWLYLIRSNRFGLQYSRKRYFVLNDLLLKSYKSNPVTNIEDPVRSAVIDSCIRVTDNG  70

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPA---I  551
             RE+  RKV F FTL N SNH+DQLK GANSPEEAARWI+ L++AA+  + N R       
Sbjct  71    RESIQRKVVFIFTLYNASNHNDQLKLGANSPEEAARWIQALQEAALKADMNKRTTVDGPR  130

Query  552   RKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKD  713
             R  Q  RL+ S++         T  SS+  DA TSDV+ P  W IFG QNGLR+FKEAKD
Sbjct  131   RDSQSLRLNCSNKSHHLNSSDWTYCSSSVADATTSDVVAPSSWTIFGCQNGLRLFKEAKD  190

Query  714   RNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDI  893
             R  +GK W+ HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFC  +GSV+EHLDGHTDI
Sbjct  191   RKSHGK-WNDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCHYKGSVIEHLDGHTDI  249

Query  894   IHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGG  1073
             +H  L   WLPW +++RDLLL+RYWRREDDGTYVILYHSV H KCP Q+GYVRA +KSGG
Sbjct  250   VHKLLRRDWLPWSMRKRDLLLQRYWRREDDGTYVILYHSVFHQKCPSQKGYVRACLKSGG  309

Query  1074  HVITPVNQGKSSTVKHMLSVDW---KSYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYF  1244
             +VI+PVNQ K S VKHML++DW   KS L+ ++++ +TI MLG +AALRE+F AK G   
Sbjct  310   YVISPVNQKKQSVVKHMLAIDWRFWKSNLQTSSARYITIHMLGRLAALRELFIAKLGDCS  369

Query  1245  PDPAMNELTIDIQLPVSEKEEIKNEVVATERIE--------EDTTEKYPSACSSIVELDD  1400
                 + E   D +L   + EE+K E+    R+E        E+   K PS  +S++ L+D
Sbjct  370   SSHFLEEHVRDKRL--HQIEEVKVEI--QTRVENGKNMADMEEEVAKSPSEHASLMGLND  425

Query  1401  VADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK----  1562
              +DEFFDV E  D + S+ GWP    PE +  +T   KLSSAA FV+KL DLAV K    
Sbjct  426   ASDEFFDVSEPLDYDQSEDGWPSDFGPEMYSQDTRHAKLSSAAGFVKKLHDLAVHKRGYV  485

Query  1563  NFQEIVGGEEGAKGC-YGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGT  1739
             +  E    +E A  C YG TLPKD ++N+P SWA  D S+FLIRGE YL+D  KI +KGT
Sbjct  486   DLHE--KAKEDALLCHYGSTLPKDPTFNLPCSWAQTDPSTFLIRGETYLEDRKKIKAKGT  543

Query  1740  LTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYML  1919
             L Q+V ADWL+S+ RED+L  RPGSIVQKYAA+  PEFFF+VNIQVPG+T YSLALYYM+
Sbjct  544   LMQMVAADWLKSDKREDDLGGRPGSIVQKYAAKGGPEFFFIVNIQVPGSTTYSLALYYMM  603

Query  1920  KTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKG  2099
              TP+   PLLE FV GDDAFRNS+FKLIPYISKG WIVKQSVGKK+CL+G +LE+NYF+G
Sbjct  604   DTPIENAPLLESFVKGDDAFRNSRFKLIPYISKGPWIVKQSVGKKACLVGPALEINYFRG  663

Query  2100  QNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLD  2279
             +NYLELD+ VGSSTVARGV++LV+GYLNNLVIEMAFLVQA+T EELPE+LL TCRLNHLD
Sbjct  664   KNYLELDIHVGSSTVARGVVSLVVGYLNNLVIEMAFLVQANTPEELPEYLLATCRLNHLD  723

Query  2280  ASKAV  2294
              SKAV
Sbjct  724   ISKAV  728



>ref|XP_010920447.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X2 [Elaeis 
guineensis]
Length=740

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/737 (61%), Positives = 541/737 (73%), Gaps = 31/737 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +   D  MEGWLYLIR NRLGLQY RKRYF+LEDN L  YKAVP + RE+P+RSA+ID
Sbjct  1     MGITEGDRRMEGWLYLIRSNRLGLQYSRKRYFVLEDNALNCYKAVPASRREDPIRSALID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             SCI V DNGR + HR VF+ FTL +++NH+D+LK GA S EEAA WIR L +AA+    N
Sbjct  61    SCIRVTDNGRASIHRSVFYIFTLYSSANHNDRLKLGARSSEEAASWIRSLMEAALKECPN  120

Query  522   PEKNLRAPAIRKWQPFRLS---VSSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQN  683
              E+N  A + R+ Q FRLS     S M   D    SS   D M SDVI P PW IFG +N
Sbjct  121   KEENFVACSKRRRQSFRLSRTKARSLMHSIDWTVYSSVHADPMASDVIAPSPWTIFGCKN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKE+ + + +GK WD HPAIMAVGV+D TSEAIF+ +MSLGPSRSEWDF    G V
Sbjct  181   GLRLFKESNEGDFHGKQWDDHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDIIH +L   WLPWG+K+RDLLLRRYWRREDDGTYVILYHSV H  C P+ G
Sbjct  241   VEHLDGHTDIIHKKLRGDWLPWGMKKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALRE  1214
             Y+RA +KSGG+VI+PVNQGK S VKHML++DWK   SY+  +++K +TI MLG +A LRE
Sbjct  301   YIRACLKSGGYVISPVNQGKRSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAGLRE  360

Query  1215  MFKAKSGS-YFPDPAMNELTIDIQLPVSEKEEIKNEV---------VATERIEEDTTEKY  1364
              F+AK G+    D +  ELT +I LP  EKE IK EV         V +    + +  ++
Sbjct  361   FFRAKLGNCTCSDYSSGELTREIGLPYGEKEHIKVEVQTTGENNKSVDSAEAPQQSPSRH  420

Query  1365  PSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRST---TPEYHETPRPKLSSAACFVR  1535
                  S ++L+D ADEFFDV + SD++ ++  WP      +    E  +P+LS+AA FV+
Sbjct  421   ADTNGSFLQLNDAADEFFDVIDESDNDQTESLWPSDEGMHSQLLQEQRQPRLSTAAVFVK  480

Query  1536  KLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKY  1703
             KL D AVQK    + QE   G+  A   YG TLPKD S  MP SWA AD++SFLIRGE Y
Sbjct  481   KLHDFAVQKKGYIDLQEASMGDM-APCSYGATLPKDTSCTMPCSWAMADSTSFLIRGESY  539

Query  1704  LQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPG  1883
             L+DH KI +  TL Q+V ADWL S+ RED+L  RPG IVQKYAAQ   EFFF+VNIQVPG
Sbjct  540   LRDHQKIKANSTLMQMVAADWLNSDKREDDLGGRPGGIVQKYAAQGGSEFFFIVNIQVPG  599

Query  1884  ATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCL  2063
             +T YSLALYYM+ TPL   PLLE FV GD+A+RNS+FKLIPYISKGSWIVKQSVGKK+CL
Sbjct  600   STTYSLALYYMMDTPLENVPLLESFVKGDNAYRNSRFKLIPYISKGSWIVKQSVGKKACL  659

Query  2064  IGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPE  2243
             +GQ+LE++YF+G NYLEL +DVGSSTVARGV++LVLGYLNNLVIE+AFL+Q +T+EELPE
Sbjct  660   VGQALEIHYFRGSNYLELGIDVGSSTVARGVVSLVLGYLNNLVIELAFLIQGNTQEELPE  719

Query  2244  HLLGTCRLNHLDASKAV  2294
              LLGTCRLNHLDASK+V
Sbjct  720   FLLGTCRLNHLDASKSV  736



>ref|XP_010920444.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X1 [Elaeis 
guineensis]
 ref|XP_010920446.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X1 [Elaeis 
guineensis]
Length=741

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/737 (61%), Positives = 541/737 (73%), Gaps = 31/737 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +   D  MEGWLYLIR NRLGLQY RKRYF+LEDN L  YKAVP + RE+P+RSA+ID
Sbjct  1     MGITEGDRRMEGWLYLIRSNRLGLQYSRKRYFVLEDNALNCYKAVPASRREDPIRSALID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             SCI V DNGR + HR VF+ FTL +++NH+D+LK GA S EEAA WIR L +AA+    N
Sbjct  61    SCIRVTDNGRASIHRSVFYIFTLYSSANHNDRLKLGARSSEEAASWIRSLMEAALKECPN  120

Query  522   PEKNLRAPAIRKWQPFRLS---VSSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQN  683
              E+N  A + R+ Q FRLS     S M   D    SS   D M SDVI P PW IFG +N
Sbjct  121   KEENFVACSKRRRQSFRLSRTKARSLMHSIDWTVYSSVHADPMASDVIAPSPWTIFGCKN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKE+ + + +GK WD HPAIMAVGV+D TSEAIF+ +MSLGPSRSEWDF    G V
Sbjct  181   GLRLFKESNEGDFHGKQWDDHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDIIH +L   WLPWG+K+RDLLLRRYWRREDDGTYVILYHSV H  C P+ G
Sbjct  241   VEHLDGHTDIIHKKLRGDWLPWGMKKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALRE  1214
             Y+RA +KSGG+VI+PVNQGK S VKHML++DWK   SY+  +++K +TI MLG +A LRE
Sbjct  301   YIRACLKSGGYVISPVNQGKRSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAGLRE  360

Query  1215  MFKAKSGS-YFPDPAMNELTIDIQLPVSEKEEIKNEV---------VATERIEEDTTEKY  1364
              F+AK G+    D +  ELT +I LP  EKE IK EV         V +    + +  ++
Sbjct  361   FFRAKLGNCTCSDYSSGELTREIGLPYGEKEHIKVEVQTTGENNKSVDSAEAPQQSPSRH  420

Query  1365  PSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRST---TPEYHETPRPKLSSAACFVR  1535
                  S ++L+D ADEFFDV + SD++ ++  WP      +    E  +P+LS+AA FV+
Sbjct  421   ADTNGSFLQLNDAADEFFDVIDESDNDQTESLWPSDEGMHSQLLQEQRQPRLSTAAVFVK  480

Query  1536  KLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKY  1703
             KL D AVQK    + QE   G+  A   YG TLPKD S  MP SWA AD++SFLIRGE Y
Sbjct  481   KLHDFAVQKKGYIDLQEASMGDM-APCSYGATLPKDTSCTMPCSWAMADSTSFLIRGESY  539

Query  1704  LQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPG  1883
             L+DH KI +  TL Q+V ADWL S+ RED+L  RPG IVQKYAAQ   EFFF+VNIQVPG
Sbjct  540   LRDHQKIKANSTLMQMVAADWLNSDKREDDLGGRPGGIVQKYAAQGGSEFFFIVNIQVPG  599

Query  1884  ATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCL  2063
             +T YSLALYYM+ TPL   PLLE FV GD+A+RNS+FKLIPYISKGSWIVKQSVGKK+CL
Sbjct  600   STTYSLALYYMMDTPLENVPLLESFVKGDNAYRNSRFKLIPYISKGSWIVKQSVGKKACL  659

Query  2064  IGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPE  2243
             +GQ+LE++YF+G NYLEL +DVGSSTVARGV++LVLGYLNNLVIE+AFL+Q +T+EELPE
Sbjct  660   VGQALEIHYFRGSNYLELGIDVGSSTVARGVVSLVLGYLNNLVIELAFLIQGNTQEELPE  719

Query  2244  HLLGTCRLNHLDASKAV  2294
              LLGTCRLNHLDASK+V
Sbjct  720   FLLGTCRLNHLDASKSV  736



>ref|XP_002529938.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32446.1| conserved hypothetical protein [Ricinus communis]
Length=689

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/718 (63%), Positives = 544/718 (76%), Gaps = 45/718 (6%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYL+R NR+GLQY RKRYF+LE++ L+S+K++P +  E                  
Sbjct  1     MEGWLYLVRSNRIGLQYSRKRYFVLENHLLQSFKSLPSSKHE------------------  42

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW  560
                    VFF FTL NTSNH+DQLK GA+SPEEAARWI  +++AA+  ++N    +   W
Sbjct  43    -------VFFIFTLYNTSNHNDQLKLGASSPEEAARWIHSIQEAALKGDQNTVGCSKSSW  95

Query  561   QPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNP  722
             Q F+L  SSR++       T  S T  D +T DVI P PW IFG QNGLR+FKEAKDR+ 
Sbjct  96    QSFKLIGSSRVSHSKPIDWTLCSLTHSDPVT-DVIAPSPWTIFGCQNGLRLFKEAKDRDS  154

Query  723   NGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHM  902
             + K WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +GSVVEHLDGHTDIIH 
Sbjct  155   HVK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIIHK  213

Query  903   QLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVI  1082
              L   WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCPPQ+GYVRA +KSGG+VI
Sbjct  214   MLYNDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVI  273

Query  1083  TPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSY-FPD  1250
             +PVNQGK S VKHML++DWK   SYLR ++++S+TI MLG +AALRE+F+AK G+    +
Sbjct  274   SPVNQGKRSVVKHMLAIDWKFWKSYLRTSSARSITIRMLGRVAALRELFRAKLGTCPSSE  333

Query  1251  PAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPE  1430
              +  ELT +I+L  SE++    +    E + E+  +K PS  +S+  L+D ADEFFDVPE
Sbjct  334   FSSGELTRNIKLHQSEEDRKVGDGKTKEYLSEEV-DKAPSEHASLGGLNDAADEFFDVPE  392

Query  1431  ASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK----NFQEIVGGEE  1592
              SD E SD GW     PE +  +  +PKL +AA FV+KL DLAVQK    + QE+   E+
Sbjct  393   PSDHEQSDSGWSYDFGPETYSQDMRQPKLCTAAGFVKKLHDLAVQKRGYVDLQEM-ARED  451

Query  1593  GAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQ  1772
                 CYG TLPKD + +M  SW AAD S+FLIRGE YL+D  K  +KGTL Q+V ADWL+
Sbjct  452   SISCCYGTTLPKDPTCSMLSSWTAADPSTFLIRGENYLEDQKKFKAKGTLMQMVAADWLR  511

Query  1773  SEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLE  1952
             S  RED+LA RPGSIVQKYAAQ  PEFFF++NIQVPG+T YSLALYYM+ TPL + PLLE
Sbjct  512   SNKREDDLAGRPGSIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYMMTTPLEDAPLLE  571

Query  1953  RFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVG  2132
             RFV GDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+G+NYLEL VD+G
Sbjct  572   RFVKGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGENYLELGVDIG  631

Query  2133  SSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAVHTNS  2306
             SSTVARGV++LVLGYL+NLVIEMAFL+QA+T EELPE+LLGTCRLNHLDASKAV  +S
Sbjct  632   SSTVARGVVSLVLGYLSNLVIEMAFLIQANTPEELPEYLLGTCRLNHLDASKAVLLDS  689



>ref|XP_008367239.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Malus domestica]
Length=730

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/731 (61%), Positives = 548/731 (75%), Gaps = 29/731 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +P +DG MEGWLY+I  NR GLQY RKRYFIL+DNCL+S+KA P +  EEP+RSA+ID
Sbjct  1     MGIPQNDGKMEGWLYIIGSNRFGLQYSRKRYFILKDNCLRSFKAKPSSDSEEPVRSAVID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             +CI   DNGR + HRK FF FTL NTSN+ DQLK GA+S EEAA+WIR L+DAA+    N
Sbjct  61    TCIRATDNGRASIHRKGFFVFTLYNTSNNSDQLKLGASSSEEAAKWIRSLQDAALKACPN  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMARTDASSTPV---DAMTSDVIGPCPWKIFGIQNGLR  692
               ++  A +  +W  FR +   R    D + +P+   + MTSDVI P PWKIFG QNGLR
Sbjct  121   ATQDFVACSKSRWPSFRRT--ERKNSVDWTFSPLMHTEGMTSDVIAPSPWKIFGCQNGLR  178

Query  693   IFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEH  872
             +FKEAKD +  G+HWD HPAIMAVGV+DGTSEAIF+ L+SLGPSRSEWDFC+ +GSVVE 
Sbjct  179   LFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFRTLLSLGPSRSEWDFCYYQGSVVER  238

Query  873   LDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVR  1052
             LDGHTDIIH QL + WLPWG++RRDLL+RRYWRREDDGTYVILYHSV H KCPP+ GYVR
Sbjct  239   LDGHTDIIHQQLYSDWLPWGMQRRDLLIRRYWRREDDGTYVILYHSVSHKKCPPKRGYVR  298

Query  1053  ATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFK  1223
             A +KSGG VITP NQGK S V+HML++DWK    YLR ++++ +TI ML  +AALRE+F 
Sbjct  299   ACLKSGGFVITPANQGKQSLVRHMLAIDWKFWKLYLRPSSARCITIRMLERVAALRELFG  358

Query  1224  AKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIE--------EDTTEKYPSACS  1379
             AK+G+  P+    +++ +I+   S ++ IK EV     ++        ED  EK P   +
Sbjct  359   AKAGTSSPEFXSGDMSSEIKFSQSGQQNIKTEVQHPGEVKKMEEGVLVEDEVEK-PEGRA  417

Query  1380  SIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETP--RPKLSSAACFVRKLQDLA  1553
             S+  L D ADEFFDVPE ++ +  ++ WP   + E + T     KLSSAA  V+KL +L 
Sbjct  418   SLKGLHDAADEFFDVPEPTEYDQFENEWPSDVSMEQNPTSIQHHKLSSAAVLVKKLHELR  477

Query  1554  VQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSK  1721
             VQK    + QE+   +E +   YG TL KD S  +P SW +AD SSFLIRG  YL+D  K
Sbjct  478   VQKKGYMDLQEVC--KEDSVCPYGATLQKDPSCALPCSWGSADPSSFLIRGPNYLRDRQK  535

Query  1722  ITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSL  1901
             I +K TL Q+VG DWL+S+ RED+L +R G+IVQK A +   EFFF+VNIQVPG T Y+L
Sbjct  536   IKAKSTLMQLVGVDWLRSDKREDDLGSRYGNIVQKSAERGGSEFFFIVNIQVPGTTMYTL  595

Query  1902  ALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLE  2081
             A YYM+KTPL E PLL  FVNGDD++RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE
Sbjct  596   AFYYMIKTPLEETPLLHAFVNGDDSYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALE  655

Query  2082  MNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTC  2261
             ++YF+G+NYLEL VDVGSSTVARGV+NLVLGYLNNLVIEMAFL+QA+TEEELPE LLGTC
Sbjct  656   VHYFRGKNYLELGVDVGSSTVARGVVNLVLGYLNNLVIEMAFLIQANTEEELPEVLLGTC  715

Query  2262  RLNHLDASKAV  2294
             R+N LDASK+V
Sbjct  716   RINQLDASKSV  726



>ref|XP_010906506.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Elaeis guineensis]
Length=730

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/720 (61%), Positives = 537/720 (75%), Gaps = 28/720 (4%)
 Frame = +3

Query  195   GNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQD  374
             G MEGWLYLIR NRLGLQ  R+RYF+L+DN L  YK +P + RE+P+RSA+IDSCI V D
Sbjct  14    GRMEGWLYLIRSNRLGLQSSRRRYFVLQDNSLHCYKTIPTSTREDPIRSALIDSCIRVTD  73

Query  375   NGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----PEKNLRA  542
             NGRE+ HR V F FTL N SNH+DQLK GA SPEEAARWIR L +AA+       +N+ A
Sbjct  74    NGRESIHRNVLFIFTLYNASNHNDQLKLGARSPEEAARWIRSLMEAALKECPIKRENVVA  133

Query  543   PAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKE  704
              + R+W   RLS S R +R      T  SS   D MTSDVI P PW IFG +NGLR+FKE
Sbjct  134   CSRRRWPSLRLSQSKRTSRMHSVDWTVFSSLHTDPMTSDVIAPSPWTIFGCKNGLRLFKE  193

Query  705   AKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGH  884
             AKD + + K WD HPAIMAVGV+D T EAIF+ +MSLGPSRSEWDFCF  GSV+EHLDGH
Sbjct  194   AKDGDLHRKCWDDHPAIMAVGVVDATPEAIFRTVMSLGPSRSEWDFCFAHGSVIEHLDGH  253

Query  885   TDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVK  1064
             TDIIH +L + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H  C P+ GY+RA +K
Sbjct  254   TDIIHKKLHSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLK  313

Query  1065  SGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSG  1235
             SGG+VI+P NQG  S VKHML++DWK   SYL  +++  +TI MLG +AALRE+F+ K G
Sbjct  314   SGGYVISPANQGNVSVVKHMLAIDWKFWKSYLFASSAIYITIRMLGRVAALRELFRVKLG  373

Query  1236  SY-FPDPAMNELTIDIQLPVSEKEEIKNEVVATERIE--EDTTEKYPSACSSIVELDDVA  1406
             +Y   D +  ++  ++QLP    E  K+E    E IE  E+++ K      S ++L+D A
Sbjct  374   NYSHTDFSSGDMEPEVQLP---GENSKSE----EFIEGSENSSAKPAKTGGSFLQLNDAA  426

Query  1407  DEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK----NFQE  1574
             DEFFDV + S+ E ++  WP     +  +  +PKLS+AA FVR+L DLAVQK    + QE
Sbjct  427   DEFFDVLDESEYEQTEAMWPSDAGMQPQDQRQPKLSTAAVFVRRLHDLAVQKKGYVDLQE  486

Query  1575  IVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIV  1754
                 E+    CYG TL KD+S+ +  SWA+AD S+FLIR + YLQD  KI + GTL Q+V
Sbjct  487   -ASMEDSMPCCYGATLQKDSSFTIACSWASADPSTFLIRSKTYLQDRQKIKANGTLMQMV  545

Query  1755  GADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLA  1934
              ADWL+S  RED+L  R G IVQKYAAQ   EFFF+VNIQVPG+T YSLALYYM+ TP+ 
Sbjct  546   AADWLKSSKREDDLGGRAGGIVQKYAAQGGREFFFIVNIQVPGSTTYSLALYYMMDTPVE  605

Query  1935  ENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLE  2114
             + PLLE F+  DDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF G NYLE
Sbjct  606   DVPLLESFIREDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFHGGNYLE  665

Query  2115  LDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             L +D+GSSTVARGV++LVLGYLNNLVIEMAFL+Q +TEEELPE LLGTCRLNHLDAS+AV
Sbjct  666   LGIDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQGNTEEELPEFLLGTCRLNHLDASRAV  725



>ref|XP_002274053.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Vitis 
vinifera]
Length=737

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/733 (60%), Positives = 540/733 (74%), Gaps = 26/733 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M M  + G MEGWLYLIR NR GLQY RKRY IL DNCL+ ++++PI+  EEP+R+A+ID
Sbjct  1     MGMSQTGGKMEGWLYLIRFNRFGLQYLRKRYLILRDNCLRGFRSMPISEEEEPVRTAVID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             S   V DNGREN  R VFF FTL +TSN ++QLK GA+S EEAA+WI  L++A      N
Sbjct  61    SRFRVTDNGRENIQRHVFFIFTLYDTSNPNNQLKLGASSSEEAAKWIHSLQEAVTKECAN  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQN  683
             P  ++      K Q  RL  S +         T +S    DA+ SDV+ P PWKIFG QN
Sbjct  121   PTNDVDPYPKSKKQYLRLHGSKKTGHKTSLDWTVSSPMHTDAIASDVVAPSPWKIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+F+EAKD + +  +WD HPAIMAVGV+D T EAIF+ LMSLGPSRSEWDFCF +GSV
Sbjct  181   GLRLFREAKDGDSHRMNWDDHPAIMAVGVVDATPEAIFRVLMSLGPSRSEWDFCFYQGSV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDI+H Q    WLPWG+KRRDLL++RYWRREDDGTYVIL HSV H KCP Q  
Sbjct  241   VEHLDGHTDIVHEQFYRDWLPWGMKRRDLLMQRYWRREDDGTYVILQHSVFHKKCPQQRS  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKSY---LRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG+VITP++ GK S VKHML+ DWK +   L  ++++S+TI ML  +AALRE
Sbjct  301   YVRACLKSGGYVITPMDHGKRSLVKHMLAADWKFWKCCLPASSARSITIRMLERVAALRE  360

Query  1215  MFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATER--------IEEDTTEKYPS  1370
             +FK+K+GS   +    +L  D++LP S+++ IK EV   E         + ED  EK PS
Sbjct  361   LFKSKAGSCPSELTSGKLQRDMELPQSQEDSIKVEVQKQEEIKKKEKVDLMEDGAEKLPS  420

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQ  1544
               +S V L+D ADEFFD PE SD    ++ WP       H  +  +PKLSSAA FV++L 
Sbjct  421   RPASFVGLNDAADEFFDFPELSDGNELENEWPSEQCSSLHSLDIHQPKLSSAASFVKRLH  480

Query  1545  DLAVQKN-FQEI--VGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDH  1715
             DLAVQK  + ++  V  E+    CYG TL KD +  +  SWA AD S+FLIRG+ YL DH
Sbjct  481   DLAVQKKGYMDLKEVSREDDISCCYGSTLEKDPNCTLDCSWAEADPSTFLIRGDNYLVDH  540

Query  1716  SKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRY  1895
              KI ++ TL Q+VGADWL+S  RED+LA RPGSIVQKYA   RPEFFFVVN+Q+PGATRY
Sbjct  541   QKIKAQKTLMQLVGADWLRSNKREDDLAGRPGSIVQKYAEWSRPEFFFVVNLQLPGATRY  600

Query  1896  SLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQS  2075
             +LALYYML+TPL + PLLE FVNGDDAFRNS+FKLIPYIS+GSWIVKQSVGKK+CL+GQ+
Sbjct  601   NLALYYMLRTPLKDTPLLESFVNGDDAFRNSRFKLIPYISQGSWIVKQSVGKKACLVGQA  660

Query  2076  LEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLG  2255
             LE NYF+G+NYLEL +D GSSTVARGV+NLV+GYLNN+V EMAFL+QA+T+EELPE LLG
Sbjct  661   LETNYFRGKNYLELGIDAGSSTVARGVVNLVVGYLNNMVTEMAFLIQANTQEELPEVLLG  720

Query  2256  TCRLNHLDASKAV  2294
             TCR NHLDASKAV
Sbjct  721   TCRFNHLDASKAV  733



>ref|XP_004982841.1| PREDICTED: uncharacterized protein LOC101786041 [Setaria italica]
Length=763

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/721 (61%), Positives = 541/721 (75%), Gaps = 23/721 (3%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQY RKRYF+LED  L+ +K+ P + RE+P+RSA+IDSCI V DNG
Sbjct  38    MEGWLYLIRSNRFGLQYSRKRYFVLEDAALRCFKSAPSSKREDPVRSAVIDSCIRVTDNG  97

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI-NPEKN--LRAPAI  551
             RE+ HR  F+ FTL N SNH DQLK GA S EEAARWIRCL ++A+ +P K+  + A + 
Sbjct  98    RESVHRSDFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMESALKSPRKDEHIVACSH  157

Query  552   RKWQPFRLSV-SSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRN  719
             R+WQ FRLS  +SRM   D    SS   D M SDVI P PW IFG +NGLR F EA D  
Sbjct  158   RRWQAFRLSRRNSRMHSIDWTLFSSAHNDPMASDVIAPSPWSIFGCKNGLRFFTEANDGG  217

Query  720   PNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIH  899
               G +WD HPAIMAVGV+D  SEA+F+ LMSLG SRSEWDFC   G VVEHLDGHTDIIH
Sbjct  218   SRGTYWDDHPAIMAVGVVDANSEAVFQTLMSLGQSRSEWDFCLQEGKVVEHLDGHTDIIH  277

Query  900   MQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHV  1079
              +L   WLPWG+++RDLLLRRYWRREDDGTYVILYHSV H KC P+ GY+RA +KSGG+V
Sbjct  278   KKLRGDWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYKCRPERGYIRACLKSGGYV  337

Query  1080  ITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YFP  1247
             I+P+NQG+ S VKHML++DWK   SYL  +++K +TI MLG +AALRE F+AK+G+    
Sbjct  338   ISPINQGRQSVVKHMLAIDWKFWKSYLFTSSAKYITIRMLGRVAALREFFRAKNGNCACL  397

Query  1248  DPAMNELTIDIQLPVSEKEEIKNEVVA---TERIEEDT------TEKYPSACSSIVELDD  1400
             + +  ELT D+ LP  E E I  E+     + R+E  T      + ++ S+  S V+L+D
Sbjct  398   EFSSGELTRDMGLPQGENERINLEMRQENESRRLEGPTEGSLGGSNRHLSSTGSFVQLND  457

Query  1401  VADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK-NFQEI  1577
              ADEFFDVP+ S+ +  +  +P   +    +    KLS+AA FV++L DLAVQK  + ++
Sbjct  458   AADEFFDVPDESEYDQREIVFPSDESTHAVDQRHAKLSTAAVFVKRLHDLAVQKRGYVDL  517

Query  1578  VGGEEGAKG--CYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQI  1751
              G  +   G  CYG TLPKD+SY +P +WA  D ++FLIRGE YL D  KI +  TL Q+
Sbjct  518   QGAADADNGPCCYGYTLPKDSSYTVPSTWAMTDPTTFLIRGETYLHDRLKIKANSTLMQM  577

Query  1752  VGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPL  1931
             VGADW++S+ RED+LA RPG +VQK AAQ   +FFF+VNIQVPG+T YSLALYYM+ TPL
Sbjct  578   VGADWIKSDKREDDLAGRPGGLVQKCAAQGGTKFFFIVNIQVPGSTTYSLALYYMMDTPL  637

Query  1932  AENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYL  2111
              + PLLERFVNGDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G NYL
Sbjct  638   EKVPLLERFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFRGSNYL  697

Query  2112  ELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKA  2291
             EL VD+GSSTVARGV++LVLGYLNNLVIEMAFLVQ +T EELPE LLGTCRLN+LDASKA
Sbjct  698   ELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNTSEELPEFLLGTCRLNYLDASKA  757

Query  2292  V  2294
             V
Sbjct  758   V  758



>ref|XP_008456489.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Cucumis melo]
Length=733

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/731 (60%), Positives = 557/731 (76%), Gaps = 26/731 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M  P++DG MEGWLYLIR NR GLQY +KRYF+L+D+CLKS+K+VP++  EEP +SA+ID
Sbjct  1     MGAPINDGKMEGWLYLIRSNRFGLQYSQKRYFVLQDDCLKSFKSVPVSENEEPNKSAVID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             S I V DNGRE+ HRKVFF FTL NT N +D+LK GA+SPE+AARWIR L D  +    +
Sbjct  61    SYIRVTDNGRESIHRKVFFIFTLHNTVNQNDRLKLGASSPEDAARWIRSLLDTTLKGCSD  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRM---ARTD---ASSTPVDAMTSDVIGPCPWKIFGIQN  683
             P +N R  + R++   R   S R+   A  D    SS  ++AMTSDVI P PWKIFG QN
Sbjct  121   PARNFRDRSKRQYPVLRFRGSKRIDWKASIDWIVCSSVQMEAMTSDVIAPSPWKIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKE+KD + + + WD HPAIMAVG++ GTSE IF+ LMSLG SRSEWDFCF RGS+
Sbjct  181   GLRLFKESKDNDSHRRQWDDHPAIMAVGMVCGTSEEIFRTLMSLGSSRSEWDFCFFRGSL  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEH+DGHTDIIHMQL   WLPWG+K+RD LLRRYWRREDDGTYV+LYHSV H K PPQ+G
Sbjct  241   VEHIDGHTDIIHMQLYRDWLPWGMKKRDFLLRRYWRREDDGTYVLLYHSVFHVKFPPQKG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG+V+TPVNQGK S VKHML+VDWK    YLR ++++++TI M+  +AALRE
Sbjct  301   YVRACLKSGGYVVTPVNQGKHSLVKHMLAVDWKFWKLYLRPSSARAITIRMVERLAALRE  360

Query  1215  MFKAKSGSYFPDPAMNELTI-DIQLPVSEKEEIKNEVVATE---RIEE----DTTEKYPS  1370
             +F+AK G    + + +   +   +LP S+ +EIK E+ + E   +I+E    +   + P 
Sbjct  361   LFRAKVGDSSSEFSSSSRDLRHFELPQSDIDEIKTEIQSPETMRKIKEAFLKENEAEMPR  420

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDL  1550
             A  S++ L+D  DEFFDVPE ++ +H ++ W    T +     + KLS+AA FV+KL DL
Sbjct  421   A--SLIGLNDAVDEFFDVPEPAELDHYENEWTSDLTLQQLNMSQNKLSTAAVFVKKLHDL  478

Query  1551  AVQKN-FQEI--VGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSK  1721
             AVQK  + E+  +  EE     YG TLPKD +++ P S A+AD S FLIRGE YL+D  K
Sbjct  479   AVQKKGYTELPELPREESMAYSYGSTLPKDFNFSTPCSVASADPSLFLIRGENYLKDSQK  538

Query  1722  ITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSL  1901
             I + GTL Q+VGADWL+S+ REDNL  RPGSIVQKYA +   EFFFVVNIQVPG T Y+L
Sbjct  539   IKANGTLMQLVGADWLRSDRREDNLGGRPGSIVQKYAERGGTEFFFVVNIQVPGTTMYTL  598

Query  1902  ALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLE  2081
             A+YYM++TPL  +PLL+ FV GDDAFRNS+FKLIPYIS+GSWIVKQSVGKK+CL+G +LE
Sbjct  599   AMYYMMRTPLESSPLLKNFVEGDDAFRNSRFKLIPYISQGSWIVKQSVGKKACLVGHALE  658

Query  2082  MNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTC  2261
             ++YF+G+NYLE+++DVGSSTVARGV++LVLGYLNNLVIEMAF++Q +T+EELPE LLGTC
Sbjct  659   VHYFRGKNYLEVEIDVGSSTVARGVVSLVLGYLNNLVIEMAFVIQGNTQEELPEILLGTC  718

Query  2262  RLNHLDASKAV  2294
             RLNHLD +K++
Sbjct  719   RLNHLDVAKSL  729



>gb|AAK21344.1|AC024594_8 unknown protein [Oryza sativa Japonica Group]
Length=773

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/728 (61%), Positives = 547/728 (75%), Gaps = 30/728 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITG-------REEPLRSAIIDSC  359
             MEGWLYLIR NRLGLQY RKRYF+LED  L+ +KA P          RE+P+RSAIIDSC
Sbjct  41    MEGWLYLIRSNRLGLQYSRKRYFVLEDAALRCFKAPPPPSSSSSSSKREDPVRSAIIDSC  100

Query  360   IHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI-NPEKN-  533
             I V DNGRE+ HR VF+ FTL N SNH DQLK GA S EEAARWIRCL ++A+ +P K+ 
Sbjct  101   IRVTDNGRESVHRSVFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMESALKSPRKDE  160

Query  534   -LRAPAIRKWQPFRLSV-SSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIF  698
              + A + R+WQ FRLS  S+RM   D    SS   D M SDVI P PW IFG +NGLR+F
Sbjct  161   HIVACSHRRWQAFRLSRRSNRMHSIDWTVFSSVHNDPMASDVIAPSPWTIFGCKNGLRLF  220

Query  699   KEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLD  878
              EAKD    GK+WD HPAIMAVGV+D  SEA+F+ +MSLG SRSEWDFC   G VVEH+D
Sbjct  221   TEAKDGGSEGKYWDDHPAIMAVGVVDANSEAVFQTVMSLGQSRSEWDFCLQEGRVVEHID  280

Query  879   GHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRAT  1058
             GHTDIIH +L   WLPWG+++RDLLLRRYWRREDDGTYVILYHSV H +C  + GYVRA 
Sbjct  281   GHTDIIHKKLRDGWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYRCRSERGYVRAC  340

Query  1059  VKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAK  1229
             +KSGG+VI+PVNQGK S VKHML++DWK   SYL   ++K +TI MLG +AALRE F+AK
Sbjct  341   LKSGGYVISPVNQGKQSVVKHMLAIDWKFWKSYLFTASAKHITIRMLGRVAALREFFRAK  400

Query  1230  SGS-YFPDPAMNELTIDIQLPVSEKEEIKNEVVAT---ERIEEDT------TEKYPSACS  1379
             +G+    + +  ELT D++L   E E IK E+++     R+E+ T      + ++ S+  
Sbjct  401   NGNCACIEFSSGELTRDMRLQQGENERIKIEMLSASENNRLEDPTEGSLGGSNRHLSSAG  460

Query  1380  SIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQ  1559
             S ++L+D ADEFFDVP+ S+ +  +  WP   +    +    KLS+AA FV+KL DLAVQ
Sbjct  461   SFIQLNDAADEFFDVPDDSEYDQREAMWPSDESTHSVDQRHAKLSTAAVFVKKLHDLAVQ  520

Query  1560  K-NFQEIVGGEEGAKG--CYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITS  1730
             K  + ++ G  +   G  CYG TLPKD++  MP +WA  D ++FLIRGE YLQD  KI +
Sbjct  521   KRGYVDLQGAADFDNGPFCYGYTLPKDSNCTMPSTWAMTDPTTFLIRGESYLQDRLKIKA  580

Query  1731  KGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALY  1910
               TL Q+VGADW++S+ RED+L+ RPG +VQK AAQ   +FFF+VNIQVPG++ YSLALY
Sbjct  581   NNTLMQMVGADWIKSDKREDDLSGRPGGLVQKCAAQGGNKFFFIVNIQVPGSSTYSLALY  640

Query  1911  YMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNY  2090
             YM+ TPL + PLLERFVNGDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NY
Sbjct  641   YMMDTPLEKVPLLERFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINY  700

Query  2091  FKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLN  2270
             F+G NYLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFLVQ +T+EELPE LLGTCRLN
Sbjct  701   FRGSNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNTQEELPEFLLGTCRLN  760

Query  2271  HLDASKAV  2294
             +LDASKAV
Sbjct  761   YLDASKAV  768



>ref|XP_002880934.1| hypothetical protein ARALYDRAFT_901677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57193.1| hypothetical protein ARALYDRAFT_901677 [Arabidopsis lyrata subsp. 
lyrata]
Length=737

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/730 (60%), Positives = 545/730 (75%), Gaps = 33/730 (5%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S+  MEGWLY+IR NR GL + RKRYF+L D+ LKS+K++  +  ++  RSA+IDSCI V
Sbjct  9     SETKMEGWLYIIRSNRFGLHFSRKRYFVLRDHLLKSFKSISDSKTKDAGRSAVIDSCIRV  68

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEK---NLR  539
              DNGREN HRK FF FTL NTSNH+DQLK GA+SPE+AARWI  +++AA+       ++ 
Sbjct  69    TDNGRENVHRKAFFIFTLYNTSNHNDQLKLGASSPEDAARWINLIKEAALKGAPFPGDVF  128

Query  540   APAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
               +  +W   RLS S R   +++      SS  VD +T+DV+ P PW IFG QNGLR+FK
Sbjct  129   NCSRSRWDSLRLSSSVRDRHSNSIDWTLRSSARVDPVTTDVVAPSPWTIFGCQNGLRLFK  188

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             EAK+R+  G+ WD HPAIMAVGV+DGTSE IF+ L+SLGPSRSEWDFCF +GSVVEHLDG
Sbjct  189   EAKERDSLGR-WDDHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDG  247

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDIIH QL + WLPWG+KRRD  LRRYWRREDDGTYVILYHSV H KCPPQ+GYVRA +
Sbjct  248   HTDIIHKQLYSDWLPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACL  307

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+P++ GK S VKHML+VDWKS   Y++ + ++S+T+ MLG I+ALRE+F+AK 
Sbjct  308   KSGGYVISPIDNGKQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAKH  367

Query  1233  GSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTT----EKYPSACSSIVELDD  1400
             GS+ P+ +  EL+    L  +E     +  +    + +DT     +K+PS  SS+V+LD 
Sbjct  368   GSFPPNLSSGELSRSAGLTQNEDGVFGDSSLRESEMFKDTANEERDKFPSERSSLVDLD-  426

Query  1401  VADEFFDVPEASDDEHSDHGWPRSTTPEY--HETPRPKLSSAACFVRKLQDLAVQK----  1562
                EFFDVPE SD++H D  W      +    E+ +PKL+SA   V+KL DLAVQK    
Sbjct  427   ---EFFDVPEPSDNDHLDDSWTSDFDLDTCCQESRQPKLNSATSLVKKLHDLAVQKRGYV  483

Query  1563  NFQEIVGGEEGAKG------CYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKI  1724
             +  E    E           CYG TLP D S ++P SW   D S+FLIRG+ YL D  K+
Sbjct  484   DLHERAREESSPHAARSPPCCYGTTLPTDPSCDLPCSWTTTDPSTFLIRGKTYLDDQKKV  543

Query  1725  TSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLA  1904
              +KGTL ++V ADWL+S+ RED+L +RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL 
Sbjct  544   KAKGTLMEMVAADWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLV  603

Query  1905  LYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEM  2084
             LYYM+ TP+ E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+
Sbjct  604   LYYMMSTPIEEHPLLVSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEI  663

Query  2085  NYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCR  2264
             NYF+G+NY+EL VD+GSSTVARGV++LVLGYLN LVIEMAFLVQA+TEEELPE+LLGTCR
Sbjct  664   NYFRGKNYIELGVDIGSSTVARGVVSLVLGYLNKLVIEMAFLVQANTEEELPEYLLGTCR  723

Query  2265  LNHLDASKAV  2294
              NHLDASKAV
Sbjct  724   FNHLDASKAV  733



>ref|XP_008678703.1| PREDICTED: uncharacterized protein LOC100192558 isoform X1 [Zea 
mays]
 tpg|DAA49599.1| TPA: hypothetical protein ZEAMMB73_435086 [Zea mays]
Length=766

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/721 (61%), Positives = 543/721 (75%), Gaps = 23/721 (3%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR G+QY RKRYF+LED  L+ +K+ P + RE+P+RSAIIDSCI V DNG
Sbjct  41    MEGWLYLIRSNRFGMQYSRKRYFVLEDAALRCFKSTPSSKREDPVRSAIIDSCIRVTDNG  100

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI-NPEKN--LRAPAI  551
             RE+ HR  F+ FTL N+SNH DQLK GA S EEAARWIRCL ++A+ +P K+  + A + 
Sbjct  101   RESVHRSDFYIFTLYNSSNHYDQLKLGARSSEEAARWIRCLMESALKSPRKDEHIVACSH  160

Query  552   RKWQPFRLSV-SSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRN  719
             R+WQ FRLS  +SRM   D    SS   D M SDVI P PW IFG  NGLR+F EA D  
Sbjct  161   RRWQAFRLSRRNSRMHSIDWTLFSSAHNDPMASDVIAPSPWTIFGCTNGLRLFTEANDGG  220

Query  720   PNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIH  899
              +GK+WD HPAIMAVGV+D  SEA+F+ LMSLG SRSEWDFC   G V+EHLDGHTDII 
Sbjct  221   SHGKYWDDHPAIMAVGVVDANSEAVFQTLMSLGQSRSEWDFCLREGKVIEHLDGHTDIIQ  280

Query  900   MQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHV  1079
              +L + WLPWG+++RDLLLRRYWRREDDGTYVILYHSV H KC P++GY+RA +KSGG+V
Sbjct  281   KKLRSDWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYKCRPEKGYIRACLKSGGYV  340

Query  1080  ITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YFP  1247
             I+PVNQG+ S VKHML++DWK   SYL  +++K +TI MLG +AALRE F+AK+G+    
Sbjct  341   ISPVNQGRQSVVKHMLAIDWKFWKSYLFTSSAKYITIRMLGRVAALREFFRAKNGNCSCM  400

Query  1248  DPAMNELTIDIQLPVSEKEEIKNEVVATE---RIEEDT------TEKYPSACSSIVELDD  1400
             + +  ELT D  LP  E + I  E+       R+E  T      + ++ S+  S V+L+D
Sbjct  401   EFSSGELTRDTGLPQGENQRINLEMQQENENGRLEGPTEGSLGGSNRHLSSTGSFVQLND  460

Query  1401  VADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK-NFQEI  1577
              ADEFFDVP+ S+ +  +  +P   +    +    KLS+AA FV++L DLAVQK  + ++
Sbjct  461   AADEFFDVPDESEYDQREVMFPSDESLHAADQRHAKLSTAAVFVKRLHDLAVQKRGYIDL  520

Query  1578  VGGEEGAKG--CYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQI  1751
              G  +   G  CYG TLPKD+SY +P +WA  D ++FLIRGE YL D  KI +  TL Q+
Sbjct  521   QGAADADNGPCCYGYTLPKDSSYTVPSTWAMTDPTTFLIRGETYLHDRIKIKANSTLMQM  580

Query  1752  VGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPL  1931
             VGADW++S+ RED+LA RPG +VQK AAQ    FFF+VNIQVPG+T YSLALYYM+ TPL
Sbjct  581   VGADWIKSDKREDDLAGRPGGLVQKCAAQGGTRFFFIVNIQVPGSTTYSLALYYMMDTPL  640

Query  1932  AENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYL  2111
              + PLLERFVNGDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G+NYL
Sbjct  641   EKVPLLERFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFRGRNYL  700

Query  2112  ELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKA  2291
             EL VD+GSSTVARGV++LVLGYLNNLVIEMAFLVQ +T EELPE LLGTCRLN+LDASKA
Sbjct  701   ELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNTNEELPEFLLGTCRLNYLDASKA  760

Query  2292  V  2294
             V
Sbjct  761   V  761



>ref|XP_006436438.1| hypothetical protein CICLE_v10030795mg [Citrus clementina]
 ref|XP_006485700.1| PREDICTED: uncharacterized protein LOC102625473 [Citrus sinensis]
 gb|ESR49678.1| hypothetical protein CICLE_v10030795mg [Citrus clementina]
Length=744

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/744 (60%), Positives = 551/744 (74%), Gaps = 41/744 (6%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  ++  +EGWLY I +NR+G+Q  RKRYFIL DNCL  YK VP + +EEP++SA+I 
Sbjct  1     MGIARNESKIEGWLYAILVNRIGMQISRKRYFILLDNCLNGYKMVPSSEKEEPVKSAMIH  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----  521
             SCI V DNGRE+ +RKV F FTL N+ +H+++LK GA SPEEAA+WIR L++AA+     
Sbjct  61    SCIRVTDNGRESINRKVLFVFTLYNSLDHNEKLKLGARSPEEAAKWIRSLQEAAVKECPC  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQN  683
             P  N  A + R+W   RL VS R         T  SS   +A  SDVI P PWKIFG QN
Sbjct  121   PTYNFVAVSKRRWPSLRLYVSKRSDYKYSGDWTLGSSIRSEATASDVIAPSPWKIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEAKD +  G+HWD HPAIMAVGV+DGTSEAIF+ LMSLG SRSEWDFCF RG V
Sbjct  181   GLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGH+D++H  L + WLPWG++RRDLL+RRYWRREDDGTYVILYHSV H KCP Q+G
Sbjct  241   VEHLDGHSDVVHKLLYSDWLPWGMQRRDLLVRRYWRREDDGTYVILYHSVNHKKCPKQKG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG VITP NQGK S VKHML+VDWK    YLR ++++S+TI ML  +AALRE
Sbjct  301   YVRACLKSGGFVITPSNQGKQSIVKHMLAVDWKYWKLYLRPSSARSITIRMLERVAALRE  360

Query  1215  MFKAKSGS----YFPDPAMNELTI--DIQLPVSEKEEIKNE---------VVATERIEED  1349
             +F+AK+G+    +    +  E+    D +LP  E  ++KNE         +    + E+D
Sbjct  361   LFQAKAGNTSSEFLSRGSTREIKAAQDSELP--EDIQLKNEEDTEIEIQKIEEIRKTEKD  418

Query  1350  ---TTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLS  1514
                T EK  S  +S++ ++D +DEFFDVPEA  D H ++ W    +PE      P+ KL+
Sbjct  419   APFTEEKPSSGRASLMGINDASDEFFDVPEAYSD-HMENDWSLEVSPELQPLSAPQSKLA  477

Query  1515  SAACFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSF  1682
             SAA FV+KL DLAV K    + QE V  E+     YG TL  D+S+  P SWAAAD S+F
Sbjct  478   SAAGFVKKLHDLAVHKKGCTDLQE-VPNEDEKSWSYGATLQTDSSFTSPCSWAAADPSTF  536

Query  1683  LIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFV  1862
             LIRGE YL+DH KI + GTL Q++GADWL+S  REDNLAARP S+VQKYAA   PEFFFV
Sbjct  537   LIRGENYLKDHRKIKADGTLMQMIGADWLRSNKREDNLAARPCSLVQKYAAGGGPEFFFV  596

Query  1863  VNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQS  2042
             VNIQ PG T+Y+LALYY++KTPL +NPLL +FVNGDDAFRNS+FKLIPYISKGSWIVKQS
Sbjct  597   VNIQFPGTTKYTLALYYVIKTPLEDNPLLHKFVNGDDAFRNSRFKLIPYISKGSWIVKQS  656

Query  2043  VGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQAD  2222
             VGK +CL+G++LE+NY++G+NYLE+ +DVGSSTVA GV +LVLGYLNNLVIEMAFL+Q +
Sbjct  657   VGKTACLLGRALEVNYYRGRNYLEIQIDVGSSTVATGVASLVLGYLNNLVIEMAFLIQGE  716

Query  2223  TEEELPEHLLGTCRLNHLDASKAV  2294
             TEEELPE LLGTCRLNHLD SK+V
Sbjct  717   TEEELPEFLLGTCRLNHLDVSKSV  740



>ref|XP_008678750.1| PREDICTED: uncharacterized protein LOC100192558 isoform X2 [Zea 
mays]
Length=767

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/722 (61%), Positives = 543/722 (75%), Gaps = 24/722 (3%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR G+QY RKRYF+LED  L+ +K+ P + RE+P+RSAIIDSCI V DNG
Sbjct  41    MEGWLYLIRSNRFGMQYSRKRYFVLEDAALRCFKSTPSSKREDPVRSAIIDSCIRVTDNG  100

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI--NPEKN--LRAPA  548
             RE+ HR  F+ FTL N+SNH DQLK GA S EEAARWIRCL ++A+  +P K+  + A +
Sbjct  101   RESVHRSDFYIFTLYNSSNHYDQLKLGARSSEEAARWIRCLMESALKQSPRKDEHIVACS  160

Query  549   IRKWQPFRLSV-SSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDR  716
              R+WQ FRLS  +SRM   D    SS   D M SDVI P PW IFG  NGLR+F EA D 
Sbjct  161   HRRWQAFRLSRRNSRMHSIDWTLFSSAHNDPMASDVIAPSPWTIFGCTNGLRLFTEANDG  220

Query  717   NPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDII  896
               +GK+WD HPAIMAVGV+D  SEA+F+ LMSLG SRSEWDFC   G V+EHLDGHTDII
Sbjct  221   GSHGKYWDDHPAIMAVGVVDANSEAVFQTLMSLGQSRSEWDFCLREGKVIEHLDGHTDII  280

Query  897   HMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGH  1076
               +L + WLPWG+++RDLLLRRYWRREDDGTYVILYHSV H KC P++GY+RA +KSGG+
Sbjct  281   QKKLRSDWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYKCRPEKGYIRACLKSGGY  340

Query  1077  VITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YF  1244
             VI+PVNQG+ S VKHML++DWK   SYL  +++K +TI MLG +AALRE F+AK+G+   
Sbjct  341   VISPVNQGRQSVVKHMLAIDWKFWKSYLFTSSAKYITIRMLGRVAALREFFRAKNGNCSC  400

Query  1245  PDPAMNELTIDIQLPVSEKEEIKNEVVATE---RIEEDT------TEKYPSACSSIVELD  1397
              + +  ELT D  LP  E + I  E+       R+E  T      + ++ S+  S V+L+
Sbjct  401   MEFSSGELTRDTGLPQGENQRINLEMQQENENGRLEGPTEGSLGGSNRHLSSTGSFVQLN  460

Query  1398  DVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK-NFQE  1574
             D ADEFFDVP+ S+ +  +  +P   +    +    KLS+AA FV++L DLAVQK  + +
Sbjct  461   DAADEFFDVPDESEYDQREVMFPSDESLHAADQRHAKLSTAAVFVKRLHDLAVQKRGYID  520

Query  1575  IVGGEEGAKG--CYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQ  1748
             + G  +   G  CYG TLPKD+SY +P +WA  D ++FLIRGE YL D  KI +  TL Q
Sbjct  521   LQGAADADNGPCCYGYTLPKDSSYTVPSTWAMTDPTTFLIRGETYLHDRIKIKANSTLMQ  580

Query  1749  IVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTP  1928
             +VGADW++S+ RED+LA RPG +VQK AAQ    FFF+VNIQVPG+T YSLALYYM+ TP
Sbjct  581   MVGADWIKSDKREDDLAGRPGGLVQKCAAQGGTRFFFIVNIQVPGSTTYSLALYYMMDTP  640

Query  1929  LAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNY  2108
             L + PLLERFVNGDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G+NY
Sbjct  641   LEKVPLLERFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFRGRNY  700

Query  2109  LELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASK  2288
             LEL VD+GSSTVARGV++LVLGYLNNLVIEMAFLVQ +T EELPE LLGTCRLN+LDASK
Sbjct  701   LELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNTNEELPEFLLGTCRLNYLDASK  760

Query  2289  AV  2294
             AV
Sbjct  761   AV  762



>ref|XP_003541992.1| PREDICTED: uncharacterized protein LOC100812931 [Glycine max]
Length=738

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/716 (62%), Positives = 552/716 (77%), Gaps = 20/716 (3%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR+GLQ+ RKRYF+L+ N L+S+K+VP++  ++P+RSAI+DSCI V DNG
Sbjct  21    MEGWLYLIRFNRIGLQFSRKRYFVLDGNLLRSFKSVPVSNNQDPVRSAIVDSCIRVMDNG  80

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN--PE--KNLRAPA  548
             RE+ +RKVFF FTL NT NH+DQLKFGA+ PEEAARWI+   +A++   P+   +    +
Sbjct  81    RESVNRKVFFIFTLYNTLNHNDQLKFGASRPEEAARWIQSFHEASLKGAPDGGDDTVGCS  140

Query  549   IRKWQPFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNG  728
              R+WQ       S  +R+  +S      ++DVI P PW IFG QNGLR+FKEAKDR+ +G
Sbjct  141   KRRWQS-FRLSGSSSSRSHPNSVDWTLSSADVIAPSPWTIFGCQNGLRLFKEAKDRDSSG  199

Query  729   KHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQL  908
             K WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +G+VVEHLDGHTDIIH QL
Sbjct  200   KKWDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQL  259

Query  909   TTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITP  1088
              + WLPWG+KRRDLLLRRYWRREDDGTYVILYHS+ H KCPPQ+GYVRA +KSGG+VI+P
Sbjct  260   FSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSMFHKKCPPQKGYVRACLKSGGYVISP  319

Query  1089  VNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YFPDPA  1256
             VN+GK S VKHML++DWK    YL+ +++ S+TI MLG +AALRE+FKAK G+    D +
Sbjct  320   VNKGKQSVVKHMLAIDWKCWRLYLKSSSAHSITIQMLGRVAALRELFKAKLGNCSSSDYS  379

Query  1257  MNELTIDIQLPVSEKEEIKN--EVVATER---IEEDTTEKYPSACSSIVELDDVADEFFD  1421
               ELT + +L + E+  I +  E+ A E    I     ++  S  +S+V L+D  DEF+D
Sbjct  380   SGELTRNRELHIKEEHIINSDTEIQADENNHDISVGEVDQTQSEHASLVTLNDADDEFYD  439

Query  1422  VPEASDDEHSDHGW-PRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK----NFQEIVGG  1586
             VPE SD + S++GW    +  +  E    KLS+AA FV++L DLAVQK    + QE+V  
Sbjct  440   VPEPSDCDVSENGWMTECSHQKSQEIRHQKLSTAANFVKRLHDLAVQKRGYVDLQEMVR-  498

Query  1587  EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADW  1766
             E+     YG TLP+D++  +P S    D S+FLIRGE YL+D  K+ +KGTL ++V ADW
Sbjct  499   EDSITCSYGSTLPQDSTCTLPCSLTETDPSTFLIRGENYLEDRLKVKAKGTLMKMVAADW  558

Query  1767  LQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPL  1946
             ++S+ RED+L  RPGSIVQKYAAQ  PEFFF+VNIQVPG+T YSLALYYM+ TP+ + PL
Sbjct  559   VRSDKREDDLGGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPL  618

Query  1947  LERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVD  2126
             LE F+ GDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G NYLEL VD
Sbjct  619   LESFIKGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFQGSNYLELGVD  678

Query  2127  VGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             +GSSTVARGV++LVLGYLN+LVIEMAFL+Q +T EELPE LLGTCRLNHLDASKAV
Sbjct  679   IGSSTVARGVVSLVLGYLNHLVIEMAFLIQGNTREELPEFLLGTCRLNHLDASKAV  734



>ref|XP_010521754.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Tarenaya hassleriana]
Length=737

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/733 (61%), Positives = 550/733 (75%), Gaps = 33/733 (5%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S+  MEGWLY+I  NR  LQ+ RKRYF+LED+ LKS+K+   +  +   RSA+IDSCI V
Sbjct  9     SETKMEGWLYIISSNRFILQFSRKRYFVLEDHLLKSFKSASDSKTKGAGRSAVIDSCIRV  68

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEK---NLR  539
              DNGRE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAA+WI  ++DA +       ++ 
Sbjct  69    IDNGRESVHRKVFFIFTLYNTSNHNDQLKLGASSPEEAAKWINSIKDATLKGTPFPGDVF  128

Query  540   APAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
             + +  +W   RLS S R   +++      SS  VD + +DVI P PW IFG QNGLR+FK
Sbjct  129   SCSRSRWDSLRLSSSVRDYHSNSIDWTIRSSARVDPIANDVIAPSPWTIFGCQNGLRLFK  188

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             EAK+R+ +G+ WD HPAIMAVG++DGTSEAIF+ LMSLG SRSEWDFCF +GSVVEHLDG
Sbjct  189   EAKERDSHGR-WDDHPAIMAVGIVDGTSEAIFETLMSLGNSRSEWDFCFYKGSVVEHLDG  247

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDIIH +L + WLPWG++RRDLLLRRYWRREDDGTYVILYHSV H KCP Q+GY+RA +
Sbjct  248   HTDIIHKKLYSDWLPWGMQRRDLLLRRYWRREDDGTYVILYHSVFHKKCPSQKGYIRACL  307

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+PV  GK S VKHML+VDWKS   YL+ + ++S+T+ MLG I+ALRE+F+AK 
Sbjct  308   KSGGYVISPVKNGKQSVVKHMLAVDWKSWRSYLKPSLARSITVRMLGRISALRELFRAKH  367

Query  1233  GSYFPDPAMN--ELTIDIQLPVSEKEEIKNEVVATE--RIEEDTTE---KYPSACSSIVE  1391
             GS FP   ++  EL+  ++L  + ++         E  R +E T E   K PS  SS+V+
Sbjct  368   GS-FPTSVLSSGELSRSLRLNSNLEDGAIGSSSHKESGRFKEITNEEMDKLPSEHSSLVD  426

Query  1392  LDDVADEFFDVPEASDDEHSDHGWPR-----STTPEYHETPRPKLSSAACFVRKLQDLAV  1556
             L+D ADEFFDVPE SD+++SD  W       +  PE H    PKL+ AA  V+KL DLAV
Sbjct  427   LNDSADEFFDVPEPSDNDYSDDSWTSDFDLDTCCPESHH---PKLTGAASLVKKLHDLAV  483

Query  1557  QKN----FQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKI  1724
             QK       E+   E     CYG TLP D + ++P SW   D S+FLIRG  YL+D  K+
Sbjct  484   QKRGYVELHEMTREESSMPCCYGTTLPNDLTCSVPCSWTETDPSTFLIRGNTYLEDRKKV  543

Query  1725  TSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLA  1904
              +KGTL ++V ADWL+S+ RED+L + PG IVQKYAAQ  PEFFF+VNIQVPG+T YSL 
Sbjct  544   KAKGTLLKMVAADWLKSDKREDDLGSHPGGIVQKYAAQGGPEFFFIVNIQVPGSTTYSLV  603

Query  1905  LYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEM  2084
             LYYM+  P+ E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+
Sbjct  604   LYYMMSAPIEEHPLLYSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEL  663

Query  2085  NYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCR  2264
             NYF+G+NY+EL VD+GSSTVARGV++LVLGYLNNLVIEMAFLVQA+TEEELPE+LLGTCR
Sbjct  664   NYFRGKNYIELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQANTEEELPEYLLGTCR  723

Query  2265  LNHLDASKAVHTN  2303
             LNHLDASK+V  N
Sbjct  724   LNHLDASKSVPIN  736



>emb|CBI31451.3| unnamed protein product [Vitis vinifera]
Length=728

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/724 (61%), Positives = 536/724 (74%), Gaps = 26/724 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQY RKRY IL DNCL+ ++++PI+  EEP+R+A+IDS   V DNG
Sbjct  1     MEGWLYLIRFNRFGLQYLRKRYLILRDNCLRGFRSMPISEEEEPVRTAVIDSRFRVTDNG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----NPEKNLRAPA  548
             REN  R VFF FTL +TSN ++QLK GA+S EEAA+WI  L++A      NP  ++    
Sbjct  61    RENIQRHVFFIFTLYDTSNPNNQLKLGASSSEEAAKWIHSLQEAVTKECANPTNDVDPYP  120

Query  549   IRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAK  710
               K Q  RL  S +         T +S    DA+ SDV+ P PWKIFG QNGLR+F+EAK
Sbjct  121   KSKKQYLRLHGSKKTGHKTSLDWTVSSPMHTDAIASDVVAPSPWKIFGCQNGLRLFREAK  180

Query  711   DRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
             D + +  +WD HPAIMAVGV+D T EAIF+ LMSLGPSRSEWDFCF +GSVVEHLDGHTD
Sbjct  181   DGDSHRMNWDDHPAIMAVGVVDATPEAIFRVLMSLGPSRSEWDFCFYQGSVVEHLDGHTD  240

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             I+H Q    WLPWG+KRRDLL++RYWRREDDGTYVIL HSV H KCP Q  YVRA +KSG
Sbjct  241   IVHEQFYRDWLPWGMKRRDLLMQRYWRREDDGTYVILQHSVFHKKCPQQRSYVRACLKSG  300

Query  1071  GHVITPVNQGKSSTVKHMLSVDWKSY---LRKTTSKSLTIDMLGGIAALREMFKAKSGSY  1241
             G+VITP++ GK S VKHML+ DWK +   L  ++++S+TI ML  +AALRE+FK+K+GS 
Sbjct  301   GYVITPMDHGKRSLVKHMLAADWKFWKCCLPASSARSITIRMLERVAALRELFKSKAGSC  360

Query  1242  FPDPAMNELTIDIQLPVSEKEEIKNEVVATER--------IEEDTTEKYPSACSSIVELD  1397
               +    +L  D++LP S+++ IK EV   E         + ED  EK PS  +S V L+
Sbjct  361   PSELTSGKLQRDMELPQSQEDSIKVEVQKQEEIKKKEKVDLMEDGAEKLPSRPASFVGLN  420

Query  1398  DVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQKN-F  1568
             D ADEFFD PE SD    ++ WP       H  +  +PKLSSAA FV++L DLAVQK  +
Sbjct  421   DAADEFFDFPELSDGNELENEWPSEQCSSLHSLDIHQPKLSSAASFVKRLHDLAVQKKGY  480

Query  1569  QEI--VGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTL  1742
              ++  V  E+    CYG TL KD +  +  SWA AD S+FLIRG+ YL DH KI ++ TL
Sbjct  481   MDLKEVSREDDISCCYGSTLEKDPNCTLDCSWAEADPSTFLIRGDNYLVDHQKIKAQKTL  540

Query  1743  TQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLK  1922
              Q+VGADWL+S  RED+LA RPGSIVQKYA   RPEFFFVVN+Q+PGATRY+LALYYML+
Sbjct  541   MQLVGADWLRSNKREDDLAGRPGSIVQKYAEWSRPEFFFVVNLQLPGATRYNLALYYMLR  600

Query  1923  TPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQ  2102
             TPL + PLLE FVNGDDAFRNS+FKLIPYIS+GSWIVKQSVGKK+CL+GQ+LE NYF+G+
Sbjct  601   TPLKDTPLLESFVNGDDAFRNSRFKLIPYISQGSWIVKQSVGKKACLVGQALETNYFRGK  660

Query  2103  NYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDA  2282
             NYLEL +D GSSTVARGV+NLV+GYLNN+V EMAFL+QA+T+EELPE LLGTCR NHLDA
Sbjct  661   NYLELGIDAGSSTVARGVVNLVVGYLNNMVTEMAFLIQANTQEELPEVLLGTCRFNHLDA  720

Query  2283  SKAV  2294
             SKAV
Sbjct  721   SKAV  724



>ref|XP_006365757.1| PREDICTED: uncharacterized protein LOC102579740 [Solanum tuberosum]
Length=732

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/725 (61%), Positives = 541/725 (75%), Gaps = 30/725 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQY RKRYF+L D   KSYK+ P+T  E+P+RSA+IDSCI V DNG
Sbjct  11    MEGWLYLIRSNRFGLQYSRKRYFVLHDLLFKSYKSNPVTNIEDPVRSAVIDSCIRVTDNG  70

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPA---I  551
             RE+  RKV F FTL N SNH+DQLK GAN PEEAARWI+ L++AA+  + N R       
Sbjct  71    RESIQRKVVFIFTLYNASNHNDQLKLGANRPEEAARWIQALQEAALKADMNKRTAVDRPR  130

Query  552   RKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKD  713
             R  Q  RL+ S++    ++      SS+  DA TSDV+ P  W IFG QNGLR+FKEAKD
Sbjct  131   RDSQSLRLNCSNKSHHLNSIDWTFCSSSVADATTSDVVAPSSWTIFGCQNGLRLFKEAKD  190

Query  714   RNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDI  893
             R  +GK W+ HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFC  +GSV+EHLDGHTDI
Sbjct  191   RESHGK-WNDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCHYKGSVIEHLDGHTDI  249

Query  894   IHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGG  1073
             +H  L   WLPW +++RDLLL+RYWRREDDGTYVILYHSV H KCP Q+GYVRA +KSGG
Sbjct  250   VHKLLRRDWLPWSMRKRDLLLQRYWRREDDGTYVILYHSVFHQKCPCQKGYVRACLKSGG  309

Query  1074  HVITPVNQGKSSTVKHMLSVDW---KSYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYF  1244
             +VI+PVNQ K S VKHML++DW   KS L+ ++++ +TI MLG +AALRE+F AK G   
Sbjct  310   YVISPVNQKKQSVVKHMLAIDWRFWKSNLQTSSTRYITIHMLGRLAALRELFIAKLGDCS  369

Query  1245  PDPAMNELTIDIQLPVSEKEEIKNEV---VATERIEEDTTE---KYPSACSSIVELDDVA  1406
                 + E   D +L   + EE+K E+   V   +   D  E   K PS  +S++ L+D +
Sbjct  370   SSYFLEEHVRDKRL--QQIEEVKVEIQTIVENGKNMADMEEEVAKSPSEHASLMGLNDAS  427

Query  1407  DEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK----NF  1568
             DEFFDV E  D + S++GWP    PE +  +T   +LSSAA FV+KL DLAV K    + 
Sbjct  428   DEFFDVSEPLDYDQSENGWPSDFGPEMYSQDTRHARLSSAAGFVKKLHDLAVHKRGYVDL  487

Query  1569  QEIVGGEEGAKGC-YGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLT  1745
              E    +E A  C YG TLPKD ++N+P SWA  D S+FLIRGE YL+D  KI +KGTL 
Sbjct  488   HE--KAKEDALLCHYGSTLPKDPTFNLPCSWAQTDPSTFLIRGETYLEDRKKIKAKGTLM  545

Query  1746  QIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKT  1925
             Q+V ADWL+S+ RED+L  RPGSIVQKYAA+  PEFFF+VNIQVPG+T Y+LALYYM+ T
Sbjct  546   QMVAADWLKSDKREDDLGGRPGSIVQKYAAKGGPEFFFIVNIQVPGSTTYTLALYYMMDT  605

Query  1926  PLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQN  2105
             P+   PLLE FV GDDAFRNS+FKLIPYISKG WIVKQSVGKK+CL+G +LE+NYF+G+N
Sbjct  606   PIENAPLLESFVKGDDAFRNSRFKLIPYISKGPWIVKQSVGKKACLVGPALEINYFRGKN  665

Query  2106  YLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDAS  2285
             YLELD++VGSSTVARGV++LV+GYLNNLVIEMAFL+QA+T EELPE+LL TCRLNHLD S
Sbjct  666   YLELDINVGSSTVARGVVSLVVGYLNNLVIEMAFLIQANTPEELPEYLLATCRLNHLDIS  725

Query  2286  KAVHT  2300
             KAV  
Sbjct  726   KAVQV  730



>gb|KFK32307.1| hypothetical protein AALP_AA6G225400 [Arabis alpina]
Length=742

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/724 (60%), Positives = 544/724 (75%), Gaps = 23/724 (3%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S+  MEGWLY+IR NR GL + RKRYF+L D+ LKS+K++  +  E   RSA+IDSCI V
Sbjct  16    SETKMEGWLYIIRSNRFGLLFSRKRYFVLGDHLLKSFKSLSDSETENAGRSAVIDSCIRV  75

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEK---NLR  539
              DNGR++ HRK  F FTL NTSNH+DQLK GA+SPE+AARWI  +++AA+       ++ 
Sbjct  76    TDNGRDSVHRKALFIFTLYNTSNHNDQLKLGASSPEDAARWINFIKEAALKGAPFPGDVF  135

Query  540   APAIRKWQPFRLSVS------SRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
               +  +W   RLS S      + +  T  SS  VD +T+DV+ P PW IFG QNGLR+FK
Sbjct  136   NCSRSRWDSLRLSSSVPDHHPNSIDWTLRSSARVDPVTTDVVAPSPWTIFGCQNGLRLFK  195

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             EAK+R+  G+ WD HPAIMAVGV+DGTSE IF+ L+SLGPSRSEWDFCF +GSVVEHLDG
Sbjct  196   EAKERDSLGR-WDDHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDG  254

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDIIH QL + WLPWG+KRRD  LRRYWRREDDGTYVILYHSV H KCPPQ+GYVRA +
Sbjct  255   HTDIIHKQLYSDWLPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACL  314

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+P++ GK S VKHML+VDWKS   YL+ + ++S+T+ MLG ++ALRE+F+AK 
Sbjct  315   KSGGYVISPIDNGKQSVVKHMLAVDWKSWRSYLKPSLARSITVKMLGRLSALRELFRAKH  374

Query  1233  GSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTT----EKYPSACSSIVELDD  1400
             GS+  + +  EL    +L  +E     +  ++   + +D      EK+PS  SS+V+L+D
Sbjct  375   GSFPTNLSSGELIRSARLSQNEDGGFGDSSLSESGMFKDNANAEAEKFPSERSSLVDLND  434

Query  1401  VADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK----  1562
               DEFFDVPE SD++H D  W      + +  E+ +PKL+SA   V+KL DLAVQK    
Sbjct  435   GVDEFFDVPEPSDNDHLDDSWTSDFDSDRYSQESRQPKLNSATSLVKKLHDLAVQKRGYV  494

Query  1563  NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTL  1742
             +  E    E     CYG TLP D +  +P SW   D S+FLIRG+ YL+D  K+ +KG L
Sbjct  495   DLHERAREEISVPCCYGSTLPTDPTCALPCSWTTTDPSTFLIRGKTYLEDQKKVKAKGKL  554

Query  1743  TQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLK  1922
              ++V ADWL+S+ RED+L +RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL LYYM+ 
Sbjct  555   MEMVAADWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMS  614

Query  1923  TPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQ  2102
             TP+ E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+G+
Sbjct  615   TPIEEHPLLVSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGK  674

Query  2103  NYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDA  2282
             NY+EL VD+GSSTVARGV++LVLGYLN LVIEMAFLVQA+TEEELPE+LLGTCRLNHLDA
Sbjct  675   NYIELGVDIGSSTVARGVVSLVLGYLNKLVIEMAFLVQANTEEELPEYLLGTCRLNHLDA  734

Query  2283  SKAV  2294
             SK+V
Sbjct  735   SKSV  738



>gb|AES67511.2| pleckstrin-like (PH) and lipid-binding START domain protein [Medicago 
truncatula]
Length=727

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/711 (61%), Positives = 540/711 (76%), Gaps = 16/711 (2%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQ+ RKRYF+L D+ L+S+K++P +  ++P+RSAI+DSCI V DNG
Sbjct  16    MEGWLYLIRCNRFGLQFSRKRYFVLHDHLLRSFKSIPNSTDQDPVRSAIVDSCIRVMDNG  75

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW  560
             RE+ +RKVFF FTL NTS+H+DQLK GA+ PEEAARWI+   +A++         + R+W
Sbjct  76    RESINRKVFFIFTLYNTSDHNDQLKLGASRPEEAARWIQSFNEASLKGAPEAIGCSKRRW  135

Query  561   QPFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWD  740
             Q F L  SS  +R+   S      +SDVI P  W IFG QNGLR+F+EAKDR   GK WD
Sbjct  136   QSFSLRGSS--SRSQQYSIDWTLSSSDVIAPSTWTIFGCQNGLRLFREAKDRGSCGKKWD  193

Query  741   GHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHW  920
              HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +G+VVEHLDGHTDIIH QL + W
Sbjct  194   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQLYSDW  253

Query  921   LPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVNQG  1100
             LPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCP Q+GYVRA +KSGG+VI+P N G
Sbjct  254   LPWGIKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGYVRACLKSGGYVISPANMG  313

Query  1101  KSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YFPDPAMNEL  1268
             K S VKHML++DWKS   YL+ +++ S+TI MLG +AALRE+F+ + G+    D +  EL
Sbjct  314   KQSVVKHMLAIDWKSWRSYLKSSSAYSMTIQMLGRVAALRELFRTRLGNCTLSDYSSGEL  373

Query  1269  TIDIQ-LPVSEKEEIKNEVVATERIEEDT---TEKYPSACSSIVELDDVADEFFDVPEAS  1436
             T + +  P  E      ++ A E   +++    E   S  +S+V L+D  DEF+DV E S
Sbjct  374   TRNRRNSPKEEYASSDTQIQADENNHDNSIGEVEPTQSEHASLVSLNDADDEFYDVMEPS  433

Query  1437  DDEHSDHGWPRSTTPEYHETPR-PKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAK  1601
             + + S+ GW    + +  +  R  KLS+AA FVRKL DLAV K    + QE+V  EE   
Sbjct  434   NCDESEKGWMTECSHQKSQDIRHQKLSTAANFVRKLHDLAVHKRGYMDLQEMVR-EESIS  492

Query  1602  GCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEI  1781
               YG TLPKD +  +P S   AD S+FLIRGE YL+DH K+ +KGTL Q+V ADWL+S+ 
Sbjct  493   CPYGSTLPKDPTCTLPCSLTEADPSTFLIRGENYLEDHQKVKAKGTLMQMVAADWLRSDR  552

Query  1782  REDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFV  1961
             RED+L  RPGSIVQKYAAQ  PEFFF+VNIQVPG+T YSLALYYM+ TP+ + PLL+ F+
Sbjct  553   REDDLGGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPLLDSFI  612

Query  1962  NGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSST  2141
              GD+AFRNS+FKLIPYIS+GSWIVKQSVGKK+CL+GQ+LE+NYF+G+NYLE+ VDVGSST
Sbjct  613   KGDNAFRNSRFKLIPYISEGSWIVKQSVGKKACLVGQALEINYFQGKNYLEIGVDVGSST  672

Query  2142  VARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             +ARGV+NLVLGYLN+LVIEMAFL+Q +T EELPE LLGTCRLNHLDASKAV
Sbjct  673   IARGVVNLVLGYLNHLVIEMAFLIQGNTREELPEVLLGTCRLNHLDASKAV  723



>ref|XP_010089970.1| hypothetical protein L484_008048 [Morus notabilis]
 gb|EXB38684.1| hypothetical protein L484_008048 [Morus notabilis]
Length=787

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/732 (62%), Positives = 547/732 (75%), Gaps = 48/732 (7%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             +DG MEGWLYLIR NR+GLQY RKRYF+LE + L+S+K+VP +  EEP++SAIIDSCI V
Sbjct  6     TDGRMEGWLYLIRSNRIGLQYSRKRYFVLEAHHLRSFKSVPASNDEEPVKSAIIDSCIRV  65

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPA  548
              DNGRE+ HRKVFF FTL NTSNH+DQLK           W +    A +  ++    P 
Sbjct  66    MDNGRESIHRKVFFIFTLYNTSNHNDQLK---------VPWGQ----AVLKKQQGGFIPF  112

Query  549   IRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAK  710
               K Q +RL   SR +R ++       ST  D MTSDVI P PW IFG QNGLR+FKEAK
Sbjct  113   --KKQLYRLGGPSRSSRINSIDWTICPSTQADPMTSDVIAPSPWTIFGCQNGLRLFKEAK  170

Query  711   DRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
             DR+ +GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRS+WDFCF  GSVVEHLDGHTD
Sbjct  171   DRDSHGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSQWDFCFYEGSVVEHLDGHTD  229

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             IIH QL + WLPWG++RRDLLLRRYWRREDDGTYVILYHSV H KCPPQ+GYVRA +KSG
Sbjct  230   IIHKQLYSDWLPWGMQRRDLLLRRYWRREDDGTYVILYHSVSHKKCPPQKGYVRACLKSG  289

Query  1071  GHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSY  1241
             G+VI+PVNQGK S VKHML++DWK   SYLR ++++++TI MLG +AALRE+F+AK G +
Sbjct  290   GYVISPVNQGKQSVVKHMLAIDWKFWKSYLRTSSARAITIRMLGRVAALRELFRAKQGYH  349

Query  1242  FPDPAMNELTIDIQLPVSEKEEIKNEVVATE------RIEEDTTEKYPSACSSIVELDDV  1403
               + +  ELT +I    +E +++ +    T        I E+  +K PS  +S+V L+D 
Sbjct  350   SSEYSSGELTRNIGANQNEVDDMFDVRTVTGDGSSMGNIAEEV-DKTPSEHASLVSLNDA  408

Query  1404  ADEFFDVPEASDDEHSDHGWPRSTTPE--YHETPRPKLSSAACFVRKLQDLAVQK----N  1565
             ADEFFDVPE  D + S+  W     PE    +   PKLS+AA FV+KL DLA+QK    +
Sbjct  409   ADEFFDVPEPPDYDQSEADWVPEFVPEQNLQDVRHPKLSTAAGFVKKLHDLAIQKRGYVD  468

Query  1566  FQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLT  1745
              QE+   E+    CYG TLPKD +  +P SW   D S+FLIRG+ YL+D  K+ +KGTL 
Sbjct  469   LQEM-AMEDSVSCCYGSTLPKDPTCALPCSWTTTDPSTFLIRGKSYLEDRLKVKAKGTLM  527

Query  1746  QIVGADWLQSEIREDNLAARPGSIVQ---------KYAAQDRPEFFFVVNIQVPGATRYS  1898
             Q+VGADWL+S+ RED+LA RPGSIVQ         KYA Q  PEFFF+VNIQVPG+  YS
Sbjct  528   QMVGADWLRSDKREDDLAGRPGSIVQAGLKVFLLQKYAVQGGPEFFFIVNIQVPGSMTYS  587

Query  1899  LALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSL  2078
             LALYYM+ T L + PLLE FV GDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+L
Sbjct  588   LALYYMMNTRLEDAPLLESFVKGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLIGQAL  647

Query  2079  EMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGT  2258
             E+NYF G+NYLEL V++GSSTVARGV++LVLGYL+NLVIEMAFLVQA+T EELPE+LLGT
Sbjct  648   EINYFHGKNYLELGVNIGSSTVARGVVSLVLGYLSNLVIEMAFLVQANTPEELPEYLLGT  707

Query  2259  CRLNHLDASKAV  2294
             CRLNHLDASK+V
Sbjct  708   CRLNHLDASKSV  719



>ref|NP_180399.2| pleckstrin homology (PH) and lipid-binding START domain-containing 
protein [Arabidopsis thaliana]
 gb|AEC08107.1| pleckstrin homology (PH) and lipid-binding START domain-containing 
protein [Arabidopsis thaliana]
Length=737

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/730 (59%), Positives = 545/730 (75%), Gaps = 33/730 (5%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S+  MEGWLY+IR NR GL + RKRYF+L D+ LKS+K++  +  +   RSA+IDSCI V
Sbjct  9     SETKMEGWLYIIRSNRFGLHFSRKRYFVLGDHLLKSFKSISDSKTKNAGRSAVIDSCIRV  68

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEK---NLR  539
              DNGREN HRK FF FTL NTSNH+DQLK GA+SPE+AARWI  +++AA+       ++ 
Sbjct  69    TDNGRENVHRKAFFIFTLYNTSNHNDQLKLGASSPEDAARWINLIKEAALKGAPFPGDVF  128

Query  540   APAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
               +  +W   RLS S R   +++      SS  VD +T+DV+ P PW IFG QNGLR+FK
Sbjct  129   NCSRSRWDSLRLSSSVRDHHSNSIDWTLRSSARVDPVTTDVVAPSPWTIFGCQNGLRLFK  188

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             EAK+R+  G+ WD HPAIMAVGV+DGTSE IF+ L+SLGPSRSEWDFCF +GSVVEHLDG
Sbjct  189   EAKERDSLGR-WDDHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDG  247

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDIIH QL + WLPWG+KRRD  LRRYWRREDDGTYVILYHSV H KCPPQ+GYVRA +
Sbjct  248   HTDIIHKQLYSDWLPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACL  307

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+P++ GK S VKHML+VDWKS   Y++ + ++S+T+ MLG I+ALRE+F+AK 
Sbjct  308   KSGGYVISPIDNGKQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAKH  367

Query  1233  GSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTT----EKYPSACSSIVELDD  1400
             GS+ P+ +  EL+   +L  +E     +  +    + +DT     +K+PS  SS+V+LD 
Sbjct  368   GSFPPNLSSGELSRSARLTQNEDGVFGDSSLRENEMFKDTANEERDKFPSERSSLVDLD-  426

Query  1401  VADEFFDVPEASDDEHSDHGWPRSTTPEY--HETPRPKLSSAACFVRKLQDLAVQK----  1562
                EFFDVPE SD+++ D  W      +    E+ +PKL+SA   V+KL DLAVQK    
Sbjct  427   ---EFFDVPEPSDNDNLDDSWTSDFDLDTCCQESRQPKLNSATSLVKKLHDLAVQKRGYV  483

Query  1563  NFQEIVGGEEGAKG------CYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKI  1724
             +  E    E           CYG TLP D S ++P SW   D S+FLIRG+ YL D  K+
Sbjct  484   DLHERAKEESSPHATCNPPCCYGTTLPTDPSCDLPCSWTTTDPSTFLIRGKTYLDDQKKV  543

Query  1725  TSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLA  1904
              +KGTL ++V ADWL+S+ RED+L +RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL 
Sbjct  544   KAKGTLMEMVAADWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLV  603

Query  1905  LYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEM  2084
             LYYM+ TP+ E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+
Sbjct  604   LYYMMSTPIEEHPLLVSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEI  663

Query  2085  NYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCR  2264
             NYF+G+NY+EL VD+GSSTVARGV++LVLGYLN LVIEMAFL+QA+TEEELPE+LLGTCR
Sbjct  664   NYFRGKNYIELGVDIGSSTVARGVVSLVLGYLNKLVIEMAFLIQANTEEELPEYLLGTCR  723

Query  2265  LNHLDASKAV  2294
              NHLDASKA+
Sbjct  724   FNHLDASKAI  733



>ref|XP_006293758.1| hypothetical protein CARUB_v10022718mg [Capsella rubella]
 gb|EOA26656.1| hypothetical protein CARUB_v10022718mg [Capsella rubella]
Length=731

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/724 (60%), Positives = 542/724 (75%), Gaps = 27/724 (4%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S+  MEGWLY+IR NR GL + RKRYF+L D+ LKS+K+V  +  ++  RSA+IDSCI V
Sbjct  9     SETKMEGWLYIIRSNRFGLHFSRKRYFVLGDHLLKSFKSVSDSKSKDAGRSAVIDSCIRV  68

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEK---NLR  539
              DNGRE+ HRK FF FTL NTSNH+DQLK GA+SPE+AARWI  +++AA+       ++ 
Sbjct  69    TDNGRESVHRKAFFIFTLYNTSNHNDQLKLGASSPEDAARWINLIKEAALKGAPFPGDVF  128

Query  540   APAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
               +  +W   RLS S R   + +       S  VD +T+DV+ P PW IFG QNGLR+FK
Sbjct  129   NCSRSRWDSLRLSSSVRDRHSSSIDWTLRPSARVDPVTTDVVAPSPWTIFGCQNGLRLFK  188

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             EAK+R+  G+ WD HPAIMAVGV+DGTSE IF+ L+SLGPSRSEWDFCF +GSVVEHLDG
Sbjct  189   EAKERDSLGR-WDDHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDG  247

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDIIH QL + WLPWG+KRRD  LRRYWRREDDGTYVILYHSV H KCPPQ+GYVRA +
Sbjct  248   HTDIIHKQLYSDWLPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACL  307

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+P++ GK S VKHML+VDWKS   Y+R + ++S+T+ MLG ++ALRE+F+AK 
Sbjct  308   KSGGYVISPIDNGKQSVVKHMLAVDWKSWRAYMRPSLARSITVKMLGRLSALRELFRAKH  367

Query  1233  GSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTT----EKYPSACSSIVELDD  1400
             GS+ P+ +  EL+   +L  +E     +  +    + +DT     +K+PS  SS+V+LD 
Sbjct  368   GSFPPNLSSGELSRSARLTQNEDGVFGDSSLRESEMFKDTANEERDKFPSERSSLVDLD-  426

Query  1401  VADEFFDVPEASDDEHSDHGWPRSTTPEY--HETPRPKLSSAACFVRKLQDLAVQK----  1562
                EFFDVPE SD+++ +  W      +    E+ +PKL+SA   V+KL DLAVQK    
Sbjct  427   ---EFFDVPEPSDNDYLEESWTSDFDLDTCCQESRQPKLNSATNLVKKLHDLAVQKRGYV  483

Query  1563  NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTL  1742
             +  E    E     CYG TLP D S  +P SW   D S+FLIRG+ YL D  K  +KGTL
Sbjct  484   DLHERAREESSTPCCYGTTLPTDPSCGLPCSWTVTDPSTFLIRGKTYLDDQKKFKAKGTL  543

Query  1743  TQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLK  1922
              ++V ADWL+S+ RED+L +RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL LYYM+ 
Sbjct  544   MEMVAADWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMS  603

Query  1923  TPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQ  2102
             TP+ E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+G+
Sbjct  604   TPIEEHPLLLSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGK  663

Query  2103  NYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDA  2282
             NY+EL VD+GSSTVARGV++LVLGYLN LVIEMAFLVQA+TEEELPE+L+GTCR NHLDA
Sbjct  664   NYIELGVDIGSSTVARGVVSLVLGYLNKLVIEMAFLVQANTEEELPEYLIGTCRFNHLDA  723

Query  2283  SKAV  2294
             SKAV
Sbjct  724   SKAV  727



>ref|XP_010510641.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
Length=731

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/720 (60%), Positives = 539/720 (75%), Gaps = 27/720 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLY+IR NR GL + RKRYF+L D+ LKS+K+V  +  ++  RSA+IDSCI V DNG
Sbjct  13    MEGWLYIIRSNRFGLHFSRKRYFVLRDHLLKSFKSVSDSKSKDAGRSAVIDSCIRVTDNG  72

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEK---NLRAPAI  551
             RE+ HRK FF FTL NTSNH+DQLK GA+SPE+AARWI  +++AA+       ++   + 
Sbjct  73    RESVHRKAFFIFTLFNTSNHNDQLKLGASSPEDAARWINLIKEAALKGSPFPGDVFNCSR  132

Query  552   RKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKD  713
              +W   RLS S R   +++       S  VD +T+DV+ P PW IFG QNGLR+FKEAK+
Sbjct  133   GRWDSLRLSSSVRDRHSNSIDWTLRPSARVDPVTTDVVAPSPWTIFGCQNGLRLFKEAKE  192

Query  714   RNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDI  893
             R+  G+ WD HPAIMAVGV+DGTSE IF+ L+SLGPSRSEWDFCF +GSVVEHLDGHTDI
Sbjct  193   RDSLGR-WDDHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDGHTDI  251

Query  894   IHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGG  1073
             IH Q  + WLPWG+KRRD  LRRYWRREDDGTYVILYHSV H KCPPQ+GYVRA +KSGG
Sbjct  252   IHKQFYSDWLPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGG  311

Query  1074  HVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYF  1244
             +VI+P++ G  S VKHML+VDWKS   Y++ + ++S+T+ MLG ++ALRE+F+AK GS+ 
Sbjct  312   YVISPIDNGTQSVVKHMLAVDWKSWRSYMKPSLARSITVKMLGRLSALRELFRAKHGSFP  371

Query  1245  PDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTT----EKYPSACSSIVELDDVADE  1412
             P+ +  EL+   +L  +E  E  +  +    + +DT     +K+PS  SS+V+LD    E
Sbjct  372   PNLSSGELSRSARLTQNEDGEFGDSSLRESEMFKDTANEERDKFPSERSSLVDLD----E  427

Query  1413  FFDVPEASDDEHSDHGWPRSTTPEY--HETPRPKLSSAACFVRKLQDLAVQK----NFQE  1574
             FFDVPE SD ++ +  W      E    E+ +PKL+SA   V+KL DLAVQK    +  E
Sbjct  428   FFDVPEPSDSDYLEDSWTSDFDTETCCQESRQPKLNSATNLVKKLHDLAVQKRGYVDLHE  487

Query  1575  IVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIV  1754
                 E     CYG TLP D +  +P SW   D S+FLIRG+ YL D  K  +KGTL ++V
Sbjct  488   RAREESSTSCCYGTTLPTDPTCALPCSWTTTDPSTFLIRGKTYLDDQKKFKAKGTLMEMV  547

Query  1755  GADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLA  1934
              ADWL+S+ RED+L +RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL LYYM+ TP+ 
Sbjct  548   AADWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIE  607

Query  1935  ENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLE  2114
             E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+G+NY+E
Sbjct  608   EHPLLLSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGKNYIE  667

Query  2115  LDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             L VD+GSSTVARGV++LVLGYLN LVIEMAFLVQA+TEEELPE+LLGTCR NHLDASKAV
Sbjct  668   LGVDIGSSTVARGVVSLVLGYLNKLVIEMAFLVQANTEEELPEYLLGTCRFNHLDASKAV  727



>ref|XP_009589980.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Nicotiana 
tomentosiformis]
Length=730

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/724 (61%), Positives = 540/724 (75%), Gaps = 30/724 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYL+R NR GLQY RK YF+L DN LKSYK+ P++  E+P+RSA+I+SCI V DNG
Sbjct  11    MEGWLYLVRSNRFGLQYSRKLYFVLYDNLLKSYKSDPVSNNEDPVRSAVINSCIRVTDNG  70

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW  560
             RE+  RKV F FTL + SNH DQLK GANSPEEAARWI+ L++AA+  +           
Sbjct  71    RESIQRKVVFIFTLYSASNHSDQLKLGANSPEEAARWIQALQEAALQHKGTAVDCPRGDS  130

Query  561   QPFRLSVSSR------MARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNP  722
             Q  RL+ SS+      +  T  SS+  DA TSDV+ P  W IFG QNGLR+FKEAKDR  
Sbjct  131   QSLRLNSSSKSHCLNSINWTLCSSSVADATTSDVVAPSSWTIFGGQNGLRLFKEAKDRES  190

Query  723   NGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHM  902
              GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFC+ +GSV+EHLDGHTDI+H 
Sbjct  191   QGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCYYKGSVIEHLDGHTDIVHK  249

Query  903   QLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVI  1082
              L   WLPW +KRRDLLLRRYWRREDDGTYVILYHSV H KCP Q+GYVRA +KSGG+VI
Sbjct  250   LLRRDWLPWSMKRRDLLLRRYWRREDDGTYVILYHSVFHQKCPRQKGYVRACLKSGGYVI  309

Query  1083  TPVNQGKSSTVKHMLSVDW---KSYLRKTTSKSLTIDMLGGIAALREMFKAKSG----SY  1241
             +PVNQ K S VKHML++DW   KSYLR ++++ +TI ML  +AALRE+F+AK G    SY
Sbjct  310   SPVNQRKQSVVKHMLAIDWRFWKSYLRTSSARYITIHMLERLAALRELFRAKLGDCSSSY  369

Query  1242  FPDPAMNELTI----DIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVAD  1409
             F +  +    +    ++++ V  + E +  V     +EE+     PS  +S++ L+D +D
Sbjct  370   FLEEQVRNKRLHQIEEVKVEVQNRLESRKNVAD---MEEEEMVNSPSEHASLMGLNDASD  426

Query  1410  EFFDVPEASDDEHSDHGWPRSTTPE-YHETPR-PKLSSAACFVRKLQDLAVQK----NFQ  1571
             EFFDV E  D + S++GWP    PE Y +  R  +LSSAA FV+KL DLAVQK    +  
Sbjct  427   EFFDVSEPLDYDESENGWPSDFGPETYSQDMRHARLSSAAVFVKKLHDLAVQKRGYVDLH  486

Query  1572  EIVGGEEGAKGCY-GCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQ  1748
             E V  +EG   CY G TL KD + N+P SW   D S+FLIRGE YL+D  KI +KGTL +
Sbjct  487   EKV--KEGTLLCYYGSTLTKDPTCNLPCSWTQTDPSTFLIRGETYLEDRKKIKAKGTLMK  544

Query  1749  IVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTP  1928
             +V ADWL+S+ RED+L  RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL LYYM+ TP
Sbjct  545   MVAADWLKSDKREDDLGGRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLGLYYMMDTP  604

Query  1929  LAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNY  2108
             +   PLLE FV GDDA+RNS FKLIPYISKG WIVKQSVGKK+C++GQ+LE+NYF+G+NY
Sbjct  605   IENAPLLESFVKGDDAYRNSSFKLIPYISKGPWIVKQSVGKKACIVGQALEINYFRGKNY  664

Query  2109  LELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASK  2288
             LELD+DVGSSTVARGV++LV+GYLNNLVIEMAFLVQA+T EELPE+LLGTCRLNHLD SK
Sbjct  665   LELDIDVGSSTVARGVVSLVVGYLNNLVIEMAFLVQANTTEELPEYLLGTCRLNHLDVSK  724

Query  2289  AVHT  2300
             AV  
Sbjct  725   AVQA  728



>ref|XP_010521753.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Tarenaya hassleriana]
Length=740

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/736 (60%), Positives = 547/736 (74%), Gaps = 36/736 (5%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S+  MEGWLY+I  NR  LQ+ RKRYF+LED+ LKS+K+   +  +   RSA+IDSCI V
Sbjct  9     SETKMEGWLYIISSNRFILQFSRKRYFVLEDHLLKSFKSASDSKTKGAGRSAVIDSCIRV  68

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEK---NLR  539
              DNGRE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAA+WI  ++DA +       ++ 
Sbjct  69    IDNGRESVHRKVFFIFTLYNTSNHNDQLKLGASSPEEAAKWINSIKDATLKGTPFPGDVF  128

Query  540   APAIRKWQPFRLSVSSRMAR---------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLR  692
             + +  +W   R  + S   R         T  SS  VD + +DVI P PW IFG QNGLR
Sbjct  129   SCSRSRWDSLRKYILSSSVRDYHSNSIDWTIRSSARVDPIANDVIAPSPWTIFGCQNGLR  188

Query  693   IFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEH  872
             +FKEAK+R+ +G+ WD HPAIMAVG++DGTSEAIF+ LMSLG SRSEWDFCF +GSVVEH
Sbjct  189   LFKEAKERDSHGR-WDDHPAIMAVGIVDGTSEAIFETLMSLGNSRSEWDFCFYKGSVVEH  247

Query  873   LDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVR  1052
             LDGHTDIIH +L + WLPWG++RRDLLLRRYWRREDDGTYVILYHSV H KCP Q+GY+R
Sbjct  248   LDGHTDIIHKKLYSDWLPWGMQRRDLLLRRYWRREDDGTYVILYHSVFHKKCPSQKGYIR  307

Query  1053  ATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFK  1223
             A +KSGG+VI+PV  GK S VKHML+VDWKS   YL+ + ++S+T+ MLG I+ALRE+F+
Sbjct  308   ACLKSGGYVISPVKNGKQSVVKHMLAVDWKSWRSYLKPSLARSITVRMLGRISALRELFR  367

Query  1224  AKSGSYFPDPAMN--ELTIDIQLPVSEKEEIKNEVVATE--RIEEDTTE---KYPSACSS  1382
             AK GS FP   ++  EL+  ++L  + ++         E  R +E T E   K PS  SS
Sbjct  368   AKHGS-FPTSVLSSGELSRSLRLNSNLEDGAIGSSSHKESGRFKEITNEEMDKLPSEHSS  426

Query  1383  IVELDDVADEFFDVPEASDDEHSDHGWPR-----STTPEYHETPRPKLSSAACFVRKLQD  1547
             +V+L+D ADEFFDVPE SD+++SD  W       +  PE H    PKL+ AA  V+KL D
Sbjct  427   LVDLNDSADEFFDVPEPSDNDYSDDSWTSDFDLDTCCPESHH---PKLTGAASLVKKLHD  483

Query  1548  LAVQKN----FQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDH  1715
             LAVQK       E+   E     CYG TLP D + ++P SW   D S+FLIRG  YL+D 
Sbjct  484   LAVQKRGYVELHEMTREESSMPCCYGTTLPNDLTCSVPCSWTETDPSTFLIRGNTYLEDR  543

Query  1716  SKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRY  1895
              K+ +KGTL ++V ADWL+S+ RED+L + PG IVQKYAAQ  PEFFF+VNIQVPG+T Y
Sbjct  544   KKVKAKGTLLKMVAADWLKSDKREDDLGSHPGGIVQKYAAQGGPEFFFIVNIQVPGSTTY  603

Query  1896  SLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQS  2075
             SL LYYM+  P+ E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+
Sbjct  604   SLVLYYMMSAPIEEHPLLYSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQA  663

Query  2076  LEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLG  2255
             LE+NYF+G+NY+EL VD+GSSTVARGV++LVLGYLNNLVIEMAFLVQA+TEEELPE+LLG
Sbjct  664   LELNYFRGKNYIELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQANTEEELPEYLLG  723

Query  2256  TCRLNHLDASKAVHTN  2303
             TCRLNHLDASK+V  N
Sbjct  724   TCRLNHLDASKSVPIN  739



>ref|XP_010920449.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X4 [Elaeis 
guineensis]
Length=738

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/737 (60%), Positives = 538/737 (73%), Gaps = 34/737 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +   D  MEGWLYLIR NRLGLQY RKRYF+LEDN L  YKAVP + RE+P+RSA+ID
Sbjct  1     MGITEGDRRMEGWLYLIRSNRLGLQYSRKRYFVLEDNALNCYKAVPASRREDPIRSALID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             SCI V DNGR + HR VF+ FTL +++NH+D+LK GA S EEAA WIR L +AA+    N
Sbjct  61    SCIRVTDNGRASIHRSVFYIFTLYSSANHNDRLKLGARSSEEAASWIRSLMEAALKECPN  120

Query  522   PEKNLRAPAIRKWQPFRLS---VSSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQN  683
              E+N  A + R+ Q FRLS     S M   D    SS   D M SDVI P PW IFG   
Sbjct  121   KEENFVACSKRRRQSFRLSRTKARSLMHSIDWTVYSSVHADPMASDVIAPSPWTIFGC--  178

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
              LR+FKE+ + + +GK WD HPAIMAVGV+D TSEAIF+ +MSLGPSRSEWDF    G V
Sbjct  179   -LRLFKESNEGDFHGKQWDDHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRV  237

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDIIH +L   WLPWG+K+RDLLLRRYWRREDDGTYVILYHSV H  C P+ G
Sbjct  238   VEHLDGHTDIIHKKLRGDWLPWGMKKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERG  297

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALRE  1214
             Y+RA +KSGG+VI+PVNQGK S VKHML++DWK   SY+  +++K +TI MLG +A LRE
Sbjct  298   YIRACLKSGGYVISPVNQGKRSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAGLRE  357

Query  1215  MFKAKSGS-YFPDPAMNELTIDIQLPVSEKEEIKNEV---------VATERIEEDTTEKY  1364
              F+AK G+    D +  ELT +I LP  EKE IK EV         V +    + +  ++
Sbjct  358   FFRAKLGNCTCSDYSSGELTREIGLPYGEKEHIKVEVQTTGENNKSVDSAEAPQQSPSRH  417

Query  1365  PSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRST---TPEYHETPRPKLSSAACFVR  1535
                  S ++L+D ADEFFDV + SD++ ++  WP      +    E  +P+LS+AA FV+
Sbjct  418   ADTNGSFLQLNDAADEFFDVIDESDNDQTESLWPSDEGMHSQLLQEQRQPRLSTAAVFVK  477

Query  1536  KLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKY  1703
             KL D AVQK    + QE   G+  A   YG TLPKD S  MP SWA AD++SFLIRGE Y
Sbjct  478   KLHDFAVQKKGYIDLQEASMGDM-APCSYGATLPKDTSCTMPCSWAMADSTSFLIRGESY  536

Query  1704  LQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPG  1883
             L+DH KI +  TL Q+V ADWL S+ RED+L  RPG IVQKYAAQ   EFFF+VNIQVPG
Sbjct  537   LRDHQKIKANSTLMQMVAADWLNSDKREDDLGGRPGGIVQKYAAQGGSEFFFIVNIQVPG  596

Query  1884  ATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCL  2063
             +T YSLALYYM+ TPL   PLLE FV GD+A+RNS+FKLIPYISKGSWIVKQSVGKK+CL
Sbjct  597   STTYSLALYYMMDTPLENVPLLESFVKGDNAYRNSRFKLIPYISKGSWIVKQSVGKKACL  656

Query  2064  IGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPE  2243
             +GQ+LE++YF+G NYLEL +DVGSSTVARGV++LVLGYLNNLVIE+AFL+Q +T+EELPE
Sbjct  657   VGQALEIHYFRGSNYLELGIDVGSSTVARGVVSLVLGYLNNLVIELAFLIQGNTQEELPE  716

Query  2244  HLLGTCRLNHLDASKAV  2294
              LLGTCRLNHLDASK+V
Sbjct  717   FLLGTCRLNHLDASKSV  733



>gb|KFK32308.1| hypothetical protein AALP_AA6G225400 [Arabis alpina]
Length=744

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/726 (60%), Positives = 544/726 (75%), Gaps = 25/726 (3%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGRE--EPLRSAIIDSCI  362
             S+  MEGWLY+IR NR GL + RKRYF+L D+ LKS+K++  +  E     RSA+IDSCI
Sbjct  16    SETKMEGWLYIIRSNRFGLLFSRKRYFVLGDHLLKSFKSLSDSETEVKNAGRSAVIDSCI  75

Query  363   HVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEK---N  533
              V DNGR++ HRK  F FTL NTSNH+DQLK GA+SPE+AARWI  +++AA+       +
Sbjct  76    RVTDNGRDSVHRKALFIFTLYNTSNHNDQLKLGASSPEDAARWINFIKEAALKGAPFPGD  135

Query  534   LRAPAIRKWQPFRLSVS------SRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRI  695
             +   +  +W   RLS S      + +  T  SS  VD +T+DV+ P PW IFG QNGLR+
Sbjct  136   VFNCSRSRWDSLRLSSSVPDHHPNSIDWTLRSSARVDPVTTDVVAPSPWTIFGCQNGLRL  195

Query  696   FKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHL  875
             FKEAK+R+  G+ WD HPAIMAVGV+DGTSE IF+ L+SLGPSRSEWDFCF +GSVVEHL
Sbjct  196   FKEAKERDSLGR-WDDHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHL  254

Query  876   DGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRA  1055
             DGHTDIIH QL + WLPWG+KRRD  LRRYWRREDDGTYVILYHSV H KCPPQ+GYVRA
Sbjct  255   DGHTDIIHKQLYSDWLPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRA  314

Query  1056  TVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKA  1226
              +KSGG+VI+P++ GK S VKHML+VDWKS   YL+ + ++S+T+ MLG ++ALRE+F+A
Sbjct  315   CLKSGGYVISPIDNGKQSVVKHMLAVDWKSWRSYLKPSLARSITVKMLGRLSALRELFRA  374

Query  1227  KSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTT----EKYPSACSSIVEL  1394
             K GS+  + +  EL    +L  +E     +  ++   + +D      EK+PS  SS+V+L
Sbjct  375   KHGSFPTNLSSGELIRSARLSQNEDGGFGDSSLSESGMFKDNANAEAEKFPSERSSLVDL  434

Query  1395  DDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK--  1562
             +D  DEFFDVPE SD++H D  W      + +  E+ +PKL+SA   V+KL DLAVQK  
Sbjct  435   NDGVDEFFDVPEPSDNDHLDDSWTSDFDSDRYSQESRQPKLNSATSLVKKLHDLAVQKRG  494

Query  1563  --NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKG  1736
               +  E    E     CYG TLP D +  +P SW   D S+FLIRG+ YL+D  K+ +KG
Sbjct  495   YVDLHERAREEISVPCCYGSTLPTDPTCALPCSWTTTDPSTFLIRGKTYLEDQKKVKAKG  554

Query  1737  TLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYM  1916
              L ++V ADWL+S+ RED+L +RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL LYYM
Sbjct  555   KLMEMVAADWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYM  614

Query  1917  LKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFK  2096
             + TP+ E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+
Sbjct  615   MSTPIEEHPLLVSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFR  674

Query  2097  GQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHL  2276
             G+NY+EL VD+GSSTVARGV++LVLGYLN LVIEMAFLVQA+TEEELPE+LLGTCRLNHL
Sbjct  675   GKNYIELGVDIGSSTVARGVVSLVLGYLNKLVIEMAFLVQANTEEELPEYLLGTCRLNHL  734

Query  2277  DASKAV  2294
             DASK+V
Sbjct  735   DASKSV  740



>ref|XP_006589423.1| PREDICTED: uncharacterized protein LOC100802528 isoform X1 [Glycine 
max]
Length=730

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/739 (60%), Positives = 543/739 (73%), Gaps = 37/739 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +P  +  MEGWLYLIR NR G  Y RKRYFIL+ N L+S+K  P +  EEP+RSAIID
Sbjct  1     MGIPQRERKMEGWLYLIRANRFGQHYSRKRYFILKGNALRSFKIKPTSQMEEPIRSAIID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             SCI V DNGRE  ++ V F FT+ N ++  D+LK GA+S EEAARWIR L+DAA+    +
Sbjct  61    SCIRVNDNGRETMNKNVLFIFTVYNATDQSDKLKLGASSSEEAARWIRTLQDAAMKGCPS  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMARTD--------ASSTPVDAMTSDVIGPCPWKIFGI  677
             P KNL A   ++    R   S     TD         S    +AMT+DVI P PWKIFG 
Sbjct  121   PAKNLVACHKKRRSSLRNGGSKS---TDWKYSNLNFQSCIYTEAMTADVIAPSPWKIFGC  177

Query  678   QNGLRIFKEAKDRNPNGKHWDG-HPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCR  854
             QNGLR+FKEAKD +  G HW G +PAIMAVGV+DG SEAIF  LM+L PSRSEWDFC  R
Sbjct  178   QNGLRMFKEAKDWDSRGSHWVGENPAIMAVGVVDGASEAIFHTLMTLDPSRSEWDFCIYR  237

Query  855   GSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPP  1034
             G+VV+H+DGHTDIIH+QL   WLPWG+K RDLLLRRYWRREDDG+YV+L+HSV HSKCPP
Sbjct  238   GNVVDHIDGHTDIIHLQLYNDWLPWGMKPRDLLLRRYWRREDDGSYVLLFHSVYHSKCPP  297

Query  1035  QEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAA  1205
             ++GYVRA VKSGG V+TPVN+G  S V+HML+VDWK    YLR  +++S+TI ML  IAA
Sbjct  298   KKGYVRACVKSGGFVVTPVNKGTQSVVRHMLAVDWKFWKLYLRPASARSITIRMLERIAA  357

Query  1206  LREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATER--------IEEDTTEK  1361
             LRE+F+ K G+Y  +P    +T DI LP+  KE+IK EV   +         + ED  E 
Sbjct  358   LRELFRTKGGNYSSEPL--AMTKDIGLPLGVKEDIKTEVSQEKNKFEEPPLVVMEDEVE-  414

Query  1362  YPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKL  1541
              PS   S++ L+D +DEFFDVPE ++ +H  + W    + E      P+++SAA FV+KL
Sbjct  415   -PSGRRSLMGLND-SDEFFDVPEPTEYDHFQNEWHADLSSEQMSMSIPRMTSAAGFVKKL  472

Query  1542  QDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQ  1709
               LAVQK    + QE    EE     YG TL KD+S   P +WAA+D S FL+RGE YLQ
Sbjct  473   HGLAVQKKGYMDLQE-AAMEESTSCSYGATLQKDSSCASPCTWAASDPSLFLVRGENYLQ  531

Query  1710  DHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGAT  1889
             DH K+ + GTLTQ+VGADWL+S+ REDNL++RPGSIVQ+YAA+  PEFFFV+N+Q+PG+ 
Sbjct  532   DHQKVKANGTLTQMVGADWLRSDTREDNLSSRPGSIVQQYAAKGGPEFFFVINMQMPGSP  591

Query  1890  RYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIG  2069
              YSLALYYMLKTPL +NPLL+ FV+GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+G
Sbjct  592   MYSLALYYMLKTPLEDNPLLQSFVDGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVG  651

Query  2070  QSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHL  2249
             Q+LEM Y +G+NYLE+D+DVGSSTVARGV +LVLGYLNNLV+EMAFLVQ  T +ELPE L
Sbjct  652   QALEMLYIRGKNYLEIDIDVGSSTVARGVASLVLGYLNNLVVEMAFLVQGSTPDELPEVL  711

Query  2250  LGTCRLNHLDASKAVHTNS  2306
             LGTCRLNH+DASKA   NS
Sbjct  712   LGTCRLNHMDASKAFLVNS  730



>gb|KHN21511.1| hypothetical protein glysoja_021091 [Glycine soja]
Length=742

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/720 (61%), Positives = 552/720 (77%), Gaps = 24/720 (3%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR+GLQ+ RKRYF+L+ N L+S+K+VP++  ++P+RSAI+DSCI V DNG
Sbjct  21    MEGWLYLIRFNRIGLQFSRKRYFVLDGNLLRSFKSVPVSNNQDPVRSAIVDSCIRVMDNG  80

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN--PE--KNLRAPA  548
             RE+ +RKVFF FTL NT NH+DQLKFGA+ PEEAARWI+   +A++   P+   +    +
Sbjct  81    RESVNRKVFFIFTLYNTLNHNDQLKFGASRPEEAARWIQSFHEASLKGAPDGGDDTVGCS  140

Query  549   IRKWQPFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNG  728
              R+WQ       S  +R+  +S      ++DVI P PW IFG QNGLR+FKEAKDR+ +G
Sbjct  141   KRRWQS-FRLSGSSSSRSHPNSVDWTLSSADVIAPSPWTIFGCQNGLRLFKEAKDRDSSG  199

Query  729   KHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQL  908
             K WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +G+VVEHLDGHTDIIH QL
Sbjct  200   KKWDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQL  259

Query  909   TTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITP  1088
              + WLPWG+KRRDLLLRRYWRREDDGTYVILYHS+ H KCPPQ+GYVRA +KSGG+VI+P
Sbjct  260   FSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSMFHKKCPPQKGYVRACLKSGGYVISP  319

Query  1089  VNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YFPDPA  1256
             VN+GK S VKHML++DWK    YL+ +++ S+TI MLG +AALRE+FKAK G+    D +
Sbjct  320   VNKGKQSVVKHMLAIDWKCWRLYLKSSSAHSITIQMLGRVAALRELFKAKLGNCSSSDYS  379

Query  1257  MNELTIDIQLPVSEKEEIKN--EVVATER---IEEDTTEKYPSACSSIVELDDVADEFFD  1421
               ELT + +L + E+  I +  E+ A E    I     ++  S  +S+V L+D  DEF+D
Sbjct  380   SGELTRNRELHIKEEHIINSDTEIQADENNHDISVGEVDQTQSEHASLVTLNDADDEFYD  439

Query  1422  VPEASDDEHSDHGW-PRSTTPEYHETPRPKLSSAACFVRKLQDLA----VQK----NFQE  1574
             VPE SD + S++GW    +  +  E    KLS+AA FV++L DLA    VQK    + QE
Sbjct  440   VPEPSDCDVSENGWMTECSHQKSQEIRHQKLSTAANFVKRLHDLADPVAVQKRGYVDLQE  499

Query  1575  IVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIV  1754
             +V  E+     YG TLP+D++  +P S    D S+FLIRGE YL+D  K+ +KGTL ++V
Sbjct  500   MVR-EDSITCSYGSTLPQDSTCTLPCSLTETDPSTFLIRGENYLEDRLKVKAKGTLMKMV  558

Query  1755  GADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLA  1934
              ADW++S+ RED+L  RPGSIVQKYAAQ  PEFFF+VNIQVPG+T YSLALYYM+ TP+ 
Sbjct  559   AADWVRSDKREDDLGGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVE  618

Query  1935  ENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLE  2114
             + PLLE F+ GDDAFR+S+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G NYLE
Sbjct  619   DAPLLESFIKGDDAFRDSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFQGSNYLE  678

Query  2115  LDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             L VD+GSSTVARGV++LVLGYLN+LVIEMAFL+Q +T EELPE LLGTCRLNHLDASKAV
Sbjct  679   LGVDIGSSTVARGVVSLVLGYLNHLVIEMAFLIQGNTREELPEFLLGTCRLNHLDASKAV  738



>ref|XP_009396972.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=743

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/733 (60%), Positives = 534/733 (73%), Gaps = 30/733 (4%)
 Frame = +3

Query  192   DGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQ  371
             D  M+GWLYL+R NRLGLQY RKRYF+L+ N L  YK VP + +EEP+RSA+ID CI V 
Sbjct  10    DRRMQGWLYLVRSNRLGLQYSRKRYFVLDGNALNCYKNVPASNKEEPIRSAVIDFCIRVT  69

Query  372   DNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----NPEKNLR  539
             DNGREN  R V + FTLC+ SNH DQLK GA S EEAARWIR + +AA+    N E+N+ 
Sbjct  70    DNGRENMLRNVMYVFTLCSASNHKDQLKLGARSSEEAARWIRSIMEAALKEDPNKEENVV  129

Query  540   APAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
             A + R+ Q FRL  ++   R      T  +S   D  T+DVI P  W I G +NGLR+FK
Sbjct  130   ACSKRRCQSFRLRHANGRGRKHPLDWTVFTSVLADPTTADVIAPSTWTIVGCKNGLRLFK  189

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             E +D + +G HWD HPA+MAVGVID TSEA+F+ +MSLGPSRSEWDFC   G+VVEHLDG
Sbjct  190   ETRDADSHGMHWDDHPALMAVGVIDATSEAVFRRVMSLGPSRSEWDFCLLEGNVVEHLDG  249

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDIIH +L + WLPWG+K+RDLLLRRYWRREDDGTYVILYHS  H KC P+ GYVRA +
Sbjct  250   HTDIIHKKLRSDWLPWGMKKRDLLLRRYWRREDDGTYVILYHSFSHQKCQPERGYVRACL  309

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+PVNQGK S VKHML++DWK   SYL  ++++ +TI MLG +AALRE F+AK 
Sbjct  310   KSGGYVISPVNQGKQSVVKHMLAIDWKFWKSYLFTSSAEYITIRMLGRVAALREFFRAKV  369

Query  1233  GS-YFPDPAMNELTIDIQLPVSEKEEIKNEVVATE----RIEEDTTEKYPS----ACSSI  1385
             GS    D +  E T +I LP +E+E +K E  A E        D T++ P+    A  S 
Sbjct  370   GSCACSDFSSGESTREIGLPQNEREHMKLEQPAEEISKSEDSADETQRSPAKNAKAGGSF  429

Query  1386  VELDDVADEFFDVPEASDDEHSDHGWPRS---TTPEYHETPRPKLSSAACFVRKLQDLAV  1556
             ++L+D ADEFFDV   S+    +  WP      T    +    KLS+AA FVRKL D+AV
Sbjct  430   LQLNDAADEFFDVINESEYNEVEALWPSDDGLQTQLVQDQRHSKLSTAAVFVRKLHDIAV  489

Query  1557  QK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKI  1724
             QK    + QE   GE      YG TLPKD   ++P SWA AD S+FLIRGE YL DH KI
Sbjct  490   QKRGYVDLQEASTGE-SVPCSYGATLPKDPCCSLPSSWAMADPSTFLIRGESYLHDHLKI  548

Query  1725  TSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLA  1904
              + GTL Q+V ADWL+S+ RED+L  RPG IVQKY+A    EFFF+V+IQVPG+T YSLA
Sbjct  549   KANGTLMQMVAADWLKSDKREDDLGGRPGGIVQKYSAHGGSEFFFIVHIQVPGSTTYSLA  608

Query  1905  LYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEM  2084
             LYYM+ +PL   PLLERFV GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+L++
Sbjct  609   LYYMMDSPLESFPLLERFVKGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALDI  668

Query  2085  NYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCR  2264
             NYF G NY+EL VDVGSSTVARGV++LVLGYL NLVIEMAFL+Q +TEEELPE LLGTCR
Sbjct  669   NYFCGSNYIELGVDVGSSTVARGVVSLVLGYLTNLVIEMAFLIQGNTEEELPEFLLGTCR  728

Query  2265  LNHLDASKAVHTN  2303
             LNHLDASKAV +N
Sbjct  729   LNHLDASKAVPSN  741



>ref|XP_010470101.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
Length=731

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/720 (59%), Positives = 539/720 (75%), Gaps = 27/720 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLY+IR NR GL + RKRYF+L D+ LKS+K+V  +  ++  RSA+IDSCI V DNG
Sbjct  13    MEGWLYIIRSNRFGLHFSRKRYFVLRDHLLKSFKSVSDSKSKDAGRSAVIDSCIRVTDNG  72

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI--NPEKNLRAPAIR  554
             RE+ HRK FF FTL NTSNH+DQLK GA+SPE+AARWI  +++AA+  +P+        R
Sbjct  73    RESVHRKAFFIFTLFNTSNHNDQLKLGASSPEDAARWINLIKEAALKGSPDPGDVFNCSR  132

Query  555   -KWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKD  713
              +W   RLS S R   +++       S  VD +T+DV+ P PW IFG QNGLR+FKEAK+
Sbjct  133   GRWDSLRLSSSVRDRHSNSIDWTLRPSARVDPVTTDVVAPSPWTIFGCQNGLRLFKEAKE  192

Query  714   RNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDI  893
             R+  G+ WD HPAIMAVGV+DGTSE IF+ L+SLGPSRSEWDFCF +GSVVEHLDGHTDI
Sbjct  193   RDSLGR-WDDHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDGHTDI  251

Query  894   IHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGG  1073
             IH Q  + WLPWG+KRRD  LRRYWRREDDGTYVILYHSV H KCPPQ+GYVRA +KSGG
Sbjct  252   IHKQFYSDWLPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGG  311

Query  1074  HVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYF  1244
             +VI+P++ G  S VKHML+VDWKS   Y++ + ++S+T+ MLG ++ALRE+F+AK GS+ 
Sbjct  312   YVISPIDNGTQSVVKHMLAVDWKSWRSYMKPSLARSITVKMLGRLSALRELFRAKHGSFP  371

Query  1245  PDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTT----EKYPSACSSIVELDDVADE  1412
             P+ +  EL+   +L  +E     +  +    + +DT     +K+PS  SS+V+LD    E
Sbjct  372   PNLSSGELSRSARLTQNEDGVFGDSSLRESEMFKDTANEERDKFPSERSSLVDLD----E  427

Query  1413  FFDVPEASDDEHSDHGWPRSTTPEY--HETPRPKLSSAACFVRKLQDLAVQK----NFQE  1574
             FFDVPE SD ++ +  W      E    ++ +PKL+SA   V+KL DLAVQK    +  E
Sbjct  428   FFDVPEPSDSDYLEDSWTSDFDLETCCQDSRQPKLNSATNLVKKLHDLAVQKRGYVDLHE  487

Query  1575  IVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIV  1754
                 E     CYG TLP D +  +P SW   D S+FLIRG+ YL D  K  +KGTL ++V
Sbjct  488   RAREESSTSCCYGTTLPTDPTCALPCSWTTTDPSTFLIRGKTYLDDQKKFKAKGTLMEMV  547

Query  1755  GADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLA  1934
              ADWL+S+ RED++ +RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL LYYM+ TP+ 
Sbjct  548   AADWLKSDKREDDVGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIE  607

Query  1935  ENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLE  2114
             E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+G+NY+E
Sbjct  608   EHPLLLSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGKNYIE  667

Query  2115  LDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             L VD+GSSTVARGV++LVLGYLN LVIEMAFL+QA+TEEELPE+LLGTCR NHLDASKA+
Sbjct  668   LGVDIGSSTVARGVVSLVLGYLNKLVIEMAFLIQANTEEELPEYLLGTCRFNHLDASKAI  727



>ref|XP_004487249.1| PREDICTED: uncharacterized protein LOC101507747 [Cicer arietinum]
Length=731

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/714 (62%), Positives = 546/714 (76%), Gaps = 26/714 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQ+ RKRYF+L+D+ L+S+K+VP +  ++P+RSAI+DSCI V DNG
Sbjct  24    MEGWLYLIRCNRFGLQFSRKRYFVLDDHLLRSFKSVPNSNDQDPVRSAIVDSCIRVMDNG  83

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAP-----  545
             RE+ +RKVFF FTL NTSNH+DQLK GA+SPEEAARWI+   +A++       AP     
Sbjct  84    RESINRKVFFIFTLYNTSNHNDQLKLGASSPEEAARWIQSFHEASLKLLLLQGAPEAVGC  143

Query  546   AIRKWQPFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPN  725
             + R+WQ    S+S   +R   +S      +SDVI P PW IFG QNGLR+FKEAKDR+  
Sbjct  144   SKRRWQ--SFSLSGSSSRNHQNSVDWTLSSSDVIAPSPWTIFGCQNGLRLFKEAKDRDSG  201

Query  726   GKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQ  905
             GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +G+VVEHLDGHTDIIH Q
Sbjct  202   GKKWDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQ  261

Query  906   LTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVIT  1085
             L + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCP Q GYVRA +KSGG+VI+
Sbjct  262   LYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQIGYVRACLKSGGYVIS  321

Query  1086  PVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YFPDP  1253
             P N+GK S VKHML++DWK   SYL+ +++ S+TI MLG +AALRE+F+ + G+    D 
Sbjct  322   PANKGKQSVVKHMLAIDWKCWRSYLKSSSAYSMTIQMLGRVAALRELFRTRQGNCTLSDY  381

Query  1254  AMNELTIDIQLPVSEKEEIKNEVVATERIEE-DTTEKYPSACSSIVELDDVADEFFDVPE  1430
             +  ELT +     S+ + + +E      I E D T+   S  +S+V L+D  DEF+DV E
Sbjct  382   SSGELTRNTS---SDTQILADENSHDNSIGEVDPTQ---SEHASLVSLNDADDEFYDVME  435

Query  1431  ASDDEHSDHGWPRSTTPEYHETPR-PKLSSAACFVRKLQDLAVQK----NFQEIVGGEEG  1595
              S+ + S++ W    + +  +  R  K S+AA FVRKL DLAVQK    + QE+V   E 
Sbjct  436   PSNCDESENEWLTECSYQKSQDSRHQKFSTAANFVRKLHDLAVQKKGYVDLQEMV--RED  493

Query  1596  AKGC-YGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQ  1772
             +  C YG TL KD +  +P S   AD S+FLIRGE YL+DH KI +KGTL Q+V ADWL+
Sbjct  494   SITCPYGSTLLKDPTCTLPCSLTEADPSTFLIRGENYLEDHLKIKAKGTLMQMVAADWLR  553

Query  1773  SEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLE  1952
             S+ RED+L  RPGSIVQKYAAQ  PEFFF++NIQVPG+T YSLALYYM+ TP+ ++P+LE
Sbjct  554   SDKREDDLGGRPGSIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYMMNTPVEDSPMLE  613

Query  1953  RFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVG  2132
              F+ GD+AFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G+NYLEL +D+G
Sbjct  614   SFIKGDNAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFQGKNYLELGIDIG  673

Query  2133  SSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             SSTVARGV+NLVLGYLN+LVIEMAFL+Q +T EELPE LLGTCRLNHLDASK+V
Sbjct  674   SSTVARGVVNLVLGYLNHLVIEMAFLIQGNTREELPEFLLGTCRLNHLDASKSV  727



>ref|XP_006589424.1| PREDICTED: uncharacterized protein LOC100802528 isoform X2 [Glycine 
max]
Length=721

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/730 (60%), Positives = 539/730 (74%), Gaps = 37/730 (5%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR G  Y RKRYFIL+ N L+S+K  P +  EEP+RSAIIDSCI V DNG
Sbjct  1     MEGWLYLIRANRFGQHYSRKRYFILKGNALRSFKIKPTSQMEEPIRSAIIDSCIRVNDNG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----NPEKNLRAPA  548
             RE  ++ V F FT+ N ++  D+LK GA+S EEAARWIR L+DAA+    +P KNL A  
Sbjct  61    RETMNKNVLFIFTVYNATDQSDKLKLGASSSEEAARWIRTLQDAAMKGCPSPAKNLVACH  120

Query  549   IRKWQPFRLSVSSRMARTD--------ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKE  704
              ++    R   S     TD         S    +AMT+DVI P PWKIFG QNGLR+FKE
Sbjct  121   KKRRSSLRNGGSKS---TDWKYSNLNFQSCIYTEAMTADVIAPSPWKIFGCQNGLRMFKE  177

Query  705   AKDRNPNGKHWDG-HPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             AKD +  G HW G +PAIMAVGV+DG SEAIF  LM+L PSRSEWDFC  RG+VV+H+DG
Sbjct  178   AKDWDSRGSHWVGENPAIMAVGVVDGASEAIFHTLMTLDPSRSEWDFCIYRGNVVDHIDG  237

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDIIH+QL   WLPWG+K RDLLLRRYWRREDDG+YV+L+HSV HSKCPP++GYVRA V
Sbjct  238   HTDIIHLQLYNDWLPWGMKPRDLLLRRYWRREDDGSYVLLFHSVYHSKCPPKKGYVRACV  297

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG V+TPVN+G  S V+HML+VDWK    YLR  +++S+TI ML  IAALRE+F+ K 
Sbjct  298   KSGGFVVTPVNKGTQSVVRHMLAVDWKFWKLYLRPASARSITIRMLERIAALRELFRTKG  357

Query  1233  GSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATER--------IEEDTTEKYPSACSSIV  1388
             G+Y  +P    +T DI LP+  KE+IK EV   +         + ED  E  PS   S++
Sbjct  358   GNYSSEPL--AMTKDIGLPLGVKEDIKTEVSQEKNKFEEPPLVVMEDEVE--PSGRRSLM  413

Query  1389  ELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK--  1562
              L+D +DEFFDVPE ++ +H  + W    + E      P+++SAA FV+KL  LAVQK  
Sbjct  414   GLND-SDEFFDVPEPTEYDHFQNEWHADLSSEQMSMSIPRMTSAAGFVKKLHGLAVQKKG  472

Query  1563  --NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKG  1736
               + QE    EE     YG TL KD+S   P +WAA+D S FL+RGE YLQDH K+ + G
Sbjct  473   YMDLQE-AAMEESTSCSYGATLQKDSSCASPCTWAASDPSLFLVRGENYLQDHQKVKANG  531

Query  1737  TLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYM  1916
             TLTQ+VGADWL+S+ REDNL++RPGSIVQ+YAA+  PEFFFV+N+Q+PG+  YSLALYYM
Sbjct  532   TLTQMVGADWLRSDTREDNLSSRPGSIVQQYAAKGGPEFFFVINMQMPGSPMYSLALYYM  591

Query  1917  LKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFK  2096
             LKTPL +NPLL+ FV+GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LEM Y +
Sbjct  592   LKTPLEDNPLLQSFVDGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEMLYIR  651

Query  2097  GQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHL  2276
             G+NYLE+D+DVGSSTVARGV +LVLGYLNNLV+EMAFLVQ  T +ELPE LLGTCRLNH+
Sbjct  652   GKNYLEIDIDVGSSTVARGVASLVLGYLNNLVVEMAFLVQGSTPDELPEVLLGTCRLNHM  711

Query  2277  DASKAVHTNS  2306
             DASKA   NS
Sbjct  712   DASKAFLVNS  721



>ref|XP_010555822.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Tarenaya 
hassleriana]
Length=735

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/739 (60%), Positives = 537/739 (73%), Gaps = 39/739 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLY IR NR GLQ+ RKRYF+L DN L SYK+VP    EEP R A +D
Sbjct  1     MGVSQTDGRMEGWLYTIRQNRFGLQFSRKRYFVLRDNNLTSYKSVPSADNEEPDRRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----  521
             SCI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA++     
Sbjct  61    SCIRVNDNGRESFHRKILFIFTLYNTSNHSDQLKLGASSPEEAAKWIRSLQDASLKGSPF  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR-------------TDASSTPVDAMTSDVIGPCPW  662
             P+ +  + + R     RL VS R  R             T+ SS   +    DVI P PW
Sbjct  121   PDCDFVSHSERGL--VRLDVSKRSRRKNSVDWTNYTSTNTNYSSVNPEVTAPDVIAPSPW  178

Query  663   KIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDF  842
             KIFG QNGLR+FKEAKD +  G+HWD H AIMAVGVIDGTSE IF  LMSLGP RSEWDF
Sbjct  179   KIFGCQNGLRLFKEAKDWDSRGRHWDDHAAIMAVGVIDGTSEEIFNTLMSLGPLRSEWDF  238

Query  843   CFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHS  1022
             CF RGSVVEHLDGHTDII+ QL + WLPWG+K RDLLLRRYWRREDDGTYVIL HSV H 
Sbjct  239   CFYRGSVVEHLDGHTDIIYQQLYSDWLPWGMKPRDLLLRRYWRREDDGTYVILCHSVYHK  298

Query  1023  KCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLG  1193
             KCPP +GYVRA VKSGG+V+TP+N G  S VKHM+++DW+S   Y+R ++++S+TI M+ 
Sbjct  299   KCPPGKGYVRACVKSGGYVVTPMNNGTQSMVKHMIAIDWRSWNLYMRPSSARSITIRMVE  358

Query  1194  GIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIK------NEVVATER--IEED  1349
              +AALREMF+AK G +F + +  +      L  ++   +       +EVV +E   +  +
Sbjct  359   RVAALREMFRAKHGQFFSNLSSGDFMTTKTLSKNKTRAVSFEGNKLDEVVKSEVTIMAGE  418

Query  1350  TTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACF  1529
               EK  S   S +EL+D++DEFFDV E  +    D  + R T+P+    P+ KL SAA  
Sbjct  419   EAEKTSSPRPSFMELNDMSDEFFDVLEPHESSGFD-SFIRDTSPQ---GPQLKLPSAAGL  474

Query  1530  VRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGE  1697
             V+KLQDLAVQK    + QE V  EE     YG TL KD S++ P SWA AD S+FLIRG 
Sbjct  475   VKKLQDLAVQKKGYVDLQE-VAMEENVTYLYGATLQKDPSFSAPCSWATADPSTFLIRGS  533

Query  1698  KYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQV  1877
              YL+DH K  +KGT+ Q++GADW+ S+ RED+L  R G IVQ +AA+ RPEFFF+VNIQV
Sbjct  534   NYLKDHQKEKAKGTMMQMMGADWISSDKREDDLGGRLGGIVQDFAAEGRPEFFFIVNIQV  593

Query  1878  PGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKS  2057
             PG+  Y+LA+YYML TPL ENPLL  FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVGKK+
Sbjct  594   PGSAMYTLAMYYMLNTPLEENPLLHGFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGKKA  653

Query  2058  CLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEEL  2237
             CL+GQ+LE  Y +G+NYLELD+DVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+TEEEL
Sbjct  654   CLLGQALETRYVRGKNYLELDIDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTEEEL  713

Query  2238  PEHLLGTCRLNHLDASKAV  2294
             PE LLGTCRLN+LD SK+V
Sbjct  714   PEVLLGTCRLNYLDVSKSV  732



>ref|XP_009770311.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Nicotiana sylvestris]
Length=730

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/728 (61%), Positives = 542/728 (74%), Gaps = 38/728 (5%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYL+R NR GLQY RKRYF+L D+ LKS+K+ P++  E+P+RSA+I+SCI V DNG
Sbjct  11    MEGWLYLVRSNRFGLQYSRKRYFVLHDHLLKSFKSDPVSNNEDPVRSAVINSCIRVTDNG  70

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN-LRAPAIRK  557
             RE+  RKV F FTL + SNH+DQLK GANSPEEAARWI+ L++AA+  + + +  P    
Sbjct  71    RESIQRKVVFIFTLYSASNHNDQLKLGANSPEEAARWIQALQEAALQHKGSAVDCPRSDS  130

Query  558   WQPFRLSVS-----SRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNP  722
                   S S     + +  T  SS+  DAMTSDV+ P  W IFG QNGLR+FKEAKDR  
Sbjct  131   QSLSLNSSSKSHCLNSINWTLCSSSVADAMTSDVVAPSSWTIFGGQNGLRLFKEAKDRES  190

Query  723   NGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHM  902
             +GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFC+ RGSV+EHLDGHTDI+H 
Sbjct  191   HGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCYYRGSVIEHLDGHTDIVHK  249

Query  903   QLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVI  1082
              L   WLPW +KRRDLLLRRYWRREDDGTYVILYHSV H KCP Q+ YVRA +KSGG+VI
Sbjct  250   LLRRDWLPWSMKRRDLLLRRYWRREDDGTYVILYHSVFHQKCPRQKDYVRACLKSGGYVI  309

Query  1083  TPVNQGKSSTVKHMLSVDW---KSYLRKTTSKSLTIDMLGGIAALREMFKAKSG----SY  1241
             +PVNQ K S VKHML++DW   KSYLR ++++ +TI ML  +AALRE+F+AK G    SY
Sbjct  310   SPVNQRKQSVVKHMLAIDWRFWKSYLRTSSARCITIHMLERLAALRELFRAKLGDCSSSY  369

Query  1242  FPDPAMN--------ELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELD  1397
             F +  M         E+ ++IQ   +  E  KN+      +EE+   K PS  +S++ L+
Sbjct  370   FLEEQMRNKRLHQIEEVKVEIQ---NRLENRKNKA----DMEEEEVVKSPSEHASLMGLN  422

Query  1398  DVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQKNFQ  1571
             D +DEFFDV E  D + S++GWP    PE +  +T   +LSSAA FV+KL DLAVQK  +
Sbjct  423   DASDEFFDVSEPLDYDESENGWPSDFGPETYSQDTRHARLSSAAVFVKKLHDLAVQK--R  480

Query  1572  EIVGGEEGAKGC-----YGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKG  1736
               +   E AK       YG TL KD + N+P SW   D S+FLIRGE YL+D  KI +KG
Sbjct  481   GYIDLHEKAKESTLLCYYGSTLTKDPTCNLPCSWTQTDPSTFLIRGETYLEDRKKIKAKG  540

Query  1737  TLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYM  1916
             TL Q+V ADWL+S+ +ED+L  RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL LYYM
Sbjct  541   TLMQMVAADWLKSDKQEDDLGGRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLGLYYM  600

Query  1917  LKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFK  2096
             + TP+   PLLE FV GDDA+RNS FKLIPYISKG WIVKQSVGKK+C++GQ+LE+NYF+
Sbjct  601   MDTPIENAPLLESFVKGDDAYRNSSFKLIPYISKGPWIVKQSVGKKACIVGQALEINYFE  660

Query  2097  GQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHL  2276
             G+NYLELD+DVGSSTVARGV++LV+GYLNNLVIEMAFLVQA+T EELPE+LLGTCRLNHL
Sbjct  661   GKNYLELDIDVGSSTVARGVVSLVVGYLNNLVIEMAFLVQANTTEELPEYLLGTCRLNHL  720

Query  2277  DASKAVHT  2300
             D SKAV  
Sbjct  721   DVSKAVQA  728



>gb|KDO73323.1| hypothetical protein CISIN_1g004508mg [Citrus sinensis]
Length=730

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/733 (61%), Positives = 548/733 (75%), Gaps = 59/733 (8%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S G MEGWL+LIR NR+GLQY RKRYF+LED+ LKS+K+VP +  E+P+RSAIIDSCI V
Sbjct  8     SQGRMEGWLHLIRSNRIGLQYSRKRYFLLEDHFLKSFKSVPHSKNEDPVRSAIIDSCIRV  67

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI--NPEK----  530
              DNGRE+ HRK+                  GA+SPEEAA+WI  L++AA+   P +    
Sbjct  68    TDNGRESIHRKL------------------GASSPEEAAKWIHSLQEAALKGGPHQGVGD  109

Query  531   NLRAPAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLR  692
             ++  P    W+ FRLS SSR + T +      S T ++ +T+DVI P PW IFG QNGLR
Sbjct  110   HIGCPN-SPWESFRLSGSSRASHTKSIDWTLCSGTHMEQVTADVIAPSPWTIFGCQNGLR  168

Query  693   IFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEH  872
             +FKE KDR   GK WD HPAIMAVGV+DGTSEAIF+ LMSLG SRS WDFCF RG VVEH
Sbjct  169   LFKEGKDRGSRGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGASRSVWDFCFYRGCVVEH  227

Query  873   LDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVR  1052
             LDGHTDIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCP Q+G VR
Sbjct  228   LDGHTDIIHKQLYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVR  287

Query  1053  ATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFK  1223
             A +KSGG+VITP+N GK S VKHML++DWK   SYL+ ++++S+TI MLG +AALRE+F+
Sbjct  288   ACLKSGGYVITPMNHGKKSVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFR  347

Query  1224  AKSGSYF-PDPAMNELTID----------IQLPVSEKEEIKNEVVATERIEEDTTEKYPS  1370
             AK G+Y  P+    ELT +          +Q+P  +    KN    +E +++ ++E    
Sbjct  348   AKQGNYSSPEFLSGELTRNMRMHQTDGNMVQMPTEDGNSKKN---TSEEVDQVSSEH---  401

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQ  1544
               +S+V L+D ADEFFDVPE SD + S++GW     PE +  +T  PK+S+AA FVRKL 
Sbjct  402   --ASLVGLNDAADEFFDVPEPSDYDDSENGWTSDFGPEMNSQDTRHPKISTAAGFVRKLH  459

Query  1545  DLAVQK-NFQEIVG--GEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDH  1715
             DLAVQK  + ++ G   E+    CYG TL KD +  +P SW + D S+FLIRG+ YLQD 
Sbjct  460   DLAVQKRGYVDLQGTAKEDNFSCCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDR  519

Query  1716  SKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRY  1895
              K+ +KGTL Q+V ADWL+S+ RED+L  RPG IVQKYA Q  PEFFF++NIQVPG+T Y
Sbjct  520   HKVKAKGTLMQMVAADWLKSDKREDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTY  579

Query  1896  SLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQS  2075
             SLALYYM+ TP+ + PLLE F+NGDDA+RNS+FKLIPYIS+GSWIVKQSVGKK+CLIGQ+
Sbjct  580   SLALYYMMTTPVKDAPLLESFINGDDAYRNSRFKLIPYISEGSWIVKQSVGKKACLIGQA  639

Query  2076  LEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLG  2255
             LE+NYF G+NYLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFL+QA+TEEELPE LLG
Sbjct  640   LEINYFHGKNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQANTEEELPEFLLG  699

Query  2256  TCRLNHLDASKAV  2294
             TCRLNHLDA+KAV
Sbjct  700   TCRLNHLDAAKAV  712



>ref|XP_006662447.1| PREDICTED: uncharacterized protein LOC102718305 [Oryza brachyantha]
Length=715

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/724 (60%), Positives = 535/724 (74%), Gaps = 40/724 (6%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITG------------REEPLRSA  344
             MEGWLYLIR NRLGLQY RKRYF+LED  L+ +KA P               RE+P+RSA
Sbjct  1     MEGWLYLIRSNRLGLQYSRKRYFVLEDAALRCFKAAPSPSSSSSSSSSSSSKREDPIRSA  60

Query  345   IIDSCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI-N  521
             IIDSCI V DNGRE+ HR VF+ FTL N +NH DQLK GA S EEAARWIRCL ++A+ +
Sbjct  61    IIDSCIRVTDNGRESVHRSVFYIFTLYNATNHYDQLKLGARSSEEAARWIRCLMESALKS  120

Query  522   PEKN--LRAPAIRKWQPFRLSV-SSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQN  683
             P K+  + A + R+WQ FRLS  ++RM   D    SS   D M +DVI P PW IFG +N
Sbjct  121   PRKDEHIVACSHRRWQAFRLSRRNNRMHSIDWTVFSSVHNDPMAADVIAPSPWTIFGCKN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+F EAKD    GK+WD HPAIMAVGV+D  SEA+F+ +MSLG SRSEWDFC   G V
Sbjct  181   GLRLFTEAKDGGSEGKYWDDHPAIMAVGVVDANSEAVFQTIMSLGQSRSEWDFCLQEGRV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEH+DGHTDIIH +L   WLPWG+++RDLLLRRYWRREDDGTYVILYHSV H +C  + G
Sbjct  241   VEHIDGHTDIIHKKLKGDWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYRCRSERG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG+VI+PVNQG  S VKHML++DWK   SYL  +++KS+TI MLG +AALRE
Sbjct  301   YVRACLKSGGYVISPVNQGNQSVVKHMLAIDWKFWKSYLFTSSAKSITIRMLGRVAALRE  360

Query  1215  MFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVEL  1394
              F+AK+G+             ++    E   +++    +       + ++ S+  S ++L
Sbjct  361   FFRAKNGN----------CACLEFSSGENNRLEDPTEGSL----GGSNRHLSSAGSFIQL  406

Query  1395  DDVADEFFDVPEASDDEHSDHGWPR-STTPEYHETPRPKLSSAACFVRKLQDLAVQK-NF  1568
             +D ADEFFDVP+ S+ +  +  WP   +T    +    KLS+AA FVRKL DLAVQK  +
Sbjct  407   NDAADEFFDVPDESEYDQREAMWPSDESTHSVQDQRHAKLSTAAVFVRKLHDLAVQKKGY  466

Query  1569  QEIVGGEEGAKG--CYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTL  1742
              ++ G  +   G  CYGCTLPKD+S  MP +WA AD ++FLIRGE YL D  KI +  TL
Sbjct  467   VDLQGAADFDNGSFCYGCTLPKDSSCTMPSTWAMADPTTFLIRGESYLLDRHKIKAHSTL  526

Query  1743  TQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLK  1922
              Q+VGADW++S+ RED+LA RPG +VQK AAQ   +FFF+VNIQVPG++ YSLALYYM+ 
Sbjct  527   MQMVGADWIKSDKREDDLAGRPGGLVQKCAAQGGNKFFFIVNIQVPGSSTYSLALYYMMD  586

Query  1923  TPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQ  2102
             TPL + PLLERFVNGDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G 
Sbjct  587   TPLEKVPLLERFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFRGS  646

Query  2103  NYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDA  2282
             NYLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFLVQ +T+EELPE LLGTCRLN+LDA
Sbjct  647   NYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNTQEELPEFLLGTCRLNYLDA  706

Query  2283  SKAV  2294
             SKAV
Sbjct  707   SKAV  710



>ref|XP_010414549.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
Length=731

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/720 (59%), Positives = 537/720 (75%), Gaps = 27/720 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLY+IR NR GL + RKRYF+L D+ LKS+K+V  +  ++  RSA+IDSCI V DNG
Sbjct  13    MEGWLYIIRSNRFGLHFSRKRYFVLRDHLLKSFKSVSDSKSKDAGRSAVIDSCIRVTDNG  72

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEK---NLRAPAI  551
             RE+ HRK FF FTL NTSNH+DQLK GA+SPE+AARWI  +++AA+       ++   + 
Sbjct  73    RESVHRKAFFIFTLFNTSNHNDQLKLGASSPEDAARWINLIKEAALKGSPFPGDVFNCSR  132

Query  552   RKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKD  713
              +W   RLS S R   +++       S  VD +T+DV+ P PW IFG QNGLR+FKEAK+
Sbjct  133   GRWDSLRLSSSVRDRHSNSIDWTLRPSARVDPVTTDVVAPSPWTIFGCQNGLRLFKEAKE  192

Query  714   RNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDI  893
             R+  G+ WD HPAIMAVGV+DGTSE IF+ L+SLGPSRSEWDFCF +GSVVEHLDGHTDI
Sbjct  193   RDSLGR-WDDHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFFQGSVVEHLDGHTDI  251

Query  894   IHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGG  1073
             IH Q  + WLPWG+KRRD  LRRYWRREDDGTYVILYHSV H KC PQ+GYVRA +KSGG
Sbjct  252   IHKQFYSDWLPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCSPQKGYVRACLKSGG  311

Query  1074  HVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYF  1244
             +VI+P++ G  S VKHML+VDWKS   Y++ + ++S+T+ MLG ++ALRE+F+AK GS+ 
Sbjct  312   YVISPIDNGTQSVVKHMLAVDWKSWRSYMKPSLARSITVKMLGRLSALRELFRAKHGSFP  371

Query  1245  PDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTT----EKYPSACSSIVELDDVADE  1412
             P+ +  EL+   +L  +E     +  +    + +D+     +K+PS  SS+V+LD    E
Sbjct  372   PNLSSGELSRSARLTQNEDGVFGDSSLRESEMFKDSANEERDKFPSERSSLVDLD----E  427

Query  1413  FFDVPEASDDEHSDHGWPRSTTPEY--HETPRPKLSSAACFVRKLQDLAVQK----NFQE  1574
             FFDVPE SD ++ +  W      E    ++ +PKL+SA   V+KL DLAVQK    +  E
Sbjct  428   FFDVPEPSDSDYLEDSWTSDFDLETCCQDSRQPKLNSATNLVKKLHDLAVQKRGYVDLHE  487

Query  1575  IVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIV  1754
                 E     CYG TLP D +  +P SW   D S+FLIRG+ YL D  K  +KGTL ++V
Sbjct  488   RAREESSTSCCYGTTLPTDPTCALPCSWTTTDPSTFLIRGKTYLDDQKKFKAKGTLMEMV  547

Query  1755  GADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLA  1934
              ADWL+S+ RED+L +RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL LYYM+ TP+ 
Sbjct  548   AADWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIE  607

Query  1935  ENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLE  2114
             E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+G+NY+E
Sbjct  608   EHPLLLSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGKNYIE  667

Query  2115  LDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             L VD+GSSTVARGV++LVLGYLN LVIEMAFL+QA+TEEELPE+LLGTCR NHLDASKAV
Sbjct  668   LGVDIGSSTVARGVVSLVLGYLNKLVIEMAFLIQANTEEELPEYLLGTCRFNHLDASKAV  727



>ref|XP_008791557.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X2 [Phoenix 
dactylifera]
Length=738

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/731 (60%), Positives = 529/731 (72%), Gaps = 28/731 (4%)
 Frame = +3

Query  192   DGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQ  371
             D  MEGWLYLIR NRLGLQY RKRYF+LEDN L  YKAVP + RE+P+RSA+I+SCI V 
Sbjct  7     DRRMEGWLYLIRSNRLGLQYSRKRYFVLEDNALNCYKAVPASRREDPIRSALINSCIRVT  66

Query  372   DNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN--PEKNLRAP  545
             DNGR + HR VF+ FTL ++SNH+DQLK GA S EEAA WIR L +AA+   P K+ +  
Sbjct  67    DNGRASMHRSVFYIFTLYSSSNHNDQLKLGARSSEEAASWIRSLMEAALKECPNKDEKFV  126

Query  546   AIRKWQPFRLSVSSRMAR--------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
             A  K +   L +S   AR        T  SS   D M SDVI P PW IFG +NGLR+FK
Sbjct  127   ACSKRRRHSLRLSRTRARSLMHSIDWTVYSSVHTDPMASDVIAPSPWMIFGCKNGLRLFK  186

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             E+ + +  GKHWD HPAIMAVGV+D TSEAIF+ +MSLGPSRSEWDF    G VVEHLDG
Sbjct  187   ESNEGDFLGKHWDDHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRVVEHLDG  246

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDIIH +L   WLPWG+ +RDLLLRRYWRREDDGTYVILYHSV H  C P+ GY+RA +
Sbjct  247   HTDIIHKKLHGDWLPWGMNKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACL  306

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+PVNQGK S VKHML++DWK   SY+  +++K +TI MLG +AALRE F+AK 
Sbjct  307   KSGGYVISPVNQGKQSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAALREFFRAKL  366

Query  1233  GS-YFPDPAMNELTIDIQLPVSEKEEIKNEVVAT---------ERIEEDTTEKYPSACSS  1382
             G+    D +  ELT +I LP SEKE IK EV  T             + +   + +   S
Sbjct  367   GNCTCSDYSSGELTREIGLPYSEKEHIKVEVQTTGENSKSADSAEAPQQSPSSHANTSGS  426

Query  1383  IVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK  1562
              ++L+D ADEFFDV + SD++ ++  WP        E  + KLS+AA FV+KL D AVQK
Sbjct  427   FLQLNDAADEFFDVIDESDNDQTEALWPSDEGMHSQEQRQHKLSTAAVFVKKLHDFAVQK  486

Query  1563  ----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITS  1730
                 + QE   G+  A   YG TLPKD S  M  SWA AD +SFLIRGE YL+D  KI +
Sbjct  487   KGYIDLQEASMGDM-APCSYGTTLPKDPSCTMTCSWAMADPTSFLIRGESYLRDQQKIKA  545

Query  1731  KGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALY  1910
               TL Q+V ADWL S+ RED+L  RPG +VQKYAAQ   EFFF+VNIQ+PG++ YSLALY
Sbjct  546   NSTLMQMVAADWLNSDKREDDLGGRPGGVVQKYAAQGGSEFFFIVNIQIPGSSTYSLALY  605

Query  1911  YMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNY  2090
             YM+ TPL   PLLE FV GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+L  +Y
Sbjct  606   YMMDTPLENVPLLESFVKGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALASHY  665

Query  2091  FKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLN  2270
             F+G NYLE+ +D GSSTVARGV++LVLGYLNNLVIE+AFL+Q +T+EELPE LLGTCRLN
Sbjct  666   FRGSNYLEVGIDAGSSTVARGVVSLVLGYLNNLVIELAFLIQGNTQEELPELLLGTCRLN  725

Query  2271  HLDASKAVHTN  2303
             HLDASK+V  N
Sbjct  726   HLDASKSVSIN  736



>ref|XP_004308785.1| PREDICTED: uncharacterized protein LOC101295576 [Fragaria vesca 
subsp. vesca]
Length=734

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/733 (60%), Positives = 544/733 (74%), Gaps = 25/733 (3%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLYL+RLNRLG+QY RK YF L+ N L+ +K+   +  +EP+RSA+ID
Sbjct  1     MGVSQNDGKMEGWLYLMRLNRLGMQYSRKMYFNLQGNFLRCFKSKATSEIQEPVRSAVID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             SCI V DNG+   +RKVFF+FTL N+SN +DQLK GA+SPEEAA+WIR L+DAA+    N
Sbjct  61    SCIRVTDNGKATVNRKVFFSFTLYNSSNPNDQLKLGASSPEEAAKWIRALQDAALKELPN  120

Query  522   PEKNLRAPAIRKWQPFRL--SVSSRMARTDASSTPV---DAMTSDVIGPCPWKIFGIQNG  686
             P K+  A +  K  P RL  S S+  +  D +  P+   + MT+DVI P PWKIFG QNG
Sbjct  121   PAKDFVACSSGKRLPLRLVGSRSTLRSSVDWTFCPLLNTEGMTNDVIAPSPWKIFGCQNG  180

Query  687   LRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVV  866
             LR+FKEAKD +  G+HWD HPAIMAVGV+DGTSEAIF+ L+SLGPSRSEWDFCF RG+VV
Sbjct  181   LRLFKEAKDGDSRGRHWDDHPAIMAVGVVDGTSEAIFRTLLSLGPSRSEWDFCFYRGTVV  240

Query  867   EHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGY  1046
             E+LDGHTDI+H QL + WLPWG+KRRDLLLRRYWRRE+DGTYVILYHSV H KCPP+ GY
Sbjct  241   ENLDGHTDIVHQQLYSDWLPWGMKRRDLLLRRYWRREEDGTYVILYHSVSHKKCPPKRGY  300

Query  1047  VRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREM  1217
             +RA +KSGG+VITP N GK S V+HML++DWK    YLR ++++S+TI ML  IAALRE+
Sbjct  301   MRACLKSGGYVITPANHGKQSLVRHMLAIDWKFWKLYLRPSSARSITIRMLERIAALREL  360

Query  1218  FKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATE---RIEEDT---TEKYPSACS  1379
             + AK+G+   +    E + DI L  S  E  K E  + E   R+EE      E      +
Sbjct  361   YGAKAGNCSREFTSGEFSRDIGLAHSGNEITKTEFHSMEEIKRVEEINPMEVEVEKPGRA  420

Query  1380  SIVELDDVADEFFDVPEA--SDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLA  1553
             S+  + D ADEFFDVPE   +D +  ++ WP   T +   T +P++S+++ FV+K  +L 
Sbjct  421   SLKGMHDSADEFFDVPEPEPTDYDQFENEWPSEFTLDVQNTHQPRMSNSSRFVKKFHELR  480

Query  1554  VQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSK  1721
             VQK    + QE V  E+     YG TL KD +   P SW AAD SSFLIRG  YL+DH K
Sbjct  481   VQKKGYVDLQE-VAKEDNMSCSYGSTLQKDPNCAFPCSWGAADPSSFLIRGPNYLRDHEK  539

Query  1722  ITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSL  1901
             I +KGTL Q+V  DWL+ + R DNL++R G IVQKYA  D PEFFFVVN+QVPG T Y+L
Sbjct  540   IKAKGTLMQLVCVDWLRCDERIDNLSSRFGGIVQKYAELDGPEFFFVVNMQVPGTTMYTL  599

Query  1902  ALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLE  2081
             A YY+L TPL ENPLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE
Sbjct  600   AFYYILNTPLEENPLLHSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALE  659

Query  2082  MNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTC  2261
             + YF+G+NYLEL +DVGSSTVARGV NLVLGYLNNLVIEMAFL+Q +TEEELPE LLGTC
Sbjct  660   VQYFRGKNYLELMIDVGSSTVARGVCNLVLGYLNNLVIEMAFLIQGNTEEELPEVLLGTC  719

Query  2262  RLNHLDASKAVHT  2300
             R+NHLDASK+V  
Sbjct  720   RINHLDASKSVQV  732



>ref|XP_009396971.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=837

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/733 (60%), Positives = 534/733 (73%), Gaps = 30/733 (4%)
 Frame = +3

Query  192   DGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQ  371
             D  M+GWLYL+R NRLGLQY RKRYF+L+ N L  YK VP + +EEP+RSA+ID CI V 
Sbjct  105   DRRMQGWLYLVRSNRLGLQYSRKRYFVLDGNALNCYKNVPASNKEEPIRSAVIDFCIRVT  164

Query  372   DNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----NPEKNLR  539
             DNGREN  R V + FTLC+ SNH DQLK GA S EEAARWIR + +AA+    N E+N+ 
Sbjct  165   DNGRENMLRNVMYVFTLCSASNHKDQLKLGARSSEEAARWIRSIMEAALKEDPNKEENVV  224

Query  540   APAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
             A + R+ Q FRL  ++   R      T  +S   D  T+DVI P  W I G +NGLR+FK
Sbjct  225   ACSKRRCQSFRLRHANGRGRKHPLDWTVFTSVLADPTTADVIAPSTWTIVGCKNGLRLFK  284

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             E +D + +G HWD HPA+MAVGVID TSEA+F+ +MSLGPSRSEWDFC   G+VVEHLDG
Sbjct  285   ETRDADSHGMHWDDHPALMAVGVIDATSEAVFRRVMSLGPSRSEWDFCLLEGNVVEHLDG  344

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDIIH +L + WLPWG+K+RDLLLRRYWRREDDGTYVILYHS  H KC P+ GYVRA +
Sbjct  345   HTDIIHKKLRSDWLPWGMKKRDLLLRRYWRREDDGTYVILYHSFSHQKCQPERGYVRACL  404

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+PVNQGK S VKHML++DWK   SYL  ++++ +TI MLG +AALRE F+AK 
Sbjct  405   KSGGYVISPVNQGKQSVVKHMLAIDWKFWKSYLFTSSAEYITIRMLGRVAALREFFRAKV  464

Query  1233  GS-YFPDPAMNELTIDIQLPVSEKEEIKNEVVATE----RIEEDTTEKYPS----ACSSI  1385
             GS    D +  E T +I LP +E+E +K E  A E        D T++ P+    A  S 
Sbjct  465   GSCACSDFSSGESTREIGLPQNEREHMKLEQPAEEISKSEDSADETQRSPAKNAKAGGSF  524

Query  1386  VELDDVADEFFDVPEASDDEHSDHGWPRS---TTPEYHETPRPKLSSAACFVRKLQDLAV  1556
             ++L+D ADEFFDV   S+    +  WP      T    +    KLS+AA FVRKL D+AV
Sbjct  525   LQLNDAADEFFDVINESEYNEVEALWPSDDGLQTQLVQDQRHSKLSTAAVFVRKLHDIAV  584

Query  1557  QK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKI  1724
             QK    + QE   GE      YG TLPKD   ++P SWA AD S+FLIRGE YL DH KI
Sbjct  585   QKRGYVDLQEASTGE-SVPCSYGATLPKDPCCSLPSSWAMADPSTFLIRGESYLHDHLKI  643

Query  1725  TSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLA  1904
              + GTL Q+V ADWL+S+ RED+L  RPG IVQKY+A    EFFF+V+IQVPG+T YSLA
Sbjct  644   KANGTLMQMVAADWLKSDKREDDLGGRPGGIVQKYSAHGGSEFFFIVHIQVPGSTTYSLA  703

Query  1905  LYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEM  2084
             LYYM+ +PL   PLLERFV GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+L++
Sbjct  704   LYYMMDSPLESFPLLERFVKGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALDI  763

Query  2085  NYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCR  2264
             NYF G NY+EL VDVGSSTVARGV++LVLGYL NLVIEMAFL+Q +TEEELPE LLGTCR
Sbjct  764   NYFCGSNYIELGVDVGSSTVARGVVSLVLGYLTNLVIEMAFLIQGNTEEELPEFLLGTCR  823

Query  2265  LNHLDASKAVHTN  2303
             LNHLDASKAV +N
Sbjct  824   LNHLDASKAVPSN  836



>dbj|BAK01993.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=758

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/729 (60%), Positives = 543/729 (74%), Gaps = 28/729 (4%)
 Frame = +3

Query  192   DGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITG-----REEPLRSAIIDS  356
             DG MEGWLYLIR NRLGLQ  RKRYF+LED+ L+ +KA P        RE+P+RSA+IDS
Sbjct  25    DGRMEGWLYLIRSNRLGLQTSRKRYFVLEDSALRCFKAAPAPSSSSSKREDPVRSAVIDS  84

Query  357   CIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI-NPEKN  533
             CI V DNGRE+ HR +F+ FTL N SNH DQLK GA S EEAARWIRCL ++A+ +P K+
Sbjct  85    CIRVTDNGRESVHRSIFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMESALKSPRKD  144

Query  534   --LRAPAIRKWQPFRLSV-SSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQNGLRI  695
               + A + R+WQ FRLS  S+RM   D    SS+  D M SDVI P  W IFG  NGLR+
Sbjct  145   EHVVACSHRRWQAFRLSRRSNRMHSIDWTILSSSHNDPMASDVIAPSAWTIFGCTNGLRL  204

Query  696   FKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHL  875
             F EAKD    GK+WD HPAIMAVGV+D  SE IF+ LMSLG SRSEWDFC   G VVEHL
Sbjct  205   FTEAKDGGSRGKYWDDHPAIMAVGVVDANSEDIFQTLMSLGQSRSEWDFCLREGRVVEHL  264

Query  876   DGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRA  1055
             DGH+DIIH +L   WLPWG+++RDLLLRRYWRREDDGTYVILYHSV H++C P++GY+ A
Sbjct  265   DGHSDIIHKKLRGDWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHNRCSPEKGYIHA  324

Query  1056  TVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKA  1226
              +KSGG+VI+PV+QG+ S VKHML++DWK   SYL  +++K +TI MLG +AALRE+F+A
Sbjct  325   CLKSGGYVISPVSQGRQSVVKHMLAIDWKFWKSYLLTSSAKYITIRMLGRVAALRELFRA  384

Query  1227  KSGS-YFPDPAMNELTIDIQLPVSEKEEIKNEVVATE---RIE------EDTTEKYPSAC  1376
             K+G+    + +  ELT D  LP    E  K E+ +     R+E      +  + +  S+ 
Sbjct  385   KNGNCACMEFSSGELTRDTGLPQGGNERRKIEMQSANECGRLEGPVEGLQGGSNRQLSST  444

Query  1377  SSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAV  1556
              S+V+L+D  DEFFDVP+ S+ +  +  W    +    +    KLSSAA FVRKL DLAV
Sbjct  445   GSLVQLNDATDEFFDVPDESEYDQREAMWSSDESTHAVDQRHAKLSSAAVFVRKLHDLAV  504

Query  1557  QK-NFQEIVGGEEG--AKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKIT  1727
             QK  + ++ G  +   A   YG TLPKD+S  +P SW+  D ++FLIRGE YL D  K+ 
Sbjct  505   QKRGYVDLQGAADADNAPCYYGHTLPKDSSCTIPSSWSMTDPTTFLIRGESYLIDRQKVK  564

Query  1728  SKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLAL  1907
             ++ TL Q+VGADW++S+ RED+LA RPG +VQKYAAQ   +FFF+VNIQVPG+T YSLAL
Sbjct  565   AENTLMQMVGADWIKSDKREDDLAGRPGGLVQKYAAQGGSKFFFIVNIQVPGSTTYSLAL  624

Query  1908  YYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMN  2087
             YYM+ TPL + PLLERFVNGDD FRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+N
Sbjct  625   YYMMDTPLEKVPLLERFVNGDDTFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEIN  684

Query  2088  YFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRL  2267
             YF+G NYLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFLVQ +T+EELPE LLGTCRL
Sbjct  685   YFRGSNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNTQEELPEFLLGTCRL  744

Query  2268  NHLDASKAV  2294
             N+LDASKAV
Sbjct  745   NYLDASKAV  753



>ref|XP_010234829.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Brachypodium distachyon]
Length=760

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/732 (60%), Positives = 543/732 (74%), Gaps = 30/732 (4%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITG-------REEPLRSAI  347
             ++G MEGWLYLIR NRLGLQ  RKRYF+LED  L+ +KA P          RE+P+RSA+
Sbjct  24    AEGRMEGWLYLIRSNRLGLQTSRKRYFVLEDAALQCFKAAPAPSSDSDSSKREDPVRSAM  83

Query  348   IDSCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI-NP  524
             IDSC  V DNGRE+ HR VF+ FTL N SNH DQLK GA S EEAARWIRCL ++A+ +P
Sbjct  84    IDSCTRVTDNGRESVHRSVFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMESALKSP  143

Query  525   EKN--LRAPAIRKWQPFRLSVSSRMAR----TDASSTPVDAMTSDVIGPCPWKIFGIQNG  686
              K+  + A + R+WQ FRLS  +        T  SS   D MTSDVI P PW IFG  NG
Sbjct  144   RKDEHIVACSHRRWQAFRLSRRASCMHSIDWTRLSSAHNDPMTSDVIAPSPWTIFGCTNG  203

Query  687   LRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVV  866
             LR+F EAKD + + K+W  HPAIMAVGV+D  SE IF+ LMSLG SRSEWDFC   G V+
Sbjct  204   LRLFTEAKDGDSHEKYWHDHPAIMAVGVVDANSEDIFQTLMSLGQSRSEWDFCLREGRVI  263

Query  867   EHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGY  1046
             EHLDGH+DIIH +L   WLPWG+++RDLLLRRYWRREDDGTYVILYHSV H+KC P++GY
Sbjct  264   EHLDGHSDIIHKKLRGDWLPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHNKCRPEQGY  323

Query  1047  VRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREM  1217
             +RA +KSGG+VI+PV+QG+ S VKHML++DWK   SYL  +++K +TI MLG +AALRE 
Sbjct  324   IRACLKSGGYVISPVSQGRQSVVKHMLAIDWKFWKSYLFTSSAKYITIRMLGRVAALREF  383

Query  1218  FKAKSGS-YFPDPAMNELTIDIQLPVSEKEEIKNEVVA---TERIEEDT------TEKYP  1367
             F+AK+G+    + +  EL  D+ LP  E E+IK E+ +   + R+E  T      + ++ 
Sbjct  384   FRAKNGNCACLEFSSGELMRDMGLPQGENEQIKIEMHSANESRRLEGSTEGSQGGSNRHL  443

Query  1368  SACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQD  1547
             S+  S V+L+D  DEFFDVP+ S+ +  +  W    +    +    KLSSAA FVR+L D
Sbjct  444   SSAGSFVQLNDATDEFFDVPDESEYDQREAMWSSDESTHAVDQRHAKLSSAAVFVRRLHD  503

Query  1548  LAVQK-NFQEIVGGEEGAKG--CYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHS  1718
             LAVQK  + ++ G  +   G  CYG TLPKD+S  MP SWA  D ++FLIRGE YL D  
Sbjct  504   LAVQKRGYIDLQGATDADNGPCCYGHTLPKDSSCTMPSSWAMTDPTTFLIRGESYLLDRQ  563

Query  1719  KITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYS  1898
             KI +  TL Q+VGADW++S+ RED+LA RPG +VQKYAA+   +FFF+VNIQVPG+T YS
Sbjct  564   KIKANNTLMQMVGADWIKSDKREDDLAGRPGGLVQKYAAEGGNKFFFIVNIQVPGSTTYS  623

Query  1899  LALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSL  2078
             LALYY + TPL + PLLERFVNGDD FRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+L
Sbjct  624   LALYYAMDTPLEKVPLLERFVNGDDTFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQAL  683

Query  2079  EMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGT  2258
             E+NYF+G NYLEL VD+GSSTVARGV++LVLGYL+NLVIEMAFLVQ +T+EELPE LLGT
Sbjct  684   EINYFRGTNYLELGVDIGSSTVARGVVSLVLGYLSNLVIEMAFLVQGNTQEELPEFLLGT  743

Query  2259  CRLNHLDASKAV  2294
             CRLN+LDASKAV
Sbjct  744   CRLNYLDASKAV  755



>ref|XP_008377573.1| PREDICTED: LOW QUALITY PROTEIN: protein ENHANCED DISEASE RESISTANCE 
2-like [Malus domestica]
Length=735

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/734 (59%), Positives = 545/734 (74%), Gaps = 30/734 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLY+I  NR GLQY RKRYFILEDNCL S+KA P +  EEP+RSA+ID
Sbjct  1     MGISQNDGKMEGWLYIIGSNRFGLQYSRKRYFILEDNCLGSFKAKPSSDSEEPVRSAVID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             SCI   DNGR + HRK FF FTL NTSN++D+LK GA+S EEAA+WIR L+DAA+    N
Sbjct  61    SCIRATDNGRASIHRKGFFVFTLYNTSNNNDRLKLGASSSEEAAKWIRSLQDAALKACPN  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQN  683
               ++  A + R+    R+  S R  R      T +S    + MTSDVI P PWKIFG QN
Sbjct  121   TAQDFVACSKRRRPSLRMGGSRRTERKNSVDWTFSSLMHTERMTSDVIAPSPWKIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+F+EAKD +  G+HWD HPAIMAVGV+DGTSEAIF+ L+SLGPSRSEWDFC+ RGSV
Sbjct  181   GLRLFEEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFRTLLSLGPSRSEWDFCYYRGSV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VE LDGHTDIIH QL + WLP G+KRRDLL+RRYWRREDDGTYVILYHS  H KCPP+ G
Sbjct  241   VESLDGHTDIIHQQLYSDWLPRGMKRRDLLMRRYWRREDDGTYVILYHSASHKKCPPKRG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG+VITPVN+GK S V+HML++DWK    YLR ++++ +TI ML  +AALRE
Sbjct  301   YVRACLKSGGYVITPVNKGKQSLVRHMLAIDWKFWKLYLRPSSARGITIRMLEIVAALRE  360

Query  1215  MFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIE--------EDTTEKYPS  1370
             +F+AK G+  P+ +  +++ +I+L  S ++ I+ +V     ++        ED  EK P 
Sbjct  361   LFRAKXGTSSPEFSSGDMSREIRLSQSGQQNIRTQVQHPGEVKKMEEGVLVEDEVEK-PE  419

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETP--RPKLSSAACFVRKLQ  1544
               +S+  L D ADEFFDVPE+++ +  ++ WP   + E + T    PKLSSAA  V++L 
Sbjct  420   GRTSLKGLHDAADEFFDVPESTEYDQFENEWPSDISMEQNPTSIQHPKLSSAAVLVKRLH  479

Query  1545  DLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQD  1712
             +L VQK    + QE+   +E     YG TL KD S  +P SW +AD SSFLIRG  YLQD
Sbjct  480   ELGVQKKGCPDLQEV--SKENNVFPYGATLQKDPSCALPCSWGSADPSSFLIRGPNYLQD  537

Query  1713  HSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATR  1892
               KI +K TL Q+VG DWL+S+ RED++++R GSIVQK A +D  EFFF+VN+Q+PG T+
Sbjct  538   RQKIKAKSTLMQLVGVDWLRSDKREDDISSRYGSIVQKSAERDGSEFFFIVNMQIPGTTK  597

Query  1893  YSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQ  2072
             ++LA YYM+KTPL E PLL  FVNGDD++RNS+FKLIPY+ KGSWIVKQSV KK CL+GQ
Sbjct  598   HTLAFYYMMKTPLEETPLLHNFVNGDDSYRNSRFKLIPYVVKGSWIVKQSVAKKPCLVGQ  657

Query  2073  SLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLL  2252
              LE++YF+G+NYLEL +D GSST+ARGV NLV+GYLNNLVIEMAFL+QA+TEEELPE LL
Sbjct  658   LLEVHYFRGKNYLELGIDAGSSTLARGVSNLVVGYLNNLVIEMAFLIQANTEEELPEVLL  717

Query  2253  GTCRLNHLDASKAV  2294
             GT RLN LDASK+V
Sbjct  718   GTYRLNQLDASKSV  731



>ref|XP_006846792.1| hypothetical protein AMTR_s00148p00054510 [Amborella trichopoda]
 gb|ERN08373.1| hypothetical protein AMTR_s00148p00054510 [Amborella trichopoda]
Length=774

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/734 (60%), Positives = 546/734 (74%), Gaps = 35/734 (5%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S+  +EGWLYLI  NR GLQ   KRYF L++N L  +KA P++ RE+P+RSA I+SC+ V
Sbjct  8     SNKIIEGWLYLIWSNRFGLQSSSKRYFALKENQLNCFKAPPVSDREDPVRSAEINSCVRV  67

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----NPEKNL  536
              DNGREN  RK  F FTL N SNHDD+LK GA S EEAARWI   ++AA+    + E+N 
Sbjct  68    TDNGRENVSRKPLFIFTLYNASNHDDRLKLGARSSEEAARWIHSFQEAALKECPDQERNF  127

Query  537   RAPAIRKWQPFRLSV---SSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGL  689
                + RKWQ FRL+    ++RM  +D        S  V+  T+DV+ P PW IFG +NGL
Sbjct  128   SLCSKRKWQSFRLNRNRGATRMYSSDLLDWTGFPSVHVEPTTADVVAPSPWTIFGCKNGL  187

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEA+D   +GKHWD HPAIMAVGV+D +SE +F+ +MSLGPSR+EWDFCF RGSV+E
Sbjct  188   RLFKEARDVGCHGKHWDDHPAIMAVGVVDASSELVFQTVMSLGPSRTEWDFCFSRGSVIE  247

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KC PQ   +
Sbjct  248   HLDGHTDIIHKQLHSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHRKCLPQRRSI  307

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMF  1220
             +A +KSGG+VI+PVN GK S VKHML++DWK   SYL   +++++TI MLG +AALREMF
Sbjct  308   QACLKSGGYVISPVNHGKQSVVKHMLAIDWKFWKSYLSAASARNITIKMLGRVAALREMF  367

Query  1221  KAKSGSY-FPDPAMNELTIDIQLPVSEKEEIKNEVVA-------TERIEEDTTEKYPSAC  1376
             KAK G+Y   D +  EL  DI LP   +E+IK EV         ++  EE+   K  +  
Sbjct  368   KAKLGTYQCSDFSSGELARDILLPQGVREDIKVEVGVQVGSGKKSKSSEEEDLLKPTTGS  427

Query  1377  SSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEY--HETPRPKLSSAACFVRKLQDL  1550
              S ++L++VADEFFDVPE S  E   +GW      E    +  +PKLSSAA FV++L  L
Sbjct  428   GSFLQLNEVADEFFDVPELS--ECDQNGWSPDDGSEMPSQDLIQPKLSSAAVFVKRLHVL  485

Query  1551  A--VQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQD  1712
             A  VQ+    + +E V  EE    CYG TLPKDA+ +MP SW  AD S+FLIRG+ YL+D
Sbjct  486   AGGVQRRPYIDLRE-VSEEEETSCCYGATLPKDATCSMPCSWTTADPSTFLIRGKNYLKD  544

Query  1713  HSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATR  1892
             H KI +K TL Q+VGADWL+S+ RED+LA RPGS VQKYAAQ   EFF +VNIQVPG+T 
Sbjct  545   HEKIKAKSTLMQMVGADWLKSDKREDDLAGRPGSFVQKYAAQGGNEFFVIVNIQVPGSTT  604

Query  1893  YSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQ  2072
             YSLALYYM+ TP+ + PLLERF+  DDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ
Sbjct  605   YSLALYYMMDTPVEKVPLLERFIKEDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQ  664

Query  2073  SLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLL  2252
             +LE+NYF+G+NYLEL VDVGSSTVARGV++LVLGYLNNLVIEMAFL+Q ++EEELPE LL
Sbjct  665   ALEINYFQGKNYLELGVDVGSSTVARGVVSLVLGYLNNLVIEMAFLIQGNSEEELPEFLL  724

Query  2253  GTCRLNHLDASKAV  2294
             GTCRLNHL+ASK+V
Sbjct  725   GTCRLNHLEASKSV  738



>ref|XP_004496270.1| PREDICTED: uncharacterized protein LOC101513040 [Cicer arietinum]
Length=721

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/724 (58%), Positives = 549/724 (76%), Gaps = 27/724 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR +R G  Y RKR+FIL++N L+S+K +P +  EEP+RSA+IDSCI V DNG
Sbjct  1     MEGWLYLIRSSRFGQHYSRKRFFILKENVLRSFKIIPSSQMEEPIRSAVIDSCIRVTDNG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----NPEKNLRAPA  548
             RE+ +RKV F FT+ N SN  D+LK GA+S EEAA+WIR  ++AA+    +P +N  A +
Sbjct  61    RESINRKVLFIFTVYNASNQGDKLKLGASSSEEAAKWIRSFQEAAVKEYPDPTENFVACS  120

Query  549   IRKWQPFRL--SVSSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKD  713
              ++    R   S S+    ++    S    +A+TSDVI P PWKIFG QNGLR+FKEAK 
Sbjct  121   KKRRSTLRYGGSKSADWKYSNLNFQSCVYSEAITSDVIAPSPWKIFGCQNGLRMFKEAKY  180

Query  714   RNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDI  893
              +  G++W  HPAIMAVGV+DGTSEAIF  LMSL PSRSEWDFC  RGSVV+HLDGHTDI
Sbjct  181   WDSRGRNWGDHPAIMAVGVVDGTSEAIFHTLMSLDPSRSEWDFCINRGSVVDHLDGHTDI  240

Query  894   IHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGG  1073
             IH+QL + WLPWG+K RDLLLRRYWRREDDGTYV+LYHSV HSKCPP++GY+RA +KSGG
Sbjct  241   IHLQLYSDWLPWGIKPRDLLLRRYWRREDDGTYVLLYHSVYHSKCPPKKGYIRACLKSGG  300

Query  1074  HVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYF  1244
              V++PVN+G  S V+HML++DWK    YL+ T++KS+TI ML  +AALRE+++ K+G+Y 
Sbjct  301   FVVSPVNKGTQSIVRHMLAIDWKLWKLYLQPTSAKSITIRMLERVAALRELYRTKAGNYS  360

Query  1245  PDPAMNELTIDIQLPVSEKEEIKNEV------VATERIEEDTTEKYPSACSSIVELDDVA  1406
              +P    +T DI+LP+S  E++  EV      +    + +D   +  S  +S++ L+D +
Sbjct  361   SEPIT--MTKDIELPLSINEDVNIEVPEENSSIEKLVVVKDEVNQEVSGLNSLMGLND-S  417

Query  1407  DEFFDVPEASDDEHSDHG-WPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK----NFQ  1571
             DEFFDVPE++D +H D+  W    + E    P+P++SSAA  V+K Q LAVQK    + Q
Sbjct  418   DEFFDVPESTDYDHFDNNQWHSDLSSEQLGVPQPRISSAAGLVKKFQGLAVQKKGYMDLQ  477

Query  1572  EIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQI  1751
             E+   EE A   YG TL  D +Y +P +WAA+D S FL+RGE YLQDH K+ +K TL Q+
Sbjct  478   EVTR-EESAPCSYGSTLQNDPTYTLPCTWAASDPSLFLVRGESYLQDHQKVKAKDTLMQL  536

Query  1752  VGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPL  1931
             VG DWL  + RED+L++RPGSIVQ+YAA+  PEFFFV+NIQ+PG+  Y++ALYYM+KTPL
Sbjct  537   VGTDWLCCDTREDDLSSRPGSIVQQYAAKGGPEFFFVINIQMPGSPMYNIALYYMMKTPL  596

Query  1932  AENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYL  2111
              +NPLL++FV GDD +RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+ Y +G+NYL
Sbjct  597   EDNPLLQKFVEGDDTYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEVRYIRGKNYL  656

Query  2112  ELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKA  2291
             ELD+DVGSSTVARGV +LVLGYLNNLV+EMAFL+Q +T++ELPE L+GTCRLNH+DASKA
Sbjct  657   ELDIDVGSSTVARGVASLVLGYLNNLVVEMAFLIQGNTQDELPEVLIGTCRLNHMDASKA  716

Query  2292  VHTN  2303
             +  N
Sbjct  717   IAVN  720



>ref|XP_007143713.1| hypothetical protein PHAVU_007G095400g [Phaseolus vulgaris]
 gb|ESW15707.1| hypothetical protein PHAVU_007G095400g [Phaseolus vulgaris]
Length=719

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/728 (59%), Positives = 545/728 (75%), Gaps = 35/728 (5%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYL+R NR G  Y RKRYFIL+DN L+S+K  P+T  EEP+RSAIIDSC+ V DNG
Sbjct  1     MEGWLYLLRANRFGQHYSRKRYFILKDNVLRSFKIQPVTPTEEPIRSAIIDSCVRVNDNG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----NPEKNLRAPA  548
             RE+ ++KVFF FT+ N +N  D+LK GA+S EEAA+WIR L+D+A+    +P KNL A  
Sbjct  61    RESMNKKVFFMFTVYNATNQSDKLKLGASSSEEAAKWIRTLQDSAMKECPSPTKNLVACI  120

Query  549   IRKWQPFRLSVSSRM--------ARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKE  704
              R+    R   S            +TD  +   + + SDVI P PWKIFG QNGLR+FKE
Sbjct  121   RRRRSTLRNGGSKSTDWKYINLNLQTDLCT---ETVASDVIAPSPWKIFGCQNGLRMFKE  177

Query  705   AKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGH  884
             AKD +  G HW  HPAIMAVGV+DGTSEAIF  LM+L P+RSEWDFC  RGSVV+HLDGH
Sbjct  178   AKDWDTLGTHWGDHPAIMAVGVVDGTSEAIFNTLMTLDPTRSEWDFCVYRGSVVDHLDGH  237

Query  885   TDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVK  1064
             TDI+H+++   WLPWG+K RDLLLRRYWRREDDG+YV+LYHSV HSKCPP++GYVRA +K
Sbjct  238   TDIVHIEMYNDWLPWGMKPRDLLLRRYWRREDDGSYVLLYHSVYHSKCPPKKGYVRACLK  297

Query  1065  SGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSG  1235
             SGG V+TPVN+G  S V+HML++DWK    YLR ++++S+TI ML  IAALRE+F+ K G
Sbjct  298   SGGFVVTPVNKGTQSVVRHMLAIDWKFWKLYLRPSSARSITIRMLERIAALRELFRTKGG  357

Query  1236  SYFPDPAMNELTIDIQLPVSEKEEIKNEVVATER-------IEEDTTEKYPSACSSIVEL  1394
             +   +     +T +I LP   KE++K++V   +        + ED  E  PS  ++++  
Sbjct  358   NSSSETLT--MTKEIGLPPGVKEDVKSDVSEEKTKFEEPLIVLEDGVE--PSGRTNLMGF  413

Query  1395  DDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK----  1562
             +D +DEFFDVPE ++ +H D+ W      E      P++S+A   V+KL DLAVQK    
Sbjct  414   ND-SDEFFDVPEPTEYDHFDNEWHPDLASEQMGMSIPRMSTAVGLVKKLHDLAVQKKGYM  472

Query  1563  NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTL  1742
             +  E V  EE A   YG TL  D+S ++P +WAA+D S FL+RGE YLQDH K+ + GTL
Sbjct  473   DLHETVR-EESASCSYGATLQNDSSCSLPCTWAASDPSLFLVRGENYLQDHQKVKAHGTL  531

Query  1743  TQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLK  1922
             TQ+VGADWL+S+ RED+L++RPGSIVQ+YAA+  PEFFFV+NIQ+PG   YSLALYYMLK
Sbjct  532   TQMVGADWLRSDTREDDLSSRPGSIVQQYAAKGGPEFFFVINIQMPGTPMYSLALYYMLK  591

Query  1923  TPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQ  2102
             TPL +NPL++ FV+GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+ Y +G+
Sbjct  592   TPLEDNPLMQSFVDGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEVLYIRGK  651

Query  2103  NYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDA  2282
             NYLELD+DVGSSTVARGV +LVLGYLNNLV+EMAFLVQ++T++ELPE LLGTCRLNH+DA
Sbjct  652   NYLELDIDVGSSTVARGVASLVLGYLNNLVVEMAFLVQSNTQDELPEVLLGTCRLNHMDA  711

Query  2283  SKAVHTNS  2306
             SKA   NS
Sbjct  712   SKAFLVNS  719



>ref|XP_008791555.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008791556.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Phoenix dactylifera]
Length=741

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/734 (60%), Positives = 530/734 (72%), Gaps = 31/734 (4%)
 Frame = +3

Query  192   DGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQ  371
             D  MEGWLYLIR NRLGLQY RKRYF+LEDN L  YKAVP + RE+P+RSA+I+SCI V 
Sbjct  7     DRRMEGWLYLIRSNRLGLQYSRKRYFVLEDNALNCYKAVPASRREDPIRSALINSCIRVT  66

Query  372   DNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN--PEKNLRAP  545
             DNGR + HR VF+ FTL ++SNH+DQLK GA S EEAA WIR L +AA+   P K+ +  
Sbjct  67    DNGRASMHRSVFYIFTLYSSSNHNDQLKLGARSSEEAASWIRSLMEAALKECPNKDEKFV  126

Query  546   AIRKWQPFRLSVSSRMAR--------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
             A  K +   L +S   AR        T  SS   D M SDVI P PW IFG +NGLR+FK
Sbjct  127   ACSKRRRHSLRLSRTRARSLMHSIDWTVYSSVHTDPMASDVIAPSPWMIFGCKNGLRLFK  186

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             E+ + +  GKHWD HPAIMAVGV+D TSEAIF+ +MSLGPSRSEWDF    G VVEHLDG
Sbjct  187   ESNEGDFLGKHWDDHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRVVEHLDG  246

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDIIH +L   WLPWG+ +RDLLLRRYWRREDDGTYVILYHSV H  C P+ GY+RA +
Sbjct  247   HTDIIHKKLHGDWLPWGMNKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACL  306

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+PVNQGK S VKHML++DWK   SY+  +++K +TI MLG +AALRE F+AK 
Sbjct  307   KSGGYVISPVNQGKQSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAALREFFRAKL  366

Query  1233  GS-YFPDPAMNELTIDIQLPVSEKEEIKNEVVAT---------ERIEEDTTEKYPSACSS  1382
             G+    D +  ELT +I LP SEKE IK EV  T             + +   + +   S
Sbjct  367   GNCTCSDYSSGELTREIGLPYSEKEHIKVEVQTTGENSKSADSAEAPQQSPSSHANTSGS  426

Query  1383  IVELDDVADEFFDVPEASDDEHSDHGWPRST---TPEYHETPRPKLSSAACFVRKLQDLA  1553
              ++L+D ADEFFDV + SD++ ++  WP      +    E  + KLS+AA FV+KL D A
Sbjct  427   FLQLNDAADEFFDVIDESDNDQTEALWPSDEGMHSQLVQEQRQHKLSTAAVFVKKLHDFA  486

Query  1554  VQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSK  1721
             VQK    + QE   G+  A   YG TLPKD S  M  SWA AD +SFLIRGE YL+D  K
Sbjct  487   VQKKGYIDLQEASMGDM-APCSYGTTLPKDPSCTMTCSWAMADPTSFLIRGESYLRDQQK  545

Query  1722  ITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSL  1901
             I +  TL Q+V ADWL S+ RED+L  RPG +VQKYAAQ   EFFF+VNIQ+PG++ YSL
Sbjct  546   IKANSTLMQMVAADWLNSDKREDDLGGRPGGVVQKYAAQGGSEFFFIVNIQIPGSSTYSL  605

Query  1902  ALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLE  2081
             ALYYM+ TPL   PLLE FV GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+L 
Sbjct  606   ALYYMMDTPLENVPLLESFVKGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALA  665

Query  2082  MNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTC  2261
              +YF+G NYLE+ +D GSSTVARGV++LVLGYLNNLVIE+AFL+Q +T+EELPE LLGTC
Sbjct  666   SHYFRGSNYLEVGIDAGSSTVARGVVSLVLGYLNNLVIELAFLIQGNTQEELPELLLGTC  725

Query  2262  RLNHLDASKAVHTN  2303
             RLNHLDASK+V  N
Sbjct  726   RLNHLDASKSVSIN  739



>gb|KDO73327.1| hypothetical protein CISIN_1g004508mg [Citrus sinensis]
Length=739

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/710 (62%), Positives = 539/710 (76%), Gaps = 41/710 (6%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S G MEGWL+LIR NR+GLQY RKRYF+LED+ LKS+K+VP +  E+P+RSAIIDSCI V
Sbjct  8     SQGRMEGWLHLIRSNRIGLQYSRKRYFLLEDHFLKSFKSVPHSKNEDPVRSAIIDSCIRV  67

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI--NPEK----  530
              DNGRE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAA+WI  L++AA+   P +    
Sbjct  68    TDNGRESIHRKVFFIFTLYNTSNHNDQLKLGASSPEEAAKWIHSLQEAALKGGPHQGVGD  127

Query  531   NLRAPAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLR  692
             ++  P    W+ FRLS SSR + T +      S T ++ +T+DVI P PW IFG QNGLR
Sbjct  128   HIGCPN-SPWESFRLSGSSRASHTKSIDWTLCSGTHMEQVTADVIAPSPWTIFGCQNGLR  186

Query  693   IFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEH  872
             +FKE KDR   GK WD HPAIMAVGV+DGTSEAIF+ LMSLG SRS WDFCF RG VVEH
Sbjct  187   LFKEGKDRGSRGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGASRSVWDFCFYRGCVVEH  245

Query  873   LDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVR  1052
             LDGHTDIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCP Q+G VR
Sbjct  246   LDGHTDIIHKQLYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVR  305

Query  1053  ATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFK  1223
             A +KSGG+VITP+N GK S VKHML++DWK   SYL+ ++++S+TI MLG +AALRE+F+
Sbjct  306   ACLKSGGYVITPMNHGKKSVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFR  365

Query  1224  AKSGSYF-PDPAMNELTID----------IQLPVSEKEEIKNEVVATERIEEDTTEKYPS  1370
             AK G+Y  P+    ELT +          +Q+P  +    KN    +E +++ ++E    
Sbjct  366   AKQGNYSSPEFLSGELTRNMRMHQTDGNMVQMPTEDGNSKKN---TSEEVDQVSSEH---  419

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQ  1544
               +S+V L+D ADEFFDVPE SD + S++GW     PE +  +T  PK+S+AA FVRKL 
Sbjct  420   --ASLVGLNDAADEFFDVPEPSDYDDSENGWTSDFGPEMNSQDTRHPKISTAAGFVRKLH  477

Query  1545  DLAVQK-NFQEIVGG--EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDH  1715
             DLAVQK  + ++ G   E+    CYG TL KD +  +P SW + D S+FLIRG+ YLQD 
Sbjct  478   DLAVQKRGYVDLQGTAKEDNFSCCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDR  537

Query  1716  SKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRY  1895
              K+ +KGTL Q+V ADWL+S+ RED+L  RPG IVQKYA Q  PEFFF++NIQVPG+T Y
Sbjct  538   HKVKAKGTLMQMVAADWLKSDKREDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTY  597

Query  1896  SLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQS  2075
             SLALYYM+ TP+ + PLLE F+NGDDA+RNS+FKLIPYIS+GSWIVKQSVGKK+CLIGQ+
Sbjct  598   SLALYYMMTTPVKDAPLLESFINGDDAYRNSRFKLIPYISEGSWIVKQSVGKKACLIGQA  657

Query  2076  LEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADT  2225
             LE+NYF G+NYLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFL+Q  +
Sbjct  658   LEINYFHGKNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQVKS  707



>ref|XP_008807473.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Phoenix dactylifera]
Length=736

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/720 (60%), Positives = 528/720 (73%), Gaps = 28/720 (4%)
 Frame = +3

Query  195   GNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQD  374
             G MEGWLYLIR NR GLQ  R+RYF+LEDN L  YK +P + RE+P+RSA+IDSCI V D
Sbjct  20    GRMEGWLYLIRSNRFGLQSSRRRYFVLEDNSLHCYKTIPTSTREDPIRSALIDSCIRVAD  79

Query  375   NGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----PEKNLRA  542
             NGRE+ HR  F  F L N +NH+DQLK GA SPEEAARWIR L +AA+       +N  A
Sbjct  80    NGRESIHRNGFSYFMLYNAANHNDQLKLGARSPEEAARWIRSLMEAALKECPIKRENAVA  139

Query  543   PAIRKWQPFRLSVS---SRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKE  704
              + R+W   RLS S   SRM   D    SS   D M SDVI P PW IFG +NGLR+FKE
Sbjct  140   CSRRRWPSLRLSQSKGRSRMHSIDWTVFSSIHTDPMASDVIAPSPWTIFGCKNGLRLFKE  199

Query  705   AKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGH  884
             AKD + + K WD HPAIMAVGV+D T EAIF+ +MSLGPSRSEWDFCF RGSV+EHLDGH
Sbjct  200   AKDGDFHRKCWDDHPAIMAVGVVDATPEAIFRTVMSLGPSRSEWDFCFARGSVIEHLDGH  259

Query  885   TDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVK  1064
             TDIIH +L + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H  C P+ GY+RA +K
Sbjct  260   TDIIHKKLHSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLK  319

Query  1065  SGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSG  1235
             SGG+VI+P NQG  S VKHML++DWK   SYL  +++  +TI MLG +AALRE+F+ K G
Sbjct  320   SGGYVISPANQGNISVVKHMLAIDWKFWKSYLFASSAICITIRMLGRVAALRELFRVKLG  379

Query  1236  SY-FPDPAMNELTIDIQLPVSEKEEIKNEVVATERIE--EDTTEKYPSACSSIVELDDVA  1406
             +Y   D + ++   ++QL     E  K+E    E +E  E +  K      S ++L+D A
Sbjct  380   NYSHTDFSSHDTEPEVQLA---GENSKSE----EFLEGSEKSPAKPAKTSGSFLQLNDAA  432

Query  1407  DEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK----NFQE  1574
             DEFFDV + S+ + ++  W      +  +  +PKLS+AA  VR+L DLAVQK    + Q+
Sbjct  433   DEFFDVLDESEYDQTEVMWTSDAGMQSQDQRQPKLSTAAVLVRRLHDLAVQKRGYVDLQD  492

Query  1575  IVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIV  1754
                 E+    CYG TL  D+S+ +  SWA+AD S+FLIR + YLQD  KI + GTL Q+V
Sbjct  493   -ASMEDAIPCCYGATLQNDSSFTIACSWASADPSTFLIRSKTYLQDRQKIKANGTLMQMV  551

Query  1755  GADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLA  1934
              ADWL+S  RED+L +R G IVQKYA Q   EFFF+VNIQVPG+T YSLALYYM+ TPL 
Sbjct  552   AADWLKSSKREDDLGSRAGGIVQKYATQGGREFFFIVNIQVPGSTTYSLALYYMMDTPLE  611

Query  1935  ENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLE  2114
             + PLLE FV GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G NYLE
Sbjct  612   DVPLLENFVRGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFRGGNYLE  671

Query  2115  LDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             L +D+GSSTVARGV++LVLGYLNNLVIEMAFLVQ + EEELPE LLGTCRLNHLDA+KAV
Sbjct  672   LGIDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNAEEELPEFLLGTCRLNHLDAAKAV  731



>ref|XP_009103932.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Brassica 
rapa]
Length=722

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/731 (60%), Positives = 537/731 (73%), Gaps = 34/731 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M M  +DG MEGWLY IR NR GLQ+ RKRYF+L DN LKS+++VP    EEP R A +D
Sbjct  1     MEMSQTDGRMEGWLYTIRHNRFGLQFSRKRYFLLLDNTLKSFRSVPSDHNEEPDRRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN--PE  527
              CI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA+    P 
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDASQKGFPF  120

Query  528   KNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGL  689
              +    +  +    +L +S R  R      T+ SS  V+ +  DVI P PWKIFG QNGL
Sbjct  121   PDCEFVSHAEKGLVKLDLSKRTRRKVSVDWTNYSSLNVETIALDVIAPSPWKIFGCQNGL  180

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEAKD +  GKHWD HPA+MAVGVIDGTSE IF  LMSL P RSEWDFCF +GSVVE
Sbjct  181   RLFKEAKDWDSRGKHWDDHPAVMAVGVIDGTSEDIFNTLMSLDPLRSEWDFCFYKGSVVE  240

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDII++QL + WLPWG+ RRDLLLRRYWRRE+DGTYVIL HSV H KCPP+ GYV
Sbjct  241   HLDGHTDIINVQLYSDWLPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKKCPPRRGYV  300

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMF  1220
             RA VKSGG+V+TPV++GK S VKHM+++DW+S   Y+R ++S+S+TI ++  +AALREMF
Sbjct  301   RACVKSGGYVVTPVSKGKQSLVKHMVAIDWRSWNLYMRPSSSRSITIRVVERLAALREMF  360

Query  1221  KAKSGSYFPDPAMNEL--------TIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSAC  1376
             KAK G  F +    E          ++I+  ++E + +  E+V     + D  EK  SA 
Sbjct  361   KAKQGQGFAEFVSGEFLETKPCLSKVNIRPLITEAKRVDLELV-----KADEMEKPSSAR  415

Query  1377  SSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAV  1556
              S+++L+DV+DEFFDVPE S+ +      P S      + P P     A  V+KLQDLA 
Sbjct  416   HSLMDLNDVSDEFFDVPEPSEFDSLIDNSPFSQGHSQLKIPSP-----AGIVKKLQDLAN  470

Query  1557  QK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKI  1724
              K    + QE VG ++ +   YG TL KD ++ MP SWA AD S+FLIRGE YL+D  K+
Sbjct  471   NKKGYMDLQE-VGMDDKSTFFYGATLQKDPNFTMPCSWATADPSTFLIRGENYLKDRQKV  529

Query  1725  TSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLA  1904
              +  TL Q++GADW+ S+ REDNL  R G +VQ+YAA+D PEFFF+VN+QVPG+  YSLA
Sbjct  530   KANDTLMQMIGADWISSDKREDNLGGRIGGLVQEYAAKDGPEFFFIVNMQVPGSAMYSLA  589

Query  1905  LYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEM  2084
             LYYMLKTPL E+PLLE FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVGKK+CL+GQ+LE+
Sbjct  590   LYYMLKTPLEEHPLLESFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGKKACLVGQALEV  649

Query  2085  NYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCR  2264
              Y +G+NYLELDVDVGSSTVARGV NLVLGYL NLVIEMAFL+QA+TE ELPE LLGTCR
Sbjct  650   RYTRGKNYLELDVDVGSSTVARGVTNLVLGYLTNLVIEMAFLIQANTENELPELLLGTCR  709

Query  2265  LNHLDASKAVH  2297
             LN+LD SK+V 
Sbjct  710   LNYLDVSKSVQ  720



>emb|CDX67608.1| BnaA07g16480D [Brassica napus]
Length=722

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/731 (60%), Positives = 537/731 (73%), Gaps = 34/731 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M M  +DG MEGWLY IR NR GLQ+ RKRYF+L DN LKS+++VP    EEP R A +D
Sbjct  1     MEMSQTDGRMEGWLYTIRHNRFGLQFSRKRYFLLLDNNLKSFRSVPSDHNEEPDRRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN--PE  527
              CI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA+    P 
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDASQKGFPF  120

Query  528   KNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGL  689
              +    +  +    +L +S R  R      T+ SS  V+ +  DVI P PWKIFG QNGL
Sbjct  121   PDCEFVSHAEKGLVKLDLSKRTRRKVSVDWTNYSSLNVETIALDVIAPSPWKIFGCQNGL  180

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEAKD +  GKHWD HPA+MAVGVIDGTSE IF  LMSL P RSEWDFCF +GSVVE
Sbjct  181   RLFKEAKDWDSRGKHWDDHPAVMAVGVIDGTSEDIFNTLMSLDPLRSEWDFCFYKGSVVE  240

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDII++QL + WLPWG+ RRDLLLRRYWRRE+DGTYVIL HSV H KCPP+ GYV
Sbjct  241   HLDGHTDIINVQLYSDWLPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKKCPPRRGYV  300

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMF  1220
             RA VKSGG+V+TPV++GK S VKHM+++DW+S   Y+R ++S+S+TI ++  +AALREMF
Sbjct  301   RACVKSGGYVVTPVSKGKQSLVKHMVAIDWRSWNLYMRPSSSRSITIRVVERLAALREMF  360

Query  1221  KAKSGSYFPDPAMNEL--------TIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSAC  1376
             KAK G  F +    E          ++I+  ++E + +  E+V     + D  EK  SA 
Sbjct  361   KAKQGQGFAEFVSGEFLETKPCLSKVNIRPLITEAKRVDLELV-----KADEMEKPSSAR  415

Query  1377  SSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAV  1556
              S+++L+DV+DEFFDVPE S+ +      P S      + P P     A  V+KLQDLA 
Sbjct  416   HSLMDLNDVSDEFFDVPEPSEFDSLIDNSPFSQGHSQLKIPSP-----AGIVKKLQDLAN  470

Query  1557  QK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKI  1724
              K    + QE VG ++ +   YG TL KD ++ MP SWA AD S+FLIRGE YL+D  K+
Sbjct  471   NKKGYMDLQE-VGMDDKSTFFYGATLQKDPNFTMPCSWATADPSTFLIRGENYLKDRQKV  529

Query  1725  TSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLA  1904
              +  TL Q++GADW+ S+ REDNL  R G +VQ+YAA+D PEFFF+VN+QVPG+  YSLA
Sbjct  530   KANDTLMQMIGADWISSDKREDNLGGRIGGLVQEYAAKDGPEFFFIVNMQVPGSAMYSLA  589

Query  1905  LYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEM  2084
             LYYMLKTPL E+PLLE FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVGKK+CL+GQ+LE+
Sbjct  590   LYYMLKTPLEEHPLLESFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGKKACLVGQALEV  649

Query  2085  NYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCR  2264
              Y +G+NYLELDVDVGSSTVARGV NLVLGYL NLVIEMAFL+QA+TE ELPE LLGTCR
Sbjct  650   RYTRGKNYLELDVDVGSSTVARGVTNLVLGYLTNLVIEMAFLIQANTENELPELLLGTCR  709

Query  2265  LNHLDASKAVH  2297
             LN+LD SK+V 
Sbjct  710   LNYLDVSKSVQ  720



>ref|XP_006292259.1| hypothetical protein CARUB_v10018468mg [Capsella rubella]
 gb|EOA25157.1| hypothetical protein CARUB_v10018468mg [Capsella rubella]
Length=731

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/737 (59%), Positives = 537/737 (73%), Gaps = 39/737 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +P SDG MEGWLY IR NR GLQ+ RKRYF+L DN L S+K+VP    EEP R A +D
Sbjct  1     MGVPQSDGRMEGWLYTIRQNRFGLQFSRKRYFVLVDNTLTSFKSVPSDHNEEPDRRATLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN--PE  527
              CI V DNGRE+FHRK+ F FTL NTSNH D+LK GA+SPEEAA+WIR L+DA+    P 
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHLDELKLGASSPEEAAKWIRSLQDASQKGFPF  120

Query  528   KNLRAPAIRKWQPFRLSVSSRMARTDA-------------SSTPVDAMTSDVIGPCPWKI  668
              +    +  +    +L VS R  R ++             SS  V+ +  DVI P PWKI
Sbjct  121   PDCEFVSHAEKGLVKLDVSKRSRRKNSVDWTNYSATNYSSSSLNVETVAPDVIAPSPWKI  180

Query  669   FGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCF  848
             FG QNGLR+FKEAKD +  G+HWD H AIMAVGVI+GTSE IF  LMSLGP RSEWDFCF
Sbjct  181   FGCQNGLRLFKEAKDWDSRGRHWDDHAAIMAVGVIEGTSEDIFNTLMSLGPLRSEWDFCF  240

Query  849   CRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKC  1028
              +GSVVEHLDGHTDII+MQL + WLPWG+ RRDLLLRRYWRRE+DGTYVIL HSV H KC
Sbjct  241   YKGSVVEHLDGHTDIINMQLYSDWLPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKKC  300

Query  1029  PPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGI  1199
             PP+ GYVRA VKSGG+V+TPVN+GK S VKHM+++DW+S   Y+R ++++S+TI ++  +
Sbjct  301   PPKRGYVRACVKSGGYVVTPVNKGKHSLVKHMVAIDWRSWNLYMRPSSARSITIRVVERV  360

Query  1200  AALREMFKAKSGSYFPDPAMNELTI--------DIQLPVSEKEEIKNEVVATERIEEDTT  1355
             AALREMFKAK G  F +    E  +        + +   +E +E+  E V  E ++    
Sbjct  361   AALREMFKAKQGHGFTEFVSGEFAVTKPCLSKVNTKPLKTEAKEVNQETVKAEEMD----  416

Query  1356  EKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVR  1535
              K  SA +S+++L+D +DEFFDVPE ++    D     S   + H+   PK    A  V+
Sbjct  417   -KPSSARNSLMDLNDASDEFFDVPEPNESTEFDSFIDNSPFSQGHQLKIPK---PAGIVK  472

Query  1536  KLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKY  1703
             KLQDLA+ K    + QE+ G EE     YG TL KD +  +P SW+ AD S+FLIRG  Y
Sbjct  473   KLQDLAINKKGYMDLQEM-GLEENNTFFYGATLQKDPNLTLPCSWSTADPSTFLIRGNNY  531

Query  1704  LQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPG  1883
             L+DH K+ +KGTL Q++GADW+ S+ RED+L  R G +VQ++AA+  PEFFFVVNIQVPG
Sbjct  532   LEDHQKVKAKGTLMQMIGADWISSDKREDDLGGRVGGLVQEFAAKGGPEFFFVVNIQVPG  591

Query  1884  ATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCL  2063
             +  YSLALYYMLKTPL E+PLL+ FVNGDDA+RNS+FKL+P+ISKGSWIVKQSVGKK+CL
Sbjct  592   SAMYSLALYYMLKTPLEEHPLLQSFVNGDDAYRNSRFKLVPHISKGSWIVKQSVGKKACL  651

Query  2064  IGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPE  2243
             +GQ+LE+ Y +G+NYLELD+DVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T EELPE
Sbjct  652   VGQALEVRYTRGKNYLELDIDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTAEELPE  711

Query  2244  HLLGTCRLNHLDASKAV  2294
              LLGTCRLN+LD SK+V
Sbjct  712   LLLGTCRLNYLDVSKSV  728



>ref|XP_010234828.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Brachypodium distachyon]
Length=785

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/757 (58%), Positives = 543/757 (72%), Gaps = 55/757 (7%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITG-------REE------  329
             ++G MEGWLYLIR NRLGLQ  RKRYF+LED  L+ +KA P          REE      
Sbjct  24    AEGRMEGWLYLIRSNRLGLQTSRKRYFVLEDAALQCFKAAPAPSSDSDSSKREEGLCSCT  83

Query  330   -------------------PLRSAIIDSCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQL  452
                                P+RSA+IDSC  V DNGRE+ HR VF+ FTL N SNH DQL
Sbjct  84    RWIRTKSYCQFRTMQEIQDPVRSAMIDSCTRVTDNGRESVHRSVFYIFTLYNASNHYDQL  143

Query  453   KFGANSPEEAARWIRCLRDAAI-NPEKN--LRAPAIRKWQPFRLSVSSRMAR----TDAS  611
             K GA S EEAARWIRCL ++A+ +P K+  + A + R+WQ FRLS  +        T  S
Sbjct  144   KLGARSSEEAARWIRCLMESALKSPRKDEHIVACSHRRWQAFRLSRRASCMHSIDWTRLS  203

Query  612   STPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEA  791
             S   D MTSDVI P PW IFG  NGLR+F EAKD + + K+W  HPAIMAVGV+D  SE 
Sbjct  204   SAHNDPMTSDVIAPSPWTIFGCTNGLRLFTEAKDGDSHEKYWHDHPAIMAVGVVDANSED  263

Query  792   IFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywr  971
             IF+ LMSLG SRSEWDFC   G V+EHLDGH+DIIH +L   WLPWG+++RDLLLRRYWR
Sbjct  264   IFQTLMSLGQSRSEWDFCLREGRVIEHLDGHSDIIHKKLRGDWLPWGMRKRDLLLRRYWR  323

Query  972   rEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVD---WK  1142
             REDDGTYVILYHSV H+KC P++GY+RA +KSGG+VI+PV+QG+ S VKHML++D   WK
Sbjct  324   REDDGTYVILYHSVFHNKCRPEQGYIRACLKSGGYVISPVSQGRQSVVKHMLAIDWKFWK  383

Query  1143  SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YFPDPAMNELTIDIQLPVSEKEEIKNE  1319
             SYL  +++K +TI MLG +AALRE F+AK+G+    + +  EL  D+ LP  E E+IK E
Sbjct  384   SYLFTSSAKYITIRMLGRVAALREFFRAKNGNCACLEFSSGELMRDMGLPQGENEQIKIE  443

Query  1320  VVA---TERIEEDT------TEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRS  1472
             + +   + R+E  T      + ++ S+  S V+L+D  DEFFDVP+ S+ +  +  W   
Sbjct  444   MHSANESRRLEGSTEGSQGGSNRHLSSAGSFVQLNDATDEFFDVPDESEYDQREAMWSSD  503

Query  1473  TTPEYHETPRPKLSSAACFVRKLQDLAVQK-NFQEIVGGEEGAKG--CYGCTLPKDASYN  1643
              +    +    KLSSAA FVR+L DLAVQK  + ++ G  +   G  CYG TLPKD+S  
Sbjct  504   ESTHAVDQRHAKLSSAAVFVRRLHDLAVQKRGYIDLQGATDADNGPCCYGHTLPKDSSCT  563

Query  1644  MPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQ  1823
             MP SWA  D ++FLIRGE YL D  KI +  TL Q+VGADW++S+ RED+LA RPG +VQ
Sbjct  564   MPSSWAMTDPTTFLIRGESYLLDRQKIKANNTLMQMVGADWIKSDKREDDLAGRPGGLVQ  623

Query  1824  KYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLI  2003
             KYAA+   +FFF+VNIQVPG+T YSLALYY + TPL + PLLERFVNGDD FRNS+FKLI
Sbjct  624   KYAAEGGNKFFFIVNIQVPGSTTYSLALYYAMDTPLEKVPLLERFVNGDDTFRNSRFKLI  683

Query  2004  PYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLN  2183
             PYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G NYLEL VD+GSSTVARGV++LVLGYL+
Sbjct  684   PYISKGSWIVKQSVGKKACLVGQALEINYFRGTNYLELGVDIGSSTVARGVVSLVLGYLS  743

Query  2184  NLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             NLVIEMAFLVQ +T+EELPE LLGTCRLN+LDASKAV
Sbjct  744   NLVIEMAFLVQGNTQEELPEFLLGTCRLNYLDASKAV  780



>ref|XP_010920450.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X5 [Elaeis 
guineensis]
Length=723

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/737 (59%), Positives = 526/737 (71%), Gaps = 49/737 (7%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +   D  MEGWLYLIR NRLGLQY RKRYF+LEDN L  YKAVP + RE+P+RSA+ID
Sbjct  1     MGITEGDRRMEGWLYLIRSNRLGLQYSRKRYFVLEDNALNCYKAVPASRREDPIRSALID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             SCI V DNGR + HR +                  GA S EEAA WIR L +AA+    N
Sbjct  61    SCIRVTDNGRASIHRSL------------------GARSSEEAASWIRSLMEAALKECPN  102

Query  522   PEKNLRAPAIRKWQPFRLS---VSSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQN  683
              E+N  A + R+ Q FRLS     S M   D    SS   D M SDVI P PW IFG +N
Sbjct  103   KEENFVACSKRRRQSFRLSRTKARSLMHSIDWTVYSSVHADPMASDVIAPSPWTIFGCKN  162

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKE+ + + +GK WD HPAIMAVGV+D TSEAIF+ +MSLGPSRSEWDF    G V
Sbjct  163   GLRLFKESNEGDFHGKQWDDHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRV  222

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDIIH +L   WLPWG+K+RDLLLRRYWRREDDGTYVILYHSV H  C P+ G
Sbjct  223   VEHLDGHTDIIHKKLRGDWLPWGMKKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERG  282

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALRE  1214
             Y+RA +KSGG+VI+PVNQGK S VKHML++DWK   SY+  +++K +TI MLG +A LRE
Sbjct  283   YIRACLKSGGYVISPVNQGKRSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAGLRE  342

Query  1215  MFKAKSGS-YFPDPAMNELTIDIQLPVSEKEEIKNEV---------VATERIEEDTTEKY  1364
              F+AK G+    D +  ELT +I LP  EKE IK EV         V +    + +  ++
Sbjct  343   FFRAKLGNCTCSDYSSGELTREIGLPYGEKEHIKVEVQTTGENNKSVDSAEAPQQSPSRH  402

Query  1365  PSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRST---TPEYHETPRPKLSSAACFVR  1535
                  S ++L+D ADEFFDV + SD++ ++  WP      +    E  +P+LS+AA FV+
Sbjct  403   ADTNGSFLQLNDAADEFFDVIDESDNDQTESLWPSDEGMHSQLLQEQRQPRLSTAAVFVK  462

Query  1536  KLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKY  1703
             KL D AVQK    + QE   G+  A   YG TLPKD S  MP SWA AD++SFLIRGE Y
Sbjct  463   KLHDFAVQKKGYIDLQEASMGDM-APCSYGATLPKDTSCTMPCSWAMADSTSFLIRGESY  521

Query  1704  LQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPG  1883
             L+DH KI +  TL Q+V ADWL S+ RED+L  RPG IVQKYAAQ   EFFF+VNIQVPG
Sbjct  522   LRDHQKIKANSTLMQMVAADWLNSDKREDDLGGRPGGIVQKYAAQGGSEFFFIVNIQVPG  581

Query  1884  ATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCL  2063
             +T YSLALYYM+ TPL   PLLE FV GD+A+RNS+FKLIPYISKGSWIVKQSVGKK+CL
Sbjct  582   STTYSLALYYMMDTPLENVPLLESFVKGDNAYRNSRFKLIPYISKGSWIVKQSVGKKACL  641

Query  2064  IGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPE  2243
             +GQ+LE++YF+G NYLEL +DVGSSTVARGV++LVLGYLNNLVIE+AFL+Q +T+EELPE
Sbjct  642   VGQALEIHYFRGSNYLELGIDVGSSTVARGVVSLVLGYLNNLVIELAFLIQGNTQEELPE  701

Query  2244  HLLGTCRLNHLDASKAV  2294
              LLGTCRLNHLDASK+V
Sbjct  702   FLLGTCRLNHLDASKSV  718



>ref|XP_010516021.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
 ref|XP_010516022.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
Length=731

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/734 (59%), Positives = 540/734 (74%), Gaps = 33/734 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLY IR NR GLQ+ RKRYF+L DN L S+K+VP    EEP R A +D
Sbjct  1     MGVSQTDGRMEGWLYTIRHNRFGLQFSRKRYFLLVDNTLTSFKSVPSDHNEEPDRRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----  521
              CI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA+      
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDASQKGFPI  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMARTDA-------------SSTPVDAMTSDVIGPCPW  662
             P+    + A +     +L VS R  R ++             SS  V+ + SDVI P PW
Sbjct  121   PDYEFVSHAEKGL--VKLDVSKRTRRKNSVDWTNYSSTNYSSSSLNVETVASDVIAPSPW  178

Query  663   KIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDF  842
             KIFG QNGLR+FKEAKD +  G+HW+ H AIMAVGVI+GTSE IF  LMSLGP RSEWDF
Sbjct  179   KIFGCQNGLRLFKEAKDWDSRGRHWEDHAAIMAVGVIEGTSEDIFNTLMSLGPLRSEWDF  238

Query  843   CFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHS  1022
             CF +GSVVEHLDGHTDII+MQL + WLPWG+ RRDLLLRRYWRRE+DGTYVIL HSV H 
Sbjct  239   CFYKGSVVEHLDGHTDIINMQLYSDWLPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHK  298

Query  1023  KCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLG  1193
             KCPP+ GYVRA VKSGG+V+TPVN+GK S VKHM+++DW+S   Y+R ++++S+TI ++ 
Sbjct  299   KCPPKRGYVRACVKSGGYVVTPVNKGKHSLVKHMVAIDWRSWNLYMRPSSARSITIRVVE  358

Query  1194  GIAALREMFKAKSGSYFPDPAMNELTIDIQ-LPVSEKEEIKNEV--VATERIEEDTTEKY  1364
              +AALREMFKA+ G  F +    E  +    L     + +K E   V  E ++ D  +K 
Sbjct  359   RVAALREMFKARQGHSFSEFVSGEFMVTKPCLSKLNTKPLKTEAKDVYQESMKADDMDKP  418

Query  1365  PSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQ  1544
              SA +S+++L+D +DEFFDVPE ++    D      T+P Y +  + K+ + +  V+KLQ
Sbjct  419   SSARNSLMDLNDASDEFFDVPEPNESTEFDSFI--DTSP-YSQGHQLKIPTPSGIVKKLQ  475

Query  1545  DLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQD  1712
             DLA+ K    + QE VG EE     YG TL KD+S  +P SW+ AD S+FLIRG+ YL+D
Sbjct  476   DLAINKKGYMDLQE-VGLEESNTFFYGATLHKDSSLTLPCSWSTADASTFLIRGDSYLED  534

Query  1713  HSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATR  1892
               K+ + GTL Q++GADW+ S+ RED+L  R G +VQ+YAA+  PEFFFVVNIQVPG+  
Sbjct  535   RQKVKANGTLMQMIGADWISSDKREDDLGGRLGGLVQEYAAKGSPEFFFVVNIQVPGSAM  594

Query  1893  YSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQ  2072
             YSLALYYMLKTPL E+PLL+ FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVGKK+CL+GQ
Sbjct  595   YSLALYYMLKTPLEEHPLLQSFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGKKACLVGQ  654

Query  2073  SLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLL  2252
             +LE+ Y +G+NYLELDVDVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T EELPE L+
Sbjct  655   ALEVRYTRGKNYLELDVDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTAEELPELLI  714

Query  2253  GTCRLNHLDASKAV  2294
             GTCRLN+LD SK+V
Sbjct  715   GTCRLNYLDVSKSV  728



>ref|XP_002876269.1| hypothetical protein ARALYDRAFT_485890 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52528.1| hypothetical protein ARALYDRAFT_485890 [Arabidopsis lyrata subsp. 
lyrata]
Length=732

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/741 (59%), Positives = 539/741 (73%), Gaps = 46/741 (6%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLY IR NR GLQ+ RKRYF+L +N L S+K+VP    EEP R A +D
Sbjct  1     MGVSQTDGRMEGWLYTIRHNRFGLQFSRKRYFVLLENNLTSFKSVPSDHNEEPERRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN  533
              CI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA+   +K 
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDAS---QKG  117

Query  534   LRAPAIR-----KWQPFRLSVSSRMARTDA-------------SSTPVDAMTS-DVIGPC  656
              + P        +    +L VS R  R ++             +S  V+ + + DVI P 
Sbjct  118   FQFPDCEFVSHAEKGLVKLDVSKRNRRKNSVDWTNYSSTNYSSTSLNVETVVAHDVIAPS  177

Query  657   PWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEW  836
             PWKIFG QNGLR+FKEAKD +  G+HWD HPAIMAVGVIDGTSE IF  LMSLGP RSEW
Sbjct  178   PWKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEW  237

Query  837   DFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVI  1016
             DFCF +GSVVEHLDGHTDII++QL + WLPWG+ RRDLLLRRYWRRE+DGTYVIL HSV 
Sbjct  238   DFCFYKGSVVEHLDGHTDIINLQLYSDWLPWGMNRRDLLLRRYWRREEDGTYVILCHSVY  297

Query  1017  HSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDM  1187
             H  CPP++GYVRA VKSGG+V+TP N GK S VKHM+++DW+S   Y+R ++++S+TI +
Sbjct  298   HKNCPPKKGYVRACVKSGGYVVTPANNGKQSLVKHMVAIDWRSWNLYMRPSSARSITIRV  357

Query  1188  LGGIAALREMFKAKSGSYFPDPAMNEL--------TIDIQLPVSEKEEIKNEVVATERIE  1343
             +  +AALREMFKAK G+ F D    E          I+ +   +E +E+  E V  E ++
Sbjct  358   VERVAALREMFKAKQGNGFTDFVSGEFLDTKPCLSKINTRPLKTEAKEVDLETVKAEEMD  417

Query  1344  EDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAA  1523
             + T     SA +S+++L+D +DEFFDVPE ++    D     S   + H+    K+ + A
Sbjct  418   KPT-----SARNSLMDLNDASDEFFDVPEPNESTEFDSFIDTSPYSQGHQL---KIPTPA  469

Query  1524  CFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIR  1691
               V+KLQDLA+ K    + QE VG EE     YG TL KD S  +P SW+ AD S+FLIR
Sbjct  470   GIVKKLQDLAINKKGYMDLQE-VGLEENNTFFYGATLQKDPSLTLPCSWSTADPSTFLIR  528

Query  1692  GEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNI  1871
             G  YL+D  K+ +KGTL Q+VGADW+ S+ RED+L  R G +VQ++AA+  PEFFF+VNI
Sbjct  529   GNNYLKDQQKVKAKGTLMQMVGADWISSDKREDDLGGRVGGLVQEFAAKGGPEFFFIVNI  588

Query  1872  QVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGK  2051
             QVPG+  YSLALYYMLKTPL E+PLLE FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVGK
Sbjct  589   QVPGSAMYSLALYYMLKTPLEEHPLLESFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGK  648

Query  2052  KSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEE  2231
             K+CL+GQ+LE+ Y +G+NYLELD+DVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T E
Sbjct  649   KACLVGQALEVRYTRGKNYLELDIDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTAE  708

Query  2232  ELPEHLLGTCRLNHLDASKAV  2294
             ELPE LLGTCRLN+LD SK+V
Sbjct  709   ELPELLLGTCRLNYLDVSKSV  729



>ref|XP_010504305.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
 ref|XP_010504306.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
Length=734

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/737 (59%), Positives = 535/737 (73%), Gaps = 36/737 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLY IR NR GLQ+ RKRYF+L DN L S+K+VP    EEP R A +D
Sbjct  1     MGVSQTDGRMEGWLYTIRHNRFGLQFSRKRYFLLVDNTLTSFKSVPSDHNEEPDRRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN--PE  527
              CI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA+    P 
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHVDQLKLGASSPEEAAKWIRSLQDASQKGFPI  120

Query  528   KNLRAPAIRKWQPFRLSVSSRMAR------TDASSTP------------VDAMTSDVIGP  653
              +    +  +    +L VS R  R      T+ SST             V+ + SDVI P
Sbjct  121   PDCEFVSHAEKGLVKLDVSKRTRRKNSVDWTNYSSTNHSSTNYSSSSLNVETVASDVIAP  180

Query  654   CPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSE  833
              PWKIFG QNGLR+FKEAKD +  G+HW+ H AIMAVGVI+GTSE IF  LMSLGP RSE
Sbjct  181   SPWKIFGCQNGLRLFKEAKDWDSRGRHWEDHAAIMAVGVIEGTSEDIFNTLMSLGPLRSE  240

Query  834   WDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSV  1013
             WDFCF +GSVVEHLDGHT II+MQL + WLPWG+ RRDLLLRRYWRRE+DGTYVIL HSV
Sbjct  241   WDFCFYKGSVVEHLDGHTYIINMQLYSDWLPWGMNRRDLLLRRYWRREEDGTYVILCHSV  300

Query  1014  IHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTID  1184
              H KCPP+ GYVRA VKSGG+V+TPVN+GK S VKHM+++DW+S   Y+R ++++S+TI 
Sbjct  301   YHKKCPPKRGYVRACVKSGGYVVTPVNKGKHSLVKHMVAIDWRSWNLYMRPSSARSITIR  360

Query  1185  MLGGIAALREMFKAKSGSYFPDPAMNELTIDI-QLPVSEKEEIKNEV--VATERIEEDTT  1355
             ++  +AALREMFKA+ G  F +    E  +    L     + +K E   V  E ++ D  
Sbjct  361   VVERVAALREMFKARQGHSFSEFVSGEFMVTKPSLSKINIKPLKTEAKDVYQETMKADEM  420

Query  1356  EKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVR  1535
             +K  SA +S+++L+D +DEFFDVPE ++    D     S   + H+ P P     +  V+
Sbjct  421   DKPSSARNSLMDLNDASDEFFDVPEPNESTEFDSFIDTSPYSQGHQIPTP-----SGIVK  475

Query  1536  KLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKY  1703
             KLQDLA+ K    + QE VG EE     YG TL KD+S  +P SW+ AD S+FLIRG+ Y
Sbjct  476   KLQDLAINKKGYMDLQE-VGLEENNTFFYGATLHKDSSLTLPCSWSTADASTFLIRGDSY  534

Query  1704  LQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPG  1883
             L+D  K+ + GTL Q++GADW+ S+ RED+L  R G +VQ+YAA+  PEFFFVVNIQVPG
Sbjct  535   LEDRQKVKANGTLMQMIGADWISSDKREDDLGGRLGGLVQEYAAKGSPEFFFVVNIQVPG  594

Query  1884  ATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCL  2063
             +  YSLALYYMLKTPL E+PLL+ FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVGKK+CL
Sbjct  595   SAMYSLALYYMLKTPLEEHPLLQSFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGKKACL  654

Query  2064  IGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPE  2243
             +GQ+LE+ Y + +NYLELDVDVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T EELPE
Sbjct  655   VGQALEVRYTRCKNYLELDVDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTAEELPE  714

Query  2244  HLLGTCRLNHLDASKAV  2294
              L+GTCRLN+LD SK+V
Sbjct  715   LLIGTCRLNYLDVSKSV  731



>ref|XP_010427199.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
 ref|XP_010427200.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
Length=736

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/737 (58%), Positives = 538/737 (73%), Gaps = 34/737 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLY IR NR GLQ+ RKRYF+L DN L S+K+VP    EEP R A +D
Sbjct  1     MGVSQTDGRMEGWLYTIRHNRFGLQFSRKRYFLLVDNTLTSFKSVPSDHNEEPDRRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN--PE  527
              CI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA+    P 
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDASQKGFPL  120

Query  528   KNLRAPAIRKWQPFRLSVSSRMAR------TDASSTP------------VDAMTSDVIGP  653
              +    +  +    +L VS R  R      T+ SST             V+ + SDVI P
Sbjct  121   PDCEFVSHAEKGLVKLDVSKRSRRKISVDWTNYSSTNHSSTNYSSSSLNVETVASDVIAP  180

Query  654   CPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSE  833
              PWKIFG QNGLR+FKEAKD +  G+HW+ H AIMAVGVI+GTSE IF  LMSLGP RSE
Sbjct  181   SPWKIFGCQNGLRLFKEAKDWDSRGRHWEDHAAIMAVGVIEGTSEDIFNTLMSLGPLRSE  240

Query  834   WDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSV  1013
             WDFCF +GSVVEHLDGHTDII++QL + WLPWGL RRDLLLRRYWRRE+DGTYVIL HSV
Sbjct  241   WDFCFYKGSVVEHLDGHTDIINLQLYSDWLPWGLNRRDLLLRRYWRREEDGTYVILCHSV  300

Query  1014  IHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTID  1184
              H KCPP++GYVRA VKSGG+V+TPVN+GK S VKHM+++DW+S   Y+R ++++S+TI 
Sbjct  301   YHKKCPPKKGYVRACVKSGGYVVTPVNKGKHSLVKHMVAIDWRSWNLYMRPSSARSITIR  360

Query  1185  MLGGIAALREMFKAKSGSYFPDPAMNELTIDIQ-LPVSEKEEIKNEV--VATERIEEDTT  1355
             ++  +AALREMFKA+ G  F +    E  +    LP      +K E   V  E ++ D  
Sbjct  361   VVERVAALREMFKARQGHSFSEFVSGEFMVTKPCLPKINTYPLKTEAKDVYQETMKADEM  420

Query  1356  EKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVR  1535
             +K  SA +S+++L+D +DEFFDVPE ++    D     S   + H+    K+ + +  V+
Sbjct  421   DKPSSARNSLMDLNDASDEFFDVPEPNESTEFDSFIDTSPYTQGHQL---KIPTPSGIVK  477

Query  1536  KLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKY  1703
             KLQDLA+ K    + QE VG EE     YG TL KD+S  +P +W+ AD S+FLIRG+ Y
Sbjct  478   KLQDLAINKKGYMDLQE-VGLEENNTFFYGATLQKDSSLTLPCTWSTADPSTFLIRGDSY  536

Query  1704  LQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPG  1883
             L+D  K+ + GTL Q++GADW+ S+ RED+L  R G +VQ+YAA+  PEFFF+VN+QVPG
Sbjct  537   LEDRQKVKANGTLMQMIGADWISSDKREDDLGGRLGGLVQEYAAKGSPEFFFIVNMQVPG  596

Query  1884  ATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCL  2063
             +  YSLALYYMLKTPL E+PLL+ FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVGKK+CL
Sbjct  597   SAMYSLALYYMLKTPLEEHPLLQSFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGKKACL  656

Query  2064  IGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPE  2243
             +GQ+LE+ Y +G+NYLEL VDVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T EELPE
Sbjct  657   VGQALEVRYTRGKNYLELGVDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTAEELPE  716

Query  2244  HLLGTCRLNHLDASKAV  2294
              L+GTCRLN+LD SK+V
Sbjct  717   LLIGTCRLNYLDVSKSV  733



>ref|XP_006403534.1| hypothetical protein EUTSA_v10010151mg [Eutrema salsugineum]
 gb|ESQ44987.1| hypothetical protein EUTSA_v10010151mg [Eutrema salsugineum]
Length=731

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/737 (59%), Positives = 539/737 (73%), Gaps = 39/737 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M M  +DG MEGWLY IR NR GLQ+ RKRYF+L DN L S+K+VP    EEP R A +D
Sbjct  1     MEMSQTDGRMEGWLYTIRHNRFGLQFSRKRYFVLLDNNLTSFKSVPSDHNEEPDRRATLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN--PE  527
              CI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA+    P 
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDASQKGFPF  120

Query  528   KNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDA------MTSDVIGPCPWKIF  671
              +    +  +    +L VS R  R      T+ SS  V+       +  DVI P PWKIF
Sbjct  121   PDCEFVSHAEKGLVKLDVSKRSRRKNSVDWTNYSSLSVETTIAPTTIAPDVIAPSPWKIF  180

Query  672   GIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFC  851
             G QNGLR+FKEAKD +  G+HWD HPAIMAVGVIDGTSE IF  LMSLGP RSEWDFCF 
Sbjct  181   GCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEWDFCFY  240

Query  852   RGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCP  1031
             +G+VVEHLDGHTDII++QL + WLPWG+ RRDLLLRRYWRRE+DGTYVIL HSV H KCP
Sbjct  241   KGTVVEHLDGHTDIINIQLYSDWLPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKKCP  300

Query  1032  PQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIA  1202
             P+ GYVRA VKSGG+V+TPVN+GK S VKHM+++DW+S   Y+R ++++S+TI ++  +A
Sbjct  301   PKRGYVRACVKSGGYVVTPVNKGKQSLVKHMVAIDWRSWNLYMRSSSARSITIRVVERLA  360

Query  1203  ALREMFKAKSGSYFPDPAMNELT--------IDIQLPVSEKEEIKNEVVATERIEEDTTE  1358
             ALREMFKAK G  F +    E          I+ +    E + I  ++V  E +E     
Sbjct  361   ALREMFKAKQGHGFTEFVSGEFMEANSCLSKINTRPLKPEAKRIDLDLVKAEEME-----  415

Query  1359  KYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETP-RPKLSSAACFVR  1535
             K  SA +S+++L+D +DEFFDVPE ++    D+   +S+   + + P + K+ S A FV+
Sbjct  416   KPSSARNSLMDLNDASDEFFDVPEPNESTEFDNLIDKSS---FSQGPSQLKIPSPAGFVK  472

Query  1536  KLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKY  1703
             KLQDLA+ K    + QE V  +E     YG TL KD +  +P SWA AD S+FLIRG+ Y
Sbjct  473   KLQDLAINKKGYMDLQE-VAIDEKTTFFYGATLQKDPNLTLPCSWAIADPSTFLIRGDNY  531

Query  1704  LQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPG  1883
             L+D  K+ +KGTL Q++GADW+ S  RED+L  R G +VQ++A +  PEFFF+VNIQVPG
Sbjct  532   LKDQQKVKAKGTLMQMIGADWISSNKREDDLGGRLGGLVQEFAEKGGPEFFFIVNIQVPG  591

Query  1884  ATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCL  2063
             +  YSLALYYMLKTPL E+PLL+ FV+GDDA+RNS+FKLIP+ISKGSWIVKQSVGKK+CL
Sbjct  592   SAMYSLALYYMLKTPLEEHPLLQSFVDGDDAYRNSRFKLIPHISKGSWIVKQSVGKKACL  651

Query  2064  IGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPE  2243
             +GQ+LE+ Y +G+NYLELD+DVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T EELPE
Sbjct  652   VGQALEVRYTRGKNYLELDIDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTAEELPE  711

Query  2244  HLLGTCRLNHLDASKAV  2294
              LLGTCRLN+LD SK+V
Sbjct  712   LLLGTCRLNYLDVSKSV  728



>emb|CDY07523.1| BnaC06g15410D [Brassica napus]
Length=722

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/731 (59%), Positives = 532/731 (73%), Gaps = 34/731 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M M  +DG MEGWLY IR NR GLQ+ RKRYF+L DN LKS+++VP    EEP R A +D
Sbjct  1     MEMSQTDGRMEGWLYTIRHNRFGLQFSRKRYFLLLDNNLKSFRSVPSDHNEEPDRRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN--PE  527
              CI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA+    P 
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDASQKGFPF  120

Query  528   KNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGL  689
              +    +  +    +L +S R  R      T+ SS  V+ +  DVI P PWKIFG QNGL
Sbjct  121   PDCEFVSHAEKGLVKLDLSKRTRRKVSVDWTNYSSLNVETIAPDVIAPSPWKIFGCQNGL  180

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEAKD +  GKHWD HPA+MAVGVIDGTSE IF  LMSL P RSEWDFCF +GSVVE
Sbjct  181   RLFKEAKDWDSRGKHWDDHPAVMAVGVIDGTSEDIFNTLMSLDPLRSEWDFCFYKGSVVE  240

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDII++QL + WLPWG+ RRDLLLRRYWRRE+DGTYVIL HSV H KCPP+ GYV
Sbjct  241   HLDGHTDIINVQLYSDWLPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKKCPPRRGYV  300

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMF  1220
             RA VKSGG+V+ PV++GK S VKHM+++DW+S   Y+R ++S+S+TI ++  +AALREMF
Sbjct  301   RACVKSGGYVVAPVSKGKQSLVKHMVAIDWRSWNLYMRPSSSRSITIRVVERLAALREMF  360

Query  1221  KAKSGSYFPDPAMNEL--------TIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSAC  1376
             KAK G  F +    E          ++I+  ++E + +  E+V     + D  EK  SA 
Sbjct  361   KAKQGHGFAEFVSGEFLETKSCLSKVNIRPLITEAKRVDLELV-----KADEMEKPSSAR  415

Query  1377  SSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAV  1556
              S+++L++V+DEFFDVPE S+ +      P S      + P P     A  V+KLQDLA 
Sbjct  416   HSLMDLNNVSDEFFDVPEPSEFDSLIDNSPFSQGHSQLKIPSP-----AGIVKKLQDLAN  470

Query  1557  QK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKI  1724
              K    + QE VG ++ +   YG TL KD +  MP SWA AD S+FLIRGE YL+D  K+
Sbjct  471   NKKGYMDLQE-VGMDDKSTFFYGATLQKDPNLTMPCSWATADPSTFLIRGENYLKDRQKV  529

Query  1725  TSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLA  1904
              +  TL Q++GADW+ S  RED+L  R G +VQ+YAA+  PEFFF+VN+QVPG+  YSLA
Sbjct  530   KANETLMQMIGADWISSNKREDDLGGRLGGLVQEYAAKGGPEFFFIVNMQVPGSAMYSLA  589

Query  1905  LYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEM  2084
             LYYMLKTPL E+PL+E FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVGKK+CL+GQ+LE+
Sbjct  590   LYYMLKTPLEEHPLIESFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGKKACLVGQALEV  649

Query  2085  NYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCR  2264
              Y +G+NY ELDVDVGSSTVARGV NLVLGYL NLVIEMAFL+QA+TE ELPE LLGTCR
Sbjct  650   RYTRGKNYFELDVDVGSSTVARGVTNLVLGYLTNLVIEMAFLIQANTENELPELLLGTCR  709

Query  2265  LNHLDASKAVH  2297
             LN+LD SK+V 
Sbjct  710   LNYLDVSKSVQ  720



>ref|XP_009400818.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=748

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/730 (59%), Positives = 530/730 (73%), Gaps = 29/730 (4%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             +D  MEGWLYL+R NRLGLQY RKRYF+L  N L  +K  P +  EEP RSA++DS I +
Sbjct  9     ADRRMEGWLYLVRHNRLGLQYSRKRYFVLRGNALDCFKTAPTSNGEEPSRSAVVDSSIRI  68

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----NPEKNL  536
              DNGR+  HR V + FTL N SNH DQLK GA S EEAARWIR L +AA+    N E+N+
Sbjct  69    TDNGRDILHRNVLYIFTLYNASNHKDQLKLGARSSEEAARWIRSLMEAALKEGPNKEENV  128

Query  537   RAPAIRKWQPFRLSVSSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEA  707
              + + R+++  R S  S+    D    +S   D M SDVI P PW I G +NGLR+FKEA
Sbjct  129   VSRSKRRFRMIRRSGRSQKRSVDWTVFTSVLADPMASDVIAPSPWTIVGCRNGLRLFKEA  188

Query  708   KDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHT  887
             +D +  G + D HPA+MAVGVID +SEAIFK +MSLG SRSEWDFC   G+VVEH+DGHT
Sbjct  189   RDADSRGMYRDDHPALMAVGVIDASSEAIFKRVMSLGSSRSEWDFCLLEGNVVEHVDGHT  248

Query  888   DIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKS  1067
             DIIH +L   WLPW +KRRDLLLRRYWRREDDGTYVILYHSV H KCP + GYVRA +KS
Sbjct  249   DIIHKKLCGDWLPWRMKRRDLLLRRYWRREDDGTYVILYHSVFHQKCPSKRGYVRACLKS  308

Query  1068  GGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS  1238
             GG+VI+PV+QGK S VKHML+VDWK   SY   +++K +TI MLG +AALRE F+AK GS
Sbjct  309   GGYVISPVSQGKQSVVKHMLAVDWKFWKSYFFTSSAKYITIRMLGRVAALREFFRAKLGS  368

Query  1239  YF-PDPAMNELTIDIQLPVSEKEEIKNEVVATER---IEE--DTTEKYPS----ACSSIV  1388
                 D + +E T +I+L  SEKE++K EV + +    IE+  D T++ P+    A  S +
Sbjct  369   RACSDLSSSESTREIELQQSEKEQMKLEVHSADENDNIEDSADETQRSPTKIAKASGSFL  428

Query  1389  ELDDVADEFFDVPEASDDEHSDHGWPRS---TTPEY-HETPRPKLSSAACFVRKLQDLAV  1556
             +++D ADEFFDV    + + ++  WP       P+   +    KLS+AA FV+KL D+AV
Sbjct  429   QMNDAADEFFDVINEPEYDETEALWPSEEGMMQPQLVQDQHHSKLSTAAVFVKKLHDIAV  488

Query  1557  QK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKI  1724
             QK    + QE   GE      YG TLPKD + ++P SWA AD S+FLIRG+ YL DH KI
Sbjct  489   QKKGYIDLQEASLGE-SVPCSYGLTLPKDLNCSLPSSWAMADPSTFLIRGKSYLHDHQKI  547

Query  1725  TSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLA  1904
              + GTL Q+V ADWL S+ RED+L  RPG IVQKY+AQ   EFFF+++IQVPG+T YSLA
Sbjct  548   KANGTLMQMVAADWLNSDKREDDLGGRPGGIVQKYSAQGGSEFFFIIHIQVPGSTTYSLA  607

Query  1905  LYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEM  2084
              YYM+  PL   PLLERFV GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+L +
Sbjct  608   FYYMMDCPLESVPLLERFVKGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALHI  667

Query  2085  NYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCR  2264
             NYF G NY+EL +D+GSSTVARGV++LVLGYL+NLVIEMAFL+Q +TEEELPE LLGTCR
Sbjct  668   NYFCGCNYIELGIDIGSSTVARGVVSLVLGYLSNLVIEMAFLIQGNTEEELPEFLLGTCR  727

Query  2265  LNHLDASKAV  2294
             LNHLD SK+V
Sbjct  728   LNHLDVSKSV  737



>ref|NP_191040.2| Pleckstrin homology (PH) and lipid-binding START domain-containing 
protein [Arabidopsis thaliana]
 ref|NP_001030862.1| Pleckstrin homology (PH) and lipid-binding START domain-containing 
protein [Arabidopsis thaliana]
 dbj|BAH19994.1| AT3G54800 [Arabidopsis thaliana]
 gb|AEE79289.1| Pleckstrin homology (PH) and lipid-binding START domain-containing 
protein [Arabidopsis thaliana]
 gb|AEE79290.1| Pleckstrin homology (PH) and lipid-binding START domain-containing 
protein [Arabidopsis thaliana]
Length=733

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/742 (58%), Positives = 536/742 (72%), Gaps = 47/742 (6%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLY IR NR GLQ+ RKRYF+L +N L S+K+VP    EEP R A +D
Sbjct  1     MGVSQTDGRMEGWLYTIRHNRFGLQFSRKRYFVLHENNLTSFKSVPSDHNEEPERRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN  533
              CI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA+   +K 
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDAS---QKG  117

Query  534   LRAPAIRKWQP------FRLSVSSRMARTDA-----------SSTPVDAMTS---DVIGP  653
                P    +         +L VS R  R ++           SST ++  T+   DVI P
Sbjct  118   FPIPDCEFFVSHAEKGLVKLDVSKRNRRKNSVDWTNYSSTNYSSTSLNVETNVAPDVIAP  177

Query  654   CPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSE  833
              PWKIFG QNGLR+FKEAKD +  G+HWD HPAIMAVGVIDGTSE IF  LMSLGP RSE
Sbjct  178   SPWKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVIDGTSEDIFNTLMSLGPLRSE  237

Query  834   WDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSV  1013
             WDFCF +G+VVEHLDGHTDIIH+QL + WLPWG+ RRDLLLRRYWRREDDGTYVIL HSV
Sbjct  238   WDFCFYKGNVVEHLDGHTDIIHLQLYSDWLPWGMNRRDLLLRRYWRREDDGTYVILCHSV  297

Query  1014  IHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTID  1184
              H  CPP++GYVRA VKSGG+V+TP N GK S VKHM+++DW+S   Y+R ++++S+TI 
Sbjct  298   YHKNCPPKKGYVRACVKSGGYVVTPANNGKQSLVKHMVAIDWRSWNLYMRPSSARSITIR  357

Query  1185  MLGGIAALREMFKAKSGSYFPDPAMNEL--------TIDIQLPVSEKEEIKNEVVATERI  1340
             ++  +AALREMFKAK G  F +    E          I+     +E +E+  E +  E +
Sbjct  358   VVERVAALREMFKAKQGHGFTEFVSGEFLDTKPCLSKINTMPLKTEAKEVDLETMHAEEM  417

Query  1341  EEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSA  1520
             ++ T     SA +S+++L+D +DEFFDVPE ++    D     S   + H+    K+ + 
Sbjct  418   DKPT-----SARNSLMDLNDASDEFFDVPEPNESTEFDSFIDSSPYSQGHQL---KIPTP  469

Query  1521  ACFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLI  1688
             A  V+KLQDLA+ K    + QE VG EE     YG TL KD S  +P SW+ AD S+FLI
Sbjct  470   AGIVKKLQDLAINKKGYMDLQE-VGLEENNTFFYGATLQKDPSLTLPCSWSTADPSTFLI  528

Query  1689  RGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVN  1868
             RG  YL++  K+ +KGTL Q++GADW+ S+ RED+L  R G +VQ+YAA+  PEFFF+VN
Sbjct  529   RGNNYLKNQQKVKAKGTLMQMIGADWISSDKREDDLGGRIGGLVQEYAAKGSPEFFFIVN  588

Query  1869  IQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVG  2048
             IQVPG+  YSLALYYMLKTPL E+PLLE FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVG
Sbjct  589   IQVPGSAMYSLALYYMLKTPLEEHPLLESFVNGDDAYRNSRFKLIPHISKGSWIVKQSVG  648

Query  2049  KKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTE  2228
             KK+CL+GQ LE+ Y +G+NYLELD+DVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T 
Sbjct  649   KKACLVGQVLEVCYTRGKNYLELDIDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTV  708

Query  2229  EELPEHLLGTCRLNHLDASKAV  2294
             EELPE LLGTCRLN+LD SK+V
Sbjct  709   EELPELLLGTCRLNYLDVSKSV  730



>ref|XP_010319624.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Solanum 
lycopersicum]
Length=700

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/633 (66%), Positives = 488/633 (77%), Gaps = 17/633 (3%)
 Frame = +3

Query  456   FGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQPFRLSVSSRMAR------TDASST  617
              GA SPEEAA WI CL+DAA+N E++L AP+ RKWQPFRLSVS  +A        DAS  
Sbjct  67    LGATSPEEAANWIHCLKDAALNTERSLTAPSRRKWQPFRLSVSKSVAHKRSMDMADASFM  126

Query  618   PVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIF  797
              VDAMT DVI P PWKIFG QNGLR+FKEAKD+  NGK  DG PA+MAVGVI+GTSEAIF
Sbjct  127   HVDAMTFDVIAPSPWKIFGCQNGLRLFKEAKDKGSNGKV-DGSPAVMAVGVIEGTSEAIF  185

Query  798   KALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrE  977
             + LM LG SR EWDF F RG VVEHLDGHTDI+H+QL  HWLPWG KRRDLLLRRYWRRE
Sbjct  186   RTLMCLGQSRIEWDFSFYRGCVVEHLDGHTDIVHIQLYNHWLPWGTKRRDLLLRRYWRRE  245

Query  978   DDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SY  1148
             +DGTYVILYHSVIHSKCPPQ GYVRA +KSGGHVITP    K S VKHM+S+DWK    Y
Sbjct  246   EDGTYVILYHSVIHSKCPPQNGYVRACIKSGGHVITPTKHDKPSIVKHMISIDWKLWKPY  305

Query  1149  LRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVA  1328
             ++K  + S+TI  L  IAALREMFKAK G+YF + +   LT DI LPV EKEEIK EV  
Sbjct  306   MKKGATVSMTIRFLERIAALREMFKAKEGNYFSELSPAVLTSDIDLPVIEKEEIKIEVDY  365

Query  1329  TERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEY--HETPR  1502
                 +E   E      S++  LDD ADEF+DVPE SDDEHSD  W  + +PE    E+  
Sbjct  366   KMITDERVNEAKNPVSSNLTRLDDAADEFYDVPEPSDDEHSDLAWASNASPEVGCMESYH  425

Query  1503  PKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAAD  1670
              KL++A   V+KLQDL VQK    + QE+   +E     YG TL KD S+ +P SWAAAD
Sbjct  426   TKLTTAN-IVKKLQDLTVQKKGYMDLQEMARDQECVSFFYGATLQKDKSFGIPCSWAAAD  484

Query  1671  TSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPE  1850
              SSFLIR + YL D  K+ +K TL Q+V ADWL+S+ RED+LA+RPG IVQ+YA+Q R E
Sbjct  485   PSSFLIRADSYLADQEKVKAKSTLLQMVAADWLRSDRREDDLASRPGGIVQRYASQGRAE  544

Query  1851  FFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWI  2030
             FFF++NIQVPGAT Y+LALYYML +PL E PLLERFVNGDD+FRNS+FKLIPYISKGSWI
Sbjct  545   FFFIINIQVPGATTYNLALYYMLTSPLEETPLLERFVNGDDSFRNSRFKLIPYISKGSWI  604

Query  2031  VKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFL  2210
             VKQSVGKK+CL+GQ+LE++YF+G+NYLEL +DVGSSTVARGV++LVLGYLNNLVIEMAFL
Sbjct  605   VKQSVGKKACLVGQALEVHYFQGRNYLELGIDVGSSTVARGVVSLVLGYLNNLVIEMAFL  664

Query  2211  VQADTEEELPEHLLGTCRLNHLDASKAVHTNSI  2309
             +Q +T EELPE LLGTCRLNHLD SK++ T+S+
Sbjct  665   IQGNTPEELPEFLLGTCRLNHLDVSKSIQTDSV  697



>ref|XP_009344768.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Pyrus x bretschneideri]
Length=711

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/734 (58%), Positives = 528/734 (72%), Gaps = 54/734 (7%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLY+I  NR GLQY RKRYFIL+DNCL+S+KA P +  EEP+RSA+ID
Sbjct  1     MGISQNDGKMEGWLYIIGSNRFGLQYSRKRYFILKDNCLRSFKAKPSSDSEEPVRSAVID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             +CI   DNGR + HRK FF FTL NTSN+ DQLK GA+S EEAA+WIR L+DAA+    N
Sbjct  61    TCIRATDNGRASIHRKGFFVFTLYNTSNNSDQLKLGASSSEEAAKWIRSLQDAALKACPN  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQN  683
               ++  A +  +W  FRL  S R  R      T +S    + MTSDVI P PWKIFG QN
Sbjct  121   ATRDFVACSKSRWPSFRLVGSRRTERKNSVDWTFSSLMHTEGMTSDVIAPSPWKIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEAKD +  G+HWD HPAIMAVGV+DGTSEAIF+ L+SLGPSRSEWDFC+ RGSV
Sbjct  181   GLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFRTLLSLGPSRSEWDFCYYRGSV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VE LDGHTDIIH QL + WLPWG++RRDLL+RRYWRREDDGTY                 
Sbjct  241   VERLDGHTDIIHQQLYSDWLPWGMQRRDLLIRRYWRREDDGTY-----------------  283

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALRE  1214
                     GG VITP NQGK S V+HML++DWK    YLR ++++ +TI ML  +AALRE
Sbjct  284   -------GGGFVITPANQGKQSLVRHMLAIDWKFWKLYLRPSSARCITIRMLERVAALRE  336

Query  1215  MFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIE--------EDTTEKYPS  1370
             +F+AK+G+  P+ +  +++ +I+   S ++ IK EV     ++        ED  EK P 
Sbjct  337   LFRAKAGTSSPEFSSGDMSSEIKFSQSGQQNIKTEVQHPGEVKKMEEGVLMEDEVEK-PE  395

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETP--RPKLSSAACFVRKLQ  1544
               +S+  L D ADEFFDVPE ++ +  ++ WP   + E + T    PKLSSAA  V+KL 
Sbjct  396   GRASLKGLHDAADEFFDVPEPTEYDQFENEWPSDVSMEQNPTSIQHPKLSSAAVLVKKLH  455

Query  1545  DLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQD  1712
             +L VQK    + QE+   +E +   YG TL KD S  +P SW +AD SSFLIRG  YL+D
Sbjct  456   ELRVQKKGYMDLQEV--SKEDSVCPYGATLQKDPSCALPCSWGSADPSSFLIRGPNYLRD  513

Query  1713  HSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATR  1892
               KI +K TL Q+VG DWL+S+ RED+L +R GSIVQK A +   EFFF+VNIQVPG T 
Sbjct  514   RQKIKAKSTLMQLVGVDWLRSDKREDDLGSRYGSIVQKSAERGGSEFFFIVNIQVPGTTM  573

Query  1893  YSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQ  2072
             Y+LA YYM+KTPL E PLL  FVNGDD++RNS+FKLIPYISKGSWIVKQ VG+K+CL+GQ
Sbjct  574   YTLAFYYMIKTPLEETPLLHDFVNGDDSYRNSRFKLIPYISKGSWIVKQRVGEKACLVGQ  633

Query  2073  SLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLL  2252
             +LE++YF+G+NYLEL VDVGSSTVARGV+NLVLGYLNNLVIEMAFL+QA+TEEELPE LL
Sbjct  634   ALEVHYFRGKNYLELGVDVGSSTVARGVVNLVLGYLNNLVIEMAFLIQANTEEELPEMLL  693

Query  2253  GTCRLNHLDASKAV  2294
             GTCR+N LDASK+V
Sbjct  694   GTCRINQLDASKSV  707



>ref|XP_009116156.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Brassica 
rapa]
 ref|XP_009116157.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Brassica 
rapa]
Length=722

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/727 (59%), Positives = 533/727 (73%), Gaps = 28/727 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M M  +DG MEGWLY IR NR GLQ+ RKRYF+L D+ LKS+++VP    EEP R A +D
Sbjct  1     MEMSQTDGRMEGWLYTIRHNRFGLQFSRKRYFVLLDDNLKSFRSVPSDQNEEPYRRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----  521
              CI V DNGRE+F+RKV F FTL NT+NH DQLK GA+SPEEAA+WIR L+DA+      
Sbjct  61    CCIRVTDNGRESFNRKVLFIFTLYNTTNHLDQLKLGASSPEEAAKWIRSLQDASQKKFPF  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR----TDASSTPVDAMTSDVIGPCPWKIFGIQNGL  689
             P+    + A +    F +S  SR       T+ SS  V+ +  DVI P PWKIFG QNGL
Sbjct  121   PDCEFVSHAEKGLVKFNVSRRSRRKNSVDWTNYSSLNVETIAPDVIAPSPWKIFGCQNGL  180

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEAKD +  G+HWD HPAIMAVGVIDGTSE IF  LMS GP RSEWDF F +GSVVE
Sbjct  181   RLFKEAKDWDSRGRHWDDHPAIMAVGVIDGTSENIFNTLMSFGPLRSEWDFSFYKGSVVE  240

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDII++QL + WLPWG+ RRDLLLRRYWRRE+DGTYVIL HSV H  CPP++GYV
Sbjct  241   HLDGHTDIINVQLYSDWLPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKDCPPKKGYV  300

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMF  1220
             RA VKSGG+V+TPVN+ K S VKHM+++DW+S   Y   ++S+S+TI ++  +AALREMF
Sbjct  301   RACVKSGGYVVTPVNKAKQSLVKHMVAIDWRSWNLYTGASSSRSITIRVVERLAALREMF  360

Query  1221  KAKSGSYFPDPAMNELTIDIQLPVSEKE----EIKNEVVATERIEEDTTEKYPSACSSIV  1388
             KAK G  F +    E  +D +  VS       +I  + V  E ++ +  EK  SA +S++
Sbjct  361   KAKQGHGFTEFVSGEF-MDTKSCVSNINTGPLKIAAKRVDLELVKAEDMEKPSSARNSLM  419

Query  1389  ELDDVADEFFDVPEASD-DEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK-  1562
             +L+D +DEFFDVPE S+ D   D+      +P      + K+ S A  V+KLQDLA+ K 
Sbjct  420   DLNDASDEFFDVPEPSEFDSFIDN------SPISQGHSQLKIPSPAGIVKKLQDLAINKK  473

Query  1563  ---NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSK  1733
                + QE VG +E     YG TL KD +  +P SWA AD S+FLIRGE YLQD  K+ +K
Sbjct  474   GYMDLQE-VGMDEKTTFFYGATLQKDPNLTLPCSWATADPSTFLIRGENYLQDQQKVKAK  532

Query  1734  GTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYY  1913
              T+ Q++GADW+ S+ RED+L  R G +VQ++AA+  PEFFF+VN+Q PG+  YSLALYY
Sbjct  533   DTMMQMIGADWISSDKREDDLGGRLGGVVQEFAAKGGPEFFFIVNMQAPGSAMYSLALYY  592

Query  1914  MLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYF  2093
             MLKTPL ++PLL  FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVGKK+CL+GQ+L + Y 
Sbjct  593   MLKTPLEDHPLLHSFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGKKACLVGQALVVRYT  652

Query  2094  KGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNH  2273
             +G+NYLELD+DVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T EELPE LLGTCRLN+
Sbjct  653   RGKNYLELDIDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTVEELPELLLGTCRLNY  712

Query  2274  LDASKAV  2294
             LDASK+V
Sbjct  713   LDASKSV  719



>ref|XP_010689525.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=727

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/716 (59%), Positives = 523/716 (73%), Gaps = 20/716 (3%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             +EGWLY+I  NR GLQ   KRYFILED+  K YK++P +  E P++S  +DSCI V D+G
Sbjct  10    IEGWLYVISSNRFGLQSSSKRYFILEDHHFKCYKSIPNSQNEPPVKSTTVDSCIRVADDG  69

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAA-----INPEKNLRAP  545
             RE+ HRKVFFTFTL N+SNH DQ+K GA+SPE AARWI   ++A      I     L  P
Sbjct  70    RESIHRKVFFTFTLYNSSNHSDQIKLGASSPEVAARWIHFFQEAVTKVCPIGGSSGLGCP  129

Query  546   AIRKWQPFRLSVSSRMARTD------ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEA  707
                 WQ FRLS S R+  +       ASS+ +D +T+DV+ P  W+IFG QNGLR+FKEA
Sbjct  130   H-NAWQCFRLSSSKRIHHSSSTSWVTASSSQMDFITTDVVAPSSWRIFGCQNGLRVFKEA  188

Query  708   KDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHT  887
             KD + +GK WD HPAIMAVGV+DGTSE IF+A+MSLGPSRS+WD+ F RGSVVE+LDGHT
Sbjct  189   KDGDFHGKQWDDHPAIMAVGVVDGTSENIFRAVMSLGPSRSQWDYSFYRGSVVENLDGHT  248

Query  888   DIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKS  1067
             DIIH QL  +WLPWG+++RDLLLRRYWRR+DDGTYVILYHSV H KC PQ+GY+RA +KS
Sbjct  249   DIIHKQLCAYWLPWGVQQRDLLLRRYWRRDDDGTYVILYHSVYHKKCLPQKGYIRACLKS  308

Query  1068  GGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS  1238
             GG+VITP+N GK S VKHML++DWK   +YL  + ++S TI MLG IAALRE+FKAK+G 
Sbjct  309   GGYVITPLNHGKQSVVKHMLAIDWKLWAAYLLPSLARSTTIRMLGKIAALRELFKAKAGD  368

Query  1239  YFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFF  1418
              F   +  +           K EI    V  +   E+   +  S   S+ EL+DV+DEFF
Sbjct  369   CFSSNSFGDQPFGHASQNENKPEIYPHAVDGKENLEEKELEKLSEHGSLAELNDVSDEFF  428

Query  1419  DVPEASDDEHSDHGWPRSTTPEYH-ETPRPKLSSAACFVRKLQDLAV-QKNFQEIV--GG  1586
             D PE SD +  D+GWP    PE + +  R K S+AA FV+KL  LAV +K + ++V    
Sbjct  429   DAPEGSDFDPPDYGWPSDCGPETNLQDARSKRSTAAVFVKKLHGLAVHKKGYVDLVEIAA  488

Query  1587  EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADW  1766
             +EG   CYG TL KD +  +  SW   D S+FLIRG+ YL D  KI +  TL ++V ADW
Sbjct  489   KEGISCCYGTTLAKDPTCTIASSWTTTDPSTFLIRGKTYLMDSQKIKANHTLMKMVAADW  548

Query  1767  LQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPL  1946
             + S+ RED+L  RPGSIVQ YAA+   EFFF+VNIQVPG+  Y+LALYYM  + L + PL
Sbjct  549   ITSDRREDDLGGRPGSIVQNYAAKGGSEFFFIVNIQVPGSKTYNLALYYM-TSNLEDAPL  607

Query  1947  LERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVD  2126
             L+ FV+ DDA+RNS+FKLIPYISKG WIVKQSVGKK+CL GQ+LE+NYF G+NY+EL +D
Sbjct  608   LQNFVDRDDAYRNSRFKLIPYISKGPWIVKQSVGKKACLAGQALEINYFCGKNYIELGID  667

Query  2127  VGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             +GSSTVARGV++LVLGYLNNLVIEMAFL+QA+TEEELPE LLGTCRLNHLDASKAV
Sbjct  668   IGSSTVARGVVSLVLGYLNNLVIEMAFLIQANTEEELPEQLLGTCRLNHLDASKAV  723



>emb|CDY02892.1| BnaC04g25940D [Brassica napus]
Length=725

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/730 (59%), Positives = 529/730 (72%), Gaps = 31/730 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M MP  DG MEGWLY IR NR GLQ+ RKRYF+L DN L S+K+VP    EEP R A +D
Sbjct  1     MEMPQIDGRMEGWLYTIRHNRFGLQFSRKRYFVLHDNNLTSFKSVPSDQNEEPDRRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----  521
              CI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA+      
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDASQKKFPF  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR----TDASSTPVDAMTSDVIGPCPWKIFGIQNGL  689
             P+    + A +    F +S  SR       T+ SS  V+ +  DVI P PWKIFG QNGL
Sbjct  121   PDCEFVSHAEKGLVKFNVSRRSRRKNSVDWTNYSSVNVETIAPDVIAPSPWKIFGCQNGL  180

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEAKD +  G+HWD HPAIMAVGVIDGTSE IF  LMSLGP RSEWDFCF +GSVVE
Sbjct  181   RLFKEAKDWDSRGRHWDDHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEWDFCFYKGSVVE  240

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDI+++QL + WLPW + RRD+LLRRYWRRE+DGTYVIL HSV H KCPP +GYV
Sbjct  241   HLDGHTDIVNIQLYSDWLPWLMNRRDVLLRRYWRREEDGTYVILCHSVYHKKCPPTKGYV  300

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMF  1220
             RA +KSGG+V+TPVN+GK S VKHM+++DW+S   Y+R ++ +S+TI ++  +AALREMF
Sbjct  301   RACLKSGGYVVTPVNKGKQSLVKHMVAIDWRSWNLYMRPSSERSITIRVVERLAALREMF  360

Query  1221  KAKSGSYFPDPAMNE-------LTIDIQLPVS-EKEEIKNEVVATERIEEDTTEKYPSAC  1376
             KAK G  F +    E       L+    LP   E + I  E+V  E +E     K  SA 
Sbjct  361   KAKQGHGFAEFVSGEFMQTKSSLSKINTLPFKKEAKRIDLELVKVEEME-----KPSSAR  415

Query  1377  SSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAV  1556
             +S+++L+D +DEFFDVPE ++    D     S   + H   + KL S +  V+KLQDLA 
Sbjct  416   NSLMDLNDASDEFFDVPEPNESYEFDSLIENSPFSQGHS--QLKLPSPSGIVKKLQDLAN  473

Query  1557  QK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKI  1724
              K    + QE VG +  +   YG TL +D +  MP SW+ AD S+FLIRG+ YL D  K+
Sbjct  474   NKKGYMDLQE-VGMDVNSTFIYGATLQQDPNLTMPCSWSIADPSTFLIRGDNYLNDQQKV  532

Query  1725  TSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLA  1904
              + GT+ Q+VGADW+ S+ RED+L  R G +VQ++ A+  PEFFF+VN+QVPG+   SLA
Sbjct  533   KANGTMMQMVGADWISSDKREDDLGGRLGGLVQEFGAKGGPEFFFIVNMQVPGSAMISLA  592

Query  1905  LYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEM  2084
             LYYMLKTPL E+PLL  FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVGKK+CL+G +LE+
Sbjct  593   LYYMLKTPLEEHPLLHSFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGKKACLVGHALEV  652

Query  2085  NYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCR  2264
              Y +G+NYLELD+DVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T EELPE LLGTCR
Sbjct  653   RYTRGKNYLELDIDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTAEELPELLLGTCR  712

Query  2265  LNHLDASKAV  2294
             LN+LD SK++
Sbjct  713   LNYLDVSKSL  722



>ref|XP_003597260.1| hypothetical protein MTR_2g094620 [Medicago truncatula]
Length=800

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/784 (56%), Positives = 540/784 (69%), Gaps = 89/784 (11%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQ+ RKRYF+L D+ L+S+K++P +  ++P+RSAI+DSCI V DNG
Sbjct  16    MEGWLYLIRCNRFGLQFSRKRYFVLHDHLLRSFKSIPNSTDQDPVRSAIVDSCIRVMDNG  75

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW  560
             RE+ +RKVFF FTL NTS+H+DQLK GA+ PEEAARWI+   +A++         + R+W
Sbjct  76    RESINRKVFFIFTLYNTSDHNDQLKLGASRPEEAARWIQSFNEASLKGAPEAIGCSKRRW  135

Query  561   QPFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNG------------------  686
             Q F L  SS  +R+   S      +SDVI P  W IFG QNG                  
Sbjct  136   QSFSLRGSS--SRSQQYSIDWTLSSSDVIAPSTWTIFGCQNGKSLFHYNQNLAKTWTNVY  193

Query  687   -----LRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFC  851
                  LR+F+EAKDR   GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF 
Sbjct  194   GCNAGLRLFREAKDRGSCGKKWDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFY  253

Query  852   RGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCP  1031
             +G+VVEHLDGHTDIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCP
Sbjct  254   KGNVVEHLDGHTDIIHKQLYSDWLPWGIKRRDLLLRRYWRREDDGTYVILYHSVFHKKCP  313

Query  1032  PQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIA  1202
              Q+GYVRA +KSGG+VI+P N GK S VKHML++DWKS   YL+ +++ S+TI MLG +A
Sbjct  314   RQKGYVRACLKSGGYVISPANMGKQSVVKHMLAIDWKSWRSYLKSSSAYSMTIQMLGRVA  373

Query  1203  ALREMFKAKSGS-YFPDPAMNELTIDIQ-LPVSEKEEIKNEVVATERIEEDT---TEKYP  1367
             ALRE+F+ + G+    D +  ELT + +  P  E      ++ A E   +++    E   
Sbjct  374   ALRELFRTRLGNCTLSDYSSGELTRNRRNSPKEEYASSDTQIQADENNHDNSIGEVEPTQ  433

Query  1368  SACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPR-PKLSSAACFVRKLQ  1544
             S  +S+V L+D  DEF+DV E S+ + S+ GW    + +  +  R  KLS+AA FVRKL 
Sbjct  434   SEHASLVSLNDADDEFYDVMEPSNCDESEKGWMTECSHQKSQDIRHQKLSTAANFVRKLH  493

Query  1545  DLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQD  1712
             DLAV K    + QE+V  EE     YG TLPKD +  +P S   AD S+FLIRGE YL+D
Sbjct  494   DLAVHKRGYMDLQEMVR-EESISCPYGSTLPKDPTCTLPCSLTEADPSTFLIRGENYLED  552

Query  1713  HSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATR  1892
             H K+ +KGTL Q+V ADWL+S+ RED+L  RPGSIVQKYAAQ  PEFFF+VNIQVPG+T 
Sbjct  553   HQKVKAKGTLMQMVAADWLRSDRREDDLGGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTT  612

Query  1893  YSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQ  2072
             YSLALYYM+ TP+ + PLL+ F+ GD+AFRNS+FKLIPYIS+GSWIVKQSVGKK+CL+GQ
Sbjct  613   YSLALYYMMNTPVEDAPLLDSFIKGDNAFRNSRFKLIPYISEGSWIVKQSVGKKACLVGQ  672

Query  2073  SLEMNYFKGQNYLE----------------------------------------------  2114
             +LE+NYF+G+NYLE                                              
Sbjct  673   ALEINYFQGKNYLEDNLHTFINSTILSWCIWNYICIGVPCGLRKKNEAKENELMGVETIC  732

Query  2115  ----LDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDA  2282
                 + VDVGSST+ARGV+NLVLGYLN+LVIEMAFL+Q +T EELPE LLGTCRLNHLDA
Sbjct  733   LKVYIGVDVGSSTIARGVVNLVLGYLNHLVIEMAFLIQGNTREELPEVLLGTCRLNHLDA  792

Query  2283  SKAV  2294
             SKAV
Sbjct  793   SKAV  796



>dbj|BAC42639.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64831.1| At3g54800 [Arabidopsis thaliana]
Length=733

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/742 (58%), Positives = 535/742 (72%), Gaps = 47/742 (6%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLY IR NR GLQ+ RKRYF+L +N L S+K+VP    EEP R A +D
Sbjct  1     MGVSQTDGRMEGWLYTIRHNRFGLQFSRKRYFVLHENNLTSFKSVPSDHNEEPERRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN  533
              CI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA+   +K 
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDAS---QKG  117

Query  534   LRAPAIRKWQP------FRLSVSSRMARTDA-----------SSTPVDAMTS---DVIGP  653
                P    +         +L VS R  R ++           SST ++  T+   DVI P
Sbjct  118   FPIPDCEFFVSHAEKGLVKLDVSKRNRRKNSVDWTNYSSTNYSSTSLNVETNVAPDVIAP  177

Query  654   CPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSE  833
              PWKIFG QNGLR+F+EAKD +  G+HWD HPAIMAVGVIDGTSE IF  LMSLGP RSE
Sbjct  178   SPWKIFGCQNGLRLFREAKDWDSRGRHWDDHPAIMAVGVIDGTSEDIFNTLMSLGPLRSE  237

Query  834   WDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSV  1013
             WDFCF +G+VVEHLDGHTDIIH+QL + WLPWG+ RRDLLLRRYWRREDDGTYVIL HSV
Sbjct  238   WDFCFYKGNVVEHLDGHTDIIHLQLYSDWLPWGMNRRDLLLRRYWRREDDGTYVILCHSV  297

Query  1014  IHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTID  1184
              H  CPP++GYVRA VKSGG+V+TP N GK S VKHM+++DW+S   Y+R ++++S+TI 
Sbjct  298   YHKNCPPKKGYVRACVKSGGYVVTPANNGKQSLVKHMVAIDWRSWNLYMRPSSARSITIR  357

Query  1185  MLGGIAALREMFKAKSGSYFPDPAMNEL--------TIDIQLPVSEKEEIKNEVVATERI  1340
             ++  +AALREMFKAK G  F +    E          I+     +E +E+  E +  E +
Sbjct  358   VVERVAALREMFKAKQGHGFTEFVSGEFLDTKPCLSKINTMPLKTEAKEVDLETMHAEEM  417

Query  1341  EEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSA  1520
             ++ T     SA +S+++L+D +DEFFDVPE ++    D     S   + H+    K+ + 
Sbjct  418   DKPT-----SARNSLMDLNDASDEFFDVPEPNESTEFDSFIDSSPYSQGHQL---KIPTP  469

Query  1521  ACFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLI  1688
             A  V+KLQDLA+ K    + QE VG EE     YG TL K  S  +P SW+ AD S+FLI
Sbjct  470   AGIVKKLQDLAINKKGYMDLQE-VGLEENNTFFYGATLQKGPSLTLPCSWSTADPSTFLI  528

Query  1689  RGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVN  1868
             RG  YL++  K+ +KGTL Q++GADW+ S+ RED+L  R G +VQ+YAA+  PEFFF+VN
Sbjct  529   RGNNYLKNQQKVKAKGTLMQMIGADWISSDKREDDLGGRIGGLVQEYAAKGSPEFFFIVN  588

Query  1869  IQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVG  2048
             IQVPG+  YSLALYYMLKTPL E+PLLE FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVG
Sbjct  589   IQVPGSAMYSLALYYMLKTPLEEHPLLESFVNGDDAYRNSRFKLIPHISKGSWIVKQSVG  648

Query  2049  KKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTE  2228
             KK+CL+GQ LE+ Y +G+NYLELD+DVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T 
Sbjct  649   KKACLVGQVLEVCYTRGKNYLELDIDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTV  708

Query  2229  EELPEHLLGTCRLNHLDASKAV  2294
             EELPE LLGTCRLN+LD SK+V
Sbjct  709   EELPELLLGTCRLNYLDVSKSV  730



>emb|CDX78263.1| BnaA09g34580D [Brassica napus]
Length=722

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/727 (59%), Positives = 533/727 (73%), Gaps = 28/727 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M M  +DG MEGWLY IR NR GLQ+ RKRYF+L D+ LKS+++VP    EEP R A +D
Sbjct  1     MEMSQTDGRMEGWLYTIRHNRFGLQFSRKRYFVLLDDNLKSFRSVPSDQNEEPYRRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----  521
              CI V DNGRE+F+RKV F FTL NT+NH DQLK GA+SPEEAA+WIR L+DA+      
Sbjct  61    CCIRVTDNGRESFNRKVLFIFTLYNTTNHLDQLKLGASSPEEAAKWIRSLQDASQKKFPF  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR----TDASSTPVDAMTSDVIGPCPWKIFGIQNGL  689
             P+    + A +    F +S  SR       T+ SS  V+ +  DVI P PWKIFG QNGL
Sbjct  121   PDCEFVSHAEKGLVKFNVSRRSRRKNSVDWTNYSSLNVETIAPDVIAPSPWKIFGCQNGL  180

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEAKD +  G+HWD HPAIMAVGVIDGTSE IF  LMS GP RSEWDF F +GSVVE
Sbjct  181   RLFKEAKDWDSRGRHWDDHPAIMAVGVIDGTSENIFNTLMSFGPLRSEWDFSFYKGSVVE  240

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDII++QL + WLPWG+ RRDLLLRRYWRRE+DGTYVIL HSV H  CPP++GYV
Sbjct  241   HLDGHTDIINVQLYSDWLPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKDCPPKKGYV  300

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMF  1220
             RA VKSGG+V+TPVN+ K S VKHM+++DW+S   Y   ++S+S+TI ++  +AALREMF
Sbjct  301   RACVKSGGYVVTPVNKAKQSLVKHMVAIDWRSWNLYTGASSSRSITIRVVERLAALREMF  360

Query  1221  KAKSGSYFPDPAMNELTIDIQLPVSEKE----EIKNEVVATERIEEDTTEKYPSACSSIV  1388
             KAK G  F +    E  +D +  VS       +I  + V  E ++ +  EK  SA +S++
Sbjct  361   KAKQGHGFTEFVSGEF-MDTKSCVSNINTGPLKIAAKRVDLELVKAEDMEKPSSARNSLM  419

Query  1389  ELDDVADEFFDVPEASD-DEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK-  1562
             +L+D +DEFFDVPE S+ D   D+      +P      + K+ S A  V+KLQDLA+ K 
Sbjct  420   DLNDASDEFFDVPEPSEFDSFIDN------SPISQGHSQLKIPSPAGIVKKLQDLAINKK  473

Query  1563  ---NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSK  1733
                + QE VG +E     YG TL KD +  +P SWA AD S+FLIRG+ YLQD  K+ +K
Sbjct  474   GYMDLQE-VGMDEKTTFFYGATLQKDPNLTLPCSWATADPSTFLIRGDNYLQDQQKVKAK  532

Query  1734  GTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYY  1913
              T+ Q++GADW+ S+ RED+L  R G +VQ++AA+  PEFFF+VN+Q PG+  YSLALYY
Sbjct  533   DTMMQMIGADWISSDKREDDLGGRLGGVVQEFAAKGGPEFFFIVNMQAPGSAMYSLALYY  592

Query  1914  MLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYF  2093
             MLKTP+ ++PLL  FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVGKK+CL+GQ+L + Y 
Sbjct  593   MLKTPIEDHPLLHSFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGKKACLVGQALVVRYT  652

Query  2094  KGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNH  2273
             +G+NYLELD+DVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T EELPE LLGTCRLN+
Sbjct  653   RGKNYLELDIDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTVEELPELLLGTCRLNY  712

Query  2274  LDASKAV  2294
             LDASK+V
Sbjct  713   LDASKSV  719



>emb|CDX73448.1| BnaC08g25550D [Brassica napus]
Length=722

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/727 (59%), Positives = 535/727 (74%), Gaps = 28/727 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M M  +DG MEGWLY IR NR GLQ+ RKRYF+L D+ LKS+++VP    EEP R A +D
Sbjct  1     MEMSQTDGRMEGWLYTIRHNRFGLQFSRKRYFVLLDDNLKSFRSVPSDQNEEPYRRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----  521
              CI V DNGRE+F+RK+ F FTL NT+NH DQLK GA+SPEEAA+WIR L+DA+      
Sbjct  61    CCIRVTDNGRESFNRKILFIFTLYNTTNHLDQLKLGASSPEEAAKWIRSLQDASQKKFPF  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR----TDASSTPVDAMTSDVIGPCPWKIFGIQNGL  689
             P+    + A +    F +S  SR       T+ SS  V+ +  DVI P PWKIFG QNGL
Sbjct  121   PDCEFVSHAEKGLVKFNVSRRSRRKNSVDWTNYSSLNVETIAPDVIAPSPWKIFGCQNGL  180

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEAKD +  G+HWD HPAIMAVGVIDGTSE IF  LMS GP RSEWDF F +GSVVE
Sbjct  181   RLFKEAKDWDSRGRHWDDHPAIMAVGVIDGTSEDIFNTLMSFGPLRSEWDFSFYKGSVVE  240

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDII++QL + WLPWG+ RRDLLLRRYWRRE+DGTYVIL HSV H +CPP++GYV
Sbjct  241   HLDGHTDIINVQLYSDWLPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKECPPKKGYV  300

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMF  1220
             RA VKSGG+V+TPVN+ K S VKHM+++DW+S   Y   ++S+S+TI ++  +AALREMF
Sbjct  301   RACVKSGGYVVTPVNKAKQSLVKHMVAIDWRSWNLYTGASSSRSITIRVVERLAALREMF  360

Query  1221  KAKSGSYFPDPAMNELTIDIQLPVSEKE----EIKNEVVATERIEEDTTEKYPSACSSIV  1388
             KAK G  F +    E  +D +  VS       +I  + V  E ++ +  EK  SA +S++
Sbjct  361   KAKQGHGFTEFVSGEF-MDTKSCVSNINTRPLKIAAKRVDLELVKAEDMEKPSSARNSLM  419

Query  1389  ELDDVADEFFDVPEASD-DEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK-  1562
             +L+D +DEFFDVPE S+ D   D+    S   + H   + K+ S A  V+KLQDLA+ K 
Sbjct  420   DLNDASDEFFDVPEPSEFDSFIDN----SLFSQGHS--QLKIPSPAGIVKKLQDLAINKK  473

Query  1563  ---NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSK  1733
                + QE VG +E     YG TL KD +  +P SWA AD S+FLIRG+ YLQD  K+ +K
Sbjct  474   GYMDLQE-VGMDEKTTFFYGATLQKDPNLTLPCSWATADPSTFLIRGDNYLQDQQKVKAK  532

Query  1734  GTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYY  1913
              T+ Q++GADW+ S+ RED+L  R G +VQ++AA+  PEFFF+VN+Q PG+  YSLALYY
Sbjct  533   DTMMQMIGADWISSDKREDDLGGRLGGVVQEFAAKGGPEFFFIVNMQAPGSAMYSLALYY  592

Query  1914  MLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYF  2093
             MLKTPL ++PLL  FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVGKK+CL+GQ+L + Y 
Sbjct  593   MLKTPLEDHPLLHSFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGKKACLVGQALVVRYT  652

Query  2094  KGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNH  2273
             +G+NYLELD+DVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T EELPE LLGTCRLN+
Sbjct  653   RGKNYLELDIDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTVEELPELLLGTCRLNY  712

Query  2274  LDASKAV  2294
             LDA+K+V
Sbjct  713   LDATKSV  719



>ref|XP_009139208.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Brassica 
rapa]
Length=725

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/730 (58%), Positives = 529/730 (72%), Gaps = 31/730 (4%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M M   DG MEGWLY IR NR GLQ+ RKRYF+L DN L S+K+VP    EEP R A +D
Sbjct  1     MEMSQIDGRMEGWLYTIRHNRFGLQFSRKRYFVLHDNNLTSFKSVPSDQNEEPDRRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----  521
              CI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA+      
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDASQKKFPF  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR----TDASSTPVDAMTSDVIGPCPWKIFGIQNGL  689
             P+    + A +    F +S  SR       T+ SS  V+ +  DVI P PWKIFG QNGL
Sbjct  121   PDCEFVSHAEKGLVKFNVSRRSRRKNSVDWTNYSSVNVETIAPDVIAPSPWKIFGCQNGL  180

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEAKD +  G+HWD HPAIMAVGVIDGTSE IF  LMSLGP RSEWDFCF +G+VVE
Sbjct  181   RLFKEAKDWDSRGRHWDDHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEWDFCFYKGTVVE  240

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDI+++QL + WLPW + RRD+LLRRYWRRE+DGTYVIL HSV H KCPP +GYV
Sbjct  241   HLDGHTDIVNIQLYSDWLPWLMNRRDVLLRRYWRREEDGTYVILCHSVYHKKCPPTKGYV  300

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMF  1220
             RA VKSGG+V+TPV++GK S VKHM+++DW+S   Y+R ++ +S+TI ++  +AALREMF
Sbjct  301   RACVKSGGYVVTPVSKGKQSLVKHMVAIDWRSWNLYMRPSSERSITIRVVERLAALREMF  360

Query  1221  KAKSGSYFPDPAMNE-------LTIDIQLPVS-EKEEIKNEVVATERIEEDTTEKYPSAC  1376
             KAK G  F +    E       L+    LP   E + I  E+V  E +E     K  SA 
Sbjct  361   KAKQGHGFAEFVSGEFMQTKSSLSKINTLPFKKEAKRIDLELVKVEEME-----KPSSAR  415

Query  1377  SSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAV  1556
             +S+++L+D +DEFFDVPE ++    D     S   + H   + KL S +  V+KLQDLA 
Sbjct  416   NSLMDLNDASDEFFDVPEPNESYEFDSLIDNSPFSQGHS--QLKLPSPSGIVKKLQDLAN  473

Query  1557  QK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKI  1724
              K    + QE VG +  +   YG TL +D +  MP SW+ AD S+FLIRG+ YL D  K+
Sbjct  474   NKKGYMDLQE-VGMDVNSTFIYGATLQQDPNLTMPCSWSIADPSTFLIRGDNYLNDQQKV  532

Query  1725  TSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLA  1904
              + GT+ Q+VGADW+ S+ RED+L  R G +VQ++AA+  PEFFF+VN+QVPG+   SLA
Sbjct  533   KANGTMMQMVGADWISSDKREDDLGGRLGGLVQEFAAKGGPEFFFIVNMQVPGSAMISLA  592

Query  1905  LYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEM  2084
             LYYMLKTPL E+PLL  FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVGKK+CL+G +LE+
Sbjct  593   LYYMLKTPLEEHPLLHSFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGKKACLVGHALEV  652

Query  2085  NYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCR  2264
              Y +G+NYLELD+DVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T EELPE LLGTCR
Sbjct  653   RYTRGKNYLELDIDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTAEELPELLLGTCR  712

Query  2265  LNHLDASKAV  2294
             LN+LD SK++
Sbjct  713   LNYLDVSKSL  722



>ref|XP_003591887.1| hypothetical protein MTR_1g094890 [Medicago truncatula]
 gb|AES62138.1| pleckstrin-like (PH) and lipid-binding START domain protein [Medicago 
truncatula]
Length=717

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/730 (58%), Positives = 527/730 (72%), Gaps = 43/730 (6%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYL+R NR    Y RKRYFIL++N L+++K  P +  EEP+RSA+IDS I V DNG
Sbjct  1     MEGWLYLVRSNRFTQHYSRKRYFILKENVLRNFKTKPTSQMEEPMRSAMIDSTIRVTDNG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----NPEKNLRAPA  548
             RE+ ++KV F FT+CNTSN  D+LK GA S EEAA+WIR  ++AA+    NP KN  A +
Sbjct  61    RESINKKVLFIFTVCNTSNQRDKLKLGARSSEEAAKWIRSFQEAAVKEYPNPAKNYVACS  120

Query  549   IRKWQPFRLSVSSRMARTD--------ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKE  704
              ++    R   S     TD         S    +AMTSDVI P  WKIFG QNGLR+FKE
Sbjct  121   KKRRSSLRYGGSKS---TDWKYSNLSFESCVYSEAMTSDVIAPSQWKIFGCQNGLRMFKE  177

Query  705   AKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGH  884
             AK  +  G+HW    AIMAVGVIDGTSEAIF  LMSL PSRSEWDFC  RG VV+H+DGH
Sbjct  178   AKSSDSRGRHWGEQSAIMAVGVIDGTSEAIFHTLMSLDPSRSEWDFCIHRGIVVDHIDGH  237

Query  885   TDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVK  1064
             TDIIH+QL   WLPWG+K RDLLL+RYWRREDDGTYV+LYHSV HSKCPP++GYVRA +K
Sbjct  238   TDIIHLQLYNDWLPWGMKPRDLLLQRYWRREDDGTYVLLYHSVYHSKCPPKKGYVRACLK  297

Query  1065  SGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSG  1235
             SGG V+TPVN+G  S V+HML++DWK    YL  ++++S+TI ML  IAALRE+++ K G
Sbjct  298   SGGFVVTPVNKGTQSVVRHMLTIDWKLWKLYLGASSTRSITIRMLERIAALRELYRTKVG  357

Query  1236  SYFPDPAMNELTIDIQLPVSE--KEEIKNEVVATER--------IEEDTTEKYPSACSSI  1385
             +Y     M   T DI LPV+   K+++K EV    +        +++   +K      S+
Sbjct  358   NYSEPITM---TKDIVLPVTVTVKKDVKIEVANENKSKIEELVEVKDQVDDKEIPGRISL  414

Query  1386  VELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK-  1562
             + L D +DEFFDVPE+++ +H D+ W      E      PK S A  FV+KLQ+LAV K 
Sbjct  415   MGLTD-SDEFFDVPESTEYDHYDNQWHSDFPSE------PKPSPAGSFVKKLQELAVHKK  467

Query  1563  ---NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSK  1733
                + QE V  EE A   YG TL KD +  +P SWA +D S FL+RGE YLQDH K+ + 
Sbjct  468   GYMDLQE-VAKEESASCSYGNTLQKDPNCTLPCSWAPSDPSLFLVRGETYLQDHQKVKAN  526

Query  1734  GTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYY  1913
              TL Q+VGADWL+   RED+L++RP SIVQKYAA+  PEFFFV++IQ+PG+  YS+ALYY
Sbjct  527   DTLMQLVGADWLRCNTREDDLSSRPSSIVQKYAAKGGPEFFFVIHIQMPGSPMYSIALYY  586

Query  1914  MLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYF  2093
             M+KTPL +NPLL  FV GDD +RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+ Y 
Sbjct  587   MMKTPLEDNPLLHSFVEGDDTYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEIRYI  646

Query  2094  KGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNH  2273
             +G+NYLELD+DVGSSTVARGV +LVLGYLNNLV+EMAFL+Q +T++ELPE L+GTCRLNH
Sbjct  647   RGKNYLELDIDVGSSTVARGVASLVLGYLNNLVVEMAFLIQGNTQDELPEVLIGTCRLNH  706

Query  2274  LDASKAVHTN  2303
             +DASKA+  N
Sbjct  707   MDASKAIGVN  716



>ref|XP_008456490.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Cucumis melo]
Length=695

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/728 (58%), Positives = 529/728 (73%), Gaps = 58/728 (8%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M  P++DG MEGWLYLIR NR GLQY +KRYF+L+D+CLKS+K+VP++  EEP +SA+ID
Sbjct  1     MGAPINDGKMEGWLYLIRSNRFGLQYSQKRYFVLQDDCLKSFKSVPVSENEEPNKSAVID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             S I V DNGRE+ HRKVFF FTL NT N +D+LK GA+SPE+AARWIR L D  +    +
Sbjct  61    SYIRVTDNGRESIHRKVFFIFTLHNTVNQNDRLKLGASSPEDAARWIRSLLDTTLKGCSD  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRM---ARTD---ASSTPVDAMTSDVIGPCPWKIFGIQN  683
             P +N R  + R++   R   S R+   A  D    SS  ++AMTSDVI P PWKIFG QN
Sbjct  121   PARNFRDRSKRQYPVLRFRGSKRIDWKASIDWIVCSSVQMEAMTSDVIAPSPWKIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKE+KD + + + WD HPAIMAVG++ GTSE IF+ LMSLG SRSEWDFCF RGS+
Sbjct  181   GLRLFKESKDNDSHRRQWDDHPAIMAVGMVCGTSEEIFRTLMSLGSSRSEWDFCFFRGSL  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEH+DGHTDIIHMQL   WLPWG+K+RD LLRRYWRREDDGTYV+LYHSV H K PPQ+G
Sbjct  241   VEHIDGHTDIIHMQLYRDWLPWGMKKRDFLLRRYWRREDDGTYVLLYHSVFHVKFPPQKG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKSYLRKTTSKSLTIDMLGGIAALREMFK  1223
             YVRA +KSGG+V+TPVNQ                                   ALRE+F+
Sbjct  301   YVRACLKSGGYVVTPVNQ-----------------------------------ALRELFR  325

Query  1224  AKSGSYFPDPAMNELTI-DIQLPVSEKEEIKNEVVATE---RIEE----DTTEKYPSACS  1379
             AK G    + + +   +   +LP S+ +EIK E+ + E   +I+E    +   + P A  
Sbjct  326   AKVGDSSSEFSSSSRDLRHFELPQSDIDEIKTEIQSPETMRKIKEAFLKENEAEMPRA--  383

Query  1380  SIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQ  1559
             S++ L+D  DEFFDVPE ++ +H ++ W    T +     + KLS+AA FV+KL DLAVQ
Sbjct  384   SLIGLNDAVDEFFDVPEPAELDHYENEWTSDLTLQQLNMSQNKLSTAAVFVKKLHDLAVQ  443

Query  1560  KN-FQEI--VGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITS  1730
             K  + E+  +  EE     YG TLPKD +++ P S A+AD S FLIRGE YL+D  KI +
Sbjct  444   KKGYTELPELPREESMAYSYGSTLPKDFNFSTPCSVASADPSLFLIRGENYLKDSQKIKA  503

Query  1731  KGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALY  1910
              GTL Q+VGADWL+S+ REDNL  RPGSIVQKYA +   EFFFVVNIQVPG T Y+LA+Y
Sbjct  504   NGTLMQLVGADWLRSDRREDNLGGRPGSIVQKYAERGGTEFFFVVNIQVPGTTMYTLAMY  563

Query  1911  YMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNY  2090
             YM++TPL  +PLL+ FV GDDAFRNS+FKLIPYIS+GSWIVKQSVGKK+CL+G +LE++Y
Sbjct  564   YMMRTPLESSPLLKNFVEGDDAFRNSRFKLIPYISQGSWIVKQSVGKKACLVGHALEVHY  623

Query  2091  FKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLN  2270
             F+G+NYLE+++DVGSSTVARGV++LVLGYLNNLVIEMAF++Q +T+EELPE LLGTCRLN
Sbjct  624   FRGKNYLEVEIDVGSSTVARGVVSLVLGYLNNLVIEMAFVIQGNTQEELPEILLGTCRLN  683

Query  2271  HLDASKAV  2294
             HLD +K++
Sbjct  684   HLDVAKSL  691



>ref|XP_010689526.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=716

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/710 (59%), Positives = 518/710 (73%), Gaps = 19/710 (3%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             +EGWLY+I  NR GLQ   KRYFILED+  K YK++P +  E P++S  +DSCI V D+G
Sbjct  10    IEGWLYVISSNRFGLQSSSKRYFILEDHHFKCYKSIPNSQNEPPVKSTTVDSCIRVADDG  69

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAA-----INPEKNLRAP  545
             RE+ HRKVFFTFTL N+SNH DQ+K GA+SPE AARWI   ++A      I     L  P
Sbjct  70    RESIHRKVFFTFTLYNSSNHSDQIKLGASSPEVAARWIHFFQEAVTKVCPIGGSSGLGCP  129

Query  546   AIRKWQPFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPN  725
                 WQ F     S  +   ASS+ +D +T+DV+ P  W+IFG QNGLR+FKEAKD + +
Sbjct  130   H-NAWQCF-----SSTSWVTASSSQMDFITTDVVAPSSWRIFGCQNGLRVFKEAKDGDFH  183

Query  726   GKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQ  905
             GK WD HPAIMAVGV+DGTSE IF+A+MSLGPSRS+WD+ F RGSVVE+LDGHTDIIH Q
Sbjct  184   GKQWDDHPAIMAVGVVDGTSENIFRAVMSLGPSRSQWDYSFYRGSVVENLDGHTDIIHKQ  243

Query  906   LTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVIT  1085
             L  +WLPWG+++RDLLLRRYWRR+DDGTYVILYHSV H KC PQ+GY+RA +KSGG+VIT
Sbjct  244   LCAYWLPWGVQQRDLLLRRYWRRDDDGTYVILYHSVYHKKCLPQKGYIRACLKSGGYVIT  303

Query  1086  PVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPA  1256
             P+N GK S VKHML++DWK   +YL  + ++S TI MLG IAALRE+FKAK+G  F   +
Sbjct  304   PLNHGKQSVVKHMLAIDWKLWAAYLLPSLARSTTIRMLGKIAALRELFKAKAGDCFSSNS  363

Query  1257  MNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEAS  1436
               +           K EI    V  +   E+   +  S   S+ EL+DV+DEFFD PE S
Sbjct  364   FGDQPFGHASQNENKPEIYPHAVDGKENLEEKELEKLSEHGSLAELNDVSDEFFDAPEGS  423

Query  1437  DDEHSDHGWPRSTTPEYH-ETPRPKLSSAACFVRKLQDLAV-QKNFQEIV--GGEEGAKG  1604
             D +  D+GWP    PE + +  R K S+AA FV+KL  LAV +K + ++V    +EG   
Sbjct  424   DFDPPDYGWPSDCGPETNLQDARSKRSTAAVFVKKLHGLAVHKKGYVDLVEIAAKEGISC  483

Query  1605  CYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIR  1784
             CYG TL KD +  +  SW   D S+FLIRG+ YL D  KI +  TL ++V ADW+ S+ R
Sbjct  484   CYGTTLAKDPTCTIASSWTTTDPSTFLIRGKTYLMDSQKIKANHTLMKMVAADWITSDRR  543

Query  1785  EDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVN  1964
             ED+L  RPGSIVQ YAA+   EFFF+VNIQVPG+  Y+LALYYM  + L + PLL+ FV+
Sbjct  544   EDDLGGRPGSIVQNYAAKGGSEFFFIVNIQVPGSKTYNLALYYM-TSNLEDAPLLQNFVD  602

Query  1965  GDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTV  2144
              DDA+RNS+FKLIPYISKG WIVKQSVGKK+CL GQ+LE+NYF G+NY+EL +D+GSSTV
Sbjct  603   RDDAYRNSRFKLIPYISKGPWIVKQSVGKKACLAGQALEINYFCGKNYIELGIDIGSSTV  662

Query  2145  ARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             ARGV++LVLGYLNNLVIEMAFL+QA+TEEELPE LLGTCRLNHLDASKAV
Sbjct  663   ARGVVSLVLGYLNNLVIEMAFLIQANTEEELPEQLLGTCRLNHLDASKAV  712



>gb|EYU39844.1| hypothetical protein MIMGU_mgv1a003058mg [Erythranthe guttata]
Length=611

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/606 (68%), Positives = 484/606 (80%), Gaps = 21/606 (3%)
 Frame = +3

Query  552   RKWQPFRLSVSSRMARTD----ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRN  719
             RKWQPF +SVS R+A+      A+ T V+AMTSDVI P PWKIFG QNGLR+FKEAKDR+
Sbjct  6     RKWQPFSMSVSKRIAKRSIDWTATFTHVNAMTSDVIAPSPWKIFGCQNGLRLFKEAKDRD  65

Query  720   PNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIH  899
              NG+HWD HPAIMAVGVI+G SE +F+ LMSLG SR+EWDFCF RGSVVEHLDGHTDIIH
Sbjct  66    SNGRHWDDHPAIMAVGVINGASETVFRTLMSLGASRTEWDFCFYRGSVVEHLDGHTDIIH  125

Query  900   MQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHV  1079
             +QL  HWLPW ++RRDLLLRRYWRRE+DGTYVILYHSV H KCPPQ+GYVRA +KSGG+V
Sbjct  126   IQLYNHWLPWAMQRRDLLLRRYWRRENDGTYVILYHSVFHRKCPPQDGYVRACLKSGGYV  185

Query  1080  ITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPD  1250
             I+P  QGK   +KHML+VDWK   SYL+K++S+S+TI MLG +AAL E F+AK G+   +
Sbjct  186   ISPSQQGKDCVIKHMLAVDWKFWKSYLKKSSSRSITICMLGKVAALAEFFRAKCGNMSNE  245

Query  1251  PAMNELTIDIQL-PVSEKEEIKNEV-----VATERIEEDTTEKYPSAC-SSIVELDDVAD  1409
                 EL+IDI + P +EKEEIK EV     V+ E  E++++    SA  SS+  L D AD
Sbjct  246   YLSGELSIDIGVAPENEKEEIKTEVNCKRVVSNETAEDESSRPQHSATPSSLTALSDAAD  305

Query  1410  EFFDVPEASDDEHSDHGWPRSTTPE--YHETPRPKLSSAACFVRKLQDLAVQK----NFQ  1571
             EFFDVPE SDDE  ++ W  +TT +  Y E  +PKLSSAA FV+KL  LAVQK    + Q
Sbjct  306   EFFDVPEPSDDEAFENAWHSNTTSDLSYVEMYQPKLSSAANFVKKLHGLAVQKKGYMDLQ  365

Query  1572  EIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQI  1751
             EI   EE    CYG TL KD+S+NMP SWAAAD SSFLIR E YL D+ K  +KGTL Q+
Sbjct  366   EI-SREESVSCCYGSTLAKDSSFNMPCSWAAADPSSFLIRAENYLVDNQKTKAKGTLMQM  424

Query  1752  VGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPL  1931
             V ADWL+S+ RED+LA R G IVQKYAA+  PEFFFV+NIQVPGAT Y+LALYYMLKTPL
Sbjct  425   VAADWLRSDKREDDLAGRYGGIVQKYAARGGPEFFFVINIQVPGATTYNLALYYMLKTPL  484

Query  1932  AENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYL  2111
             A+ PLLERFVNGDDAFRNS+FKLIPYISKGSWIVKQSVGKKSCL+GQ+LE+NYF+G+NYL
Sbjct  485   ADTPLLERFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKKSCLVGQALEVNYFRGKNYL  544

Query  2112  ELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKA  2291
             EL +DVGSSTVARGV++LVLGYLNNLVIEMAFL+Q +T EELPE LLGTCRLN LD SK+
Sbjct  545   ELGIDVGSSTVARGVVSLVLGYLNNLVIEMAFLIQGNTAEELPEFLLGTCRLNSLDVSKS  604

Query  2292  VHTNSI  2309
             V T+SI
Sbjct  605   VSTDSI  610



>gb|KHN17142.1| hypothetical protein glysoja_011616 [Glycine soja]
Length=705

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/739 (58%), Positives = 523/739 (71%), Gaps = 62/739 (8%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +P  +  MEGWLYLIR NR G  Y RKRYFIL+ N L+S+K  P +  E         
Sbjct  1     MGIPQRERKMEGWLYLIRANRFGQHYSRKRYFILKGNALRSFKIKPTSQME---------  51

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
                             V F FT+ N ++  D+LK GA+S EEAARWIR L+DAA+    +
Sbjct  52    ----------------VLFIFTVYNATDQSDKLKLGASSSEEAARWIRTLQDAAMKGCPS  95

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMARTD--------ASSTPVDAMTSDVIGPCPWKIFGI  677
             P KNL A   ++    R   S     TD         S    +AMT+DVI P PWKIFG 
Sbjct  96    PAKNLVACHKKRRSSLRNGGSKS---TDWKYSNLNFQSCIYTEAMTADVIAPSPWKIFGC  152

Query  678   QNGLRIFKEAKDRNPNGKHWDG-HPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCR  854
             QNGLR+FKEAKD +  G HW G +PAIMAVGV+DG SEAIF  LM+L PSRSEWDFC  R
Sbjct  153   QNGLRMFKEAKDWDSRGSHWVGENPAIMAVGVVDGASEAIFHTLMTLDPSRSEWDFCIYR  212

Query  855   GSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPP  1034
             G+VV+H+DGHTDIIH+QL   WLPWG+K RDLLLRRYWRREDDG+YV+L+HSV HSKCPP
Sbjct  213   GNVVDHIDGHTDIIHLQLYNDWLPWGMKPRDLLLRRYWRREDDGSYVLLFHSVYHSKCPP  272

Query  1035  QEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAA  1205
             ++GYVRA VKSGG V+TPVN+G  S V+HML+VDWK    YLR  +++S+TI ML  IAA
Sbjct  273   KKGYVRACVKSGGFVVTPVNKGTQSVVRHMLAVDWKFWKLYLRPASARSITIRMLERIAA  332

Query  1206  LREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATER--------IEEDTTEK  1361
             LRE+F+ K G+Y  +P    +T DI LP+  KE+IK EV   +         + ED  E 
Sbjct  333   LRELFRTKGGNYSSEPL--AMTKDIGLPLGVKEDIKTEVSQEKNKFEEPPLVVMEDEVE-  389

Query  1362  YPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKL  1541
              PS   S++ L+D +DEFFDVPE ++ +H  + W    + E      P+++SAA FV+KL
Sbjct  390   -PSGRRSLMGLND-SDEFFDVPEPTEYDHFQNEWHADLSSEQMSMSIPRMTSAAGFVKKL  447

Query  1542  QDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQ  1709
               LAVQK    + QE    EE     YG TL KD+S   P +WAA+D S FL+RGE YLQ
Sbjct  448   HGLAVQKKGYMDLQE-AAMEESTSCSYGATLQKDSSCASPCTWAASDPSLFLVRGENYLQ  506

Query  1710  DHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGAT  1889
             DH K+ + GTLTQ+VGADWL+S+ REDNL++RPGSIVQ+YAA+  PEFFFV+N+Q+PG+ 
Sbjct  507   DHQKVKANGTLTQMVGADWLRSDTREDNLSSRPGSIVQQYAAKGGPEFFFVINMQMPGSP  566

Query  1890  RYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIG  2069
              YSLALYYMLKTPL +NPLL+ FV+GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+G
Sbjct  567   MYSLALYYMLKTPLEDNPLLQSFVDGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVG  626

Query  2070  QSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHL  2249
             Q+LEM Y +G+NYLE+D+DVGSSTVARGV +LVLGYLNNLV+EMAFLVQ  T +ELPE L
Sbjct  627   QALEMLYIRGKNYLEIDIDVGSSTVARGVASLVLGYLNNLVVEMAFLVQGSTPDELPEVL  686

Query  2250  LGTCRLNHLDASKAVHTNS  2306
             LGTCRLNH+DASKA   NS
Sbjct  687   LGTCRLNHMDASKAFLVNS  705



>ref|XP_008791558.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X3 [Phoenix dactylifera]
Length=717

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/734 (58%), Positives = 511/734 (70%), Gaps = 55/734 (7%)
 Frame = +3

Query  192   DGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQ  371
             D  MEGWLYLIR NRLGLQY RKRYF+LEDN L  YKAVP + RE+P+RSA+I+SCI V 
Sbjct  7     DRRMEGWLYLIRSNRLGLQYSRKRYFVLEDNALNCYKAVPASRREDPIRSALINSCIRVT  66

Query  372   DNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN--PEKNLRAP  545
             DNGR + HR VF+ FTL ++SNH+DQLK GA S EEAA WIR L +AA+   P K+ +  
Sbjct  67    DNGRASMHRSVFYIFTLYSSSNHNDQLKLGARSSEEAASWIRSLMEAALKECPNKDEKFV  126

Query  546   AIRKWQPFRLSVSSRMAR--------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
             A  K +   L +S   AR        T  SS   D M SDVI P PW IFG +NGLR+FK
Sbjct  127   ACSKRRRHSLRLSRTRARSLMHSIDWTVYSSVHTDPMASDVIAPSPWMIFGCKNGLRLFK  186

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             E+ + +  GKHWD HPAIMAVGV+D TSEAIF+ +MSLGPSRSEWDF    G VVEHLDG
Sbjct  187   ESNEGDFLGKHWDDHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRVVEHLDG  246

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDIIH +L   WLPWG+ +RDLLLRRYWRREDDGTY                       
Sbjct  247   HTDIIHKKLHGDWLPWGMNKRDLLLRRYWRREDDGTY-----------------------  283

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
               GG+VI+PVNQGK S VKHML++DWK   SY+  +++K +TI MLG +AALRE F+AK 
Sbjct  284   -GGGYVISPVNQGKQSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAALREFFRAKL  342

Query  1233  GS-YFPDPAMNELTIDIQLPVSEKEEIKNEVVAT---------ERIEEDTTEKYPSACSS  1382
             G+    D +  ELT +I LP SEKE IK EV  T             + +   + +   S
Sbjct  343   GNCTCSDYSSGELTREIGLPYSEKEHIKVEVQTTGENSKSADSAEAPQQSPSSHANTSGS  402

Query  1383  IVELDDVADEFFDVPEASDDEHSDHGWPRST---TPEYHETPRPKLSSAACFVRKLQDLA  1553
              ++L+D ADEFFDV + SD++ ++  WP      +    E  + KLS+AA FV+KL D A
Sbjct  403   FLQLNDAADEFFDVIDESDNDQTEALWPSDEGMHSQLVQEQRQHKLSTAAVFVKKLHDFA  462

Query  1554  VQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSK  1721
             VQK    + QE   G+  A   YG TLPKD S  M  SWA AD +SFLIRGE YL+D  K
Sbjct  463   VQKKGYIDLQEASMGDM-APCSYGTTLPKDPSCTMTCSWAMADPTSFLIRGESYLRDQQK  521

Query  1722  ITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSL  1901
             I +  TL Q+V ADWL S+ RED+L  RPG +VQKYAAQ   EFFF+VNIQ+PG++ YSL
Sbjct  522   IKANSTLMQMVAADWLNSDKREDDLGGRPGGVVQKYAAQGGSEFFFIVNIQIPGSSTYSL  581

Query  1902  ALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLE  2081
             ALYYM+ TPL   PLLE FV GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+L 
Sbjct  582   ALYYMMDTPLENVPLLESFVKGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALA  641

Query  2082  MNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTC  2261
              +YF+G NYLE+ +D GSSTVARGV++LVLGYLNNLVIE+AFL+Q +T+EELPE LLGTC
Sbjct  642   SHYFRGSNYLEVGIDAGSSTVARGVVSLVLGYLNNLVIELAFLIQGNTQEELPELLLGTC  701

Query  2262  RLNHLDASKAVHTN  2303
             RLNHLDASK+V  N
Sbjct  702   RLNHLDASKSVSIN  715



>ref|XP_010906507.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Elaeis guineensis]
Length=698

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/720 (57%), Positives = 504/720 (70%), Gaps = 60/720 (8%)
 Frame = +3

Query  195   GNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQD  374
             G MEGWLYLIR NRLGLQ  R+RYF+L+DN L  YK +P + RE+P+RSA+IDSCI V D
Sbjct  14    GRMEGWLYLIRSNRLGLQSSRRRYFVLQDNSLHCYKTIPTSTREDPIRSALIDSCIRVTD  73

Query  375   NGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----PEKNLRA  542
             NGRE+ HR V F FTL N SNH+DQLK GA SPEEAARWIR L +AA+       +N+ A
Sbjct  74    NGRESIHRNVLFIFTLYNASNHNDQLKLGARSPEEAARWIRSLMEAALKECPIKRENVVA  133

Query  543   PAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKE  704
              + R+W   RLS S R +R      T  SS   D MTSDVI P PW IFG +NGLR+FKE
Sbjct  134   CSRRRWPSLRLSQSKRTSRMHSVDWTVFSSLHTDPMTSDVIAPSPWTIFGCKNGLRLFKE  193

Query  705   AKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGH  884
             AKD + + K WD HPAIMAVGV+D T EAIF+ +MSLGPSRSE          ++  D  
Sbjct  194   AKDGDLHRKCWDDHPAIMAVGVVDATPEAIFRTVMSLGPSRSEG---------MKRRD--  242

Query  885   TDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVK  1064
                  + L  +W                RREDDGTYVILYHSV H  C P+ GY+RA +K
Sbjct  243   -----LLLRRYW----------------RREDDGTYVILYHSVFHQNCRPERGYIRACLK  281

Query  1065  SGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSG  1235
             SGG+VI+P NQG  S VKHML++DWK   SYL  +++  +TI MLG +AALRE+F+ K G
Sbjct  282   SGGYVISPANQGNVSVVKHMLAIDWKFWKSYLFASSAIYITIRMLGRVAALRELFRVKLG  341

Query  1236  SY-FPDPAMNELTIDIQLPVSEKEEIKNEVVATERIE--EDTTEKYPSACSSIVELDDVA  1406
             +Y   D +  ++  ++QLP    E  K+E    E IE  E+++ K      S ++L+D A
Sbjct  342   NYSHTDFSSGDMEPEVQLP---GENSKSE----EFIEGSENSSAKPAKTGGSFLQLNDAA  394

Query  1407  DEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK----NFQE  1574
             DEFFDV + S+ E ++  WP     +  +  +PKLS+AA FVR+L DLAVQK    + QE
Sbjct  395   DEFFDVLDESEYEQTEAMWPSDAGMQPQDQRQPKLSTAAVFVRRLHDLAVQKKGYVDLQE  454

Query  1575  IVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIV  1754
                 E+    CYG TL KD+S+ +  SWA+AD S+FLIR + YLQD  KI + GTL Q+V
Sbjct  455   -ASMEDSMPCCYGATLQKDSSFTIACSWASADPSTFLIRSKTYLQDRQKIKANGTLMQMV  513

Query  1755  GADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLA  1934
              ADWL+S  RED+L  R G IVQKYAAQ   EFFF+VNIQVPG+T YSLALYYM+ TP+ 
Sbjct  514   AADWLKSSKREDDLGGRAGGIVQKYAAQGGREFFFIVNIQVPGSTTYSLALYYMMDTPVE  573

Query  1935  ENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLE  2114
             + PLLE F+  DDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF G NYLE
Sbjct  574   DVPLLESFIREDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFHGGNYLE  633

Query  2115  LDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             L +D+GSSTVARGV++LVLGYLNNLVIEMAFL+Q +TEEELPE LLGTCRLNHLDAS+AV
Sbjct  634   LGIDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQGNTEEELPEFLLGTCRLNHLDASRAV  693



>ref|XP_010906508.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X3 [Elaeis guineensis]
Length=698

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/720 (58%), Positives = 507/720 (70%), Gaps = 60/720 (8%)
 Frame = +3

Query  195   GNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQD  374
             G MEGWLYLIR NRLGLQ  R+RYF+L+DN L  YK +P + RE+P+RSA+IDSCI V D
Sbjct  14    GRMEGWLYLIRSNRLGLQSSRRRYFVLQDNSLHCYKTIPTSTREDPIRSALIDSCIRVTD  73

Query  375   NGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----PEKNLRA  542
             NGRE+ HR V F FTL N SNH+DQLK GA SPEEAARWIR L +AA+       +N+ A
Sbjct  74    NGRESIHRNVLFIFTLYNASNHNDQLKLGARSPEEAARWIRSLMEAALKECPIKRENVVA  133

Query  543   PAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKE  704
              + R+W   RLS S R +R      T  SS   D MTSDVI P PW IFG +NGLR+FKE
Sbjct  134   CSRRRWPSLRLSQSKRTSRMHSVDWTVFSSLHTDPMTSDVIAPSPWTIFGCKNGLRLFKE  193

Query  705   AKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGH  884
             AKD + + K WD HPAIMAVGV+D T EAIF+ +MSLGPSRSEWDFCF  GSV+EHLDGH
Sbjct  194   AKDGDLHRKCWDDHPAIMAVGVVDATPEAIFRTVMSLGPSRSEWDFCFAHGSVIEHLDGH  253

Query  885   TDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVK  1064
             TDIIH +L + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H  C P+ GY+RA +K
Sbjct  254   TDIIHKKLHSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLK  313

Query  1065  SGGHVITPVNQGKSSTVKHMLSVD---WKSYLRKTTSKSLTIDMLGGIAALREMFKAKSG  1235
             SGG+VI+P NQG  S VKHML++D   WKSYL  +++  +TI MLG +AALRE+F+ K G
Sbjct  314   SGGYVISPANQGNVSVVKHMLAIDWKFWKSYLFASSAIYITIRMLGRVAALRELFRVKLG  373

Query  1236  SY-FPDPAMNELTIDIQLPVSEKEEIKNEVVATERIE--EDTTEKYPSACSSIVELDDVA  1406
             +Y   D +  ++  ++QLP    E  K+E    E IE  E+++ K      S ++L+D A
Sbjct  374   NYSHTDFSSGDMEPEVQLP---GENSKSE----EFIEGSENSSAKPAKTGGSFLQLNDAA  426

Query  1407  DEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK----NFQE  1574
             DEFFDV + S+ E ++  WP     +  +  +PKLS+AA FVR+L DLAVQK    + QE
Sbjct  427   DEFFDVLDESEYEQTEAMWPSDAGMQPQDQRQPKLSTAAVFVRRLHDLAVQKKGYVDLQE  486

Query  1575  IVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIV  1754
                 E+    CYG TL KD+S+ +  SWA+AD S+FLIR + YLQD  KI + GTL Q+V
Sbjct  487   -ASMEDSMPCCYGATLQKDSSFTIACSWASADPSTFLIRSKTYLQDRQKIKANGTLMQMV  545

Query  1755  GADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLA  1934
              ADWL+S  RED+L  R G IVQKYAAQ   EFFF+VNIQVPG+T YSLALYYM+ TP+ 
Sbjct  546   AADWLKSSKREDDLGGRAGGIVQKYAAQGGREFFFIVNIQVPGSTTYSLALYYMMDTPVE  605

Query  1935  ENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLE  2114
             + PLLE F+  DDA+RNS+FKLIPYISK                                
Sbjct  606   DVPLLESFIREDDAYRNSRFKLIPYISK--------------------------------  633

Query  2115  LDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             L +D+GSSTVARGV++LVLGYLNNLVIEMAFL+Q +TEEELPE LLGTCRLNHLDAS+AV
Sbjct  634   LGIDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQGNTEEELPEFLLGTCRLNHLDASRAV  693



>gb|KDO73328.1| hypothetical protein CISIN_1g004508mg [Citrus sinensis]
Length=675

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/674 (61%), Positives = 506/674 (75%), Gaps = 41/674 (6%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             S G MEGWL+LIR NR+GLQY RKRYF+LED+ LKS+K+VP +  E+P+RSAIIDSCI V
Sbjct  8     SQGRMEGWLHLIRSNRIGLQYSRKRYFLLEDHFLKSFKSVPHSKNEDPVRSAIIDSCIRV  67

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI--NPEK----  530
              DNGRE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAA+WI  L++AA+   P +    
Sbjct  68    TDNGRESIHRKVFFIFTLYNTSNHNDQLKLGASSPEEAAKWIHSLQEAALKGGPHQGVGD  127

Query  531   NLRAPAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLR  692
             ++  P    W+ FRLS SSR + T +      S T ++ +T+DVI P PW IFG QNGLR
Sbjct  128   HIGCPN-SPWESFRLSGSSRASHTKSIDWTLCSGTHMEQVTADVIAPSPWTIFGCQNGLR  186

Query  693   IFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEH  872
             +FKE KDR   GK WD HPAIMAVGV+DGTSEAIF+ LMSLG SRS WDFCF RG VVEH
Sbjct  187   LFKEGKDRGSRGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGASRSVWDFCFYRGCVVEH  245

Query  873   LDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVR  1052
             LDGHTDIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCP Q+G VR
Sbjct  246   LDGHTDIIHKQLYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVR  305

Query  1053  ATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFK  1223
             A +KSGG+VITP+N GK S VKHML++DWK   SYL+ ++++S+TI MLG +AALRE+F+
Sbjct  306   ACLKSGGYVITPMNHGKKSVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFR  365

Query  1224  AKSGSYF-PDPAMNELTID----------IQLPVSEKEEIKNEVVATERIEEDTTEKYPS  1370
             AK G+Y  P+    ELT +          +Q+P  +    KN    +E +++ ++E    
Sbjct  366   AKQGNYSSPEFLSGELTRNMRMHQTDGNMVQMPTEDGNSKKN---TSEEVDQVSSEH---  419

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQ  1544
               +S+V L+D ADEFFDVPE SD + S++GW     PE +  +T  PK+S+AA FVRKL 
Sbjct  420   --ASLVGLNDAADEFFDVPEPSDYDDSENGWTSDFGPEMNSQDTRHPKISTAAGFVRKLH  477

Query  1545  DLAVQK-NFQEIVGG--EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDH  1715
             DLAVQK  + ++ G   E+    CYG TL KD +  +P SW + D S+FLIRG+ YLQD 
Sbjct  478   DLAVQKRGYVDLQGTAKEDNFSCCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDR  537

Query  1716  SKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRY  1895
              K+ +KGTL Q+V ADWL+S+ RED+L  RPG IVQKYA Q  PEFFF++NIQVPG+T Y
Sbjct  538   HKVKAKGTLMQMVAADWLKSDKREDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTY  597

Query  1896  SLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQS  2075
             SLALYYM+ TP+ + PLLE F+NGDDA+RNS+FKLIPYIS+GSWIVKQSVGKK+CLIGQ+
Sbjct  598   SLALYYMMTTPVKDAPLLESFINGDDAYRNSRFKLIPYISEGSWIVKQSVGKKACLIGQA  657

Query  2076  LEMNYFKGQNYLEL  2117
             LE+NYF G+NYLE+
Sbjct  658   LEINYFHGKNYLEV  671



>ref|XP_010920451.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X6 [Elaeis guineensis]
Length=698

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/737 (57%), Positives = 505/737 (69%), Gaps = 74/737 (10%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +   D  MEGWLYLIR NRLGLQY RKRYF+LEDN L  YKAVP + RE         
Sbjct  1     MGITEGDRRMEGWLYLIRSNRLGLQYSRKRYFVLEDNALNCYKAVPASRRE---------  51

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
                                                GA S EEAA WIR L +AA+    N
Sbjct  52    ----------------------------------LGARSSEEAASWIRSLMEAALKECPN  77

Query  522   PEKNLRAPAIRKWQPFRLS---VSSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQN  683
              E+N  A + R+ Q FRLS     S M   D    SS   D M SDVI P PW IFG +N
Sbjct  78    KEENFVACSKRRRQSFRLSRTKARSLMHSIDWTVYSSVHADPMASDVIAPSPWTIFGCKN  137

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKE+ + + +GK WD HPAIMAVGV+D TSEAIF+ +MSLGPSRSEWDF    G V
Sbjct  138   GLRLFKESNEGDFHGKQWDDHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRV  197

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDIIH +L   WLPWG+K+RDLLLRRYWRREDDGTYVILYHSV H  C P+ G
Sbjct  198   VEHLDGHTDIIHKKLRGDWLPWGMKKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERG  257

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALRE  1214
             Y+RA +KSGG+VI+PVNQGK S VKHML++DWK   SY+  +++K +TI MLG +A LRE
Sbjct  258   YIRACLKSGGYVISPVNQGKRSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAGLRE  317

Query  1215  MFKAKSGS-YFPDPAMNELTIDIQLPVSEKEEIKNEV---------VATERIEEDTTEKY  1364
              F+AK G+    D +  ELT +I LP  EKE IK EV         V +    + +  ++
Sbjct  318   FFRAKLGNCTCSDYSSGELTREIGLPYGEKEHIKVEVQTTGENNKSVDSAEAPQQSPSRH  377

Query  1365  PSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRST---TPEYHETPRPKLSSAACFVR  1535
                  S ++L+D ADEFFDV + SD++ ++  WP      +    E  +P+LS+AA FV+
Sbjct  378   ADTNGSFLQLNDAADEFFDVIDESDNDQTESLWPSDEGMHSQLLQEQRQPRLSTAAVFVK  437

Query  1536  KLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKY  1703
             KL D AVQK    + QE   G+  A   YG TLPKD S  MP SWA AD++SFLIRGE Y
Sbjct  438   KLHDFAVQKKGYIDLQEASMGDM-APCSYGATLPKDTSCTMPCSWAMADSTSFLIRGESY  496

Query  1704  LQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPG  1883
             L+DH KI +  TL Q+V ADWL S+ RED+L  RPG IVQKYAAQ   EFFF+VNIQVPG
Sbjct  497   LRDHQKIKANSTLMQMVAADWLNSDKREDDLGGRPGGIVQKYAAQGGSEFFFIVNIQVPG  556

Query  1884  ATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCL  2063
             +T YSLALYYM+ TPL   PLLE FV GD+A+RNS+FKLIPYISKGSWIVKQSVGKK+CL
Sbjct  557   STTYSLALYYMMDTPLENVPLLESFVKGDNAYRNSRFKLIPYISKGSWIVKQSVGKKACL  616

Query  2064  IGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPE  2243
             +GQ+LE++YF+G NYLEL +DVGSSTVARGV++LVLGYLNNLVIE+AFL+Q +T+EELPE
Sbjct  617   VGQALEIHYFRGSNYLELGIDVGSSTVARGVVSLVLGYLNNLVIELAFLIQGNTQEELPE  676

Query  2244  HLLGTCRLNHLDASKAV  2294
              LLGTCRLNHLDASK+V
Sbjct  677   FLLGTCRLNHLDASKSV  693



>gb|KEH39334.1| pleckstrin-like (PH) and lipid-binding START domain protein [Medicago 
truncatula]
Length=693

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/711 (58%), Positives = 507/711 (71%), Gaps = 50/711 (7%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQ+ RKRYF+L D+ L+S+K++P +  ++P+RSAI+DSCI V DNG
Sbjct  16    MEGWLYLIRCNRFGLQFSRKRYFVLHDHLLRSFKSIPNSTDQDPVRSAIVDSCIRVMDNG  75

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW  560
             RE+ +RKVFF FTL NTS+H+DQLK GA+ PEEAARWI+   +A++         + R+W
Sbjct  76    RESINRKVFFIFTLYNTSDHNDQLKLGASRPEEAARWIQSFNEASLKGAPEAIGCSKRRW  135

Query  561   QPFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWD  740
             Q F L  SS  +R+   S      +SDVI P  W IFG QNGLR+F+EAKDR   GK WD
Sbjct  136   QSFSLRGSS--SRSQQYSIDWTLSSSDVIAPSTWTIFGCQNGLRLFREAKDRGSCGKKWD  193

Query  741   GHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHW  920
              HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +G+VVEHLDGHTDIIH QL + W
Sbjct  194   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQLYSDW  253

Query  921   LPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVNQG  1100
             LPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCP Q+GYVRA +KSGG+VI+P N G
Sbjct  254   LPWGIKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGYVRACLKSGGYVISPANMG  313

Query  1101  KSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YFPDPAMNEL  1268
             K S VKHML++DWK   SYL+ +++ S+TI MLG +AALRE+F+ + G+    D +  EL
Sbjct  314   KQSVVKHMLAIDWKSWRSYLKSSSAYSMTIQMLGRVAALRELFRTRLGNCTLSDYSSGEL  373

Query  1269  TIDIQ-LPVSEKEEIKNEVVATERIEEDT---TEKYPSACSSIVELDDVADEFFDVPEAS  1436
             T + +  P  E      ++ A E   +++    E   S  +S+V L+D  DEF+DV E S
Sbjct  374   TRNRRNSPKEEYASSDTQIQADENNHDNSIGEVEPTQSEHASLVSLNDADDEFYDVMEPS  433

Query  1437  DDEHSDHGWPRSTTPEYHETPR-PKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAK  1601
             + + S+ GW    + +  +  R  KLS+AA FVRKL DLAV K    + QE+V  EE   
Sbjct  434   NCDESEKGWMTECSHQKSQDIRHQKLSTAANFVRKLHDLAVHKRGYMDLQEMV-REESIS  492

Query  1602  GCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEI  1781
               YG TLPKD +  +P S   AD S+FLIRGE YL+DH K+ +KGTL Q+V ADWL+S+ 
Sbjct  493   CPYGSTLPKDPTCTLPCSLTEADPSTFLIRGENYLEDHQKVKAKGTLMQMVAADWLRSDR  552

Query  1782  REDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFV  1961
             RED+L  RPGSIVQKYAAQ  PEFFF+VNIQVPG+T YSLALYYM+ TP+ + PLL+ F+
Sbjct  553   REDDLGGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPLLDSFI  612

Query  1962  NGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSST  2141
              GD+AFRNS+FKLIPYIS+GSWIVKQSVGKK+CL+GQ+LE+NYF+G+NYLE         
Sbjct  613   KGDNAFRNSRFKLIPYISEGSWIVKQSVGKKACLVGQALEINYFQGKNYLE---------  663

Query  2142  VARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
                                       +T EELPE LLGTCRLNHLDASKAV
Sbjct  664   -------------------------GNTREELPEVLLGTCRLNHLDASKAV  689



>ref|XP_010689527.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=699

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/689 (58%), Positives = 500/689 (73%), Gaps = 20/689 (3%)
 Frame = +3

Query  282   NCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFG  461
             +C+K    + +   + P++S  +DSCI V D+GRE+ HRKVFFTFTL N+SNH DQ+K G
Sbjct  9     SCIKKLLPLLLLLFQPPVKSTTVDSCIRVADDGRESIHRKVFFTFTLYNSSNHSDQIKLG  68

Query  462   ANSPEEAARWIRCLRDAA-----INPEKNLRAPAIRKWQPFRLSVSSRMARTD------A  608
             A+SPE AARWI   ++A      I     L  P    WQ FRLS S R+  +       A
Sbjct  69    ASSPEVAARWIHFFQEAVTKVCPIGGSSGLGCPH-NAWQCFRLSSSKRIHHSSSTSWVTA  127

Query  609   SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSE  788
             SS+ +D +T+DV+ P  W+IFG QNGLR+FKEAKD + +GK WD HPAIMAVGV+DGTSE
Sbjct  128   SSSQMDFITTDVVAPSSWRIFGCQNGLRVFKEAKDGDFHGKQWDDHPAIMAVGVVDGTSE  187

Query  789   AIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrryw  968
              IF+A+MSLGPSRS+WD+ F RGSVVE+LDGHTDIIH QL  +WLPWG+++RDLLLRRYW
Sbjct  188   NIFRAVMSLGPSRSQWDYSFYRGSVVENLDGHTDIIHKQLCAYWLPWGVQQRDLLLRRYW  247

Query  969   rrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK--  1142
             RR+DDGTYVILYHSV H KC PQ+GY+RA +KSGG+VITP+N GK S VKHML++DWK  
Sbjct  248   RRDDDGTYVILYHSVYHKKCLPQKGYIRACLKSGGYVITPLNHGKQSVVKHMLAIDWKLW  307

Query  1143  -SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNE  1319
              +YL  + ++S TI MLG IAALRE+FKAK+G  F   +  +           K EI   
Sbjct  308   AAYLLPSLARSTTIRMLGKIAALRELFKAKAGDCFSSNSFGDQPFGHASQNENKPEIYPH  367

Query  1320  VVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH-ET  1496
              V  +   E+   +  S   S+ EL+DV+DEFFD PE SD +  D+GWP    PE + + 
Sbjct  368   AVDGKENLEEKELEKLSEHGSLAELNDVSDEFFDAPEGSDFDPPDYGWPSDCGPETNLQD  427

Query  1497  PRPKLSSAACFVRKLQDLAV-QKNFQEIV--GGEEGAKGCYGCTLPKDASYNMPGSWAAA  1667
              R K S+AA FV+KL  LAV +K + ++V    +EG   CYG TL KD +  +  SW   
Sbjct  428   ARSKRSTAAVFVKKLHGLAVHKKGYVDLVEIAAKEGISCCYGTTLAKDPTCTIASSWTTT  487

Query  1668  DTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRP  1847
             D S+FLIRG+ YL D  KI +  TL ++V ADW+ S+ RED+L  RPGSIVQ YAA+   
Sbjct  488   DPSTFLIRGKTYLMDSQKIKANHTLMKMVAADWITSDRREDDLGGRPGSIVQNYAAKGGS  547

Query  1848  EFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSW  2027
             EFFF+VNIQVPG+  Y+LALYYM  + L + PLL+ FV+ DDA+RNS+FKLIPYISKG W
Sbjct  548   EFFFIVNIQVPGSKTYNLALYYM-TSNLEDAPLLQNFVDRDDAYRNSRFKLIPYISKGPW  606

Query  2028  IVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAF  2207
             IVKQSVGKK+CL GQ+LE+NYF G+NY+EL +D+GSSTVARGV++LVLGYLNNLVIEMAF
Sbjct  607   IVKQSVGKKACLAGQALEINYFCGKNYIELGIDIGSSTVARGVVSLVLGYLNNLVIEMAF  666

Query  2208  LVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             L+QA+TEEELPE LLGTCRLNHLDASKAV
Sbjct  667   LIQANTEEELPEQLLGTCRLNHLDASKAV  695



>emb|CAB77600.1| putative protein [Arabidopsis thaliana]
Length=709

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/742 (56%), Positives = 516/742 (70%), Gaps = 71/742 (10%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLY IR NR GLQ+ RKRYF+L +N L S+K+VP    EEP R A +D
Sbjct  1     MGVSQTDGRMEGWLYTIRHNRFGLQFSRKRYFVLHENNLTSFKSVPSDHNEEPERRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN  533
              CI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA+   +K 
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDAS---QKG  117

Query  534   LRAPAIRKWQP------FRLSVSSRMARTDA-----------SSTPVDAMTS---DVIGP  653
                P    +         +L VS R  R ++           SST ++  T+   DVI P
Sbjct  118   FPIPDCEFFVSHAEKGLVKLDVSKRNRRKNSVDWTNYSSTNYSSTSLNVETNVAPDVIAP  177

Query  654   CPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSE  833
              PWKIFG QNGLR+FKEAKD +  G+HWD HPAIMAVGVIDGTSE IF  LMSLGP RSE
Sbjct  178   SPWKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVIDGTSEDIFNTLMSLGPLRSE  237

Query  834   WDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSV  1013
             WDFCF +G+VVEHLDGHTDIIH+QL + WLPWG+ RRDLLLRRYWRREDDGTY       
Sbjct  238   WDFCFYKGNVVEHLDGHTDIIHLQLYSDWLPWGMNRRDLLLRRYWRREDDGTY-------  290

Query  1014  IHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTID  1184
                               GG+V+TP N GK S VKHM+++DW+S   Y+R ++++S+TI 
Sbjct  291   -----------------GGGYVVTPANNGKQSLVKHMVAIDWRSWNLYMRPSSARSITIR  333

Query  1185  MLGGIAALREMFKAKSGSYFPDPAMNEL--------TIDIQLPVSEKEEIKNEVVATERI  1340
             ++  +AALREMFKAK G  F +    E          I+     +E +E+  E +  E +
Sbjct  334   VVERVAALREMFKAKQGHGFTEFVSGEFLDTKPCLSKINTMPLKTEAKEVDLETMHAEEM  393

Query  1341  EEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSA  1520
             ++ T     SA +S+++L+D +DEFFDVPE ++    D     S   + H+    K+ + 
Sbjct  394   DKPT-----SARNSLMDLNDASDEFFDVPEPNESTEFDSFIDSSPYSQGHQL---KIPTP  445

Query  1521  ACFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLI  1688
             A  V+KLQDLA+ K    + QE VG EE     YG TL KD S  +P SW+ AD S+FLI
Sbjct  446   AGIVKKLQDLAINKKGYMDLQE-VGLEENNTFFYGATLQKDPSLTLPCSWSTADPSTFLI  504

Query  1689  RGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVN  1868
             RG  YL++  K+ +KGTL Q++GADW+ S+ RED+L  R G +VQ+YAA+  PEFFF+VN
Sbjct  505   RGNNYLKNQQKVKAKGTLMQMIGADWISSDKREDDLGGRIGGLVQEYAAKGSPEFFFIVN  564

Query  1869  IQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVG  2048
             IQVPG+  YSLALYYMLKTPL E+PLLE FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVG
Sbjct  565   IQVPGSAMYSLALYYMLKTPLEEHPLLESFVNGDDAYRNSRFKLIPHISKGSWIVKQSVG  624

Query  2049  KKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTE  2228
             KK+CL+GQ LE+ Y +G+NYLELD+DVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T 
Sbjct  625   KKACLVGQVLEVCYTRGKNYLELDIDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTV  684

Query  2229  EELPEHLLGTCRLNHLDASKAV  2294
             EELPE LLGTCRLN+LD SK+V
Sbjct  685   EELPELLLGTCRLNYLDVSKSV  706



>gb|KHG25367.1| Homeobox-leucine zipper ATHB-14 -like protein [Gossypium arboreum]
Length=758

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/756 (54%), Positives = 517/756 (68%), Gaps = 60/756 (8%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLY IR N LGLQ+ RKRYF+L ++ L+S+KA PI+ ++EP+RSA+IDSCI V DNG
Sbjct  1     MEGWLYTIRSNPLGLQFSRKRYFVLHNHVLRSFKANPISEKQEPVRSAVIDSCIRVIDNG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINP-----EKNLRAP  545
             +E+ ++KVFF FT+ +  + ++Q+K GA+S EEAA WIRCL+D A+        KN    
Sbjct  61    KESINKKVFFIFTVYSILDGNNQIKLGASSSEEAAAWIRCLKDVALEEPPPCQAKNFVGS  120

Query  546   AIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEA  707
                 W   R   +    R ++      SS   +A TSDVI P  WKIFG QNGLR+FKEA
Sbjct  121   PTMTWPSLRSESTWMKLRKNSVKWPFRSSVHAEATTSDVIAPSHWKIFGCQNGLRLFKEA  180

Query  708   KDRNPNG-----------------------------KHWDGHPAIMAVGVIDGTSEAIFK  800
             KDR   G                             K WD  PAIMAVGV+DGTSEAIF 
Sbjct  181   KDRGSLGGVGFYSDTIHDCCAQIIFSVYSAEETSCSKLWDDDPAIMAVGVVDGTSEAIFL  240

Query  801   ALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrED  980
             ALMSLGPSRSEWD+C   GS+VE LDGHTDIIH +L + WLPWG+KRRDLLL+RYWRRED
Sbjct  241   ALMSLGPSRSEWDYCVYHGSLVECLDGHTDIIHKKLYSDWLPWGMKRRDLLLQRYWRRED  300

Query  981   DGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYL  1151
             DGTYVILYHSV H KCPPQ GYVRA +KSGG+V+TPVNQG+ STVKHML++DWK   SY 
Sbjct  301   DGTYVILYHSVAHKKCPPQSGYVRAHLKSGGYVVTPVNQGQQSTVKHMLAIDWKLWKSYP  360

Query  1152  RKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVAT  1331
             R + ++SLTI ML  +AALRE+FKAK  +        E    I LP +EK + K +  + 
Sbjct  361   RLSAARSLTILMLMRVAALRELFKAKQRNSSSICLSREWLRHIHLPQTEKPDDKTDTESD  420

Query  1332  ERIEEDT-----TEKYPSACSSIVELDDVADEFFDVPEASDDEHSDH------GWPRSTT  1478
             + IE++       E+  S   S+  L++  DEFFDVPE S+    DH      G P S  
Sbjct  421   KSIEDNNLINNEVEQPASLHVSLSGLNEEPDEFFDVPEESEFSDYDHLESERPGEPSSEL  480

Query  1479  PEYHETPRPKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNM  1646
             P  +   +PKL+SAA FVRKL DLA QK    N QE V  E+    CYG +L KD +  +
Sbjct  481   PPLN-LHQPKLTSAASFVRKLHDLATQKKGYMNLQE-VATEDTKLYCYGNSLRKDLTATL  538

Query  1647  PGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQK  1826
             P SW+  + S FLIRG  YLQD  KI + G L Q+VGADWL SE REDNL +R G IVQ 
Sbjct  539   PSSWSPGNPSLFLIRGRNYLQDKQKIKANGALMQMVGADWLISEKREDNLGSRLGGIVQN  598

Query  1827  YAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIP  2006
             +AAQ  PEFFF+VN Q+PG  RY+LA+Y+M+K+PL ++P L +FVNGDDA+RNS+FKLIP
Sbjct  599   HAAQGGPEFFFIVNFQIPGTPRYTLAMYFMMKSPLEDHPSLYKFVNGDDAYRNSRFKLIP  658

Query  2007  YISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNN  2186
             ++S+GSWIVKQSVGK+  L+ Q+LE  YF+G+NY+E+DVDV SSTVAR V NLV+GY ++
Sbjct  659   HVSEGSWIVKQSVGKRGSLLCQTLEAQYFRGKNYMEVDVDVASSTVARSVCNLVIGYFSS  718

Query  2187  LVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             +V+E+AF++Q +T EELPE LLGT RLN +D SKA+
Sbjct  719   MVLELAFVIQGNTREELPETLLGTSRLNRVDLSKAL  754



>gb|KEH39335.1| pleckstrin-like (PH) and lipid-binding START domain protein [Medicago 
truncatula]
Length=666

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/654 (59%), Positives = 486/654 (74%), Gaps = 16/654 (2%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQ+ RKRYF+L D+ L+S+K++P +  ++P+RSAI+DSCI V DNG
Sbjct  16    MEGWLYLIRCNRFGLQFSRKRYFVLHDHLLRSFKSIPNSTDQDPVRSAIVDSCIRVMDNG  75

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW  560
             RE+ +RKVFF FTL NTS+H+DQLK GA+ PEEAARWI+   +A++         + R+W
Sbjct  76    RESINRKVFFIFTLYNTSDHNDQLKLGASRPEEAARWIQSFNEASLKGAPEAIGCSKRRW  135

Query  561   QPFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWD  740
             Q F L  SS  +R+   S      +SDVI P  W IFG QNGLR+F+EAKDR   GK WD
Sbjct  136   QSFSLRGSS--SRSQQYSIDWTLSSSDVIAPSTWTIFGCQNGLRLFREAKDRGSCGKKWD  193

Query  741   GHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHW  920
              HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +G+VVEHLDGHTDIIH QL + W
Sbjct  194   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQLYSDW  253

Query  921   LPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVNQG  1100
             LPWG+KRRDLLLRRYWRREDDGTYVILYHSV H KCP Q+GYVRA +KSGG+VI+P N G
Sbjct  254   LPWGIKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGYVRACLKSGGYVISPANMG  313

Query  1101  KSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YFPDPAMNEL  1268
             K S VKHML++DWK   SYL+ +++ S+TI MLG +AALRE+F+ + G+    D +  EL
Sbjct  314   KQSVVKHMLAIDWKSWRSYLKSSSAYSMTIQMLGRVAALRELFRTRLGNCTLSDYSSGEL  373

Query  1269  TIDIQ-LPVSEKEEIKNEVVATERIEEDT---TEKYPSACSSIVELDDVADEFFDVPEAS  1436
             T + +  P  E      ++ A E   +++    E   S  +S+V L+D  DEF+DV E S
Sbjct  374   TRNRRNSPKEEYASSDTQIQADENNHDNSIGEVEPTQSEHASLVSLNDADDEFYDVMEPS  433

Query  1437  DDEHSDHGWPRSTTPEYHETPR-PKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAK  1601
             + + S+ GW    + +  +  R  KLS+AA FVRKL DLAV K    + QE+V  EE   
Sbjct  434   NCDESEKGWMTECSHQKSQDIRHQKLSTAANFVRKLHDLAVHKRGYMDLQEMV-REESIS  492

Query  1602  GCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEI  1781
               YG TLPKD +  +P S   AD S+FLIRGE YL+DH K+ +KGTL Q+V ADWL+S+ 
Sbjct  493   CPYGSTLPKDPTCTLPCSLTEADPSTFLIRGENYLEDHQKVKAKGTLMQMVAADWLRSDR  552

Query  1782  REDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFV  1961
             RED+L  RPGSIVQKYAAQ  PEFFF+VNIQVPG+T YSLALYYM+ TP+ + PLL+ F+
Sbjct  553   REDDLGGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPLLDSFI  612

Query  1962  NGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDV  2123
              GD+AFRNS+FKLIPYIS+GSWIVKQSVGKK+CL+GQ+LE+NYF+G+NYLE+ +
Sbjct  613   KGDNAFRNSRFKLIPYISEGSWIVKQSVGKKACLVGQALEINYFQGKNYLEVSL  666



>ref|XP_011044395.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X2 [Populus 
euphratica]
Length=657

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/631 (62%), Positives = 483/631 (77%), Gaps = 26/631 (4%)
 Frame = +3

Query  468   SPEEAARWIRCLRDAAINPEKNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDA  629
             SPEEAARWI  +++AA+    ++   +    Q FRLS  S +        T  SS   D 
Sbjct  27    SPEEAARWIHSIQEAALKGAHSIVGCSRSSCQSFRLSGPSWVNHNKPIDWTHCSSAHTDL  86

Query  630   MTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALM  809
             +T DVI P PW IFG QNGLR+FKEAKDR+ +GK WD HPAIMAVGV+DGTSEAIF+ LM
Sbjct  87    VT-DVIAPSPWTIFGCQNGLRLFKEAKDRDSHGK-WDDHPAIMAVGVVDGTSEAIFQTLM  144

Query  810   SLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGT  989
             SLGPSRS+WDFCF +GSVVEHLDGH DIIH +L   WLPWG+KRRD LLRRYWRREDDGT
Sbjct  145   SLGPSRSKWDFCFYKGSVVEHLDGHMDIIHKELYNDWLPWGMKRRDFLLRRYWRREDDGT  204

Query  990   YVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKT  1160
             YVILYHSV H KCPPQ+GYVRA +KSGG+VI+PVN  + S VKHML+VDWKS   YLR +
Sbjct  205   YVILYHSVYHKKCPPQKGYVRACLKSGGYVISPVNHERRSVVKHMLAVDWKSWKSYLRTS  264

Query  1161  TSKSLTIDMLGGIAALREMFKAKSGSY-FPDPAMNELTIDIQLPVSEKEEI------KNE  1319
             +++S+TI MLG +AALRE+FKAK G+    D +  EL  +++L   E ++        N+
Sbjct  265   SARSITIRMLGRVAALRELFKAKLGNCPSSDFSSGELVGNMRLHQIEGDQRIDAQTPTND  324

Query  1320  VVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--E  1493
              +  E + E+  +K PS  +S+V L+D ADEFFDVPE SD +  ++ W     PE +  +
Sbjct  325   GMTKECMNEEV-DKTPSEYASLVGLNDPADEFFDVPEPSDYDQLENDWSSDFDPEMYSQD  383

Query  1494  TPRPKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWA  1661
               +PKLS+AA FV+KL +LAVQK    + QE+V  E+    CYG TL KD ++ +P SWA
Sbjct  384   ARQPKLSTAAGFVKKLHELAVQKRGYMDLQEMVR-EDSISCCYGTTLLKDPTFTLPSSWA  442

Query  1662  AADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQD  1841
              AD SSFLIRG+ YL+D  K  + GTL Q+V ADW++S+ RED+LA RPGSIVQKYAAQ 
Sbjct  443   MADPSSFLIRGKNYLEDQKKFKANGTLMQMVAADWIRSDKREDDLAGRPGSIVQKYAAQG  502

Query  1842  RPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKG  2021
              PEFFF+VNIQVPG+T YSLALYYM+ TP+ + PLLE F+ GDDA+RNS+FKLIPYISKG
Sbjct  503   GPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPLLESFIKGDDAYRNSRFKLIPYISKG  562

Query  2022  SWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEM  2201
             SWIVKQSVGKK+CLIGQ+LEMNYF+G+NYLEL VD+GSSTVARGV++LVLGYL+NLVIEM
Sbjct  563   SWIVKQSVGKKACLIGQALEMNYFRGKNYLELGVDIGSSTVARGVVSLVLGYLSNLVIEM  622

Query  2202  AFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             AFL+QA+T+EELPE+LLGTCRLNHLDASKAV
Sbjct  623   AFLIQANTDEELPEYLLGTCRLNHLDASKAV  653



>ref|XP_009421353.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/732 (55%), Positives = 500/732 (68%), Gaps = 32/732 (4%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWL L+R NRLGL Y RKRYF+LE N L  YK VP + RE PLRS +I S   + DNG
Sbjct  1     MEGWLQLVRCNRLGLHYTRKRYFVLEGNALNCYKGVPASDREVPLRSVLICSSTRITDNG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----NPEKNLRAPA  548
             RE+  R V + FT+C+TSN  +QLK GA S EEAARWIR + +AA     N E+N  A  
Sbjct  61    RESIQRNVLYIFTICSTSNPSNQLKLGARSSEEAARWIRNIIEAAFMENPNKEENNVACT  120

Query  549   IRKWQPFRLS---VSSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAK  710
              R+ Q FRL+   V SRM   D    S    D +  D I P  W I G +NGLR+FKE K
Sbjct  121   KRRRQSFRLNHRNVRSRMHSIDWTVHSCIHADPLIFDAISPSMWMIIGCKNGLRLFKEEK  180

Query  711   DRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
             D     KH D HP +MAVGVID +SEAIF+ +MSLG SRSEWDFC   G+VVE LD HTD
Sbjct  181   DVGSPTKHRDDHPGMMAVGVIDASSEAIFQTVMSLGQSRSEWDFCLLEGNVVESLDEHTD  240

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             IIH +L   WLPWG+KRRDL+L+R WR+EDDGTYVILYHSVIH KC P+ GYVRA +KSG
Sbjct  241   IIHKKLRGDWLPWGMKRRDLILKRSWRKEDDGTYVILYHSVIHYKCQPERGYVRACLKSG  300

Query  1071  GHVITPVNQGKSSTVKHMLSVDWKSYLRK--TTSKSLTIDMLGGIAALREMFKAKSGS-Y  1241
             G+ I+PVNQGK S VKHML++DWK +     T+  S+T+ MLG +AALRE F+AK G+  
Sbjct  301   GYEISPVNQGKQSVVKHMLAIDWKFWKSNMFTSYASITMKMLGRVAALREFFRAKLGNCA  360

Query  1242  FPDPAMNELTIDIQLPVSEKEEIK---NEVVATERIEEDTTE------KYPSACSSIVEL  1394
             F D  ++ LT +I LP  E E+IK     V    +IE    E      ++P   SS  +L
Sbjct  361   FSDFTLDGLTREIILPQIE-EQIKLDMQTVDENSKIENFVEESQMSPPRHPGNGSS-NQL  418

Query  1395  DDVADEFFDVPEASDDEHSDHGWPRSTTPE---YHETPRPKLSSAACFVRKLQDLAVQKN  1565
             +D ADEFFDV   S+ + +++  P     +     +  + KL + A F++KL D+     
Sbjct  419   NDAADEFFDVLTESEYDQTENYCPSDEGMQSQLIQDQCQDKLPTTAVFIKKLHDITGSTL  478

Query  1566  FQEIVGGEEGAKG-----CYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITS  1730
                    E+ + G      YG TLPKD S  M  SWA AD S+F IRGE YL DH K+ +
Sbjct  479   CYFCAELEDESIGDSMPCSYGTTLPKDPSCRMACSWAMADPSTFAIRGESYLHDHQKVKA  538

Query  1731  KGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALY  1910
               TL Q+V ADWL+S+ REDN+  R G IVQKYAAQ   EFFFVV++QVPG T YSLALY
Sbjct  539   NTTLMQMVAADWLKSDKREDNVGNRTGGIVQKYAAQGGSEFFFVVHMQVPGLTTYSLALY  598

Query  1911  YMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNY  2090
             YM+ TPL   P L+ FV GDD++RNS+FKLIP ISKGSW+VKQSVGKK+CLIGQ+LE+NY
Sbjct  599   YMMDTPLENVPFLKNFVRGDDSYRNSRFKLIPCISKGSWLVKQSVGKKACLIGQALEINY  658

Query  2091  FKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLN  2270
             F G NY+EL +DVGSS++A+GV++LV+GYLN+LVIEMAFL+Q DT+EELPE LLGTCRLN
Sbjct  659   FHGSNYIELAIDVGSSSIAKGVVSLVVGYLNSLVIEMAFLIQGDTQEELPEVLLGTCRLN  718

Query  2271  HLDASKAVHTNS  2306
             HLD S+AV  +S
Sbjct  719   HLDISQAVQISS  730



>ref|XP_007016767.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
isoform 2 [Theobroma cacao]
 gb|EOY34386.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
isoform 2 [Theobroma cacao]
Length=575

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/573 (65%), Positives = 460/573 (80%), Gaps = 17/573 (3%)
 Frame = +3

Query  621   VDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFK  800
             +D +TSDV+ P  W IFG QNGLR+FKEAKDR+ +GK WD HPAIMAVGV+DGTSEAIF+
Sbjct  1     MDRVTSDVVAPSSWTIFGCQNGLRLFKEAKDRDSHGK-WDDHPAIMAVGVVDGTSEAIFQ  59

Query  801   ALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrED  980
              LMSLGPSRSEWDFCF +GSVVEHLDGHTDI+H QL + WLPWG++RRDLLLRRYWRRED
Sbjct  60    TLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIVHKQLYSDWLPWGMRRRDLLLRRYWRRED  119

Query  981   DGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYL  1151
             DGTYVILYHSV H KCPPQ+  VRA +KSGG+VI+PVN+GK S VKHML++DWK   SYL
Sbjct  120   DGTYVILYHSVFHKKCPPQKSCVRACLKSGGYVISPVNEGKHSVVKHMLAIDWKFWKSYL  179

Query  1152  RKTTSKSLTIDMLGGIAALREMFKAKSGSY-FPDPAMNELTIDIQLPVSEKEEIKNEVVA  1328
             R + ++S+TI ML  +AALRE+FKAK G Y   D +  EL  +++L  SE++ + +    
Sbjct  180   RTSAARSITIRMLERVAALRELFKAKQGKYPSADLSSRELIRNVRLHQSEEDGMVDMCTQ  239

Query  1329  TE--RIEE---DTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH-  1490
              E  +I+E   +  E+ PS  SS+V L+D ADEFFDVPE +D + S+ GW     PE + 
Sbjct  240   IEAGKIKENMCEVMERAPSEHSSLVGLNDAADEFFDVPEPTDYDQSEDGWASDFGPEGYS  299

Query  1491  -ETPRPKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGS  1655
              +T  PKLS+AA FV+KL DLAVQK    + Q+++  E+G    YG TLPKD +  +P S
Sbjct  300   QDTRHPKLSTAAVFVKKLHDLAVQKRGYVDLQDMMR-EDGIFCSYGNTLPKDPTCTLPCS  358

Query  1656  WAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAA  1835
             W AA+ S+FLIRGE YL+D  K  + GTL Q+V ADWL+S+ RED+L  RPG IVQKYAA
Sbjct  359   WTAAEPSTFLIRGENYLEDRKKFKATGTLMQMVAADWLRSDKREDDLGGRPGGIVQKYAA  418

Query  1836  QDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYIS  2015
             Q  PEFFF++NIQVPG+T YSLALYYM+ TP+ ++PLL+ F+NGDDA+RNS+FKLIPYIS
Sbjct  419   QGGPEFFFIINIQVPGSTTYSLALYYMMNTPVEDSPLLQNFINGDDAYRNSRFKLIPYIS  478

Query  2016  KGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVI  2195
             KGSWIVKQSVGKK+CLIGQ+LE+NYF+G+NYLEL +D+GSSTVARGV+NLVLGYLNNLVI
Sbjct  479   KGSWIVKQSVGKKACLIGQALEINYFRGKNYLELGIDIGSSTVARGVVNLVLGYLNNLVI  538

Query  2196  EMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             EMAFL+QA+TEEELPE+LLGTCRLNHLDA+K++
Sbjct  539   EMAFLIQANTEEELPEYLLGTCRLNHLDATKSI  571



>ref|XP_007016769.1| Pleckstrin and lipid-binding START domains-containing protein 
isoform 4 [Theobroma cacao]
 gb|EOY34388.1| Pleckstrin and lipid-binding START domains-containing protein 
isoform 4 [Theobroma cacao]
Length=649

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/634 (61%), Positives = 478/634 (75%), Gaps = 28/634 (4%)
 Frame = +3

Query  192   DGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQ  371
             D  MEGWLY+IR NR+GLQY RKRYF+LED+ LKS+K++PI+  +EP RSAIIDSCI V 
Sbjct  8     DLKMEGWLYIIRSNRIGLQYSRKRYFVLEDHLLKSFKSIPISNLQEPGRSAIIDSCIRVT  67

Query  372   DNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----PEKNLR  539
             DNGRE+ HRKVFF FTL N+SNH+DQLK GA+SPEEAARWI   + AA+     P  ++ 
Sbjct  68    DNGRESIHRKVFFIFTLYNSSNHNDQLKLGASSPEEAARWIHSFQQAALKGGPYPANDV-  126

Query  540   APAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
             A +  +WQ FR S SS     ++      SST +D +TSDV+ P  W IFG QNGLR+FK
Sbjct  127   ACSKSRWQSFRSSGSSHEIHNNSIDWTLYSSTKMDRVTSDVVAPSSWTIFGCQNGLRLFK  186

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             EAKDR+ +GK WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +GSVVEHLDG
Sbjct  187   EAKDRDSHGK-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDG  245

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDI+H QL + WLPWG++RRDLLLRRYWRREDDGTYVILYHSV H KCPPQ+  VRA +
Sbjct  246   HTDIVHKQLYSDWLPWGMRRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKSCVRACL  305

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVD---WKSYLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VI+PVN+GK S VKHML++D   WKSYLR + ++S+TI ML  +AALRE+FKAK 
Sbjct  306   KSGGYVISPVNEGKHSVVKHMLAIDWKFWKSYLRTSAARSITIRMLERVAALRELFKAKQ  365

Query  1233  GSY-FPDPAMNELTIDIQLPVSEKEEIKNEVVATE--RIEE---DTTEKYPSACSSIVEL  1394
             G Y   D +  EL  +++L  SE++ + +     E  +I+E   +  E+ PS  SS+V L
Sbjct  366   GKYPSADLSSRELIRNVRLHQSEEDGMVDMCTQIEAGKIKENMCEVMERAPSEHSSLVGL  425

Query  1395  DDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKLQDLAVQK--  1562
             +D ADEFFDVPE +D + S+ GW     PE +  +T  PKLS+AA FV+KL DLAVQK  
Sbjct  426   NDAADEFFDVPEPTDYDQSEDGWASDFGPEGYSQDTRHPKLSTAAVFVKKLHDLAVQKRG  485

Query  1563  --NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKG  1736
               + Q+++  E+G    YG TLPKD +  +P SW AA+ S+FLIRGE YL+D  K  + G
Sbjct  486   YVDLQDMM-REDGIFCSYGNTLPKDPTCTLPCSWTAAEPSTFLIRGENYLEDRKKFKATG  544

Query  1737  TLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYM  1916
             TL Q+V ADWL+S+ RED+L  RPG IVQKYAAQ  PEFFF++NIQVPG+T YSLALYYM
Sbjct  545   TLMQMVAADWLRSDKREDDLGGRPGGIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYM  604

Query  1917  LKTPLAENPLLERFVNGDDAFRNSKFKLIPYISK  2018
             + TP+ ++PLL+ F+NGDDA+RNS+FKLIPYISK
Sbjct  605   MNTPVEDSPLLQNFINGDDAYRNSRFKLIPYISK  638



>ref|XP_008807464.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Phoenix dactylifera]
Length=656

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/651 (60%), Positives = 475/651 (73%), Gaps = 28/651 (4%)
 Frame = +3

Query  402   VFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----PEKNLRAPAIRKWQPF  569
             +F  F L N +NH+DQLK GA SPEEAARWIR L +AA+       +N  A + R+W   
Sbjct  9     MFSYFMLYNAANHNDQLKLGARSPEEAARWIRSLMEAALKECPIKRENAVACSRRRWPSL  68

Query  570   RLSVS---SRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGK  731
             RLS S   SRM   D    SS   D M SDVI P PW IFG +NGLR+FKEAKD + + K
Sbjct  69    RLSQSKGRSRMHSIDWTVFSSIHTDPMASDVIAPSPWTIFGCKNGLRLFKEAKDGDFHRK  128

Query  732   HWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLT  911
              WD HPAIMAVGV+D T EAIF+ +MSLGPSRSEWDFCF RGSV+EHLDGHTDIIH +L 
Sbjct  129   CWDDHPAIMAVGVVDATPEAIFRTVMSLGPSRSEWDFCFARGSVIEHLDGHTDIIHKKLH  188

Query  912   THWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV  1091
             + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H  C P+ GY+RA +KSGG+VI+P 
Sbjct  189   SDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPA  248

Query  1092  NQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSY-FPDPAM  1259
             NQG  S VKHML++DWK   SYL  +++  +TI MLG +AALRE+F+ K G+Y   D + 
Sbjct  249   NQGNISVVKHMLAIDWKFWKSYLFASSAICITIRMLGRVAALRELFRVKLGNYSHTDFSS  308

Query  1260  NELTIDIQLPVSEKEEIKNEVVATERIE--EDTTEKYPSACSSIVELDDVADEFFDVPEA  1433
             ++   ++QL     E  K+E    E +E  E +  K      S ++L+D ADEFFDV + 
Sbjct  309   HDTEPEVQLA---GENSKSE----EFLEGSEKSPAKPAKTSGSFLQLNDAADEFFDVLDE  361

Query  1434  SDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAK  1601
             S+ + ++  W      +  +  +PKLS+AA  VR+L DLAVQK    + Q+    E+   
Sbjct  362   SEYDQTEVMWTSDAGMQSQDQRQPKLSTAAVLVRRLHDLAVQKRGYVDLQD-ASMEDAIP  420

Query  1602  GCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEI  1781
              CYG TL  D+S+ +  SWA+AD S+FLIR + YLQD  KI + GTL Q+V ADWL+S  
Sbjct  421   CCYGATLQNDSSFTIACSWASADPSTFLIRSKTYLQDRQKIKANGTLMQMVAADWLKSSK  480

Query  1782  REDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFV  1961
             RED+L +R G IVQKYA Q   EFFF+VNIQVPG+T YSLALYYM+ TPL + PLLE FV
Sbjct  481   REDDLGSRAGGIVQKYATQGGREFFFIVNIQVPGSTTYSLALYYMMDTPLEDVPLLENFV  540

Query  1962  NGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSST  2141
              GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G NYLEL +D+GSST
Sbjct  541   RGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFRGGNYLELGIDIGSST  600

Query  2142  VARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             VARGV++LVLGYLNNLVIEMAFLVQ + EEELPE LLGTCRLNHLDA+KAV
Sbjct  601   VARGVVSLVLGYLNNLVIEMAFLVQGNAEEELPEFLLGTCRLNHLDAAKAV  651



>ref|XP_009621798.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Nicotiana tomentosiformis]
Length=623

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/599 (64%), Positives = 457/599 (76%), Gaps = 27/599 (5%)
 Frame = +3

Query  567   FRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNG  728
              RL+ S++  R      T  SS+  DAMTSDV+ P PW IFG QNGLR+FKEAKDR   G
Sbjct  29    LRLNCSNKSYRLSSIDWTVCSSSVTDAMTSDVVAPSPWAIFGCQNGLRLFKEAKDRESLG  88

Query  729   KHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQL  908
             K WD HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFCF +GSV+EHLDGHTDI+H  L
Sbjct  89    K-WDDHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVIEHLDGHTDIVHKLL  147

Query  909   TTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITP  1088
                WLPWG+ RRDLLL+RYWRREDDGTYVILYHSV H KCPPQ+GY+RA +KSGG+VI+P
Sbjct  148   NRDWLPWGMGRRDLLLQRYWRREDDGTYVILYHSVFHQKCPPQKGYIRACLKSGGYVISP  207

Query  1089  VNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAM  1259
             VNQ K S VKHML++DWK   SY+R + ++S+TI MLG +AALRE+F AK G+Y P    
Sbjct  208   VNQEKRSVVKHMLAIDWKFWKSYVRTSAARSITICMLGRLAALRELFSAKIGNYLPSDVS  267

Query  1260  NELTIDIQLPVSEKEEIKNEVVATERIEE-----DTTEKYPSACSSIVELDDVADEFFDV  1424
              EL    +L   E EEIK EV    R+E      D  E+     SS++ L+D ADEFFDV
Sbjct  268   GELVKSKRLRQVE-EEIKLEV--QTRLENGKNLADLEEEVVKTPSSLMGLNDAADEFFDV  324

Query  1425  PEASDDEHSDHGWPRSTTPE-YHETPR-PKLSSAACFVRKLQDLAVQK----NFQEIVGG  1586
              E  D + S++GWP    PE Y +  R PKLSSAA FV+KL DLAVQK    +  E+   
Sbjct  325   SEPLDYDQSENGWPSDFGPETYSQDARHPKLSSAAVFVKKLHDLAVQKRGYVDLHEM--A  382

Query  1587  EEGAKGC-YGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGAD  1763
             +E    C YG TLPKD++ ++P SW   D S+FLIRG  YL D  KI +KGTL Q+VGAD
Sbjct  383   KEDTSSCHYGSTLPKDSTCSLPCSWTETDPSTFLIRGLTYLDDRKKIKAKGTLMQMVGAD  442

Query  1764  WLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENP  1943
             WL+S+ RED+L  RPG IVQKYAA+  PEFFF+V+IQVPG T YSLALYYM+ TPL ++P
Sbjct  443   WLKSDKREDDLGGRPGGIVQKYAAKGGPEFFFIVHIQVPGTTTYSLALYYMMDTPLEDSP  502

Query  1944  LLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDV  2123
             LLE FV GDDA+RNS+FKLIPYISKG WIVKQSVGKK+CLIGQ+LE+NYF+G+NY+EL +
Sbjct  503   LLESFVKGDDAYRNSRFKLIPYISKGPWIVKQSVGKKACLIGQALEINYFRGKNYIELGI  562

Query  2124  DVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAVHT  2300
             D+GSSTVARGV++LV+GYL+NLVIEMAFLVQA+T EELPE+LLGTCRLNHLD +KAV  
Sbjct  563   DIGSSTVARGVVSLVVGYLSNLVIEMAFLVQANTPEELPEYLLGTCRLNHLDVTKAVQV  621



>gb|EMS46709.1| hypothetical protein TRIUR3_29071 [Triticum urartu]
Length=738

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/764 (53%), Positives = 506/764 (66%), Gaps = 103/764 (13%)
 Frame = +3

Query  195   GNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITG------------------  320
             G + G L LIR NRLGLQ  RKRYF+LED+ L+ +KA P                     
Sbjct  9     GEVGGGLSLIRSNRLGLQTSRKRYFVLEDSALRCFKAAPAPSSSSSKRETSRKRYFVLED  68

Query  321   ------------------REEPLRSAIIDSCIHVQDNGRENFHRKVFFTFTLCNTSNHDD  446
                               RE+P+RSA+IDSCI V DNGRE+ HR VF+ FTL N SNH D
Sbjct  69    SALRCFKAAPAPSSSSSKREDPVRSAVIDSCIRVTDNGRESVHRSVFYIFTLYNASNHYD  128

Query  447   QLKFGANSPEEAARWIRCLRDAAI-NPEKN--LRAPAIRKWQPFRLSV-SSRMARTD---  605
             QLK GA S EEAARWIRCL ++A+ +P K+  + A + R+WQ FRLS  S+RM   D   
Sbjct  129   QLKLGARSSEEAARWIRCLMESALKSPRKDEHVVACSHRRWQAFRLSRRSNRMHSIDWTI  188

Query  606   ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTS  785
              SS+  D M SDVI P  W IFG  NGLR+F EAKD    GK+WD HPAIMAVGV+D  S
Sbjct  189   LSSSHNDPMASDVIAPSAWTIFGCTNGLRLFTEAKDGGSRGKYWDDHPAIMAVGVVDANS  248

Query  786   EAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrry  965
             E IF+ LMSLG SRSE          +   D       + L  +W               
Sbjct  249   EDIFQTLMSLGQSRSEG---------MRKRD-------LLLRRYW---------------  277

Query  966   wrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK-  1142
              RRE+DGTYVILYHSV H++C P++GY+RA +KSGG+VI+PV+QG+ S VKHML++DWK 
Sbjct  278   -RREEDGTYVILYHSVFHNRCSPEKGYIRACLKSGGYVISPVSQGRQSVVKHMLAIDWKF  336

Query  1143  --SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YFPDPAMNELTIDIQLPVSEKEEIK  1313
               SYL  +++K +TI        LRE+F+AK+G+    + +  EL  D+ LP    E  K
Sbjct  337   WKSYLLTSSAKYITI-------PLRELFRAKNGNCACMEFSSGELMRDMGLPQGGNEPTK  389

Query  1314  NEVVAT---ERIE------EDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWP  1466
              E  +    ER+E      +  ++++ S+  S+V+L+D  DEFFDVP+ S+ +  +  W 
Sbjct  390   IETQSANECERLEGPVEGPQGGSKRHLSSTGSLVQLNDATDEFFDVPDESEYDQREAMWS  449

Query  1467  RSTTPEYHETPRPKLSSAACFVRKLQDLAVQK-NFQEIVGGEEGAKG-CY-GCTLPKDAS  1637
                +    +    KLSSAA FVRKL DLAVQK  + ++ G  +   G CY G TLPKD+S
Sbjct  450   SDESTHAADQRHAKLSSAAVFVRKLHDLAVQKRGYIDLQGAADADNGPCYYGHTLPKDSS  509

Query  1638  YNMPGSWAAADTSSFLIRGEKYLQDHSK-----ITSKGTLTQIVGADWLQSEIREDNLAA  1802
               MP SW+  D ++FLIRGE YL D  K     I ++ TL Q+VGADW++S+ RED+LA 
Sbjct  510   CTMPSSWSMTDPTTFLIRGESYLLDRQKEIRDPIKAENTLMQMVGADWIKSDKREDDLAG  569

Query  1803  RPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFR  1982
             RPG +VQKYAAQ   +FFF+VNIQVPG+T YSLALYYM+ TPL + PLLERFVNGDD FR
Sbjct  570   RPGGLVQKYAAQGGSKFFFIVNIQVPGSTTYSLALYYMMDTPLEKVPLLERFVNGDDTFR  629

Query  1983  NSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVIN  2162
             NS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G NYLEL VD+GSSTVARGV++
Sbjct  630   NSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFRGSNYLELGVDIGSSTVARGVVS  689

Query  2163  LVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             LVLGYLNNLVIEMAFLVQ +T+EELPE LLGTCRLN+LDASKAV
Sbjct  690   LVLGYLNNLVIEMAFLVQGNTQEELPEFLLGTCRLNYLDASKAV  733



>ref|XP_011041016.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Populus euphratica]
Length=609

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/603 (63%), Positives = 466/603 (77%), Gaps = 23/603 (4%)
 Frame = +3

Query  552   RKWQPFRLSVSSRM-ARTDASSTPV---DAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRN  719
             + W P R   S R  ++      P    +A+TSDVI P  WKIFG QNGLR+FKEAKD +
Sbjct  6     KNWPPSRFGSSKRADSKRSVGYYPFLQNEAVTSDVIAPSTWKIFGCQNGLRLFKEAKDWD  65

Query  720   PNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIH  899
               G+HWD HPAIMAVGV+DGT EAIF+ LMSLG SRSEWDFCF RGSVVEHLDGHTDI+H
Sbjct  66    SRGRHWDDHPAIMAVGVVDGTPEAIFRTLMSLGASRSEWDFCFYRGSVVEHLDGHTDILH  125

Query  900   MQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHV  1079
              +L ++WLPWG++RRDLLLRRYWRRE+DGTYVILYHSVI  KCPPQ+GYVRA +KSGG+V
Sbjct  126   KKLYSNWLPWGMRRRDLLLRRYWRREEDGTYVILYHSVIQKKCPPQKGYVRACLKSGGYV  185

Query  1080  ITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPD  1250
             ITPVNQG+ S VKHML++DWK    YLR  +++S+TI ML  IAALRE+F+AKSG++  D
Sbjct  186   ITPVNQGRESLVKHMLAIDWKFWKVYLRPPSARSITIRMLERIAALRELFRAKSGNHPSD  245

Query  1251  PAMNELTIDIQLPVSEKEEIKNEVVATERIE------EDTTEKYPSACSSIVELDDVADE  1412
              + ++ ++   LP +  E+I++E    ++ E      E+  EK  S   S++ L+D +DE
Sbjct  246   FSSSDSSVKTMLPKAGMEDIESEDKGQQKFEQNADLKENEAEKKNSGRRSLMSLNDASDE  305

Query  1413  FFDVPEASDDEHSD---HGW--PRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK----N  1565
             FFD P++++D   D   +GW   +S           +LSSAA FV KL DLAVQK    +
Sbjct  306   FFDFPDSNEDMDFDLLENGWYPEKSQEQPASHICLHRLSSAAVFVNKLHDLAVQKKGYID  365

Query  1566  FQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLT  1745
             FQE+   +      YG TL KD++Y++P SWA A+ S+FLIRGE YL+D  KI +KG+L 
Sbjct  366   FQEL-PKDANVATSYGNTLQKDSTYSLPCSWATAEPSTFLIRGENYLKDSQKIKAKGSLM  424

Query  1746  QIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKT  1925
             Q+VGADWL+S+ RED+L +RP SI+QKYAAQ RPEFFFV+NIQVPGAT+Y+LALYYMLKT
Sbjct  425   QMVGADWLRSDHREDDLGSRPESIIQKYAAQGRPEFFFVINIQVPGATQYTLALYYMLKT  484

Query  1926  PLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQN  2105
             PL E PLL  FV+GDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LEM+YF+G+N
Sbjct  485   PLEETPLLHSFVHGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEMHYFRGKN  544

Query  2106  YLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDAS  2285
             YLELD+DVGSSTVARGV++LVLGYLNNLVIEMAFLVQ + EEELPE LLGTCRLN+LD S
Sbjct  545   YLELDIDVGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNNEEELPEMLLGTCRLNNLDVS  604

Query  2286  KAV  2294
             K+V
Sbjct  605   KSV  607



>gb|EYU36177.1| hypothetical protein MIMGU_mgv1a003017mg [Erythranthe guttata]
Length=615

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/613 (62%), Positives = 465/613 (76%), Gaps = 22/613 (4%)
 Frame = +3

Query  516   INPEKNLR--APAIRKWQPFRLSVSSRMAR----TDASSTPVDAMTSDVIGPCPWKIFGI  677
             + P++N R    A R+ +  RL+ SS+       T  SS+  DAMTSDV+ P  WK+FG 
Sbjct  1     MQPDQNQRDFEFAARELRSLRLNGSSKHTHSIDWTVYSSSVSDAMTSDVVAPSAWKVFGC  60

Query  678   QNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRG  857
             QNGLR+FKEAKD+    K WD HPAIMAVGV+D TSEAIF+ LMSLGPSRSEWDFC+ +G
Sbjct  61    QNGLRLFKEAKDKEFREK-WDDHPAIMAVGVVDATSEAIFQTLMSLGPSRSEWDFCYYKG  119

Query  858   SVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQ  1037
             SV+EHLDGH+DI+HM L  HWLPWG+KRRDLLLRRYWRREDDGTYVILYHSVIH KCPP+
Sbjct  120   SVIEHLDGHSDIVHMLLYRHWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVIHHKCPPK  179

Query  1038  EGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAAL  1208
               YVRA +KSGG+VI+P NQG  S VKHML++DWK   SY++ + ++S+TI MLG +AAL
Sbjct  180   RHYVRACLKSGGYVISPANQGNRSVVKHMLAIDWKFWKSYVQTSAARSITISMLGRLAAL  239

Query  1209  REMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVA------TERIEEDTTEKYPS  1370
             RE+F+AK      D +  EL  +     + KE +K EV A        R  ++   K PS
Sbjct  240   RELFRAKLDCSASDFSSGELMSNNSTQQTRKE-LKVEVQARLENGQNRRSMDEDMVKTPS  298

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPE-YHETPR-PKLSSAACFVRKLQ  1544
               SS+V L+D ADEFFDVPE  + + S++GWP    P+ Y +  R PKLSSAA FV++L 
Sbjct  299   ERSSLVGLNDAADEFFDVPEPIEYDQSENGWPSDFAPDSYSQDARQPKLSSAAVFVKRLH  358

Query  1545  DLAVQKN-FQEI--VGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDH  1715
             DLAVQK  + ++  V  E+     YG TL KD + N   SW + D S+FLIRG+ YL D 
Sbjct  359   DLAVQKKGYADLHEVAREDSLSCKYGYTLSKDPTCNSLCSWTSTDPSTFLIRGKTYLDDR  418

Query  1716  SKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRY  1895
              KI ++GTL ++VGADWL+S+ RED+L  RPG IVQKYAA+  PEFFF+VNIQVPG+T Y
Sbjct  419   KKIKARGTLMEMVGADWLRSDKREDDLGGRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTY  478

Query  1896  SLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQS  2075
             +LALYYM+ TPL E PLLE FVNGDD++RNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+
Sbjct  479   NLALYYMMNTPLEEAPLLESFVNGDDSYRNSRFKLIPYISKGSWIVKQSVGKKACLVGQA  538

Query  2076  LEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLG  2255
             LE+NYF+G+NYLEL +D+GSSTVARGV++LVLGYLNNLVIEMAFLVQA+T EELPE+L+G
Sbjct  539   LEINYFRGKNYLELGIDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQANTPEELPEYLVG  598

Query  2256  TCRLNHLDASKAV  2294
             TCRLNHLD SK+V
Sbjct  599   TCRLNHLDVSKSV  611



>gb|KDP44376.1| hypothetical protein JCGZ_20056 [Jatropha curcas]
Length=585

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/575 (64%), Positives = 451/575 (78%), Gaps = 15/575 (3%)
 Frame = +3

Query  609   SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSE  788
             S+   +AMTSDV+ P PWKIFG QNGLR+FKEAKD + +G +WD H AIMAVGV+DGTSE
Sbjct  11    STLHTEAMTSDVLAPSPWKIFGCQNGLRLFKEAKDWDSHGGYWDDHAAIMAVGVVDGTSE  70

Query  789   AIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrryw  968
             AIF+ LMSLGP RSEWDFCF RGS+VEHLDGHTDIIH QL + WLP  +KRRDLLLRRYW
Sbjct  71    AIFRTLMSLGPLRSEWDFCFFRGSMVEHLDGHTDIIHKQLYSDWLPRWMKRRDLLLRRYW  130

Query  969   rrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS-  1145
             RREDDGTYVILYHSVIH KCPPQ GYVRA +KSGG VITP+NQG+ S VKHML+VDWKS 
Sbjct  131   RREDDGTYVILYHSVIHKKCPPQNGYVRACLKSGGFVITPINQGRRSLVKHMLAVDWKSW  190

Query  1146  --YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNE  1319
               YLR +  +++TI ML  +AALRE+F ++  +Y  D    + T  + LP  EK + K E
Sbjct  191   KLYLRPSAERAMTIRMLERVAALRELFNSRDENY-ADFLSGDSTEQVVLPQIEKLDFKLE  249

Query  1320  VVATERIEEDTTE-KYPSACSSIVELDDVADEFFDVPEASDD---EHSDHGWPRSTTPEY  1487
             V  +E IE + T+ +     +S+  L+   DEFFDVP+A+D    EH  + W    +PE 
Sbjct  250   VKGSENIESNLTQNEVEKTSTSLTCLNSSPDEFFDVPDANDMMDFEHMGNDWSSKISPEI  309

Query  1488  HETPR---PKLSSAACFVRKLQDLAVQKN-FQEI--VGGEEGAKGCYGCTLPKDASYNMP  1649
              +TP    P+LSSAA  V+KL DLAVQK  + ++     E+     +G TL KD + ++P
Sbjct  310   -QTPSIHPPRLSSAAGIVKKLHDLAVQKKGYTDLHEAAKEDSISCSFGSTLQKDPTCSLP  368

Query  1650  GSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKY  1829
              +WAAA+ SSFLIRG+ YL+D  K+ +KGTL Q+VGADWL+S+ RED+L  RP SIVQKY
Sbjct  369   CTWAAAEPSSFLIRGQNYLKDREKVKAKGTLMQMVGADWLRSDQREDDLGGRPESIVQKY  428

Query  1830  AAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPY  2009
             A+Q+RPEFFF+VNIQVPG+T Y+LALYYMLKTPL E P+L  FVNGDDA+RNS+FKLIPY
Sbjct  429   ASQNRPEFFFIVNIQVPGSTLYTLALYYMLKTPLEETPVLYNFVNGDDAYRNSRFKLIPY  488

Query  2010  ISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNL  2189
             ISKGSWIVKQSVGKK+CL+GQ+LE +Y +G+NYLEL++DVGSSTVARGV+NLVLGYLNNL
Sbjct  489   ISKGSWIVKQSVGKKACLVGQALESHYIRGKNYLELEIDVGSSTVARGVVNLVLGYLNNL  548

Query  2190  VIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             VIEMAFL+QA+TEEELPE LLGTCRLNHLDA+K+V
Sbjct  549   VIEMAFLIQAETEEELPEFLLGTCRLNHLDAAKSV  583



>ref|XP_006599998.1| PREDICTED: uncharacterized protein LOC100794533 [Glycine max]
Length=697

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/725 (52%), Positives = 495/725 (68%), Gaps = 52/725 (7%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M  P S+G MEGWLY+   NR+GL   RKRYFIL+++ L+S+K  P++            
Sbjct  1     MAAPHSEGVMEGWLYIFASNRIGLHCSRKRYFILKESFLRSFKDKPVS------------  48

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
                            KVFFTFT+ N SN  DQLK GA+S EEAA+WIR L+DAA+    N
Sbjct  49    -------------LMKVFFTFTVYNASNQIDQLKLGASSSEEAAKWIRLLKDAALKENSN  95

Query  522   PEKNLRAPAIRKWQPFRLSVSSR------MARTDASSTPVDAMTSDVIGPCPWKIFGIQN  683
              E NL   + +K    R+  S R      +     S    +AM SDVI P  WKIF I N
Sbjct  96    SELNLVNTSKKKHSSLRMGGSKRTNWKHYVEWNFQSCIYTEAMISDVIAPSQWKIFSINN  155

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEA+D + +G  W  HP +MAVGV+DGTSE IF  LMSLG SRSEWDFC  +GSV
Sbjct  156   GLRMFKEARDWDSHGNKWGTHPVMMAVGVVDGTSEEIFHTLMSLGSSRSEWDFCTYQGSV  215

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             V+H+D HTDIIH++L   WLPWG+K RD LLRRYWRRED+GTYV+L+HSV H  CPPQ G
Sbjct  216   VDHIDDHTDIIHVKLYNDWLPWGMKPRDFLLRRYWRREDNGTYVLLFHSVYHKICPPQRG  275

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA++KSGG ++TP+N+GK S VKHML++DWK    YL  ++++  TI ML  +AALRE
Sbjct  276   YVRASLKSGGFLVTPINKGKQSLVKHMLAIDWKLWKLYLSSSSARFSTIRMLERVAALRE  335

Query  1215  MFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVEL  1394
              FKAK+G+   +P   E+ +D +  V+E+     E V    ++ +T+ +     +S++ L
Sbjct  336   FFKAKAGNCSSEPI--EIAVDTKNEVTEENSKAVEGVLEGEVDGETSRR-----TSLMGL  388

Query  1395  DDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETP--RPKLSSAACFVRKLQDLAVQK--  1562
             DD +DEFFDV E  + +  ++ W  +   E H      PK+SSA    +KLQDL+VQK  
Sbjct  389   DD-SDEFFDVSEPKNYDEFENEWHSAPLSEQHSQTDYHPKMSSADGLAKKLQDLSVQKKG  447

Query  1563  --NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKG  1736
               + QE    +      YG TL KD+S N+P SW  +D S F IRG+ YL+D  K+ ++ 
Sbjct  448   YMDLQETSSRDNSEPCPYGATLQKDSSCNLPCSWDESDASLFYIRGKTYLKDKKKVKAER  507

Query  1737  TLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYM  1916
             TL Q+VGADW+QS  R+D+L +RPGSIVQ+Y    RPEFFFVVN QVPG++ YS+ LYYM
Sbjct  508   TLMQMVGADWIQSNSRQDDLCSRPGSIVQQYEKNGRPEFFFVVNFQVPGSSLYSIGLYYM  567

Query  1917  LKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFK  2096
             +KTPL +NPLL  FV+GDDA+RNS+FKLIPYI KG WIVKQSVG K  L+G++L++ Y +
Sbjct  568   MKTPLEDNPLLHSFVHGDDAYRNSRFKLIPYIFKGPWIVKQSVGNKPSLLGKALDIRYIR  627

Query  2097  GQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHL  2276
             G+NYLE+D+++GSSTVARGV+NLVLGYLNNLV+ MAFL+Q +TE+ELPE L+GT +LNHL
Sbjct  628   GRNYLEVDINIGSSTVARGVVNLVLGYLNNLVVGMAFLIQGNTEKELPEVLIGTSQLNHL  687

Query  2277  DASKA  2291
             D +KA
Sbjct  688   DTAKA  692



>ref|XP_002534384.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27998.1| conserved hypothetical protein [Ricinus communis]
Length=640

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/664 (58%), Positives = 468/664 (70%), Gaps = 57/664 (9%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M MP + G MEGWLY IR NR GLQ+ RKRYFILE+NCLK YK +PI+  EEP+RSA +D
Sbjct  1     MDMPQNIGRMEGWLYTIRSNRFGLQFSRKRYFILEENCLKCYKTIPISEAEEPVRSATVD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN  533
             SCI V DNGRE+ +RKVFF FTL +T NH+DQLK GA S EEAA WIR L++A +    N
Sbjct  61    SCIRVTDNGRESINRKVFFIFTLYSTLNHNDQLKLGARSSEEAAEWIRSLQNA-LTKVPN  119

Query  534   LRAPAIRKWQPFRLSVSSRM---ARTDASST-PVDAMTSDVIGPCPWKIFGIQNGLRIFK  701
                  I      RLSV+ R+      D  ST   +AMTSDVI P PWKIFG QNGLR+FK
Sbjct  120   YSFDFIMLSCFNRLSVTKRVDCKRLIDYYSTLHTEAMTSDVIAPSPWKIFGCQNGLRLFK  179

Query  702   EAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDG  881
             EAKD       WD    +                         +WD+CF RGS+VEHLDG
Sbjct  180   EAKD-------WDSSGGV-------------------------KWDYCFYRGSMVEHLDG  207

Query  882   HTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATV  1061
             HTDIIH QL   W P GLKRRDLLLRRYWRR+DDGTYVILY SVIH KCPPQ+GYVRA +
Sbjct  208   HTDIIHKQLYNDWFPRGLKRRDLLLRRYWRRDDDGTYVILYQSVIHKKCPPQKGYVRACL  267

Query  1062  KSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKS  1232
             KSGG+VITP+NQG  S VKHML+VDWKS   Y+R ++ +S+TI M+  +AALRE+F+AK+
Sbjct  268   KSGGYVITPLNQGTRSLVKHMLAVDWKSWKLYMRPSSERSITIRMIERVAALRELFRAKA  327

Query  1233  GSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEED---TTEKYPSACSSIVELDDV  1403
             G+Y  D    E++  I LP  EK ++  E    E+IE+D     E       S+  L++ 
Sbjct  328   GNY-SDFRSGEISRQIMLPQIEKVDMNVEDETLEKIEQDHNSIEEGTGKLSRSLTGLNNA  386

Query  1404  ADEFFDVPEASD--DEHSDHGWP-RSTTPEYHETPRPKLSSAACFVRKLQDLAV-QKNFQ  1571
             +DEFFDVP A++  D  SD+ WP  ST P        +LSSAA  V+KL DLAV +KN+ 
Sbjct  387   SDEFFDVPNANEMMDCDSDNEWPSESTVP-------LRLSSAAGLVKKLHDLAVHKKNYV  439

Query  1572  EIVG--GEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLT  1745
             ++ G  G++     YG TL KD S  +P SWAAAD S+FLIRGE YL+DH K+ SKGTL 
Sbjct  440   DLQGLTGKDSTVCFYGATLQKDPSCTLPCSWAAADPSTFLIRGENYLRDHKKVKSKGTLM  499

Query  1746  QIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKT  1925
             Q+VGADWL+S  RED+L +RP SIVQKYA Q RPEFFF+VNIQ+PG++ ++LA+YYMLKT
Sbjct  500   QMVGADWLRSSHREDDLGSRPDSIVQKYATQGRPEFFFIVNIQIPGSSMHTLAMYYMLKT  559

Query  1926  PLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQN  2105
             PL + PLL++FVNGDDAFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G+ 
Sbjct  560   PLEDTPLLQKFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEVNYFRGKT  619

Query  2106  YLEL  2117
             YLE+
Sbjct  620   YLEM  623



>ref|XP_002467069.1| hypothetical protein SORBIDRAFT_01g019140 [Sorghum bicolor]
 gb|EER94067.1| hypothetical protein SORBIDRAFT_01g019140 [Sorghum bicolor]
Length=725

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/756 (50%), Positives = 474/756 (63%), Gaps = 133/756 (18%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLIR NR GLQY RKRYF+LED  L+ +K+ P + RE+P+RSAIIDSCI V DNG
Sbjct  40    MEGWLYLIRSNRFGLQYSRKRYFVLEDAALRCFKSAPSSKREDPVRSAIIDSCIRVTDNG  99

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW  560
             RE+ HR  F+ FTL N SNH DQLK    SP +    + C               + R+W
Sbjct  100   RESLHRSDFYIFTLYNASNHYDQLK----SPRKDEHIVAC---------------SHRRW  140

Query  561   QPFRLSV--------------------------------SSRMARTDA----------SS  614
             Q FRL++                                  R++R +           SS
Sbjct  141   QAFRLAIDVNSENPHEISCNNLHPTHYPNTIQRGNLTNSEKRLSRRNRQMHSIDWTLFSS  200

Query  615   TPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                D M SDVI P PW IFG +NGLR+F EA D    GK+WD HPAIMAVGV+D  SEA+
Sbjct  201   AHNDPMASDVIAPSPWTIFGCRNGLRLFTEANDGGSRGKYWDDHPAIMAVGVVDANSEAV  260

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ LMSLG SRSE          +   D       + L  +W                RR
Sbjct  261   FQTLMSLGQSRSEG---------MRKRD-------LLLRRYW----------------RR  288

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---S  1145
             EDDGTY                         GG+VI+PVNQG+ S VKHML++DWK   S
Sbjct  289   EDDGTY------------------------GGGYVISPVNQGRQSVVKHMLAIDWKFWKS  324

Query  1146  YLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YFPDPAMNELTIDIQLPVSEKEEIKNEV  1322
             YL  +++K +TI MLG +AALRE F+AK+G+    + +  ELT D+ LP  E + I  E+
Sbjct  325   YLFTSSAKYITIRMLGRVAALREFFRAKNGNCACMEFSSGELTRDMGLPQGENQRINLEI  384

Query  1323  VA---TERIEEDT------TEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRST  1475
                    R+E  T      + ++ ++ SS V+L+D  DEFFDVP+ S+ +  +  +P   
Sbjct  385   QQENENRRLEGPTEGSVGGSNRHLNSTSSFVQLNDATDEFFDVPDESEYDQREVMFPSDE  444

Query  1476  TPEYHETPRPKLSSAACFVRKLQDLAVQK-NFQEIVGGEEGAKG--CYGCTLPKDASYNM  1646
             +    +    KLS+AA FV++L DLAVQK  + ++ G  +   G  CYG TLPKD+SY +
Sbjct  445   STHASDQRHAKLSTAAVFVKRLHDLAVQKRGYVDLQGAADADNGPCCYGYTLPKDSSYAV  504

Query  1647  PGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQK  1826
             P +WA  D ++FLIRGE YL D  KI +  TL Q+VGADW++S+ RED+LA RPG +VQK
Sbjct  505   PSTWAMTDPTTFLIRGETYLHDRLKIKANSTLMQMVGADWIKSDKREDDLAGRPGGLVQK  564

Query  1827  YAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIP  2006
              AAQ   +FFFVVNIQVPG+T YSLALYYM+ TPL + PLLERFVNGDDAFRNS+FKLIP
Sbjct  565   CAAQGGTKFFFVVNIQVPGSTTYSLALYYMMDTPLEKVPLLERFVNGDDAFRNSRFKLIP  624

Query  2007  YISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNN  2186
             YISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G NYLEL VD+GSSTVARGV++LVLGYLNN
Sbjct  625   YISKGSWIVKQSVGKKACLVGQALEINYFRGNNYLELGVDIGSSTVARGVVSLVLGYLNN  684

Query  2187  LVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             LVIEMAFLVQ +T EELPE LLGTCRLN+LDASKAV
Sbjct  685   LVIEMAFLVQGNTYEELPEFLLGTCRLNYLDASKAV  720



>ref|XP_008385406.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like, partial 
[Malus domestica]
Length=564

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/576 (61%), Positives = 432/576 (75%), Gaps = 32/576 (6%)
 Frame = +3

Query  612   STPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEA  791
             S   DA+TSDVI P PW IFG QNGLR+FKEAKDR+ +GK WD HPAIMAVGV+DG SE 
Sbjct  2     SAQTDAVTSDVIAPXPWTIFGCQNGLRLFKEAKDRDSHGK-WDDHPAIMAVGVVDGISEG  60

Query  792   IFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywr  971
             IF+ LMSLGPSRS+              DGHTDIIH QL + WLPWG+KRRDLLLRRYWR
Sbjct  61    IFQTLMSLGPSRSD-------------JDGHTDIIHKQLYSDWLPWGMKRRDLLLRRYWR  107

Query  972   rEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---  1142
             REDDGTYVILYHSV H +CPPQ+GYVRA +KSGG+VITPVNQ K S VKHML++DWK   
Sbjct  108   REDDGTYVILYHSVFHKRCPPQKGYVRACLKSGGYVITPVNQXKQSVVKHMLAIDWKFWK  167

Query  1143  SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEV  1322
             SYL+ ++++ +TI MLG +AALRE F+ +      + ++ EL  +  L  +E +   +  
Sbjct  168   SYLQSSSARXMTIKMLGRVAALREFFRTQGNYSSSEFSLGELRRNFSLQQNEGDGEADAP  227

Query  1323  VAT------ERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPE  1484
               T      E++ E+  EK PS  +S+V L+D +DEFFDVPE    + S+  W      E
Sbjct  228   TVTGDGRTKEKLAEEV-EKAPSEHASLVSLNDASDEFFDVPEPPSSDQSETEWIPDFGSE  286

Query  1485  YHETP--RPKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNM  1646
              H      PKLS+AA FV++L DLAVQK    + QE+    E     YG TLPKD++ N+
Sbjct  287   MHSQNIHHPKLSTAAGFVKRLHDLAVQKRGYVDLQEM--DREDITCHYGSTLPKDSACNL  344

Query  1647  PGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQK  1826
               SW +AD S+FLIRG+ YL+DH K+ +KGTL Q+V ADWL+S+ RED+L  RPGSIVQK
Sbjct  345   ASSWTSADPSTFLIRGKSYLEDHKKVKAKGTLMQMVAADWLKSDKREDDLGGRPGSIVQK  404

Query  1827  YAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIP  2006
             YA Q R EFFF+VNIQVPG+T YSLALYYM+ +P+ + PLLE F+ GDDA+RNS+FKLIP
Sbjct  405   YATQGRGEFFFIVNIQVPGSTTYSLALYYMMNSPVEDTPLLESFIKGDDAYRNSRFKLIP  464

Query  2007  YISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNN  2186
             YISKGSWIVKQSVGKK+CLIGQ+LE+NYF G+NY+EL +D+GSSTVARGV++LVLGYLNN
Sbjct  465   YISKGSWIVKQSVGKKACLIGQALEINYFHGKNYVELGIDIGSSTVARGVVSLVLGYLNN  524

Query  2187  LVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             LVIEMAFL+QA+T EELPE LLGTCRLNHLDASKAV
Sbjct  525   LVIEMAFLIQANTPEELPEFLLGTCRLNHLDASKAV  560



>gb|EMT33197.1| hypothetical protein F775_21642 [Aegilops tauschii]
Length=683

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/728 (52%), Positives = 475/728 (65%), Gaps = 102/728 (14%)
 Frame = +3

Query  192   DGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITG-----REEPLRSAIIDS  356
             DG MEGWLYLIR NRLGLQ  RKRYF+LED+ L+ +KA P        RE+P+RSA+IDS
Sbjct  26    DGRMEGWLYLIRSNRLGLQTSRKRYFVLEDSALRCFKAAPAPSSSSSKREDPVRSAVIDS  85

Query  357   CIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI-NPEKN  533
             CI V DNGRE+ HR VF+ FTL N SNH DQLK GA S EEAARWIRCL ++A+ +P K+
Sbjct  86    CIRVTDNGRESVHRSVFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMESALKSPRKD  145

Query  534   --LRAPAIRKWQPFRLSV-SSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQNGLRI  695
               + A + R+WQ FRLS  S+RM   D    SS+  D M SDVI P  W IFG  NGLR+
Sbjct  146   EHVVACSHRRWQAFRLSRRSNRMHSIDWTILSSSHNDPMASDVIAPSAWTIFGCTNGLRL  205

Query  696   FKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHL  875
             F EAKD    GK+WD HPAIMAVGV+D  SE IF+ LMSLG SRSE          +   
Sbjct  206   FTEAKDGGSRGKYWDDHPAIMAVGVVDANSEDIFQTLMSLGQSRSEG---------MRKR  256

Query  876   DGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRA  1055
             D       + L  +W                RREDDGTYVILYHSV H++C P++GY+RA
Sbjct  257   D-------LLLRRYW----------------RREDDGTYVILYHSVFHNRCSPEKGYIRA  293

Query  1056  TVKSGGHVITPVNQGKSSTVKHMLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKA  1226
              +KSGG+VI+PV+QG+ S VKHML++DWK   SYL  +++K +TI        LRE+F+A
Sbjct  294   CLKSGGYVISPVSQGRQSVVKHMLAIDWKFWKSYLLTSSAKYITI-------PLRELFRA  346

Query  1227  KSGS-YFPDPAMNELTIDIQLPVSEKEEIKNEVVAT---ERIE------EDTTEKYPSAC  1376
             K+G+    + +  EL  D+ LP    E  K E+ +    ER+E      +  + ++ S+ 
Sbjct  347   KNGNCACMEFSSGELMRDMGLPQGGNERTKIEMQSANECERLEGPVEGPQGGSNRHLSST  406

Query  1377  SSIVELDDVADEFFDVPEASDDEHSDHGWP--RSTTPEYHETPRPKLSSAACFVRKLQDL  1550
              S+V+L+D  DEFFDVP+ S+ +  +  W    ST          KL+S     +K  D+
Sbjct  407   GSLVQLNDATDEFFDVPDESEYDQREAMWSSDESTHAARRRQDDTKLTSGNT-SQKTNDM  465

Query  1551  AVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITS  1730
                     + G          C + ++                  IR          I +
Sbjct  466   LNYPVLLSLYGS---------CMILQE------------------IR--------DPIKA  490

Query  1731  KGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALY  1910
             + TL Q+VGADW++S+ RED+LA RPG +VQKYAAQ   +FFF+VNIQVPG+T YSLALY
Sbjct  491   ENTLMQMVGADWIKSDKREDDLAGRPGGLVQKYAAQGGSKFFFIVNIQVPGSTTYSLALY  550

Query  1911  YMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNY  2090
             YM+ TPL + PLLERFVNGDD FRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NY
Sbjct  551   YMMDTPLEKVPLLERFVNGDDTFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINY  610

Query  2091  FKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLN  2270
             F+G NYLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFLVQ +T+EELPE LLGTCRLN
Sbjct  611   FRGSNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNTQEELPEFLLGTCRLN  670

Query  2271  HLDASKAV  2294
             +LDASKAV
Sbjct  671   YLDASKAV  678



>ref|XP_010264665.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Nelumbo nucifera]
Length=604

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/595 (60%), Positives = 438/595 (74%), Gaps = 29/595 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +   DG MEGWLYLIR NR+GLQY RKRYFIL+D+CL S+K+ PI+ +E+P+RSAIID
Sbjct  1     MGISQKDGTMEGWLYLIRSNRIGLQYSRKRYFILQDHCLTSFKSTPISRKEDPVRSAIID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPE--  527
             SCI V DNGRE+ HRKVFF FTL NTSNH+DQLK GA+SPEEAARWI   ++AA+     
Sbjct  61    SCIRVTDNGRESIHRKVFFIFTLYNTSNHNDQLKLGASSPEEAARWISSFQEAALKERPD  120

Query  528   --KNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQN  683
               +N+ A    KWQ FRL+ S R         T  SS  +D MTSDV  P PW IFG QN
Sbjct  121   QGENVVAFPKSKWQSFRLTRSKRTGHMSSIDWTLCSSMQMDRMTSDVDAPSPWTIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEAKD + + K+ D HPAIMAVGV+DGTSEAIF+ LMSLGPSRSEWDFC  RGSV
Sbjct  181   GLRLFKEAKDCDFHRKYRDDHPAIMAVGVVDGTSEAIFRTLMSLGPSRSEWDFCIYRGSV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDIIH QL  +WLPWG+++RDLLL+RYWRREDDGTYVILYHSV   KC PQ+G
Sbjct  241   VEHLDGHTDIIHKQLNDNWLPWGMRKRDLLLKRYWRREDDGTYVILYHSVFQKKCQPQKG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVD---WKSYLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG+VI+PVNQGK S VKHML++D   WK Y+R ++++S+TI MLG IAALRE
Sbjct  301   YVRACLKSGGYVISPVNQGKQSVVKHMLAIDWRFWKCYIRTSSARSITIRMLGRIAALRE  360

Query  1215  MFKAKSGSYFP-DPAMNELTIDIQLPVSEKEEIKNEV------VATERIE--EDTTEKYP  1367
              FKAK G+Y   + +  ELT  I LP +E E++K EV      + T+ ++  ++  EK  
Sbjct  361   FFKAKVGNYPSFEFSSGELTQCIGLPQNEIEDLKVEVQTPSENIMTKEVDLMKEEVEKQS  420

Query  1368  SACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSAACFVRKL  1541
             S  +S++ L+DVADEFFDVPE SD + S++GW  + +PE H  +   PKLS+A  FV+KL
Sbjct  421   SKSASLLVLNDVADEFFDVPEPSDFDPSENGWSSNMSPEIHPQDLRHPKLSTATGFVKKL  480

Query  1542  QDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQ  1709
              DLAVQK    + QE+   E+    CYG TLPKD+  N+  SW  AD S+FLIRG+ YL 
Sbjct  481   HDLAVQKRGYMDLQEM-AREDSISCCYGATLPKDSCCNLACSWTTADPSTFLIRGDNYLI  539

Query  1710  DHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQ  1874
             DH K+ +KGTL Q+VGADWL+S+ RED+L  RPG IVQ+ A +  PEFFF+VNIQ
Sbjct  540   DHQKMKAKGTLMQMVGADWLKSDKREDDLGGRPGGIVQQSATKGGPEFFFIVNIQ  594



>gb|KHN32782.1| hypothetical protein glysoja_024141 [Glycine soja]
Length=646

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/688 (50%), Positives = 453/688 (66%), Gaps = 66/688 (10%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLY+   NR+GL   RKRYFIL+++ L+S+K  P++                     
Sbjct  1     MEGWLYIFASNRIGLHCSRKRYFILKESFLRSFKDKPVS---------------------  39

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW  560
                   KVFFTFT+ N SN  DQLK  +NS                  E NL   + +K 
Sbjct  40    ----LMKVFFTFTVYNASNQIDQLKENSNS------------------ELNLVITSKKKH  77

Query  561   QPFRLSVSSR------MARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNP  722
                R+  S R      +     S    +AM SDVI P  WKIF I NGLR+FKEA+D + 
Sbjct  78    SSLRMGGSKRTNWKHYVEWNFQSCIYTEAMISDVIAPSQWKIFSINNGLRMFKEARDWDS  137

Query  723   NGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHM  902
             +G  W  HP +MAVGV+DGTSE IF  LMSLG SRSEWDFC  +GSVV+H+D HTDIIH+
Sbjct  138   HGNKWGTHPVMMAVGVVDGTSEEIFHTLMSLGSSRSEWDFCTYQGSVVDHIDDHTDIIHV  197

Query  903   QLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVI  1082
             +L   WLPWG+K RD LLRRYWRRED+GTYV+L+HSV H  CPP+ GYVRA++KSGG ++
Sbjct  198   KLYNDWLPWGMKPRDFLLRRYWRREDNGTYVLLFHSVYHKICPPERGYVRASLKSGGFLV  257

Query  1083  TPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDP  1253
             TP+N+GK S VKHML++DWK    YL  ++++  TI ML  +AALRE FKAK+G+   +P
Sbjct  258   TPINKGKQSLVKHMLAIDWKLWKLYLSSSSARFSTIRMLERVAALREFFKAKAGNCSSEP  317

Query  1254  AMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEA  1433
                E+ +DI+  V+E+     E V    ++ +T+ +     ++++ LDD +DEFFDV E 
Sbjct  318   I--EIAVDIKNEVTEENSKAVEGVLEGEVDGETSRR-----TNLMGLDD-SDEFFDVSEP  369

Query  1434  SDDEHSDHGWPRSTTPEYHETP--RPKLSSAACFVRKLQDLAVQK----NFQEIVGGEEG  1595
              + +  ++ W  +   E H      PK+SSA    +KLQDL+VQK    + QE    +  
Sbjct  370   KNYDEFENEWHSAPLSEQHSQTDYHPKMSSADGLAKKLQDLSVQKKGYMDLQETSSRDNS  429

Query  1596  AKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQS  1775
                 YG TL KD+S N+P SW  +D S F IRG+ YL+D  K+ ++ TL Q+VGADW+QS
Sbjct  430   EPCPYGATLQKDSSCNLPCSWDESDASLFYIRGKTYLKDKKKVKAERTLMQMVGADWIQS  489

Query  1776  EIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLER  1955
               R+D+L +RPGSIVQ+Y     PEFFFVVN QVPG++ YS+ LYYM+KTPL +NPLL  
Sbjct  490   NSRQDDLCSRPGSIVQQYEKNGGPEFFFVVNFQVPGSSLYSIGLYYMMKTPLEDNPLLHS  549

Query  1956  FVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGS  2135
             FV+GDDA+RNS+FKLIPYI KG WIVKQSVG K  L+G++L++ Y +G+NYLE+D+++GS
Sbjct  550   FVHGDDAYRNSRFKLIPYIFKGPWIVKQSVGNKPSLLGKALDIRYIRGRNYLEVDINIGS  609

Query  2136  STVARGVINLVLGYLNNLVIEMAFLVQA  2219
             STVARGV+NLVLGYLNNLV+ MAFL+Q 
Sbjct  610   STVARGVVNLVLGYLNNLVVGMAFLIQV  637



>ref|XP_010906510.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X4 [Elaeis guineensis]
Length=650

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/581 (57%), Positives = 410/581 (71%), Gaps = 28/581 (5%)
 Frame = +3

Query  195   GNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQD  374
             G MEGWLYLIR NRLGLQ  R+RYF+L+DN L  YK +P + RE+P+RSA+IDSCI V D
Sbjct  14    GRMEGWLYLIRSNRLGLQSSRRRYFVLQDNSLHCYKTIPTSTREDPIRSALIDSCIRVTD  73

Query  375   NGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----PEKNLRA  542
             NGRE+ HR V F FTL N SNH+DQLK GA SPEEAARWIR L +AA+       +N+ A
Sbjct  74    NGRESIHRNVLFIFTLYNASNHNDQLKLGARSPEEAARWIRSLMEAALKECPIKRENVVA  133

Query  543   PAIRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKE  704
              + R+W   RLS S R +R  +      SS   D MTSDVI P PW IFG +NGLR+FKE
Sbjct  134   CSRRRWPSLRLSQSKRTSRMHSVDWTVFSSLHTDPMTSDVIAPSPWTIFGCKNGLRLFKE  193

Query  705   AKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGH  884
             AKD + + K WD HPAIMAVGV+D T EAIF+ +MSLGPSRSEWDFCF  GSV+EHLDGH
Sbjct  194   AKDGDLHRKCWDDHPAIMAVGVVDATPEAIFRTVMSLGPSRSEWDFCFAHGSVIEHLDGH  253

Query  885   TDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVK  1064
             TDIIH +L + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV H  C P+ GY+RA +K
Sbjct  254   TDIIHKKLHSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLK  313

Query  1065  SGGHVITPVNQGKSSTVKHMLSVD---WKSYLRKTTSKSLTIDMLGGIAALREMFKAKSG  1235
             SGG+VI+P NQG  S VKHML++D   WKSYL  +++  +TI MLG +AALRE+F+ K G
Sbjct  314   SGGYVISPANQGNVSVVKHMLAIDWKFWKSYLFASSAIYITIRMLGRVAALRELFRVKLG  373

Query  1236  SY-FPDPAMNELTIDIQLPVSEKEEIKNEVVATERIE--EDTTEKYPSACSSIVELDDVA  1406
             +Y   D +  ++  ++QLP    E  K+E    E IE  E+++ K      S ++L+D A
Sbjct  374   NYSHTDFSSGDMEPEVQLP---GENSKSE----EFIEGSENSSAKPAKTGGSFLQLNDAA  426

Query  1407  DEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK----NFQE  1574
             DEFFDV + S+ E ++  WP     +  +  +PKLS+AA FVR+L DLAVQK    + QE
Sbjct  427   DEFFDVLDESEYEQTEAMWPSDAGMQPQDQRQPKLSTAAVFVRRLHDLAVQKKGYVDLQE  486

Query  1575  IVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIV  1754
                 E+    CYG TL KD+S+ +  SWA+AD S+FLIR + YLQD  KI + GTL Q+V
Sbjct  487   -ASMEDSMPCCYGATLQKDSSFTIACSWASADPSTFLIRSKTYLQDRQKIKANGTLMQMV  545

Query  1755  GADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQV  1877
              ADWL+S  RED+L  R G IVQKYAAQ   EFFF+VNIQ+
Sbjct  546   AADWLKSSKREDDLGGRAGGIVQKYAAQGGREFFFIVNIQL  586


 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +3

Query  2109  LELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASK  2288
             ++L +D+GSSTVARGV++LVLGYLNNLVIEMAFL+Q +TEEELPE LLGTCRLNHLDAS+
Sbjct  584   IQLGIDIGSSTVARGVVSLVLGYLNNLVIEMAFLIQGNTEEELPEFLLGTCRLNHLDASR  643

Query  2289  AV  2294
             AV
Sbjct  644   AV  645



>ref|XP_010092610.1| hypothetical protein L484_002656 [Morus notabilis]
 gb|EXB51751.1| hypothetical protein L484_002656 [Morus notabilis]
Length=661

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/543 (60%), Positives = 396/543 (73%), Gaps = 27/543 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLYLIR NR GLQY RKRYFIL+D+ L+S+K +PI+  EEP+RSAIID
Sbjct  1     MSIHQNDGKMEGWLYLIRFNRFGLQYSRKRYFILKDHFLRSFKTIPISENEEPVRSAIID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             SCI V DNGRE+  RKV F FT+ NTSNH++QLK GA+SPEEAARWIR L+D+A+    N
Sbjct  61    SCIRVTDNGRESIQRKVLFLFTIYNTSNHNNQLKLGASSPEEAARWIRSLQDSALKECQN  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQN  683
             P+K+  A + RKW   RL  S R         T +S    +AMTSDVI P PWKIFG QN
Sbjct  121   PDKDFVACSKRKWPTLRLVGSKRRENKTSIDWTFSSIVHTEAMTSDVIAPSPWKIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEAKD +  G+HWD HPAIMAVG+IDGTSEAIF+ L+SLG SRSEWDFCF RGSV
Sbjct  181   GLRLFKEAKDWDSRGRHWDDHPAIMAVGIIDGTSEAIFRTLLSLGSSRSEWDFCFYRGSV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDIIH QL + WLPWG++RRDLLLRRYWRREDDGTYVILYHSV+H KCPPQ+G
Sbjct  241   VEHLDGHTDIIHKQLYSDWLPWGMQRRDLLLRRYWRREDDGTYVILYHSVVHKKCPPQKG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG VITPVNQGK S VKHMLS+DWK    YLR ++++S+TI ML  ++ALRE
Sbjct  301   YVRAWLKSGGFVITPVNQGKQSIVKHMLSIDWKYWRLYLRPSSARSITIRMLERLSALRE  360

Query  1215  MFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIE--------EDTTEKYPS  1370
             +F+AKSGS+ P+ +  +LT DI LP SEKE+IK +V  TE ++        ED  ++  S
Sbjct  361   LFRAKSGSHSPELSAAQLTRDIVLPQSEKEDIKTKVQYTEEVQNMEEVSLMEDEMDRLVS  420

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETP---RPKLSSAACFVRKL  1541
                S++EL+D  DEFFDVPE +D    ++ WP S      +TP     KLSSAA FV+KL
Sbjct  421   GRKSLMELNDAEDEFFDVPEPTDSRLLENEWPNSELSTGQKTPNISHTKLSSAAVFVKKL  480

Query  1542  QDLAVQKN-FQEIVGGE-EGAKGC-YGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQD  1712
              DL VQK  + ++   + E    C YG TL KD S  +P +W A D SSFL+RG  YLQD
Sbjct  481   NDLRVQKKGYMDLQDADREDTMSCFYGATLQKDPSCALPCTWTAGDPSSFLVRGSTYLQD  540

Query  1713  HSK  1721
             H K
Sbjct  541   HHK  543



>ref|XP_001759959.1| predicted protein [Physcomitrella patens]
 gb|EDQ75084.1| predicted protein [Physcomitrella patens]
Length=730

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/734 (45%), Positives = 457/734 (62%), Gaps = 48/734 (7%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLI  N+L + + RKRYF+L  N  + YK  P   +E PL+S   D    V D+G
Sbjct  4     MEGWLYLIESNKLMMTHPRKRYFVLSGNQARYYKEKPAYRQEAPLKSGSFDPYTRVVDHG  63

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW  560
             RE+ H +  F F + ++  H D+LKFGA S EEAA+W+   ++AA     +  A  +  +
Sbjct  64    RESIHGRTLFVFEIYDSYTHGDKLKFGARSSEEAAKWMEAFKEAAEQSCFSWDAEVMLSY  123

Query  561   QPFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRN-----PN  725
                 LS  S ++  DAS         DV+   PW+IFG  NGLR+F+E  D +     P 
Sbjct  124   HSVLLSCQS-LSMWDASP--------DVVADSPWQIFGCVNGLRLFRETTDHHGFKSMPC  174

Query  726   GKHW----DGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDI  893
              + +    +  PA+M VGV+  T E++F+ +M+LG SRSEWDFC+ +G V+EH+DGH+DI
Sbjct  175   SRGFLIRGEDPPALMGVGVVFATCESVFQTVMTLGSSRSEWDFCYAKGRVIEHIDGHSDI  234

Query  894   IHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGG  1073
             +H Q  THWLPW +K RDL++ RYWRREDDG+YVILY SV H KC P+  +VRA +KSGG
Sbjct  235   VHKQFHTHWLPWRMKPRDLVVHRYWRREDDGSYVILYKSVKHEKCRPRRKFVRAWLKSGG  294

Query  1074  HVITPVN-QG---KSSTVKHMLSVDWKSYLRKTTS---KSLTIDMLGGIAALREMFKAKS  1232
             +VI+P+  QG       VKH+L+VDWK +    +S   + +T+ +L  +AALRE +K K 
Sbjct  295   YVISPLPPQGGFQHRCAVKHILTVDWKHFKTPWSSSKDRVITLKVLERVAALREFYKVKP  354

Query  1233  GSYFP---DPAMNELTI-DIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDD  1400
               Y P    P +  L +   + P+ +KE I    +    +   + E   +  S   +L +
Sbjct  355   ADYMPTSISPDLRRLDVAGCKPPLLQKENIPEVHLCGAEVAR-SPEDNIAGQSMFRQLAE  413

Query  1401  VADEFFDVPEASD---------DEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLA  1553
               +EFFDVPE S          D   +   P  T+ E       KLS+AA  V++ Q +A
Sbjct  414   --EEFFDVPEDSAWDTELEPDLDGRRESTDPDETSDEDQNGGVHKLSAAATIVKRFQGMA  471

Query  1554  VQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSK  1733
              QK   +    +         TLPK +       + +A+ S FLIRG+ YLQD  K+ +K
Sbjct  472   AQKRTHQDDDEDGIELLAREGTLPKSSGCCTTSCYESAEASIFLIRGKHYLQDRKKVVAK  531

Query  1734  GTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRP-------EFFFVVNIQVPGATR  1892
               + Q V ADWL+S  RED+LA+RP + VQ++ A  R         FFF++NIQVPG+T 
Sbjct  532   DPVMQFVAADWLKSNKREDHLASRPSNPVQQFLANQRKIEGRVQDPFFFIINIQVPGSTT  591

Query  1893  YSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQ  2072
             YSLALYYM+  PL++  +LE FV GDD  RN+ FKLIP+I+KG WIVKQSVGK +CLIG+
Sbjct  592   YSLALYYMITQPLSDFLILENFVRGDDRHRNASFKLIPHIAKGPWIVKQSVGKTACLIGE  651

Query  2073  SLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLL  2252
             +LE+ Y   +NY+ELDVD+GSS+VA+GV+NLVLGYL+NLVIE+AFL+QA+TEEELPE+LL
Sbjct  652   ALEITYHTDKNYIELDVDIGSSSVAKGVVNLVLGYLSNLVIELAFLIQANTEEELPEYLL  711

Query  2253  GTCRLNHLDASKAV  2294
             GTCRL +LD +KA+
Sbjct  712   GTCRLVNLDIAKAI  725



>ref|XP_009400820.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=642

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/612 (52%), Positives = 405/612 (66%), Gaps = 51/612 (8%)
 Frame = +3

Query  189   SDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHV  368
             +D  MEGWLYL+R NRLGLQY RKRYF+L  N L  +K  P +  EEP RSA++DS I +
Sbjct  9     ADRRMEGWLYLVRHNRLGLQYSRKRYFVLRGNALDCFKTAPTSNGEEPSRSAVVDSSIRI  68

Query  369   QDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----------  518
              DNGR+  HR V + FTL N SNH DQLK GA S EEAARWIR L +AA+          
Sbjct  69    TDNGRDILHRNVLYIFTLYNASNHKDQLKLGARSSEEAARWIRSLMEAALKVLMFLLVLL  128

Query  519   ----------------NPEKNLRAPAIRKWQPFRLSVSSRMARTD---ASSTPVDAMTSD  641
                             N E+N+ + + R+++  R S  S+    D    +S   D M SD
Sbjct  129   YSLTILYMFIHLQEGPNKEENVVSRSKRRFRMIRRSGRSQKRSVDWTVFTSVLADPMASD  188

Query  642   VIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGP  821
             VI P PW I G +NGLR+FKEA+D +  G + D HPA+MAVGVID +SEAIFK +MSLG 
Sbjct  189   VIAPSPWTIVGCRNGLRLFKEARDADSRGMYRDDHPALMAVGVIDASSEAIFKRVMSLGS  248

Query  822   SRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVIL  1001
             SRSEWDFC   G+VVEH+DGHTDIIH +L   WLPW +KRRDLLLRRYWRREDDGTYVIL
Sbjct  249   SRSEWDFCLLEGNVVEHVDGHTDIIHKKLCGDWLPWRMKRRDLLLRRYWRREDDGTYVIL  308

Query  1002  YHSVIHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVD---WKSYLRKTTSKS  1172
             YHSV H KCP + GYVRA +KSGG+VI+PV+QGK S VKHML+VD   WKSY   +++K 
Sbjct  309   YHSVFHQKCPSKRGYVRACLKSGGYVISPVSQGKQSVVKHMLAVDWKFWKSYFFTSSAKY  368

Query  1173  LTIDMLGGIAALREMFKAKSGSYF-PDPAMNELTIDIQLPVSEKEEIKNEVVATER---I  1340
             +TI MLG +AALRE F+AK GS    D + +E T +I+L  SEKE++K EV + +    I
Sbjct  369   ITIRMLGRVAALREFFRAKLGSRACSDLSSSESTREIELQQSEKEQMKLEVHSADENDNI  428

Query  1341  EE--DTTEKYPS----ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRS---TTPEY-H  1490
             E+  D T++ P+    A  S ++++D ADEFFDV    + + ++  WP       P+   
Sbjct  429   EDSADETQRSPTKIAKASGSFLQMNDAADEFFDVINEPEYDETEALWPSEEGMMQPQLVQ  488

Query  1491  ETPRPKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSW  1658
             +    KLS+AA FV+KL D+AVQK    + QE   G E     YG TLPKD + ++P SW
Sbjct  489   DQHHSKLSTAAVFVKKLHDIAVQKKGYIDLQEASLG-ESVPCSYGLTLPKDLNCSLPSSW  547

Query  1659  AAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQ  1838
             A AD S+FLIRG+ YL DH KI + GTL Q+V ADWL S+ RED+L  RPG IVQKY+AQ
Sbjct  548   AMADPSTFLIRGKSYLHDHQKIKANGTLMQMVAADWLNSDKREDDLGGRPGGIVQKYSAQ  607

Query  1839  DRPEFFFVVNIQ  1874
                EFFF+++IQ
Sbjct  608   GGSEFFFIIHIQ  619



>ref|XP_001764317.1| predicted protein [Physcomitrella patens]
 gb|EDQ70871.1| predicted protein [Physcomitrella patens]
Length=707

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/726 (45%), Positives = 458/726 (63%), Gaps = 52/726 (7%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWLYLI  NRL +   RKRYF+L  N    YK  P    E P+++ IID    V D+G
Sbjct  1     MEGWLYLIESNRLMMTNPRKRYFVLAGNRAFFYKEKPAHPDETPIKTGIIDPSTRVADHG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW  560
             RE  H    F F + ++ NHDD+LKFGA S EEAARW+  L++AA   ++ +    + + 
Sbjct  61    REKIHGWTLFVFEIYDSYNHDDKLKFGARSSEEAARWMSALKEAAEQHKRPIPNFYVTEL  120

Query  561   QPFRLSVSSRMART-----DASSTPVDAM-----TSDVIGPCPWKIFGIQNGLRIFKEAK  710
                +L   +R  R      D+ +  V+ +     + DVI   PW+IFG +NGLR+F+E  
Sbjct  121   GISQLCFINRKRRVRVTFIDSGTCSVNLVNMMDASPDVIADSPWQIFGCRNGLRLFRETT  180

Query  711   DRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
             D +  G      PA+MAVGV+  + E++F+++MSLG SR EWDFC+ +G V+EH+DGH+D
Sbjct  181   DHH--GLKSMDPPALMAVGVVQASCESVFESVMSLGSSRVEWDFCYSKGRVIEHIDGHSD  238

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             I+H QL  +WLPW +K RDLL+ RYWRREDDG+YVILY SV H +CPP+  +VRA +KSG
Sbjct  239   IVHKQLHKYWLPWRMKPRDLLVHRYWRREDDGSYVILYKSVNHERCPPRRKFVRAWIKSG  298

Query  1071  GHVITPVN-QGK---SSTVKHMLSVDWKSYLRKTT---SKSLTIDMLGGIAALREMFKAK  1229
             G+VI+P+  QG       VKH+L+VDWK +  + +   ++ +T+ +L  ++AL E +K K
Sbjct  299   GYVISPLPPQGGFPYRCAVKHILTVDWKHFNMRWSHCRNRDITLRVLERVSALSEFYKVK  358

Query  1230  SGSYFPDPAMNEL----TIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELD  1397
                Y P     +L        +  VS+K+ I +  +  + +         +  S   +L 
Sbjct  359   PADYMPISIGQDLRRLNLTGCKFQVSQKQNISSVHLTDDEVSHSQGNN-TAGQSMFRQLA  417

Query  1398  DVADEFFDVPEASDDEHSDHGWPRSTTPEY---HETPRPKLSSAACFVRKLQDLAVQKNF  1568
             +  DEFFDVPE       D  W     P+     ++  P+ +S            VQ+  
Sbjct  418   E--DEFFDVPE-------DSAWDTELEPDLDGQRKSADPEETSDE----------VQRMH  458

Query  1569  QEIVGGEEGAK-GCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLT  1745
             Q+ V  E+G +      TLPK +       + +A+ S FL+RG+ YL D  K+ ++  + 
Sbjct  459   QDTV--EDGIELMVRAGTLPKSSCSCTTSCYESAEASVFLVRGKHYLHDRKKVVAEDPVM  516

Query  1746  QIVGADWLQSEIREDNLAARPGSIVQKYAA-QDR-PE-FFFVVNIQVPGATRYSLALYYM  1916
             Q V ADWL+S  RED+LA+RP   +QK+ A Q R P+ FFF+VNIQVPG+T YSLALYYM
Sbjct  517   QFVAADWLKSNKREDHLASRPSHPIQKFLANQGRVPDPFFFIVNIQVPGSTTYSLALYYM  576

Query  1917  LKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFK  2096
             + +PL++ P+LE FV+GDD  RN+ FKLIP+I+KG WIVKQSVGK +CLIGQ+LE+ Y  
Sbjct  577   ITSPLSDFPILENFVSGDDRHRNASFKLIPHIAKGPWIVKQSVGKTACLIGQALEITYHI  636

Query  2097  GQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHL  2276
              + Y+ELDVD+GSS+VA+GV+NLVL YL+NLVIE+AFL+QA+TEEELPE LLGTCRL +L
Sbjct  637   DKTYIELDVDIGSSSVAKGVVNLVLSYLSNLVIELAFLIQANTEEELPECLLGTCRLMNL  696

Query  2277  DASKAV  2294
             D +KA+
Sbjct  697   DIAKAI  702



>ref|XP_002969204.1| hypothetical protein SELMODRAFT_146206 [Selaginella moellendorffii]
 gb|EFJ29292.1| hypothetical protein SELMODRAFT_146206 [Selaginella moellendorffii]
Length=722

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/724 (45%), Positives = 449/724 (62%), Gaps = 31/724 (4%)
 Frame = +3

Query  198   NMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPI-TGREEPLRSAIIDSCIHVQD  374
              +EGWLY+I+ +RL +++ RKRYF+LE      YK+ PI  G ++ L+  +I     V D
Sbjct  5     KIEGWLYVIQPHRLRIRFPRKRYFVLEGRQATCYKSKPIHDGEKQSLKKGVIQPYTKVVD  64

Query  375   NGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIR  554
             NGREN H +V  TFTL + S    Q+K  A + EEAA+W+   RDAA +     +  A+ 
Sbjct  65    NGRENIHGQVLHTFTLSDPSFDQQQMKLAARTAEEAAKWMSAFRDAASSQAPLRQNLAVP  124

Query  555   KWQP-FRLSVSSRMARTDASS-----TPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDR  716
             K +P FR     R    +        T +     DVI   PWKI G +NGLR+F+E+   
Sbjct  125   KRKPYFRFFERGREGGQEVPDWTGFWTSMREQ-GDVIAESPWKILGCKNGLRLFRESSKS  183

Query  717   NP--NGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
                   K  D HPAIMAVGV+    E++F  +M+LG SR+EWDFC+  G +VE +DGHTD
Sbjct  184   KGRFTSKFADDHPAIMAVGVVKAPCESVFDTVMALGDSRAEWDFCYSTGRIVERIDGHTD  243

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             I+H QL   WLP  ++ RDLL  RYWRRE DG+YVILY SV    CP + G VRA +KSG
Sbjct  244   IVHKQLRRKWLPGHMRGRDLLFHRYWRREYDGSYVILYRSVSRKDCPTRSGTVRAKLKSG  303

Query  1071  GHVITPVN----QGKSSTVKHMLSVDW---KSYLRKTTSKSLTIDMLGGIAALREMFKAK  1229
             G+VI+P+     Q   S V+HML +DW   KS+ + +  + +T+ ML  IA LRE++KAK
Sbjct  304   GYVISPLTGEGEQPARSLVRHMLEIDWNTWKSHFKPSRVQKITLRMLERIAGLRELYKAK  363

Query  1230  SGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVAD  1409
                   +P   + + +     +++E+ +NE  A    +++    +     S + ++D  D
Sbjct  364   ----VIEPTWVDASREFDDQAAKEEKEENEERAIVVSDQEPKSAHIDEQESFLRVNDT-D  418

Query  1410  EFFDVPEASDDEHSDHGWPRSTT-PEYHETPRPKLSSAACFVRKLQDLAVQKNF-----Q  1571
             EFFD P+ SD E       RS +  E  E   P+  S A FV+++  LA   +      Q
Sbjct  419   EFFDAPDDSDQEDLPDDMLRSVSETEGTEEFEPETKSTASFVKRIHALAAAAHKKGAQPQ  478

Query  1572  EIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQI  1751
                   +        TLPK + Y    SW+AAD S+FLIRG+ YL+D+ K+ +K TL Q+
Sbjct  479   TEFSSRDAELLDREGTLPKSSFY---CSWSAADPSTFLIRGKNYLRDNKKVKAKETLMQL  535

Query  1752  VGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPL  1931
             V  DW  S  RED++A+R  + +Q    +    FFF+VN+QVPG+  YSL  YYMLK  L
Sbjct  536   VAVDWFTSNQREDHIASRENTFMQPKVRKLGRSFFFIVNLQVPGSPTYSLVFYYMLKQSL  595

Query  1932  AENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYL  2111
              + PLLE+FVNG D FR+S FKLIP++++GSWIVKQSVGK +CLIG++L+++YF G+NYL
Sbjct  596   DQIPLLEKFVNGGDRFRSSTFKLIPHVAEGSWIVKQSVGKTACLIGEALDLHYFHGKNYL  655

Query  2112  ELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKA  2291
             ELDVDVG+S+VARGV++LV GY++ LV+EMAFL+QA+TEE+LPE LLGTCR++ LD SKA
Sbjct  656   ELDVDVGASSVARGVVSLVFGYMSKLVVEMAFLIQANTEEDLPEMLLGTCRVSSLDVSKA  715

Query  2292  VHTN  2303
             V  N
Sbjct  716   VQLN  719



>ref|XP_001755631.1| predicted protein [Physcomitrella patens]
 gb|EDQ79691.1| predicted protein [Physcomitrella patens]
Length=731

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/742 (46%), Positives = 456/742 (61%), Gaps = 60/742 (8%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREE---PLRSAIIDSCIHVQ  371
             MEGWLYLI  NRL +   RKRY +L  N  + YK  P   REE   P++S  +D    V 
Sbjct  1     MEGWLYLIGSNRLMMTNPRKRYVVLCGNQARFYKDKP-AHREEVAAPIKSGTVDPYKRVA  59

Query  372   DNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAA------------  515
             D+GREN   +  F FT+ ++  H+D+LKFGA S EEAA+W+   ++AA            
Sbjct  60    DHGRENILGRTLFVFTVYDSYIHEDKLKFGARSSEEAAKWMEAFKEAAEQVSFAEYFINL  119

Query  516   ---INPEKNLRAPAIRKWQPFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNG  686
                I+ +    A   R     R       A    S  P DA + DV+   PW+IFG +NG
Sbjct  120   LVRIHEDSTTLAGCTRTLTAIRFD-----AHMFVSLLPKDA-SPDVVADSPWQIFGCENG  173

Query  687   LRIFKEAKDRNPNGKHWDGH--PAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGS  860
             LR+FKEA D +   K    H  PA+M+VGV+  T E++F+ +M+LG SR+EWDFC+ +G 
Sbjct  174   LRLFKEATDHH-GLKSMVRHDPPALMSVGVVHATCESVFETVMALGSSRAEWDFCYLKGR  232

Query  861   VVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQE  1040
             V+EH+DGH+DI+H      WL   +K RDL++ RYWRREDDG+YVILY SV H KCPP+ 
Sbjct  233   VIEHIDGHSDIVHKHFHKFWLSSRMKPRDLVVHRYWRREDDGSYVILYTSVNHEKCPPRR  292

Query  1041  GYVRATVKSGGHVITPV-NQG---KSSTVKHMLSVDWKSY---LRKTTSKSLTIDMLGGI  1199
              +VRA +KSGG+VI+P+  QG       VKH+L+VDWK++         K +T+ +L  +
Sbjct  293   KFVRAWLKSGGYVISPLPTQGGYPNRCMVKHILTVDWKNWKSCWSPCRDKDITLKVLERV  352

Query  1200  AALREMFKAKSGSYFPD---PAMNELTIDIQLPVSEKEEIK----NEVVATERIEEDTTE  1358
             AAL+E +K K   Y P    P + +     +LPV++KE I     N+  A   +EE    
Sbjct  353   AALKEFYKIKPSDYMPSSMGPNVRQ-PARCKLPVAQKENILPIHLNDDAAAFLLEEKNVG  411

Query  1359  KYPSACSSIVELDDVADEFFDVPEAS----DDEHSDHGWPRSTTPEYHETPRPKLSSAAC  1526
             K  S    + E     DEFFDVPE S    + +    G  ++T  E          S   
Sbjct  412   K--SMFQQLAE-----DEFFDVPEDSAWDLELDRDLDGQQQNTDLEETSDEDKVRQSGFG  464

Query  1527  FVRKL---QDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGE  1697
             F R +      A QK   +    ++        TLPK +S      + +A+ S+FLIRG+
Sbjct  465   FDRLIALDMPFAAQKRTYQDTDQDDIDLLTREGTLPKISSSGTTSCYQSAEASTFLIRGK  524

Query  1698  KYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAA-QDRPE--FFFVVN  1868
              YLQD  K+ +K  + Q V ADWL+S  RED+LA RP   VQ + A Q R +  FFF++N
Sbjct  525   HYLQDRKKVVAKDPVMQFVAADWLKSNKREDHLANRPSYPVQLFLANQGRVDDAFFFIIN  584

Query  1869  IQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVG  2048
             IQVPG+T YSLALYYM+  PL++ PLLE FV+GDD +RN+ FKLIP+I+KGSWIVKQSVG
Sbjct  585   IQVPGSTTYSLALYYMITQPLSDFPLLENFVHGDDRYRNAGFKLIPHIAKGSWIVKQSVG  644

Query  2049  KKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTE  2228
             K +CLIG++LE+ Y  G+NY+ELDVD+GSS+VA+GV+NLVLGYL+ LVIE+AFL+QA+TE
Sbjct  645   KTACLIGEALEITYHSGKNYIELDVDIGSSSVAKGVVNLVLGYLSTLVIELAFLIQANTE  704

Query  2229  EELPEHLLGTCRLNHLDASKAV  2294
             EELPE+LLGTCRL +LD +KA+
Sbjct  705   EELPEYLLGTCRLVNLDIAKAI  726



>ref|XP_002961222.1| hypothetical protein SELMODRAFT_74418 [Selaginella moellendorffii]
 gb|EFJ38761.1| hypothetical protein SELMODRAFT_74418 [Selaginella moellendorffii]
Length=711

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/719 (45%), Positives = 441/719 (61%), Gaps = 32/719 (4%)
 Frame = +3

Query  198   NMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDN  377
              +EGWLY+I+ +RL +++ RKRYF+LE      YK+ PI   E+     +I     V DN
Sbjct  5     KIEGWLYVIQPHRLRIRFPRKRYFVLEGRQATCYKSKPIHDGEK----GVIQPYTKVVDN  60

Query  378   GRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRK  557
             GREN H +V  TFTL + +    Q+K  A + EEAA+W+   RDAA +       PA   
Sbjct  61    GRENIHGQVLHTFTLSDPNFDQQQMKLAARTAEEAAKWMSAFRDAA-SASCPFLLPACYI  119

Query  558   WQPFRLSVSSRMARTDASSTPVDAMTS---------DVIGPCPWKIFGIQNGLRIFKEAK  710
             +            R       V   T          DVI   PWKI G +NGLR+F+E+ 
Sbjct  120   FNAKFWLFPRFFERGREGGQEVPDWTGFWTSMREQGDVIAESPWKILGCKNGLRLFRESS  179

Query  711   DRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
                  G+  + HPAIMAVGV+    E++F  +M+LG SRSEWDFC+  G +VE +DGHTD
Sbjct  180   --KSKGRFTNDHPAIMAVGVVKAPCESVFDTVMALGDSRSEWDFCYSTGRIVERIDGHTD  237

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             I+H QL   WLP  ++ RDLL  RYWRRE DG+YVILY SV    CP + G VRA +KSG
Sbjct  238   IVHKQLRRKWLPGHMRGRDLLFHRYWRREYDGSYVILYRSVSRKDCPTRSGTVRANLKSG  297

Query  1071  GHVITPVN----QGKSSTVKHMLSVDW---KSYLRKTTSKSLTIDMLGGIAALREMFKAK  1229
             G+VI+P+     Q   S V+HML +DW   KS+ + +  + +T+ ML  IA LRE++KAK
Sbjct  298   GYVISPLTGEGEQPARSLVRHMLEIDWNTWKSHFKPSRVQKITLRMLERIAGLRELYKAK  357

Query  1230  SGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVAD  1409
                   +P   + + +     +++E+ +NE  A    +++    +     S + ++D  D
Sbjct  358   ----VIEPTWVDASGEFDDQAAKEEKEENEERAIVVSDQEPKSAHIDEQESFLRVNDT-D  412

Query  1410  EFFDVPEASDDEHSDHGWPRSTT-PEYHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGG  1586
             EFFD P+ SD E       RS +  E  E   P+  S A FV+++  LA     Q     
Sbjct  413   EFFDAPDDSDQEDLPDDMLRSVSETEGTEEFEPETKSTASFVKRIHALAAAAQPQTEFSS  472

Query  1587  EEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADW  1766
              +        TLPK + Y    SW+AAD S+FLIRG+ YL+D+ K+ +K TL Q+V  DW
Sbjct  473   RDAELLDREGTLPKSSFY---CSWSAADPSTFLIRGKNYLRDNKKVKAKETLMQLVAVDW  529

Query  1767  LQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPL  1946
               S  RED++A+R  + +Q    +    FFF+VN+QVPG+T YSL  YYMLK  L + PL
Sbjct  530   FTSNQREDHIASRENTFMQPKVRKLARSFFFIVNLQVPGSTTYSLVFYYMLKQSLDQIPL  589

Query  1947  LERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVD  2126
             LE+FVNG D FR+S FKLIP++++GSWIVKQSVGK +CLIG++L+++YF G+NYLELDVD
Sbjct  590   LEKFVNGGDRFRSSTFKLIPHVAEGSWIVKQSVGKTACLIGEALDLHYFHGKNYLELDVD  649

Query  2127  VGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             VG+S+VARGV++LV GY++ LV+EMAFL+QA+TEE+LPE LLGTCR++ LD SKAV  N
Sbjct  650   VGASSVARGVVSLVFGYMSKLVVEMAFLIQANTEEDLPEMLLGTCRVSSLDVSKAVQLN  708



>ref|XP_008362690.1| PREDICTED: LOW QUALITY PROTEIN: protein ENHANCED DISEASE RESISTANCE 
2-like, partial [Malus domestica]
Length=480

 Score =   506 bits (1302),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 272/481 (57%), Positives = 342/481 (71%), Gaps = 24/481 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  +DG MEGWLY+I  NR GLQY RKRYFIL+DNCL+S+KA P +  EEP+RSA+ID
Sbjct  1     MGIXQNDGKMEGWLYIIGSNRFGLQYSRKRYFILKDNCLRSFKAKPSSDSEEPVRSAVID  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----N  521
             +CI   DNGR + HRK FF FTL NTSN+ DQLK GA+S EEAA+WIR L+DAA+    N
Sbjct  61    TCIRATDNGRASIHRKGFFVFTLYNTSNNSDQLKLGASSSEEAAKWIRSLQDAALKACPN  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR---TDASSTPV---DAMTSDVIGPCPWKIFGIQN  683
               ++  A +  +W  FRL  S R  R    D + +P+   + MTSDVI P PWKIFG QN
Sbjct  121   ATQDFVACSKSRWPSFRLVGSRRTERKNSVDWTFSPLMHTEGMTSDVIAPSPWKIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEAKD +  G+HWD HPAIMAVGV+DGTSEAIF+ L+SLGPSRSEWDFC+ +GSV
Sbjct  181   GLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFRTLLSLGPSRSEWDFCYYQGSV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VE LDGHTDIIH QL + WLPWG++RRDLL+RRYWRREDDGTYVILYHSV H KCPP+ G
Sbjct  241   VERLDGHTDIIHQQLYSDWLPWGMQRRDLLIRRYWRREDDGTYVILYHSVSHKKCPPKRG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVD---WKSYLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG VITP NQGK S V+HML++D   WK YLR ++++ +TI ML  +AALRE
Sbjct  301   YVRACLKSGGFVITPANQGKQSLVRHMLAIDWKFWKLYLRPSSARCITIRMLERVAALRE  360

Query  1215  MFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIE--------EDTTEKYPS  1370
             +F AK+G+  P+    +++ +I+   S ++ IK EV     +         ED  EK P 
Sbjct  361   LFGAKAGTSSPEFXSGDMSSEIKFSQSGQQNIKTEVQHPGEVXKMEEGVLVEDEVEK-PE  419

Query  1371  ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETP--RPKLSSAACFVRKLQ  1544
               +S+  L D ADEFFDVPE ++ +  ++ WP   + E + T     KLSSAA  V+KL 
Sbjct  420   GRASLKGLHDAADEFFDVPEPTEYDQFENEWPSDVSMEQNPTSIQHHKLSSAAVLVKKLH  479

Query  1545  D  1547
             +
Sbjct  480   E  480



>gb|AAD20693.1| unknown protein [Arabidopsis thaliana]
Length=446

 Score =   498 bits (1282),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 276/524 (53%), Positives = 344/524 (66%), Gaps = 88/524 (17%)
 Frame = +3

Query  732   HWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLT  911
              WD HPAIMAVGV+DGTSE IF+ L+SLGPSRSEWDFCF +GSVVEHLDGHTDIIH QL 
Sbjct  4     QWDDHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDGHTDIIHKQLY  63

Query  912   THWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV  1091
             + WLPWG+KRRD  LRRYWRREDDGTY                         GG+VI+P+
Sbjct  64    SDWLPWGMKRRDFSLRRYWRREDDGTY------------------------GGGYVISPI  99

Query  1092  NQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMN  1262
             + GK S VKHML+VDWKS   Y++ + ++S+T+ MLG I+   E+ ++   +   D    
Sbjct  100   DNGKQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISG--ELSRSARLTQNEDGVFG  157

Query  1263  ELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDD  1442
             + ++        + E+  +    ER      +K+PS  SS+V+LD    EFFDVPE SD+
Sbjct  158   DSSL-------RENEMFKDTANEER------DKFPSERSSLVDLD----EFFDVPEPSDN  200

Query  1443  EHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTL  1622
             ++ D  W                           D  +    Q           CYG TL
Sbjct  201   DNLDDSW-------------------------TSDFDLDTCCQSSPHATCNPPCCYGTTL  235

Query  1623  PKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAA  1802
             P D S ++P SW   D S+FLIRG+ YL D  K+ +KGTL ++V ADWL+S+ RED+L +
Sbjct  236   PTDPSCDLPCSWTTTDPSTFLIRGKTYLDDQKKVKAKGTLMEMVAADWLKSDKREDDLGS  295

Query  1803  RPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFR  1982
             RPG IVQ                 VPG+T YSL LYYM+ TP+ E+PLL  FVNGDDA+R
Sbjct  296   RPGGIVQ-----------------VPGSTTYSLVLYYMMSTPIEEHPLLVSFVNGDDAYR  338

Query  1983  NSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVIN  2162
             NS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+G+NY+EL VD+GSSTVARGV++
Sbjct  339   NSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGKNYIELGVDIGSSTVARGVVS  398

Query  2163  LVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             LVLGYLN LVIEMAFL+QA+TEEELPE+LLGTCR NHLDASKA+
Sbjct  399   LVLGYLNKLVIEMAFLIQANTEEELPEYLLGTCRFNHLDASKAI  442



>ref|XP_001767644.1| predicted protein [Physcomitrella patens]
 gb|EDQ67603.1| predicted protein [Physcomitrella patens]
Length=712

 Score =   507 bits (1305),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 301/730 (41%), Positives = 427/730 (58%), Gaps = 54/730 (7%)
 Frame = +3

Query  186   LSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIH  365
             ++   MEGW+Y +  ++L L + RKRY +LE     S+K  P TG E  +RS IID    
Sbjct  4     IAGTRMEGWVYYLSSSKLRLNHPRKRYLVLEGIRASSFKDKPRTGVEILVRSGIIDPDTR  63

Query  366   VQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKN----  533
             V D+GRE  H +VFF F++ +    + +L+ G  + E+AA+W+   R+AA  P       
Sbjct  64    VIDHGRETVHGRVFFVFSIYDPYAPEAKLRIGVQNAEDAAKWMHAFREAAERPPGTNKTF  123

Query  534   LRAPAIRKWQPFRLSVSSR---MARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKE  704
             L +P  R+  P   S  +R   +          DA + DV+   PW+I G +NGLR F+E
Sbjct  124   LPSPPGRRRLPNLRSDQTRSFCINHWTGGLLTKDA-SPDVVASSPWQIIGCKNGLRFFQE  182

Query  705   AKDRNPN---GKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHL  875
               D + +       D  P +MAVGV+D T  ++F+  M+LG SR+EWDFCF +G V+E++
Sbjct  183   TSDGDESLLEKIRGDDIPTLMAVGVVDATPASVFETAMALGRSRAEWDFCFHQGRVIENV  242

Query  876   DGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRA  1055
              GHTDIIH Q  + WLPW +K RDL+ +RYWRR+DDGTYVILY+S+ H KCPP   + RA
Sbjct  243   HGHTDIIHEQFHSRWLPWRMKPRDLVFQRYWRRDDDGTYVILYNSINHEKCPPGRKFTRA  302

Query  1056  TVKSGGHVITPVNQGKSST----VKHMLSVDWKSY---LRKTTSKSLTIDMLGGIAALRE  1214
              + SGG VI+P+   K       VKH++ VDWK +    RK+ ++ +++ ML  IAA+RE
Sbjct  303   WLHSGGFVISPLKGRKDKVKWCMVKHIMKVDWKGWEFLWRKSRNRDMSLIMLERIAAIRE  362

Query  1215  MFKAKSGSYFP-DPAMNELTIDIQLPVSE-KEEIKNEVVATERIEEDTTEKYPSACSSIV  1388
             ++K K           ++   DI    +E K E ++E    +R+    + K   + S  +
Sbjct  363   LYKVKEKPIISMKKEHHQRHEDIFYESAEPKPESEDESSNRDRVSNQPSLK--ESTSKFI  420

Query  1389  ELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQKNF  1568
             E+ D  DEFFD  E +        W R   PE       + SS     +K  +L V    
Sbjct  421   EVAD--DEFFDAEEPT-------SWERGEDPELKFYEELEGSSMDEVEQKAHNLPVWSLR  471

Query  1569  Q-------EIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKIT  1727
             +       E +  E      Y               W  A+  +FLIRG+ +L+DH K+ 
Sbjct  472   KLADEADVEFMNRESSLGSVY---------------WEPAEPGTFLIRGKHFLRDHKKVK  516

Query  1728  SKGTLTQIVGADWLQSEIREDNLAARPGSIVQK-YAAQDRPEFFFVVNIQVPGATRYSLA  1904
             +   L Q+V ADW +S+ RED++AA  G ++QK +A Q    +F ++N+QVPG   YSL 
Sbjct  517   AGTPLMQLVAADWFKSDKREDHIAAHDGCVIQKLFAKQVADSYFVIINLQVPGTPTYSLV  576

Query  1905  LYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEM  2084
             LYYM    L + PLLE FV GD+ +R  +FKL PY++KG WIVKQSVGK +CL+G++L++
Sbjct  577   LYYMTNKRLQDIPLLENFVRGDNRYRACRFKLCPYVAKGPWIVKQSVGKSACLVGEALDI  636

Query  2085  NYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCR  2264
              YF   NYLELD+D+GSS+VARGV+NLV GY+  LVIEMAFL+QA+TEEELPE LLGT R
Sbjct  637   TYFSSDNYLELDIDIGSSSVARGVVNLVTGYVTKLVIEMAFLIQANTEEELPEKLLGTVR  696

Query  2265  LNHLDASKAV  2294
             +++LD  KAV
Sbjct  697   ISNLDMQKAV  706



>ref|XP_001782866.1| predicted protein [Physcomitrella patens]
 gb|EDQ52321.1| predicted protein [Physcomitrella patens]
Length=729

 Score =   496 bits (1276),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 300/749 (40%), Positives = 437/749 (58%), Gaps = 78/749 (10%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGW+Y++  ++L L + RKRY +L  N   ++K       E PLRS IID    V D+G
Sbjct  3     MEGWVYILNPSKLRLNHPRKRYLVLVGNRASAFKDKSRAKDESPLRSGIIDLGTRVTDHG  62

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW  560
             RE    +VFF F++ +    + +LKFG  + E+AARW++  R+AA    +N  +     W
Sbjct  63    REIVLGRVFFVFSVHDPHASEAKLKFGVQNAEDAARWMQAFRNAA-ERVRNFSS----NW  117

Query  561   QPFRLS----------VSSRMARTDASSTPVDAM-----------------TSDVIGPCP  659
               F++S          +S ++   +A  T  +A+                 + DV+   P
Sbjct  118   VFFQVSCRHSHLVSIKLSFQLQDENAVQTLGEAIRNLKMPNWTGALLAKDASPDVVASSP  177

Query  660   WKIFGIQNGLRI----FKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSR  827
             W+IFG +NG +I        +   P        PA+MAVGV+D     +F  +M+LGPSR
Sbjct  178   WEIFGCKNGTQISSLDLAMIRGGTP--------PALMAVGVVDAIPATVFDTVMALGPSR  229

Query  828   SEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYH  1007
             +EWDFCF +G +++H+ GH DI+H Q  + WLPW +K RDL+  RYWRR+DDGTYVILY 
Sbjct  230   AEWDFCFHQGQIIDHVHGHMDIVHKQFHSKWLPWRMKPRDLVFERYWRRDDDGTYVILYR  289

Query  1008  SVIHSKCPPQEGYVRATVKSGGHVITPVNQGKS-----STVKHMLSVDWKSYL-RKTTSK  1169
             S+ H KCPP + + RA V SGG+VI+P+  GK+     S VKH++ VDW+ Y  RK+ ++
Sbjct  290   SIKHPKCPPSKKFTRAYVLSGGYVISPLT-GKNAEVNRSMVKHIMKVDWRGYFWRKSRNR  348

Query  1170  SLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEED  1349
             ++++ ML  IAA+RE+FK K     P P   E   + +  + E+ + + E   T   +  
Sbjct  349   NMSLLMLERIAAIRELFKVKERP--PVPLKTERR-ENEESIFERAQSQQEFANTLSNKLT  405

Query  1350  TTEKYPSACSSIVELDDVADEFFDVPE--------ASDDEHSDHGWPRSTTPEYHETPRP  1505
                    + S  +++ D  DEFFD  E         S+   SD     S   E +E PR 
Sbjct  406   NQSTLEESESKFLQVAD--DEFFDAEEPLSWKRESQSELMSSDEVEGSSMDEEQYE-PRN  462

Query  1506  KLSS---AACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTS  1676
              ++S        ++    A Q       GG             K  S     +W  A++S
Sbjct  463   YIASFQFTCSNEKQYSSFASQ-------GGTRDRTTEGDLEFMKRESSLGTMTWDTAESS  515

Query  1677  SFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKY--AAQDRPE  1850
             +FLIRG+ YL+DH K+ +   + Q+V ADW +S+  E++LAAR G ++QK   +AQ   E
Sbjct  516   TFLIRGKHYLRDHKKVKAGTPVMQLVAADWFKSDRSEEHLAARAGCVIQKLFTSAQRVAE  575

Query  1851  -FFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSW  2027
              +F ++N+QVPG   YSL LYYM    L + PLLE FV GDD +RNS+FKL P+++KGSW
Sbjct  576   SYFVIINLQVPGTPSYSLVLYYMANKLLQDIPLLEGFVRGDDHYRNSRFKLCPHVAKGSW  635

Query  2028  IVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAF  2207
             IVKQSVGK +CL+G++L++NYF   NYLE+D+D+GSS+VA+GV+NLV  Y + LV+EMAF
Sbjct  636   IVKQSVGKSACLVGEALDINYFSSDNYLEMDIDIGSSSVAKGVVNLVANYASKLVLEMAF  695

Query  2208  LVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             L+QA+T+EELPE LLGT R+++LD +KAV
Sbjct  696   LIQANTDEELPEKLLGTVRISNLDMAKAV  724



>gb|KDO44676.1| hypothetical protein CISIN_1g0045762mg, partial [Citrus sinensis]
 gb|KDO44677.1| hypothetical protein CISIN_1g0045762mg, partial [Citrus sinensis]
Length=469

 Score =   479 bits (1233),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 260/466 (56%), Positives = 326/466 (70%), Gaps = 30/466 (6%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M +  ++  +EGWLY I +NR+G+Q  RKRYFIL DNCL  YK VP + +EEP++SA+I 
Sbjct  1     MGIARNESKIEGWLYAILVNRIGMQISRKRYFILLDNCLNGYKMVPSSEKEEPVKSAMIH  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----  521
             SCI V DNGRE+ +RKV F FTL N+ +H+++LK GA SPEEAA+WIR L++AA+     
Sbjct  61    SCIRVTDNGRESINRKVLFVFTLYNSLDHNEKLKLGARSPEEAAKWIRSLQEAAVKECPC  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR------TDASSTPVDAMTSDVIGPCPWKIFGIQN  683
             P  N  A + R+W   RL VS R         T  SS   +A  SDVI P PWKIFG QN
Sbjct  121   PTYNFVAVSKRRWPSLRLYVSKRSDYKYSGDWTLGSSIRSEATASDVIAPSPWKIFGCQN  180

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEAKD +  G+HWD HPAIMAVGV+DGTSEAIF+ LMSLG SRSEWDFCF RG V
Sbjct  181   GLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCV  240

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGH+D++H  L + WLPWG++RRDLL+RRYWRREDDGTYVILYHSV H KCP Q+G
Sbjct  241   VEHLDGHSDVVHKLLYSDWLPWGMQRRDLLVRRYWRREDDGTYVILYHSVNHKKCPKQKG  300

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG VITP NQGK S VKHML+VDWK    YLR ++++S+TI ML  +AALRE
Sbjct  301   YVRACLKSGGFVITPSNQGKQSIVKHMLAVDWKYWKLYLRPSSARSITIRMLERVAALRE  360

Query  1215  MFKAKSGSYFPD------------PAMNELTIDIQLPVSEKEEIK----NEVVATERIEE  1346
             +F+AK+G+   +               +EL+ DIQL   E  EI+     E+  TE+   
Sbjct  361   LFQAKAGNTSSEFLSRGSTREIKASQDSELSEDIQLKNEEDTEIEIQKMEEIRKTEKDAP  420

Query  1347  DTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPE  1484
              T EK  S  +S++ ++D +DEFFDVPEA  D H ++ W    +PE
Sbjct  421   FTEEKPSSGRASLMGINDASDEFFDVPEAYSD-HMENDWSLEVSPE  465



>gb|EPS61698.1| hypothetical protein M569_13096, partial [Genlisea aurea]
Length=438

 Score =   473 bits (1216),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 242/429 (56%), Positives = 313/429 (73%), Gaps = 19/429 (4%)
 Frame = +3

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVDWK---S  1145
             EDDGTYVILYHSV H  CPP+ GY+RA +KSGG+VI+P+NQG+ S VKHML++DWK   S
Sbjct  16    EDDGTYVILYHSVFHQNCPPKRGYIRACLKSGGYVISPINQGRHSVVKHMLAMDWKFWRS  75

Query  1146  YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVV  1325
             YL+ + ++S+TI MLG +AA+RE+F AK     P   ++      +L  S++E    EV 
Sbjct  76    YLQLSLARSITISMLGRLAAMRELFSAKVDC-LPSGFLSG-----ELRRSKREPDVVEVQ  129

Query  1326  ATER---IEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDE-HSDHGWPRSTTPEYH-  1490
                R   +EE+TT+   S  SS++  +D ADEF+DV E  D E +   GW    + E H 
Sbjct  130   PQPREEDVEEETTKTGGSERSSLIGFNDAADEFYDVSEPLDYEPYETIGWHSDFSSETHV  189

Query  1491  -ETPRPKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGS  1655
              +  + KLS+A  FV++L DLA+QK    +  E+  G+  +    G TLPKD ++N+  S
Sbjct  190   QDVGKHKLSTATGFVKRLHDLAIQKKGYVDLHEMARGDLSSSSRCGYTLPKDPAFNVLCS  249

Query  1656  WAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAA  1835
             WAAADTSSFLIRG  YL D  KI +K TL ++VGADWL+S+ RED+L +RPG +VQ Y  
Sbjct  250   WAAADTSSFLIRGTTYLNDRKKIKAKSTLMELVGADWLKSDKREDDLGSRPGGMVQTYGL  309

Query  1836  QDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYIS  2015
             +  PEFFF+VNIQ+PG+T YSLA YYM++TPL E PLL+ FVNGDDA+RNS+FKLIPYIS
Sbjct  310   KGGPEFFFIVNIQIPGSTTYSLAAYYMMRTPLEETPLLQSFVNGDDAYRNSRFKLIPYIS  369

Query  2016  KGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVI  2195
             KGSWIVKQSVGKK+CLIGQ+LE+ Y  G+NYLE+DVDVGSSTVARGV +LVLGY+NNLVI
Sbjct  370   KGSWIVKQSVGKKACLIGQALELKYVGGKNYLEVDVDVGSSTVARGVASLVLGYINNLVI  429

Query  2196  EMAFLVQAD  2222
             E+AFL+Q +
Sbjct  430   ELAFLIQVN  438



>gb|AAP54296.2| pleckstriny domain-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=412

 Score =   469 bits (1206),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 238/407 (58%), Positives = 306/407 (75%), Gaps = 16/407 (4%)
 Frame = +3

Query  1122  MLSVDWK---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGS-YFPDPAMNELTIDIQLP  1289
             ML++DWK   SYL   ++K +TI MLG +AALRE F+AK+G+    + +  ELT D++L 
Sbjct  1     MLAIDWKFWKSYLFTASAKHITIRMLGRVAALREFFRAKNGNCACIEFSSGELTRDMRLQ  60

Query  1290  VSEKEEIKNEVVA---TERIEEDT------TEKYPSACSSIVELDDVADEFFDVPEASDD  1442
               E E IK E+++     R+E+ T      + ++ S+  S ++L+D ADEFFDVP+ S+ 
Sbjct  61    QGENERIKIEMLSASENNRLEDPTEGSLGGSNRHLSSAGSFIQLNDAADEFFDVPDDSEY  120

Query  1443  EHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQK-NFQEIVGGEEGAKG--CYG  1613
             +  +  WP   +    +    KLS+AA FV+KL DLAVQK  + ++ G  +   G  CYG
Sbjct  121   DQREAMWPSDESTHSVDQRHAKLSTAAVFVKKLHDLAVQKRGYVDLQGAADFDNGPFCYG  180

Query  1614  CTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDN  1793
              TLPKD++  MP +WA  D ++FLIRGE YLQD  KI +  TL Q+VGADW++S+ RED+
Sbjct  181   YTLPKDSNCTMPSTWAMTDPTTFLIRGESYLQDRLKIKANNTLMQMVGADWIKSDKREDD  240

Query  1794  LAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDD  1973
             L+ RPG +VQK AAQ   +FFF+VNIQVPG++ YSLALYYM+ TPL + PLLERFVNGDD
Sbjct  241   LSGRPGGLVQKCAAQGGNKFFFIVNIQVPGSSTYSLALYYMMDTPLEKVPLLERFVNGDD  300

Query  1974  AFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARG  2153
             AFRNS+FKLIPYISKGSWIVKQSVGKK+CL+GQ+LE+NYF+G NYLEL VD+GSSTVARG
Sbjct  301   AFRNSRFKLIPYISKGSWIVKQSVGKKACLVGQALEINYFRGSNYLELGVDIGSSTVARG  360

Query  2154  VINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             V++LVLGYLNNLVIEMAFLVQ +T+EELPE LLGTCRLN+LDASKAV
Sbjct  361   VVSLVLGYLNNLVIEMAFLVQGNTQEELPEFLLGTCRLNYLDASKAV  407



>dbj|BAE98675.1| hypothetical protein [Arabidopsis thaliana]
Length=410

 Score =   457 bits (1176),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 233/410 (57%), Positives = 300/410 (73%), Gaps = 23/410 (6%)
 Frame = +3

Query  1122  MLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPV  1292
             ML+VDWKS   Y++ + ++S+T+ MLG I+ALRE+F+AK GS+ P+ +  EL+   +L  
Sbjct  1     MLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAKHGSFPPNLSSGELSRSARLTQ  60

Query  1293  SEKEEIKNEVVATERIEEDTT----EKYPSACSSIVELDDVADEFFDVPEASDDEHSDHG  1460
             +E     +  +    + +DT     +K+PS  SS+V+LD    EFFDVPE SD+++ D  
Sbjct  61    NEDGVFGDSSLRENEMFKDTANEERDKFPSERSSLVDLD----EFFDVPEPSDNDNLDDS  116

Query  1461  WPRSTTPEY--HETPRPKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAKG------  1604
             W      +    E+ +PKL+SA   V+KL DLAVQK    +  E    E           
Sbjct  117   WTSDFDLDTCCQESRQPKLNSATSLVKKLHDLAVQKRGYVDLHERAKEESSPHATCNPPC  176

Query  1605  CYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIR  1784
             CYG TLP D S ++P SW   D S+FLIRG+ YL D  K+ +KGTL ++V ADWL+S+ R
Sbjct  177   CYGTTLPTDPSCDLPCSWTTTDPSTFLIRGKTYLDDQKKVKAKGTLMEMVAADWLKSDKR  236

Query  1785  EDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVN  1964
             ED+L +RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL LYYM+ TP+ E+PLL  FVN
Sbjct  237   EDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEHPLLVSFVN  296

Query  1965  GDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTV  2144
             GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+G+NY+EL VD+GSSTV
Sbjct  297   GDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGKNYIELGVDIGSSTV  356

Query  2145  ARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             ARGV++LVLGYLN LVIEMAFL+QA+TEEELPE+LLGTCR NHLDASKA+
Sbjct  357   ARGVVSLVLGYLNKLVIEMAFLIQANTEEELPEYLLGTCRFNHLDASKAI  406



>emb|CDY69875.1| BnaAnng31850D, partial [Brassica napus]
Length=462

 Score =   457 bits (1177),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 251/446 (56%), Positives = 312/446 (70%), Gaps = 24/446 (5%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIID  353
             M M   DG MEGWLY IR NR GLQ+ RKRYF+L DN L S+K+VP    EEP R A +D
Sbjct  1     MEMSQIDGRMEGWLYTIRHNRFGLQFSRKRYFVLHDNNLTSFKSVPSDQNEEPDRRASLD  60

Query  354   SCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAIN----  521
              CI V DNGRE+FHRK+ F FTL NTSNH DQLK GA+SPEEAA+WIR L+DA+      
Sbjct  61    CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDASQKKFPF  120

Query  522   PEKNLRAPAIRKWQPFRLSVSSRMAR----TDASSTPVDAMTSDVIGPCPWKIFGIQNGL  689
             P+    + A +    F +S  SR       T+ SS  V+ +  DVI P PWKIFG QNGL
Sbjct  121   PDCEFVSHAEKGLVKFNVSRRSRRKNSVDWTNYSSVNVETIAPDVIAPSPWKIFGCQNGL  180

Query  690   RIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVE  869
             R+FKEAKD +  G+HWD HPAIMAVGVIDGTSE IF  LMSLGP RSEWDFCF +G+VVE
Sbjct  181   RLFKEAKDWDSRGRHWDDHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEWDFCFYKGTVVE  240

Query  870   HLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYV  1049
             HLDGHTDI+++QL + WLPW + RRD+LLRRYWRRE+DGTYVIL HSV H KCPP +GYV
Sbjct  241   HLDGHTDIVNIQLYSDWLPWLMNRRDVLLRRYWRREEDGTYVILCHSVYHKKCPPTKGYV  300

Query  1050  RATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALREMF  1220
             RA +KSGG+V+TPV++GK S VKHM+++DW+S   Y+R ++ +S+TI ++  +AALREMF
Sbjct  301   RACIKSGGYVVTPVSKGKQSLVKHMVAIDWRSWNLYMRPSSERSITIRVVERLAALREMF  360

Query  1221  KAKSGSYFPDPAMNE-------LTIDIQLPV-SEKEEIKNEVVATERIEEDTTEKYPSAC  1376
             KAK G  F +    E       L+    LP   E + I  E+V  E +     EK  SA 
Sbjct  361   KAKQGHGFAEFVSGEFMQTKSSLSKINTLPFKKEAKRIDLELVKVEEM-----EKPSSAR  415

Query  1377  SSIVELDDVADEFFDVPEASDDEHSD  1454
             +S+++L+D +DEFFDVPE ++    D
Sbjct  416   NSLMDLNDASDEFFDVPEPNESYEFD  441



>gb|EEC67181.1| hypothetical protein OsI_34049 [Oryza sativa Indica Group]
Length=662

 Score =   442 bits (1137),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 225/380 (59%), Positives = 286/380 (75%), Gaps = 13/380 (3%)
 Frame = +3

Query  1194  GIAALREMFKAKSGS-YFPDPAMNELTIDIQLPVSEKEEIKNEVVA---TERIEEDT---  1352
             G  ALRE F+AK+G+    + +  ELT D++L   E E IK E+++     R+E+ T   
Sbjct  278   GTYALREFFRAKNGNCACIEFSSGELTRDMRLQQGENERIKIEMLSASENNRLEDPTEGS  337

Query  1353  ---TEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAA  1523
                + ++ S+  S ++L+D ADEFFDVP+ S+ +  +  WP   +    +    KLS+AA
Sbjct  338   LGGSNRHLSSAGSFIQLNDAADEFFDVPDDSEYDQREAMWPSDESTHSVDQRHAKLSTAA  397

Query  1524  CFVRKLQDLAVQK-NFQEIVGGEEGAKG--CYGCTLPKDASYNMPGSWAAADTSSFLIRG  1694
              FV+KL DLAVQK  + ++ G  +   G  CYG TLPKD++  MP +WA  D ++FLIRG
Sbjct  398   VFVKKLHDLAVQKRGYVDLQGAADFDNGPFCYGYTLPKDSNCTMPSTWAMTDPTTFLIRG  457

Query  1695  EKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQ  1874
             E YLQD  KI +  TL Q+VGADW++S+ RED+LA RPG +VQK AAQ   +FFF+VNIQ
Sbjct  458   ESYLQDRLKIKANNTLMQMVGADWIKSDKREDDLAGRPGGLVQKCAAQGGNKFFFIVNIQ  517

Query  1875  VPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKK  2054
             VPG++ YSLALYYM+ TPL + PLLERFVNGDDAFRNS+FKLIPYISKGSWIVKQSVGKK
Sbjct  518   VPGSSTYSLALYYMMDTPLEKVPLLERFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKK  577

Query  2055  SCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEE  2234
             +CL+GQ+LE+NYF+G NYLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFLVQ +T+EE
Sbjct  578   ACLVGQALEINYFRGSNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNTQEE  637

Query  2235  LPEHLLGTCRLNHLDASKAV  2294
             LPE LLGTCRLN+LDASKAV
Sbjct  638   LPEFLLGTCRLNYLDASKAV  657


 Score =   263 bits (672),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 161/226 (71%), Gaps = 15/226 (7%)
 Frame = +3

Query  201  MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITG--------REEPLRSAIIDS  356
            MEGWLYLIR NRLGLQY RKRYF+LED  L+ +KA P           RE+P+RSAIIDS
Sbjct  34   MEGWLYLIRSNRLGLQYSRKRYFVLEDAALRCFKAPPPPSSSSSSSSKREDPVRSAIIDS  93

Query  357  CIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI-NPEKN  533
            CI V DNGRE+ HR VF+ FTL N SNH DQLK GA S EEAARWIRCL ++A+ +P K+
Sbjct  94   CIRVTDNGRESVHRSVFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMESALKSPRKD  153

Query  534  --LRAPAIRKWQPFRLSV-SSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQNGLRI  695
              + A + R+WQ FRLS  S+RM   D    SS   D M SDVI P PW IFG +NGLR+
Sbjct  154  EHIVACSHRRWQAFRLSRRSNRMHSIDWTVFSSVHNDPMASDVIAPSPWTIFGCKNGLRL  213

Query  696  FKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSE  833
            F EAKD    GK+WD HPAIMAVGV+D  SEA+F+ +MSLG SRSE
Sbjct  214  FTEAKDGGSEGKYWDDHPAIMAVGVVDANSEAVFQTVMSLGQSRSE  259



>gb|EEE51149.1| hypothetical protein OsJ_31910 [Oryza sativa Japonica Group]
Length=668

 Score =   441 bits (1134),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 224/380 (59%), Positives = 286/380 (75%), Gaps = 13/380 (3%)
 Frame = +3

Query  1194  GIAALREMFKAKSGS-YFPDPAMNELTIDIQLPVSEKEEIKNEVVAT---ERIEEDT---  1352
             G  ALRE F+AK+G+    + +  ELT D++L   E E IK E+++     R+E+ T   
Sbjct  284   GTYALREFFRAKNGNCACIEFSSGELTRDMRLQQGENERIKIEMLSASENNRLEDPTEGS  343

Query  1353  ---TEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAA  1523
                + ++ S+  S ++L+D ADEFFDVP+ S+ +  +  WP   +    +    KLS+AA
Sbjct  344   LGGSNRHLSSAGSFIQLNDAADEFFDVPDDSEYDQREAMWPSDESTHSVDQRHAKLSTAA  403

Query  1524  CFVRKLQDLAVQK-NFQEIVGGEEGAKG--CYGCTLPKDASYNMPGSWAAADTSSFLIRG  1694
              FV+KL DLAVQK  + ++ G  +   G  CYG TLPKD++  MP +WA  D ++FLIRG
Sbjct  404   VFVKKLHDLAVQKRGYVDLQGAADFDNGPFCYGYTLPKDSNCTMPSTWAMTDPTTFLIRG  463

Query  1695  EKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQ  1874
             E YLQD  KI +  TL Q+VGADW++S+ RED+L+ RPG +VQK AAQ   +FFF+VNIQ
Sbjct  464   ESYLQDRLKIKANNTLMQMVGADWIKSDKREDDLSGRPGGLVQKCAAQGGNKFFFIVNIQ  523

Query  1875  VPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKK  2054
             VPG++ YSLALYYM+ TPL + PLLERFVNGDDAFRNS+FKLIPYISKGSWIVKQSVGKK
Sbjct  524   VPGSSTYSLALYYMMDTPLEKVPLLERFVNGDDAFRNSRFKLIPYISKGSWIVKQSVGKK  583

Query  2055  SCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEE  2234
             +CL+GQ+LE+NYF+G NYLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFLVQ +T+EE
Sbjct  584   ACLVGQALEINYFRGSNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQGNTQEE  643

Query  2235  LPEHLLGTCRLNHLDASKAV  2294
             LPE LLGTCRLN+LDASKAV
Sbjct  644   LPEFLLGTCRLNYLDASKAV  663


 Score =   263 bits (673),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 161/225 (72%), Gaps = 14/225 (6%)
 Frame = +3

Query  201  MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITG-------REEPLRSAIIDSC  359
            MEGWLYLIR NRLGLQY RKRYF+LED  L+ +KA P          RE+P+RSAIIDSC
Sbjct  41   MEGWLYLIRSNRLGLQYSRKRYFVLEDAALRCFKAPPPPSSSSSSSKREDPVRSAIIDSC  100

Query  360  IHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI-NPEKN-  533
            I V DNGRE+ HR VF+ FTL N SNH DQLK GA S EEAARWIRCL ++A+ +P K+ 
Sbjct  101  IRVTDNGRESVHRSVFYIFTLYNASNHYDQLKLGARSSEEAARWIRCLMESALKSPRKDE  160

Query  534  -LRAPAIRKWQPFRLSV-SSRMARTD---ASSTPVDAMTSDVIGPCPWKIFGIQNGLRIF  698
             + A + R+WQ FRLS  S+RM   D    SS   D M SDVI P PW IFG +NGLR+F
Sbjct  161  HIVACSHRRWQAFRLSRRSNRMHSIDWTVFSSVHNDPMASDVIAPSPWTIFGCKNGLRLF  220

Query  699  KEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSE  833
             EAKD    GK+WD HPAIMAVGV+D  SEA+F+ +MSLG SRSE
Sbjct  221  TEAKDGGSEGKYWDDHPAIMAVGVVDANSEAVFQTVMSLGQSRSE  265



>ref|XP_006415101.1| hypothetical protein EUTSA_v10008155mg [Eutrema salsugineum]
 gb|ESQ33454.1| hypothetical protein EUTSA_v10008155mg [Eutrema salsugineum]
Length=333

 Score =   424 bits (1091),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 205/322 (64%), Positives = 251/322 (78%), Gaps = 6/322 (2%)
 Frame = +3

Query  1347  DTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH--ETPRPKLSSA  1520
             D  +K+PS  SS+V+L+D  DEFFDVPE SD++  D  W      + +  E+ +PKL+SA
Sbjct  8     DERDKFPSERSSLVDLNDGVDEFFDVPEPSDNDPLDESWTSDYDSDTYSQESRQPKLNSA  67

Query  1521  ACFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLI  1688
                V+KL DLAVQK    +  E    E     CYG TLP D +  +P SW   D S+FLI
Sbjct  68    TSLVKKLHDLAVQKRGYVDLHEKAREESSTPCCYGTTLPTDPTCALPCSWTTTDPSTFLI  127

Query  1689  RGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVN  1868
             RG+ YL D  K+ +KGTL ++V ADWL+S+ RED+L +RPG IVQKYAA+  PEFFF+VN
Sbjct  128   RGKTYLSDQKKVKAKGTLMEMVAADWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVN  187

Query  1869  IQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVG  2048
             IQVPG+T YSL LYYM+ TP+ E+PLL  FVNGDDA+RNS+FKLIPYISKGSWIVKQSVG
Sbjct  188   IQVPGSTTYSLVLYYMMSTPIEEHPLLVSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVG  247

Query  2049  KKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTE  2228
             KK+CLIGQ+LE+NYF+G+NY+EL VD+GSSTVARGV++LVLGYLN LVIEMAFLVQA+TE
Sbjct  248   KKACLIGQALEINYFRGKNYIELGVDIGSSTVARGVVSLVLGYLNKLVIEMAFLVQANTE  307

Query  2229  EELPEHLLGTCRLNHLDASKAV  2294
             EELPE+LLGTCRLNHLDA K+V
Sbjct  308   EELPEYLLGTCRLNHLDACKSV  329



>ref|XP_009345389.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Pyrus 
x bretschneideri]
Length=406

 Score =   414 bits (1065),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 215/396 (54%), Positives = 285/396 (72%), Gaps = 17/396 (4%)
 Frame = +3

Query  1149  LRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVA  1328
             L  ++++ +TI  L  +AALRE+F+AK+G+  P+ +  +++ +I+L  S +  I+ EV  
Sbjct  10    LFHSSARCITIRRLEIVAALRELFRAKAGTSSPEFSSRDMSGEIRLSQSGQHNIRTEVQH  69

Query  1329  TERIEE--------DTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPE  1484
                ++E        D  EK P   +S+  L D ADEFFDVPE ++ +  ++ WP   + E
Sbjct  70    PGEVKEMEEGVLVEDEVEK-PEGHTSLKGLHDAADEFFDVPEPTEYDQFENEWPSDMSME  128

Query  1485  YHETP--RPKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNM  1646
              + T    PKLSSAA  V++L +L VQK    + QE+   +E     YG TL KD S  +
Sbjct  129   QNPTSIQHPKLSSAAILVKRLHELRVQKRGCTDLQEV--SKENNVFPYGATLQKDPSCAL  186

Query  1647  PGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQK  1826
             P SW +AD SSFLIRG  YLQ   KI +K TL Q+VG DWL+S+ RED++++R GSIVQK
Sbjct  187   PCSWGSADPSSFLIRGPNYLQHRQKIKAKSTLMQLVGVDWLRSDKREDDISSRYGSIVQK  246

Query  1827  YAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIP  2006
             YA +   EFFF+VN+Q+PG + ++LA YYM+KTPL E PLL  FVNGDD++RNS+FKLIP
Sbjct  247   YAERGGSEFFFIVNMQIPGTSMHTLAFYYMMKTPLEETPLLHDFVNGDDSYRNSRFKLIP  306

Query  2007  YISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNN  2186
             YISK SWIVKQS+GKK+CL+GQ LE++YF+G NYLEL+++VGSSTVAR V NLVLGYLNN
Sbjct  307   YISKESWIVKQSLGKKACLVGQRLEVHYFRGMNYLELEINVGSSTVARRVANLVLGYLNN  366

Query  2187  LVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             LV+EMAFL+QA+TEEELPE LLGTCRLN LDASK+V
Sbjct  367   LVMEMAFLIQANTEEELPEVLLGTCRLNQLDASKSV  402



>ref|NP_001131246.1| hypothetical protein [Zea mays]
 gb|ACF79576.1| unknown [Zea mays]
Length=287

 Score =   393 bits (1010),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 188/269 (70%), Positives = 224/269 (83%), Gaps = 3/269 (1%)
 Frame = +3

Query  1506  KLSSAACFVRKLQDLAVQK-NFQEIVGGEEGAKG--CYGCTLPKDASYNMPGSWAAADTS  1676
             KLS+AA FV++L DLAVQK  + ++ G  +   G  CYG TLPKD+SY +P +WA  D +
Sbjct  17    KLSTAAVFVKRLHDLAVQKRGYIDLQGAADADNGPCCYGYTLPKDSSYTVPSTWAMTDPT  76

Query  1677  SFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFF  1856
             +FLIRGE YL D  KI +  TL Q+VGADW++S+ RED+LA RPG +VQK AAQ    FF
Sbjct  77    TFLIRGETYLHDRIKIKANSTLMQMVGADWIKSDKREDDLAGRPGGLVQKCAAQGGTRFF  136

Query  1857  FVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVK  2036
             F+VNIQVPG+T YSLALYYM+ TPL + PLLERFVNGDDAFRNS+FKLIPYISKGSWIVK
Sbjct  137   FIVNIQVPGSTTYSLALYYMMDTPLEKVPLLERFVNGDDAFRNSRFKLIPYISKGSWIVK  196

Query  2037  QSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQ  2216
             QSVGKK+CL+GQ+LE+NYF+G+NYLEL VD+GSSTVARGV++LVLGYLNNLVIEMAFLVQ
Sbjct  197   QSVGKKACLVGQALEINYFRGRNYLELGVDIGSSTVARGVVSLVLGYLNNLVIEMAFLVQ  256

Query  2217  ADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
              +T EELPE LLGTCRLN+LDASKAV  +
Sbjct  257   GNTNEELPEFLLGTCRLNYLDASKAVSID  285



>gb|KDO44678.1| hypothetical protein CISIN_1g0045761mg, partial [Citrus sinensis]
Length=275

 Score =   390 bits (1002),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 189/270 (70%), Positives = 224/270 (83%), Gaps = 5/270 (2%)
 Frame = +3

Query  1497  PRPKLSSAACFVRKLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAA  1664
             P+ KL+SAA FV+KL DLAV K    + QE V  E+     YG TL  D+S+  P SWAA
Sbjct  3     PQSKLASAAGFVKKLHDLAVHKKGCTDLQE-VPNEDEKSWSYGATLQTDSSFTSPCSWAA  61

Query  1665  ADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDR  1844
             AD S+FLIRGE YL+DH KI + GTL Q++GADWL+S  REDNLAARP S+VQKYAA   
Sbjct  62    ADPSTFLIRGENYLKDHRKIKADGTLMQMIGADWLRSNKREDNLAARPCSLVQKYAAGGG  121

Query  1845  PEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGS  2024
             PEFFFVVNIQ PG T+Y+LALYY++KTPL +NPLL +FVNGDDAFRNS+FKLIPYISKGS
Sbjct  122   PEFFFVVNIQFPGTTKYTLALYYVIKTPLEDNPLLHKFVNGDDAFRNSRFKLIPYISKGS  181

Query  2025  WIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMA  2204
             WIVKQSVGK +CL+G++LE+NY++G+NYLE+ +DVGSSTVA GV +LVLGYLNNLVIEMA
Sbjct  182   WIVKQSVGKTACLLGRALEVNYYRGRNYLEIQIDVGSSTVATGVASLVLGYLNNLVIEMA  241

Query  2205  FLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             FL+Q +TEEELPE LLGTCRLNHLD SK+V
Sbjct  242   FLIQGETEEELPEFLLGTCRLNHLDVSKSV  271



>emb|CDY64695.1| BnaA04g27680D [Brassica napus]
Length=318

 Score =   382 bits (980),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 191/317 (60%), Positives = 241/317 (76%), Gaps = 7/317 (2%)
 Frame = +3

Query  1356  EKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVR  1535
             EK  SA +S+++L+D +DEFFDVPE ++    D     S   + H   + KL S +  V+
Sbjct  2     EKPSSARNSLMDLNDASDEFFDVPEPNESYEFDSLIDNSPFSQGHS--QLKLPSPSGIVK  59

Query  1536  KLQDLAVQK----NFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKY  1703
             KLQDLA  K    + QE VG +  +   YG TL +D +  MP SW+ AD S+FLIRG+ Y
Sbjct  60    KLQDLANNKKGYMDLQE-VGMDVNSTFIYGATLQQDPNLTMPCSWSIADPSTFLIRGDNY  118

Query  1704  LQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPG  1883
             L D  K+ + GT+ Q+VGADW+ S+ RED+L  R G +VQ++AA+  PEFFF+VN+QVPG
Sbjct  119   LNDQQKVKANGTMMQMVGADWISSDKREDDLGGRLGGLVQEFAAKGGPEFFFIVNMQVPG  178

Query  1884  ATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCL  2063
             +   SLALYYMLKTPL E+PLL  FVNGDDA+RNS+FKLIP+ISKGSWIVKQSVGKK+CL
Sbjct  179   SAMISLALYYMLKTPLEEHPLLHSFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGKKACL  238

Query  2064  IGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPE  2243
             +G +LE+ Y +G+NYLELD+DVGSSTVARGV NLVLGYLNNLVIEMAFL+QA+T EELPE
Sbjct  239   VGHALEVRYTRGKNYLELDIDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTAEELPE  298

Query  2244  HLLGTCRLNHLDASKAV  2294
              LLGTCRLN+LD SK++
Sbjct  299   LLLGTCRLNYLDVSKSL  315



>dbj|BAD94447.1| hypothetical protein [Arabidopsis thaliana]
Length=247

 Score =   369 bits (946),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/230 (73%), Positives = 200/230 (87%), Gaps = 0/230 (0%)
 Frame = +3

Query  1605  CYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIR  1784
             CYG TLP D S ++P SW   D S+FLIRG+ YL D  K+ +KGTL ++V ADWL+S+ R
Sbjct  14    CYGTTLPTDPSCDLPCSWTTTDPSTFLIRGKTYLDDQKKVKAKGTLMEMVAADWLKSDKR  73

Query  1785  EDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVN  1964
             ED+L +RPG IVQKYAA+  PEFFF+VNIQVPG+T YSL LYYM+ TP+ E+PLL  FVN
Sbjct  74    EDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEHPLLVSFVN  133

Query  1965  GDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTV  2144
             GDDA+RNS+FKLIPYISKGSWIVKQSVGKK+CLIGQ+LE+NYF+G+NY+EL VD+GSSTV
Sbjct  134   GDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQALEINYFRGKNYIELGVDIGSSTV  193

Query  2145  ARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             ARGV++LVLGYLN LVIEMAFL+QA+TEEELPE+LLGTCR NHLDASKA+
Sbjct  194   ARGVVSLVLGYLNKLVIEMAFLIQANTEEELPEYLLGTCRFNHLDASKAI  243



>ref|XP_007151874.1| hypothetical protein PHAVU_004G082900g [Phaseolus vulgaris]
 gb|ESW23868.1| hypothetical protein PHAVU_004G082900g [Phaseolus vulgaris]
Length=404

 Score =   362 bits (929),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 199/388 (51%), Positives = 260/388 (67%), Gaps = 26/388 (7%)
 Frame = +3

Query  201   MEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNG  380
             MEGWL +  +NRLGL+   KRYFIL+++ ++S+K  P++  EE  RS IIDS + V DNG
Sbjct  1     MEGWLSIFTINRLGLRRSHKRYFILKNSFIRSFKDKPMSQMEEAHRSTIIDSEVRVIDNG  60

Query  381   RENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI----NPEKNLRAPA  548
             RE  ++KVFF FTL +  N  D++K GA+SPEEAA+WIR L+DAA+    NPE +    +
Sbjct  61    RETINKKVFFIFTLYSILNKRDEVKLGASSPEEAAKWIRSLKDAALKENSNPEMDFLISS  120

Query  549   IRKWQPFRLSVSSRMARTDA------SSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAK  710
              +K    R+  S +     +      S    +AMTSDVI P PWKIF   NG+RIFKEA+
Sbjct  121   NKKHLSLRMGGSKKKKWKQSIEWNFQSCIYNEAMTSDVIAPSPWKIFSCHNGIRIFKEAQ  180

Query  711   DRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTD  890
             D   +   W  HP +M +GVIDGTSE IF  LMSLG SRSEWDFC  +GSV++H+D HTD
Sbjct  181   DWGFHESIWGNHPVMMTIGVIDGTSEDIFHTLMSLGSSRSEWDFCTYQGSVIDHIDDHTD  240

Query  891   IIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSG  1070
             IIH++L    LPWG+K RD LL+RYWRRE DGTYV+L+HSV+H  CPPQ  YVRA++KSG
Sbjct  241   IIHLKLYDDRLPWGMKPRDFLLQRYWRREKDGTYVLLFHSVLHKNCPPQRDYVRASLKSG  300

Query  1071  GHVITPVNQGKSSTVKHMLSVDWKSYL----RKTTSKSLTIDMLGGIAALREMFKAKSGS  1238
             G +ITPV  GKSS VKHML++DWK +       + + SLTI +L  + ALRE F+AK G+
Sbjct  301   GFLITPVKNGKSSLVKHMLAIDWKFWKLYPHLSSGAISLTISLLERLGALREFFRAKVGN  360

Query  1239  YFPDPAMNELTIDIQLPVSEKEEIKNEV  1322
             +  +            P++ K +IKNEV
Sbjct  361   FSSE------------PIAMKVDIKNEV  376



>ref|XP_004173884.1| PREDICTED: uncharacterized LOC101207368, partial [Cucumis sativus]
Length=360

 Score =   355 bits (910),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 199/358 (56%), Positives = 259/358 (72%), Gaps = 12/358 (3%)
 Frame = +3

Query  684   GLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSV  863
             GLR+FKEAKD + + + WD HPAIMAVG++ GTSE IF+ LMSLGPSRSEWDFCF RGS+
Sbjct  3     GLRLFKEAKDNDSHRRQWDDHPAIMAVGMVCGTSEEIFRTLMSLGPSRSEWDFCFLRGSL  62

Query  864   VEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEG  1043
             VEHLDGHTDIIHMQL   WLPWG+K+RD LLRRYWRREDDGTYV+LYHSV H K PPQ+G
Sbjct  63    VEHLDGHTDIIHMQLYRDWLPWGMKKRDFLLRRYWRREDDGTYVLLYHSVFHMKFPPQKG  122

Query  1044  YVRATVKSGGHVITPVNQGKSSTVKHMLSVDWKS---YLRKTTSKSLTIDMLGGIAALRE  1214
             YVRA +KSGG+V+TPVNQGK S VKHML+VDWK    YLR ++++++TI M+  +AALRE
Sbjct  123   YVRACLKSGGYVVTPVNQGKHSLVKHMLAVDWKFWKLYLRPSSARAITIRMVERLAALRE  182

Query  1215  MFKAKSGSYFPDPAMNELTI-DIQLPVSEKEEIKNEVVATE---RIEEDTTEKYPSAC--  1376
             +F+AK G    + + +   +   +LP SE +EIK E+ + E   +I+E  +++  +    
Sbjct  183   LFRAKVGDSSSEFSSSSRDLRHFELPQSEMDEIKTEIQSPETMRKIKEAFSKENEAEMPR  242

Query  1377  SSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAV  1556
             +S++ L+D  DEFFDVPE S+ +  ++ W    T +     + KLS+AA FV+KL DLAV
Sbjct  243   ASLIGLNDAVDEFFDVPEPSELDLYENEWTSDLTLQQLNMSQNKLSTAAVFVKKLHDLAV  302

Query  1557  QKN-FQEI--VGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSK  1721
             QK  + E+  +  EE     YG TLPKD +++ P S A+AD S FLIRGE YL+D  K
Sbjct  303   QKKGYAELPELPREESMAYSYGSTLPKDLNFSTPCSVASADPSLFLIRGENYLKDSQK  360



>ref|XP_008349774.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Malus 
domestica]
Length=505

 Score =   356 bits (914),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 200/367 (54%), Positives = 250/367 (68%), Gaps = 43/367 (12%)
 Frame = +3

Query  174   MVMPLSDGNMEGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGRE---EPLRSA  344
             M M  +D  MEGWLYL+R NR+GLQY RKRYF+LE + LKS+K+VP++  E    P   +
Sbjct  1     MGMSQTDQRMEGWLYLVRSNRIGLQYSRKRYFVLEGHSLKSFKSVPVSNNEVLAPPFLFS  60

Query  345   IIDSCIHVQDNGRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAI--  518
             I+                    T    +   +  +   GA+SPEEAARWI   ++ A+  
Sbjct  61    IV-------------------LTEWFPSFGRYWLECVLGASSPEEAARWIHSFQEIALQG  101

Query  519   --NPEKNLRAPAIRKWQPFRLSVSSRMARTD------------ASSTPVDAMTSDVIGPC  656
               +   N+   +   WQ F +  + R+  +              SS   DA+TSDVI P 
Sbjct  102   GPDLNDNIXHGSNSIWQSFSIH-ARRLGGSSSRSRINSIDWSLCSSAQTDAVTSDVIAPS  160

Query  657   PWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEW  836
             PW IFG QNGLR+FKEAKDR+ +GK WD HPAIMAVGV+DG SE IF+ LMSLGPSRSEW
Sbjct  161   PWTIFGCQNGLRLFKEAKDRDSHGK-WDDHPAIMAVGVVDGXSEGIFQTLMSLGPSRSEW  219

Query  837   DFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVI  1016
             DFCF +G+VVEHLDGHTDIIH QL + WLPWG+KRRDLLLRRYWRREDDGTYVILYHSV 
Sbjct  220   DFCFYKGNVVEHLDGHTDIIHKQLYSDWLPWGMKRRDLLLRRYWRREDDGTYVILYHSVF  279

Query  1017  HSKCPPQEGYVRATVKSGGHVITPVNQGKSSTVKHMLSVD---WKSYLRKTTSKSLTIDM  1187
             H +CPPQ+GYVRA +KSGG+VITPVNQGK S VKHML++D   WKSYL+ ++++++TI M
Sbjct  280   HKRCPPQKGYVRACLKSGGYVITPVNQGKQSVVKHMLAIDWKFWKSYLQSSSARTMTIKM  339

Query  1188  LGGIAAL  1208
             LG +A +
Sbjct  340   LGRVAGI  346


 Score =   164 bits (416),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +3

Query  2007  YISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNN  2186
             +  +GSWIVKQSVGKK+CLIGQ+LE+NYF G+NY+EL +D+GSSTVARGV++LVLGYLNN
Sbjct  372   FFPQGSWIVKQSVGKKACLIGQALEINYFHGKNYVELGIDIGSSTVARGVVSLVLGYLNN  431

Query  2187  LVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKA  2291
             LVIEMAFL+QA+T EELPE LLGTCRLNHLDASKA
Sbjct  432   LVIEMAFLIQANTPEELPEFLLGTCRLNHLDASKA  466



>ref|XP_009396700.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Musa acuminata 
subsp. malaccensis]
Length=713

 Score =   358 bits (920),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 247/740 (33%), Positives = 382/740 (52%), Gaps = 87/740 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  YK  P T    PL+S +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGKSFIHMRYFVLETRLLAYYKKQP-TDNMVPLQSLVIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCL--------------------  503
             +     + +   + N    + ++   A + ++A  W   +                    
Sbjct  66    KTQQGHMVYVLCVYNKKEKNQRMMMAAYNIQDALNWKEKIEFVIDQQHGLATDNGNSTFV  125

Query  504   -RDAAINPEKNLRAPAI-RKWQPFRLSVSSRMARTDASSTPVDAM---TSDVIGPCP-WK  665
              RD  ++ E+N+ + +  R  +    +  +   RT   + P D++   T D + P   W+
Sbjct  126   SRDLGMDIERNVSSSSHGRNPEDEEENNPNLPWRTTTGNGPPDSVLDWTRDQLSPRKHWR  185

Query  666   IFGIQNGLRIFKEA--KDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWD  839
             +   QNGLRIF+E    D  P G       A+ AVGV+D T  AIF+ +MS+  +R EWD
Sbjct  186   LVRCQNGLRIFEELPRADHLPRGYS----KAMKAVGVVDATCAAIFELIMSMDGTRFEWD  241

Query  840   FCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIH  1019
               F  G +VE +DGHT +++ +L   W    +  RDL   RYWR  DDG+YV+L+ S  H
Sbjct  242   CSFQHGDLVEEVDGHTAVLYQRLQLEWCSRIVWPRDLCYVRYWRHNDDGSYVVLFQSREH  301

Query  1020  SKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKSYLR---KTTSKSLTI  1181
             S C PQ G+VRA ++SGG  I+P+   N+G  + V+H++ +D + +      +  +   +
Sbjct  302   SNCGPQPGFVRAHMESGGFKISPLKPRNRGPRTQVQHLMQIDLRGWFVGYFPSFQQHCLL  361

Query  1182  DMLGGIAALREMFKAKSGSYFPD--PAMNELTIDIQLPVSEKEEIKNEV-----VATERI  1340
              ML  +A +RE+F      +     P M  +T D     SEKE+   E+     V+ +++
Sbjct  362   HMLSSVAGIRELFSQTDEVHTAPRIPIMVSMTSDS--VSSEKEQKTQEISIQPGVSLDQV  419

Query  1341  EEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSA  1520
               D T         I++ D   +E   + +A  +E  + G                   +
Sbjct  420   FTDNTHPL------ILDEDSDDEEDTHILDA--EEEMELG-------------------S  452

Query  1521  ACFVRKLQDLAVQKNFQE--IVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRG  1694
              C V        QKN +E  +   +     C+   L  D   N    W   D ++F +R 
Sbjct  453   YCHV-------FQKNIEEMDVDTSDSFDTSCFSGNLRWDDDENSRDCWRLPDGNNFKVRS  505

Query  1695  EKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQ  1874
             E + +D SKI +   + ++V  DWL++  R DN+A R G   Q   A ++  F FV+N+Q
Sbjct  506   ENFFKDKSKIPAGKYVMELVAVDWLKNATRMDNVARRSGCAAQ--VASEKGLFSFVINLQ  563

Query  1875  VPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKK  2054
             +PG+T YSL  YY +K  L    LL+RFV+GDD FRNS+FKLIP ++KGSWIV+QSVG  
Sbjct  564   IPGSTHYSLVFYY-VKKQLEPGSLLQRFVDGDDEFRNSRFKLIPSVTKGSWIVRQSVGST  622

Query  2055  SCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEE  2234
             +CL+G++++  Y +G+ YLE+DVD+GSS VA GV+ LV G L +LV++MAFL+QA + +E
Sbjct  623   ACLLGKAVDCTYVRGEKYLEIDVDIGSSAVANGVLGLVFGVLTSLVVDMAFLIQAVSPDE  682

Query  2235  LPEHLLGTCRLNHLDASKAV  2294
             LPE L+G  R+ H + S AV
Sbjct  683   LPERLIGAVRIAHAELSSAV  702



>gb|EEE64990.1| hypothetical protein OsJ_19910 [Oryza sativa Japonica Group]
Length=699

 Score =   355 bits (912),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 237/723 (33%), Positives = 378/723 (52%), Gaps = 76/723 (11%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  + R RYF+L++  L  YK  P      P+++  ID    V+D G 
Sbjct  21    EGWMLRYGRRKIGRSFVRTRYFVLDNKLLAYYKKQP-KDNMVPVKALQIDGNCRVEDRGL  79

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW-  560
             +  H ++ +   + N    ++ +  GA+  E+A  W + L +  I+ +++      RK  
Sbjct  80    KTHHGQMVYVLCIYNKKEKENHITMGAHDIEDALVWKKKL-ELLIDQQQDTMTAKNRKAF  138

Query  561   --QPFRLSVSSRMARTDASSTPVDAM----------------TSDVIGPCPWKIFGIQNG  686
                 F +     ++ +D  S P D++                T+       W++   QNG
Sbjct  139   ASLDFDMEFGGPLSFSDRDSPP-DSVHDWTKEPDIGLSDQNDTNHAYSRKNWRLLRCQNG  197

Query  687   LRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVV  866
             LRIF+E  +     +      A+ AVGV++ T E+IF  +MS+  +R EWD  F  GS+V
Sbjct  198   LRIFEELVEVEYLAR--SCSRAMRAVGVVEATCESIFGLIMSMDVTRYEWDCSFQYGSLV  255

Query  867   EHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGY  1046
             E +DGHT I++ +L  +WL W    RDL   RYWRR DDG+YV+L+ S  H  C PQ G+
Sbjct  256   EEVDGHTAILYHRLQLNWLVW---PRDLCYVRYWRRNDDGSYVVLFRSTEHQNCGPQPGF  312

Query  1047  VRATVKSGGHVITP---VNQGKSSTVKHMLSVDWK----SYLRKTTSKSLTIDMLGGIAA  1205
             VRA ++SGG  I+P   VN    + V+H++ +D K    +Y       SL + ML  +A 
Sbjct  313   VRAFIESGGFKISPLKCVNGRPRTQVQHLMQIDLKGWGVNYFSSFQYYSL-LQMLNCVAG  371

Query  1206  LREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSI  1385
             LRE F +++    P P         ++PV       + +    ++++D   +     +  
Sbjct  372   LREYF-SQTDDIHPVP---------RIPV------MSTMATVSKLKKDKKLQETDLKTKQ  415

Query  1386  VELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQKN  1565
              +   V ++  D+ +   +E  D+  P +   E      P  S +        DL+    
Sbjct  416   ADFGQVDNKNLDMIDEESEEDDDYQVPEANLEE-----APTRSDSDAKYTDPIDLS----  466

Query  1566  FQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLT  1745
                          C+   + +DA+      W   D+  F +R E +  D SK+ +   L 
Sbjct  467   -------------CFSGIIRRDANEKSRNCWTVPDSKLFKVRSESFPHDKSKVPATKYLM  513

Query  1746  QIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKT  1925
             ++V  DWL+   R D++A R G   Q   A ++  F FVVNIQ+PG++ YSL LY++ +T
Sbjct  514   ELVAIDWLRDIKRMDHVARRKGCAAQ--VAAEKGMFTFVVNIQIPGSSHYSLVLYFVTRT  571

Query  1926  PLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQN  2105
              L +  LL+RF +GDD FRNS+ KLIP + KGSWIV+QSVG   CL+G++++ +Y +GQ 
Sbjct  572   -LEKGSLLQRFADGDDDFRNSRLKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCSYMRGQE  630

Query  2106  YLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDAS  2285
             Y+E+DVD+GSS VA GV+ LV G +  L+++MAFL+QA+T +ELPE LLG  RL++++ S
Sbjct  631   YIEVDVDIGSSAVANGVLGLVFGVVTTLIVDMAFLIQANTYDELPEQLLGAARLSNIEPS  690

Query  2286  KAV  2294
              A+
Sbjct  691   SAI  693



>emb|CDP11764.1| unnamed protein product [Coffea canephora]
Length=729

 Score =   353 bits (907),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 250/750 (33%), Positives = 374/750 (50%), Gaps = 94/750 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  YK  P      PL++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSFIHMRYFVLEHRLLAYYKKKP-QDNVVPLKTLLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      +L   A + +EA  W   + ++ I+  +  +A    K+Q
Sbjct  66    KTQHGHMVYVLSIYNKKEKYHRLTMAAFNIQEALIWKEKI-ESVIDQHQESQAVNGNKYQ  124

Query  564   PF---------RLSVSSRM-----ARTDASSTPVDAMTSDVIGPCP--------------  659
              F         R S SS       A  D   +    M    IG  P              
Sbjct  125   SFEYKSGMDNGRKSSSSDHESQFSAAEDEDDSRHSLMRRTTIGNGPPESVFDWTKELDTD  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   K      A+ AVGV++ T E I
Sbjct  185   LANQSTNNQAFSRKHWRLLQCQNGLRIFEELIEVDFLPK--SCSRAMKAVGVVEATCEEI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ +MS+  +R EWD  F  GS+VE +DGHT I++ +L   WL   +  RDL   RYWRR
Sbjct  243   FELVMSMDATRFEWDCTFQYGSLVEEVDGHTAILYHRLQLDWLSMLVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV--NQGKSST-VKHMLSVD---  1136
              DDG+YV+L+ S  H  C PQ G+VRA ++SGG  I+P+  + G+  T V+H+  +D   
Sbjct  303   NDDGSYVVLFQSRQHENCGPQPGFVRAHIESGGFNISPMKPHHGRPRTQVQHLTQIDLKG  362

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKN  1316
             W      +  +   + ML  +A LRE F ++S      P +  +       VS K   K+
Sbjct  363   WGVNYISSFQQHCLLQMLNSVAGLREYF-SQSDERAAAPRIPVMVNMTSASVSSK---KS  418

Query  1317  EVVATERIEEDTT--EKYPSACSSIVELDDVADEF--FDVPEASDDEHSDHGWPRSTTPE  1484
             E +    + + +   ++  S+  ++  +DD +DE   F VP+                  
Sbjct  419   EKLYGSSVHKRSMSLDQITSSNKNVSMMDDYSDEDEDFQVPD------------------  460

Query  1485  YHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAA  1664
               E   P L           D  V+K+  E    +      +   L +D        W  
Sbjct  461   -QEVLPPSL-----------DSEVKKSASEEELADNIDLSIFSGNLRRDDHEKARHCWNI  508

Query  1665  ADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDR  1844
             +D ++F +R   +  D SKI +   L  +V  DW +   R D++A RPG   Q   A ++
Sbjct  509   SDGNNFRVRSRTFCYDKSKIPAGKHLMDLVAVDWFKDSKRMDHVARRPGCTAQ--VASEK  566

Query  1845  PEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGS  2024
               F  V+N+QVPG+T YS+  YY+ K  L    LL+RFV+GDD FRNS+ KLIP + KGS
Sbjct  567   GLFSLVINVQVPGSTHYSMVFYYVTKK-LIPGSLLQRFVDGDDEFRNSRLKLIPSVPKGS  625

Query  2025  WIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMA  2204
             WIV+QSVG   CL+G++++ NY +G NYLE+DVD+GSSTVA GV+ LV+G +  LV++MA
Sbjct  626   WIVRQSVGSTPCLLGKAVDCNYVRGNNYLEIDVDIGSSTVANGVLGLVIGVMTTLVVDMA  685

Query  2205  FLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             FLVQA++ EELPE L+G  R++H++ S AV
Sbjct  686   FLVQANSAEELPERLIGAVRVSHIELSAAV  715



>ref|XP_010677463.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=725

 Score =   352 bits (902),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 241/747 (32%), Positives = 381/747 (51%), Gaps = 91/747 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+  I   ++G  +   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  10    EGWMVRIGRRKIGRSFIHMRYFVLEPRLLAYYKRKP-QDNQVPVKTLVIDGNCRVEDRGL  68

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N  +   ++   A + +EA  W   + +  I+  +  +     K+ 
Sbjct  69    KTHHGHMVYVLSVYNKKDKYHRITMAAFNIQEALIWKEKI-EQVIDQHQESQVGNGNKYL  127

Query  564   PFRLSVSSRMARTDASSTPVDAMTSD-------------VIGPCP---------------  659
              F     S   R  +SS     +++               IG  P               
Sbjct  128   SFEYKAGSDSMRNASSSDRESQLSAQEDEEDGSNLLRRTTIGNGPPEAILDWTREIDSDL  187

Query  660   -------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFK  800
                          W++   QNGLRIF+E  + +   +      A+ AVGV++ T E IF+
Sbjct  188   SQSTNNQVFSRKHWRLLQCQNGLRIFEELSEVDYLPR--SCSRAMRAVGVVEATCEEIFE  245

Query  801   ALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrED  980
              +MS+  +R EWD  F  GS+VE +DGHT +I+ +L   W    +  RDL   RYWRR D
Sbjct  246   LIMSMDGTRFEWDCSFQLGSLVEEVDGHTAVIYQRLQLDWFSSFVWPRDLCYVRYWRRND  305

Query  981   DGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKS--  1145
             DG+YV+L+ S +H  C PQ G+VRA ++SGG  I+P+   N    S V+H++ +D K   
Sbjct  306   DGSYVVLFRSRVHENCGPQPGFVRAHLESGGFNISPLKPRNGRPRSQVQHLMQIDLKGWG  365

Query  1146  --YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNE  1319
               YL       L + +L  +A LRE F A++      P    + + + +  +     KN+
Sbjct  366   VGYLSSFQQHCL-LQVLNSVAGLREYF-AQTDERVATP---RIPVMVNMTSASMSLRKNQ  420

Query  1320  VVATERIEEDTTEK--YPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHE  1493
                   I   ++++   P+  S +++ D   DE F +PEA  + +S              
Sbjct  421   KFQDPSIHPSSSDENIVPNRNSVMMDEDSDEDEDFQIPEADQEVYS--------------  466

Query  1494  TPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADT  1673
                   S+A   V+K    AV++   +I          +  +L +D + N    W  +D 
Sbjct  467   ------STAEDEVKKT---AVEETTDQI------DLSMFSGSLRRDNNENARNCWRISDG  511

Query  1674  SSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEF  1853
             ++F +R + Y  D SK+ +   L  +V  DW +   R D++A R G   Q   A ++  F
Sbjct  512   NNFKVRSKSYSHDRSKVPAGKHLMDLVAVDWFKDSKRMDHVARRQGCAAQ--VAVEKGLF  569

Query  1854  FFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIV  2033
               V+N+QVPG+T YS+ ++Y + T L    LL+RFV+GDD FRNS+ KLIP + KGSWIV
Sbjct  570   SLVINVQVPGSTHYSM-VFYFVTTKLIPGSLLQRFVDGDDEFRNSRLKLIPSVPKGSWIV  628

Query  2034  KQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLV  2213
             +QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G +  LV++MAFLV
Sbjct  629   RQSVGSTPCLLGKAVDCNYIRGPQYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLV  688

Query  2214  QADTEEELPEHLLGTCRLNHLDASKAV  2294
             QA++E+ELPE L+G  R +H++ S A+
Sbjct  689   QANSEDELPERLIGAVRASHIELSSAI  715



>ref|NP_193639.2| protein ENHANCED DISEASE RESISTANCE 2 [Arabidopsis thaliana]
 sp|F4JSE7.1|EDR2_ARATH RecName: Full=Protein ENHANCED DISEASE RESISTANCE 2 [Arabidopsis 
thaliana]
 gb|AEE84130.1| enhanced disease resistance 2 protein [Arabidopsis thaliana]
Length=718

 Score =   351 bits (901),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 244/752 (32%), Positives = 377/752 (50%), Gaps = 96/752 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDYQVPIKTMLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +  + P  +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKI-ESVIDQHQESQVPNGQQYV  124

Query  564   PFRLSVSSRMARTDASS--------------TPVDAMTSDVIGPCP--------------  659
              F         RT +SS              +    M    IG  P              
Sbjct  125   SFEYKSGMDTGRTASSSDHESQFSAAEDEEDSRRSLMRRTTIGNGPPESVLDWTKEFDAE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E I
Sbjct  185   LANQNSDNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEEI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ LMS+  +R EWD  F  GS+VE +DGHT +++ +L   W P  +  RDL   RYWRR
Sbjct  243   FELLMSMDGTRYEWDCSFQFGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---  1136
              DDG+YV+L+ S  H  C PQ G VRA ++SGG+ I+P+   N    + V+H++ +D   
Sbjct  303   NDDGSYVVLFRSREHENCGPQPGCVRAHLESGGYNISPLKPRNGRPRTQVQHLIQIDLKG  362

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKA--KSGSYFPDPAM-NELTIDIQLPVSEKEE  1307
             W +       +   + ML  +A LRE F    + G +   P M N  +  + L  S K  
Sbjct  363   WGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGVHTRIPVMVNMASSSLSLTKSGKSL  422

Query  1308  IKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEY  1487
              K+          D T    +  S +++ D   D+ F + E+  +       P ++ PE 
Sbjct  423   HKSA------FSLDQTNSV-NRNSLLMDEDSDDDDEFQIAESEQE-------PETSKPET  468

Query  1488  HETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAA  1667
              +  RP+   A        DL+                 C+   L ++ + N    W  +
Sbjct  469   -DVKRPEEEPAHNI-----DLS-----------------CFSGNLKRNENENARNCWRIS  505

Query  1668  DTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRP  1847
             D ++F +RG+ + Q+  KI +   L  +V  DW +   R D++A R G   Q   A ++ 
Sbjct  506   DGNNFKVRGKNFGQEKRKIPAGKHLMDLVAVDWFKDSKRIDHVARRKGCAAQ--VAAEKG  563

Query  1848  EFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSW  2027
              F  VVN+QVPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KLIP + KGSW
Sbjct  564   LFSMVVNVQVPGSTHYSMVFYFVMKE-LVPGSLLQRFVDGDDEFRNSRLKLIPLVPKGSW  622

Query  2028  IVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAF  2207
             IV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+EMAF
Sbjct  623   IVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVEMAF  682

Query  2208  LVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             LVQA+T EE PE L+G  R++H++ S A+  N
Sbjct  683   LVQANTAEEQPERLIGAVRVSHIELSSAIVPN  714



>ref|XP_009785636.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Nicotiana sylvestris]
Length=711

 Score =   351 bits (900),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 237/743 (32%), Positives = 371/743 (50%), Gaps = 96/743 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  YK  P  G   P+++  ID    V+D G 
Sbjct  8     EGWMVRYGRRKIGKSFLHMRYFVLETRLLAYYKTKP-QGNAAPIKTLQIDGNFRVEDRGL  66

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H ++ +  ++ N     DQ+   A + +++  W   + ++ I+  +  +     K+ 
Sbjct  67    KTHHGQMVYVLSVYNMKEKYDQITMAAFNIQDSLSWKEKI-ESVIDQHQEAQGANRSKYN  125

Query  564   PFRLSVSSRMARTDASSTPVDAMT-------------------------------SDVIG  650
              F+    S         +P  A                                 SD+  
Sbjct  126   DFKSGTDSTGRTVSDHESPFSAAEDEEDSQPNLIRGTTMGNGPPESVVDWTKESESDLAN  185

Query  651   PCPWKIFGIQNGLRIFKEA--KDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPS  824
             P   ++   QNGLRIF+E    D  P G       A+ AVGV++ T E IF+ +MS+  +
Sbjct  186   PKYRRLLYCQNGLRIFEELLNVDLVPKG----CSRAMKAVGVVEATCEEIFELVMSMDAT  241

Query  825   RSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILY  1004
             R EWD  F  GS+VE +DGHT I++ +L   W P  +  RDL   RYWRR DDG+YV+L+
Sbjct  242   RFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPRFIWPRDLCYVRYWRRNDDGSYVVLF  301

Query  1005  HSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKSY---LRKTTS  1166
              S  H  C P  GYVRA ++SGG  I+P+   N    + V+H++ +D K +      +  
Sbjct  302   RSREHKNCGPLPGYVRAHIESGGFNISPLKPRNGRPRTQVQHLMQIDLKGWGVGFIASFQ  361

Query  1167  KSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEE  1346
             +     ML  +A LRE F             +E     ++PV     + +  +++++ ++
Sbjct  362   QHCLFQMLNSVAGLREYFSQ----------TDERAAAPRIPV--MVNMTSPSISSKKSQK  409

Query  1347  DTTEKYPS------ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPE-YHETPRP  1505
              +  + PS      A  +   +D+ +DE  D  + +D E S  G  + T      E P  
Sbjct  410   QSHHRTPSLDQIRAANRNASMMDEYSDEDEDF-QGTDQEVSSPGLDQDTIKTALEEEPLD  468

Query  1506  KLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFL  1685
             ++           DL+                  +   L +D + N    W  +D  +F 
Sbjct  469   QI-----------DLST-----------------FSGNLRRDENENGRDCWTISDGKNFR  500

Query  1686  IRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVV  1865
             +RG+ +  D +K+ +   L  +V  DW +   R D++A RPG   Q   A ++  F  V+
Sbjct  501   LRGKNFCSDKTKVPAGKPLMDLVAVDWFKDTKRMDHVARRPGCAAQ--VASEKGLFSLVI  558

Query  1866  NIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSV  2045
             N+QVPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KLIP + KGSWIV+QSV
Sbjct  559   NLQVPGSTHYSMIFYFVMKK-LIPGSLLQRFVDGDDEFRNSRMKLIPSVPKGSWIVRQSV  617

Query  2046  GKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADT  2225
             G   CL+G++++ NY +G  YLE+DVDVGSSTVA GV+ LV+G +  LV++MAF+VQ +T
Sbjct  618   GSSPCLLGKAVDCNYIRGPKYLEIDVDVGSSTVANGVMGLVIGVITTLVVDMAFVVQGNT  677

Query  2226  EEELPEHLLGTCRLNHLDASKAV  2294
              +ELPE L+G  R+ H++ S AV
Sbjct  678   PDELPEPLIGVARVCHIELSSAV  700



>ref|XP_008648200.1| PREDICTED: uncharacterized protein LOC100384563 isoform X1 [Zea 
mays]
Length=746

 Score =   352 bits (902),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 246/743 (33%), Positives = 378/743 (51%), Gaps = 97/743 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+L++  L  YK  P      PL+S IID    V+D G 
Sbjct  49    EGWMVRHGRRKIGRSFFHTRYFVLDNGVLAYYKKKP-RDHMIPLKSIIIDGNCRVEDRGL  107

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARW---IRCLRDAAINPEKNLRAPA--  548
             +  H ++ +   + N    ++Q+  G    E+A  W   I  L D      KN +A A  
Sbjct  108   KTHHGQMIYLLCIYNKKEKENQITMGGYDIEDALAWKRKIELLIDQDTTTAKNHKAFASL  167

Query  549   ---IRKWQPFRLS------------VSSRMARTDASSTPVDAM----------------T  635
                I    PF  S              + + RT   + P D++                T
Sbjct  168   DFDIDLGGPFSFSDHDSGPEDEEEPRPTLLRRTTIGNGPPDSVLDWTKEADSGLSNQNAT  227

Query  636   SDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSL  815
             S       W++   QNGLRIF+E  +     + +    A+ AVGV++ + EAIF  +MS+
Sbjct  228   SQAYSRKNWRLLRCQNGLRIFEELVEVEYLARSYSR--AMRAVGVVEASCEAIFGLVMSM  285

Query  816   GPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYV  995
               SR EWD  F  GS+VE +DGHT I++ +L  +W    +  RDL   RYWRR DDG+YV
Sbjct  286   DASRYEWDCSFQYGSLVEEVDGHTAILYHRLQLNWFSMLVWPRDLCYVRYWRRNDDGSYV  345

Query  996   ILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWK----SYLR  1154
             +L+ S  +  C PQ G+VRA+++SGG  I+P+   N    + V+H++ +D +    +YL 
Sbjct  346   VLFRSTENQNCGPQPGFVRASIESGGFKISPLKSLNGRPRTQVQHLMQIDVRGWGVNYLP  405

Query  1155  KTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATE  1334
                  SL + ML  +A LRE F             +E+    ++PV         +   +
Sbjct  406   SFQYYSL-LQMLNCVAGLREYFSQ----------TDEIHTVPRIPVMHTMVNAASMKKDQ  454

Query  1335  RIEE--DTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPK  1508
              ++E    T++  +    +V+ +   D+ + VP+A  +E      P  +  +   +    
Sbjct  455   NLQEPDSKTKQADNKHLDMVDEESEDDDDYQVPDADVEEE-----PTKSDSDAKNSDPID  509

Query  1509  LSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLI  1688
             LS  +  +R  QD              E ++ C                WA  D+  F +
Sbjct  510   LSWFSGIIR--QDT------------NEKSRNC----------------WAVPDSKIFKV  539

Query  1689  RGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVN  1868
             R + +  D SK+ +   L ++V  DW +   R D++A R GS VQ   A ++  F F+VN
Sbjct  540   RSKNFPHDKSKVPAGKYLMELVAVDWFKDAKRMDHVARRKGSAVQ--VAAEKGMFTFLVN  597

Query  1869  IQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVG  2048
             IQ+PG + YSL LY+ +   L +  LL+RF +GDD FRNS+ KLIP + KGSWIV+QSVG
Sbjct  598   IQIPGPSHYSLVLYF-VSNSLKKGSLLQRFADGDDDFRNSRLKLIPSVPKGSWIVRQSVG  656

Query  2049  KKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTE  2228
                CL+G++++ +Y +G +YLE+DVD+GSS VA GV+ LV G +  LV++MAFL+QA+T 
Sbjct  657   STPCLLGKAVDCSYLRGPDYLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAFLIQANTY  716

Query  2229  EELPEHLLGTCRLNHLDASKAVH  2297
             +ELPE LLG  RL+H++ S AV+
Sbjct  717   DELPEQLLGAARLSHIEPSAAVY  739



>ref|XP_002865237.1| hypothetical protein ARALYDRAFT_494427 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41496.1| hypothetical protein ARALYDRAFT_494427 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   351 bits (900),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 246/755 (33%), Positives = 374/755 (50%), Gaps = 99/755 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDNQLPIKTMVIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARW---IRCLRDAAINPEKNLRAPAIR  554
             +  H  + +  ++ N      ++   A + +EA  W   I C+    I+  ++   P+ +
Sbjct  66    KTHHGHMVYVLSIYNKKEKHHRITMAAFNIQEALMWKEKIECV----IDQHQDSLVPSGQ  121

Query  555   KWQPFRLSVSSRMARTDASS---TPVDAMTSD-----------VIGPCP-----------  659
             ++  F         RT +SS   +P  A+  +            IG  P           
Sbjct  122   QYVSFEYKPGMDAGRTASSSDHESPFSALDDEDDSRRDLLRRTTIGNGPPESILDWTKEF  181

Query  660   ------------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTS  785
                               W++   QNGLRIF+E  + +   +      A+ AVGV++ T 
Sbjct  182   DAELSNQSSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATC  239

Query  786   EAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrry  965
             E IF+ +MS+  +R EWD  F  G +VE +DGHT I++ +L   WLP  +  RDL   RY
Sbjct  240   EEIFELVMSMDGTRYEWDCSFQYGRLVEEVDGHTAILYHRLLLDWLPMVVWPRDLCYVRY  299

Query  966   wrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD  1136
             WRR DDG+YV+L+ S  H  C PQ G+VRA ++SGG  I P+   N    + V+H++ +D
Sbjct  300   WRRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQID  359

Query  1137  ---WKSYLRKTTSKSLTIDMLGGIAALREMFKAKS--GSYFPDPAM-NELTIDIQLPVSE  1298
                W +       +   + ML  ++ LRE F      G     P M N  +    L    
Sbjct  360   LKGWGAGYLPAFQQHCLLQMLNSVSGLREWFSQTDDRGQPIRIPVMVNMASSSFALGKGG  419

Query  1299  KEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTT  1478
             K + K+ +        D T    S  S +++ D   D+ F +P++  +  +      S  
Sbjct  420   KPQHKSSLSI------DQTNG-ASRNSVLMDEDSDDDDEFQIPDSEQEPET------SKQ  466

Query  1479  PEYHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSW  1658
              +  ET   K   AA  +    DL+                 C+   L  D + N    W
Sbjct  467   EQEQETDAKKTEEAALNI----DLS-----------------CFSGNLRHDDNENARNCW  505

Query  1659  AAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQ  1838
               +D ++F +RG+ +  D  KI +   L  +V  DW +   R D++  R G   Q   A 
Sbjct  506   RISDGNNFKVRGKSFCSDKRKIPAGKHLMDLVAVDWFKDTKRMDHVVRRKGCAAQ--VAA  563

Query  1839  DRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISK  2018
             ++  F  VVN+QVPG+T YS+  Y++ K  L    L +RFV+GDD FRNS+ KLIP + K
Sbjct  564   EKGLFSTVVNVQVPGSTHYSMVFYFVTKE-LVPGSLFQRFVDGDDEFRNSRLKLIPLVPK  622

Query  2019  GSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIE  2198
             GSWIV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+E
Sbjct  623   GSWIVRQSVGSTPCLLGRAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVE  682

Query  2199  MAFLVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             MAFLVQA+T EELPE L+G  R++H++ S A+  N
Sbjct  683   MAFLVQANTPEELPERLIGAVRVSHIELSSAIVPN  717



>ref|XP_009785635.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Nicotiana sylvestris]
Length=713

 Score =   350 bits (898),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 237/745 (32%), Positives = 371/745 (50%), Gaps = 98/745 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  YK  P  G   P+++  ID    V+D G 
Sbjct  8     EGWMVRYGRRKIGKSFLHMRYFVLETRLLAYYKTKP-QGNAAPIKTLQIDGNFRVEDRGL  66

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H ++ +  ++ N     DQ+   A + +++  W   + ++ I+  +  +     K+ 
Sbjct  67    KTHHGQMVYVLSVYNMKEKYDQITMAAFNIQDSLSWKEKI-ESVIDQHQEAQGANRSKYN  125

Query  564   PFRLSVSSRMARTDASSTPVDAMT---------------------------------SDV  644
              F+    S         +P  A                                   SD+
Sbjct  126   DFKSGTDSTGRTVSDHESPFSAAEDEEDSQPNLIRGTTMGNVEGPPESVVDWTKESESDL  185

Query  645   IGPCPWKIFGIQNGLRIFKEA--KDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLG  818
               P   ++   QNGLRIF+E    D  P G       A+ AVGV++ T E IF+ +MS+ 
Sbjct  186   ANPKYRRLLYCQNGLRIFEELLNVDLVPKG----CSRAMKAVGVVEATCEEIFELVMSMD  241

Query  819   PSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVI  998
              +R EWD  F  GS+VE +DGHT I++ +L   W P  +  RDL   RYWRR DDG+YV+
Sbjct  242   ATRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPRFIWPRDLCYVRYWRRNDDGSYVV  301

Query  999   LYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKSY---LRKT  1160
             L+ S  H  C P  GYVRA ++SGG  I+P+   N    + V+H++ +D K +      +
Sbjct  302   LFRSREHKNCGPLPGYVRAHIESGGFNISPLKPRNGRPRTQVQHLMQIDLKGWGVGFIAS  361

Query  1161  TSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERI  1340
               +     ML  +A LRE F             +E     ++PV     + +  +++++ 
Sbjct  362   FQQHCLFQMLNSVAGLREYFSQ----------TDERAAAPRIPV--MVNMTSPSISSKKS  409

Query  1341  EEDTTEKYPS------ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPE-YHETP  1499
             ++ +  + PS      A  +   +D+ +DE  D  + +D E S  G  + T      E P
Sbjct  410   QKQSHHRTPSLDQIRAANRNASMMDEYSDEDEDF-QGTDQEVSSPGLDQDTIKTALEEEP  468

Query  1500  RPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSS  1679
               ++           DL+                  +   L +D + N    W  +D  +
Sbjct  469   LDQI-----------DLST-----------------FSGNLRRDENENGRDCWTISDGKN  500

Query  1680  FLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFF  1859
             F +RG+ +  D +K+ +   L  +V  DW +   R D++A RPG   Q   A ++  F  
Sbjct  501   FRLRGKNFCSDKTKVPAGKPLMDLVAVDWFKDTKRMDHVARRPGCAAQ--VASEKGLFSL  558

Query  1860  VVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQ  2039
             V+N+QVPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KLIP + KGSWIV+Q
Sbjct  559   VINLQVPGSTHYSMIFYFVMKK-LIPGSLLQRFVDGDDEFRNSRMKLIPSVPKGSWIVRQ  617

Query  2040  SVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQA  2219
             SVG   CL+G++++ NY +G  YLE+DVDVGSSTVA GV+ LV+G +  LV++MAF+VQ 
Sbjct  618   SVGSSPCLLGKAVDCNYIRGPKYLEIDVDVGSSTVANGVMGLVIGVITTLVVDMAFVVQG  677

Query  2220  DTEEELPEHLLGTCRLNHLDASKAV  2294
             +T +ELPE L+G  R+ H++ S AV
Sbjct  678   NTPDELPEPLIGVARVCHIELSSAV  702



>gb|EEC79883.1| hypothetical protein OsI_21390 [Oryza sativa Indica Group]
Length=719

 Score =   350 bits (897),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 236/738 (32%), Positives = 375/738 (51%), Gaps = 86/738 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  + R RYF+L++  L  YK  P      P+++  ID    V+D G 
Sbjct  21    EGWMLRYGRRKIGRSFVRTRYFVLDNKLLAYYKKQP-KDNMVPVKALQIDGNCRVEDRGL  79

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H ++ +   + N    ++ +  GA+  E+A  W + L       +  + A   + + 
Sbjct  80    KTHHGQMVYVLCIYNKKEKENHITMGAHDIEDALVWKKKLELLIDQQQDTMTAKNRKAFA  139

Query  564   PFR--------LSVSSR----------MARTDASSTPVDAM----------------TSD  641
                        LS S R          + RT   + P D++                T+ 
Sbjct  140   SLDFDMEFGGPLSFSDRDNEEEPRPTLLRRTTIGNGPPDSVHDWTKEPDIGLSDQNDTNH  199

Query  642   VIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGP  821
                   W++   QNGLRIF+E  +     +      A+ AVGV++ T E+IF  +MS+  
Sbjct  200   AYSRKNWRLLRCQNGLRIFEELVEVEYLAR--SCSRAMRAVGVVEATCESIFGLIMSMDV  257

Query  822   SRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVIL  1001
             +R EWD  F  GS+VE +DGHT I++ +L  +W    +  RDL   RYWRR DDG+YV+L
Sbjct  258   TRYEWDCSFQYGSLVEEVDGHTAILYHRLQLNWFSMLVWPRDLCYVRYWRRNDDGSYVVL  317

Query  1002  YHSVIHSKCPPQEGYVRATVKSGGHVITP---VNQGKSSTVKHMLSVDWK----SYLRKT  1160
             + S  H  C PQ G+VRA ++SGG  I+P   VN    + V+H++ +D K    +Y    
Sbjct  318   FRSTEHQNCGPQPGFVRAFIESGGFKISPLKCVNGRPRTQVQHLMQIDLKGWGVNYFSSF  377

Query  1161  TSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERI  1340
                SL + ML  +A LRE F +++    P P         ++PV       + +    ++
Sbjct  378   QYYSL-LQMLNCVAGLREYF-SQTDDIHPVP---------RIPV------MSTMATVSKL  420

Query  1341  EEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSA  1520
             ++D   +     +   +   V ++  D+ +   +E  D+  P +   E      P  S +
Sbjct  421   KKDKKLQETDLKTKQADFGQVDNKNLDMIDEESEEDDDYQVPEANLEE-----APTRSDS  475

Query  1521  ACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEK  1700
                     DL+                 C+   + +DA+      W   D+  F +R E 
Sbjct  476   DAKYTDPIDLS-----------------CFSGIIRRDANEKSRNCWTVPDSKLFKVRSES  518

Query  1701  YLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVP  1880
             +  D SK+ +   L ++V  DWL+   R D++A R G   Q   A ++  F FVVNIQ+P
Sbjct  519   FPHDKSKVPATKYLMELVAIDWLRDIKRMDHVARRKGCAAQ--VAAEKGMFTFVVNIQIP  576

Query  1881  GATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSC  2060
             G++ YSL LY++ +T L +  LL+RF +GDD FRNS+ KLIP + KGSWIV+QSVG   C
Sbjct  577   GSSHYSLVLYFVTRT-LEKGSLLQRFADGDDDFRNSRLKLIPSVPKGSWIVRQSVGSTPC  635

Query  2061  LIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELP  2240
             L+G++++ +Y +GQ Y+E+DVD+GSS VA GV+ LV G +  L+++MAFL+QA+T +ELP
Sbjct  636   LLGKAVDCSYMRGQEYIEVDVDIGSSAVANGVLGLVFGVVTTLIVDMAFLIQANTYDELP  695

Query  2241  EHLLGTCRLNHLDASKAV  2294
             E LLG  RL++++ S A+
Sbjct  696   EQLLGAARLSNIEPSSAI  713



>ref|NP_001119010.1| protein ENHANCED DISEASE RESISTANCE 2 [Arabidopsis thaliana]
 gb|AEE84131.1| enhanced disease resistance 2 protein [Arabidopsis thaliana]
Length=724

 Score =   349 bits (895),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 244/758 (32%), Positives = 377/758 (50%), Gaps = 102/758 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDYQVPIKTMLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +  + P  +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKI-ESVIDQHQESQVPNGQQYV  124

Query  564   PFRLSVSSRMARTDASS--------------------TPVDAMTSDVIGPCP--------  659
              F         RT +SS                    +    M    IG  P        
Sbjct  125   SFEYKSGMDTGRTASSSDHESQSAISFRFSAAEDEEDSRRSLMRRTTIGNGPPESVLDWT  184

Query  660   ---------------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVID  776
                                  W++   QNGLRIF+E  + +   +      A+ AVGV++
Sbjct  185   KEFDAELANQNSDNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVE  242

Query  777   GTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlll  956
              T E IF+ LMS+  +R EWD  F  GS+VE +DGHT +++ +L   W P  +  RDL  
Sbjct  243   ATCEEIFELLMSMDGTRYEWDCSFQFGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLCY  302

Query  957   rrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHML  1127
              RYWRR DDG+YV+L+ S  H  C PQ G VRA ++SGG+ I+P+   N    + V+H++
Sbjct  303   VRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHLESGGYNISPLKPRNGRPRTQVQHLI  362

Query  1128  SVD---WKSYLRKTTSKSLTIDMLGGIAALREMFKA--KSGSYFPDPAM-NELTIDIQLP  1289
              +D   W +       +   + ML  +A LRE F    + G +   P M N  +  + L 
Sbjct  363   QIDLKGWGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGVHTRIPVMVNMASSSLSLT  422

Query  1290  VSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPR  1469
              S K   K+          D T    +  S +++ D   D+ F + E+  +       P 
Sbjct  423   KSGKSLHKSA------FSLDQTNSV-NRNSLLMDEDSDDDDEFQIAESEQE-------PE  468

Query  1470  STTPEYHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMP  1649
             ++ PE  +  RP+   A        DL+                 C+   L ++ + N  
Sbjct  469   TSKPET-DVKRPEEEPAHNI-----DLS-----------------CFSGNLKRNENENAR  505

Query  1650  GSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKY  1829
               W  +D ++F +RG+ + Q+  KI +   L  +V  DW +   R D++A R G   Q  
Sbjct  506   NCWRISDGNNFKVRGKNFGQEKRKIPAGKHLMDLVAVDWFKDSKRIDHVARRKGCAAQ--  563

Query  1830  AAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPY  2009
              A ++  F  VVN+QVPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KLIP 
Sbjct  564   VAAEKGLFSMVVNVQVPGSTHYSMVFYFVMKE-LVPGSLLQRFVDGDDEFRNSRLKLIPL  622

Query  2010  ISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNL  2189
             + KGSWIV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +L
Sbjct  623   VPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSL  682

Query  2190  VIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             V+EMAFLVQA+T EE PE L+G  R++H++ S A+  N
Sbjct  683   VVEMAFLVQANTAEEQPERLIGAVRVSHIELSSAIVPN  720



>gb|KFK28575.1| hypothetical protein AALP_AA7G014500 [Arabis alpina]
Length=720

 Score =   349 bits (895),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 238/753 (32%), Positives = 371/753 (49%), Gaps = 96/753 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDSQVPIKTMLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +  + P  +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKHHRITMAAFNIQEALMWKEKI-ESVIDQHQECQVPNGQQYV  124

Query  564   PFRLSVSSRMARTDASS-------TPVDA---------MTSDVIGPCP------------  659
              F         RT +SS       TP D          M    IG  P            
Sbjct  125   SFEYKSGMDTGRTASSSDHESQFSTPEDEDNSQPRRSLMRRTTIGNGPPEAVLDWTKEFD  184

Query  660   -----------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSE  788
                              W++   QNGLRIF+E  + +   +      A+ AVGV++ T E
Sbjct  185   AELANQNSDNQAFSRKHWRLLQCQNGLRIFEELLEVDYLTR--SCSRAMKAVGVVEATCE  242

Query  789   AIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrryw  968
              +F+ +MS+  +R EWD  F  GS+VE +DGHT +++ +L   W P  +  RDL   RYW
Sbjct  243   EVFELVMSMDGTRYEWDCSFHSGSLVEEVDGHTAVLYHRLLLDWFPMVVWPRDLCYVRYW  302

Query  969   rrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD-  1136
             RR DDG+YV+L+ S  H  C PQ G VRA ++SGG+ I+P+   N    + V+H++ +D 
Sbjct  303   RRNDDGSYVVLFRSREHGNCSPQPGCVRAHLESGGYNISPLKPRNGRPRTQVQHLIQIDL  362

Query  1137  --WKSYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPD--PAMNELTIDIQLPVSEKE  1304
               W +       +   + ML  +A LRE F        P   PAM  +           +
Sbjct  363   KGWGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGVPTRIPAMVNMASSSLSLSKSGK  422

Query  1305  EIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPE  1484
              +     + +  + ++  +     S +++ D   D+ F + E+  +  +         PE
Sbjct  423   SLHRSAFSLD--QNNSAHRN----SVLMDDDSDDDDEFQIAESEQEPETSKTETDVKKPE  476

Query  1485  YHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAA  1664
               E P   +   +CF   L+               E A+ C                W  
Sbjct  477   --EEPAHNI-DLSCFSGNLKR-----------NDNENARNC----------------WRT  506

Query  1665  ADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDR  1844
             +D ++F +RG+ +  D  KI +   L  +V  DW +   R D++A R G   Q   A ++
Sbjct  507   SDGNNFKVRGKSFCNDKRKIPAGKHLMDLVAVDWFKDSKRIDHVARRKGCAAQ--VAAEK  564

Query  1845  PEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGS  2024
               F  VVN+QVPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KL+P + KGS
Sbjct  565   GLFSMVVNVQVPGSTHYSMVFYFVMKE-LVRGSLLQRFVDGDDEFRNSRLKLVPLVPKGS  623

Query  2025  WIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMA  2204
             WIV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+EMA
Sbjct  624   WIVRQSVGSTPCLLGRAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVIRSLVVEMA  683

Query  2205  FLVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             FLVQA+T EELPE L+G  R++H++ S A+  N
Sbjct  684   FLVQANTPEELPERLIGAVRVSHIELSSAIVPN  716



>ref|NP_001190769.1| protein ENHANCED DISEASE RESISTANCE 2 [Arabidopsis thaliana]
 gb|AEE84132.1| enhanced disease resistance 2 protein [Arabidopsis thaliana]
Length=720

 Score =   348 bits (894),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 243/752 (32%), Positives = 376/752 (50%), Gaps = 94/752 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDYQVPIKTMLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +  + P  +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKI-ESVIDQHQESQVPNGQQYV  124

Query  564   PFRLSVSSRMARTDASS--------------TPVDAMTSDVIGPCP--------------  659
              F         RT +SS              +    M    IG  P              
Sbjct  125   SFEYKSGMDTGRTASSSDHESQFSAAEDEEDSRRSLMRRTTIGNGPPESVLDWTKEFDAE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E I
Sbjct  185   LANQNSDNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEEI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ LMS+  +R EWD  F  GS+VE +DGHT +++ +L   W+ W    RDL   RYWRR
Sbjct  243   FELLMSMDGTRYEWDCSFQFGSLVEEVDGHTAVLYHRLLLDWIVW---PRDLCYVRYWRR  299

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---  1136
              DDG+YV+L+ S  H  C PQ G VRA ++SGG+ I+P+   N    + V+H++ +D   
Sbjct  300   NDDGSYVVLFRSREHENCGPQPGCVRAHLESGGYNISPLKPRNGRPRTQVQHLIQIDLKG  359

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKA--KSGSYFPDPAM-NELTIDIQLPVSEKEE  1307
             W +       +   + ML  +A LRE F    + G +   P M N  +  + L  S K  
Sbjct  360   WGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGVHTRIPVMVNMASSSLSLTKSGKSL  419

Query  1308  IKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEY  1487
              K+          D T    +  S +++ D   D+ F + E+  +       P ++ PE 
Sbjct  420   HKSA------FSLDQTNSV-NRNSLLMDEDSDDDDEFQIAESEQE-------PETSKPET  465

Query  1488  HETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAA  1667
              +  RP +           DL+                 C+   L ++ + N    W  +
Sbjct  466   -DVKRPGVHPIKEEPAHNIDLS-----------------CFSGNLKRNENENARNCWRIS  507

Query  1668  DTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRP  1847
             D ++F +RG+ + Q+  KI +   L  +V  DW +   R D++A R G   Q   A ++ 
Sbjct  508   DGNNFKVRGKNFGQEKRKIPAGKHLMDLVAVDWFKDSKRIDHVARRKGCAAQ--VAAEKG  565

Query  1848  EFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSW  2027
              F  VVN+QVPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KLIP + KGSW
Sbjct  566   LFSMVVNVQVPGSTHYSMVFYFVMKE-LVPGSLLQRFVDGDDEFRNSRLKLIPLVPKGSW  624

Query  2028  IVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAF  2207
             IV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+EMAF
Sbjct  625   IVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVEMAF  684

Query  2208  LVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             LVQA+T EE PE L+G  R++H++ S A+  N
Sbjct  685   LVQANTAEEQPERLIGAVRVSHIELSSAIVPN  716



>ref|NP_199369.2| ENHANCED DISEASE RESISTANCE 2-like protein [Arabidopsis thaliana]
 sp|Q8VZF6.1|EDR2L_ARATH RecName: Full=Protein ENHANCED DISEASE RESISTANCE 2-like [Arabidopsis 
thaliana]
 gb|AAL57642.1| AT5g45560/MFC19_23 [Arabidopsis thaliana]
 gb|AED95268.1| ENHANCED DISEASE RESISTANCE 2-like protein [Arabidopsis thaliana]
Length=719

 Score =   348 bits (892),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 245/755 (32%), Positives = 372/755 (49%), Gaps = 101/755 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDNQLPIKTMVIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARW---IRCLRDAAINPEKNLRAPAIR  554
             +  H  + +  ++ N      ++   A + +EA  W   I C+    I+  ++   P+ +
Sbjct  66    KTHHGHMVYVLSIYNKKEKHHRITMAAFNIQEALMWKEKIECV----IDQHQDSLVPSGQ  121

Query  555   KWQPFRLSVSSRMARTDASS---TPVDAMTSD-----------VIGPCP-----------  659
             ++  F         RT +SS   +P  A+  +            IG  P           
Sbjct  122   QYVSFEYKPGMDAGRTASSSDHESPFSALEDENDSQRDLLRRTTIGNGPPESILDWTKEF  181

Query  660   ------------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTS  785
                               W++   QNGLRIF+E  + +   +      A+ AVGV++ T 
Sbjct  182   DAELSNQSSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATC  239

Query  786   EAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrry  965
             E IF+ +MS+  +R EWD  F  G +VE +DGHT I++ +L   W P  +  RDL   RY
Sbjct  240   EEIFELVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRY  299

Query  966   wrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD  1136
             WRR DDG+YV+L+ S  H  C PQ G+VRA ++SGG  I P+   N    + V+H++ +D
Sbjct  300   WRRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQID  359

Query  1137  ---WKSYLRKTTSKSLTIDMLGGIAALREMFKAKS--GSYFPDPAM-NELTIDIQLPVSE  1298
                W S       +   + ML  ++ LRE F      G     P M N  +  + L    
Sbjct  360   LKGWGSGYLPAFQQHCLLQMLNSVSGLREWFSQTDDRGQPIRIPVMVNMASSSLALGKGG  419

Query  1299  KEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTT  1478
             K   K+ +        D T    S  S +++ D   D+ F +P++  +          T+
Sbjct  420   KHHHKSSLSI------DQTNG-ASRNSVLMDEDSDDDDEFQIPDSEPEP--------ETS  464

Query  1479  PEYHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSW  1658
              +  ET   K    A  +    DL+                 C+   L  D + N    W
Sbjct  465   KQDQETDAKKTEEPALNI----DLS-----------------CFSGNLRHDDNENARNCW  503

Query  1659  AAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQ  1838
               +D ++F +RG+ +  D  KI +   L  +V  DW +   R D++  R G   Q   A 
Sbjct  504   RISDGNNFKVRGKSFCDDKRKIPAGKHLMDLVAVDWFKDTKRMDHVVRRKGCAAQ--VAA  561

Query  1839  DRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISK  2018
             ++  F  VVN+QVPG+T YS+  Y++ K  L    L +RFV+GDD FRNS+ KLIP + K
Sbjct  562   EKGLFSTVVNVQVPGSTHYSMVFYFVTKE-LVPGSLFQRFVDGDDEFRNSRLKLIPLVPK  620

Query  2019  GSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIE  2198
             GSWIV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+E
Sbjct  621   GSWIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVE  680

Query  2199  MAFLVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             MAFLVQA+T EELPE L+G  R++H++ S A+  N
Sbjct  681   MAFLVQANTPEELPERLIGAVRVSHVELSSAIVPN  715



>ref|XP_003557176.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Brachypodium 
distachyon]
Length=786

 Score =   349 bits (896),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 242/758 (32%), Positives = 388/758 (51%), Gaps = 95/758 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+L++  L  YK  P      PL++ +ID    V+D G 
Sbjct  57    EGWMVRYGRRKIGRSFFHTRYFVLDNKLLAYYKKQP-KDNMVPLKALVIDGNCRVEDRGL  115

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW-  560
             +  H ++ +   + N    D+ +  GA+  E A  W + + +  I+ +++      RK  
Sbjct  116   KTHHGQMVYVLCVYNKKEKDNPITMGAHDIEGALAWKKKI-ELLIDQQQDTMTAKNRKAF  174

Query  561   --QPFRLSVSSRMARTDASSTPVDAM----------------------------------  632
                 F + +   ++ +D  S P D                                    
Sbjct  175   ASLDFDMDLGGPLSFSDHDSGPEDEEEPRPTLLRRTTIGRGLPDSVHDWTKEPDIGLSNQ  234

Query  633   --TSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKAL  806
               T+ V     W++   QNGLRIF+E  +     +      A+ AVGV++ T EAIF  +
Sbjct  235   NDTNQVNSRKNWRLLTCQNGLRIFEELVEVEYLARSCS--RAMRAVGVVEATCEAIFGLI  292

Query  807   MSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDG  986
             MS+  +R EWD  F  GS+VE +DGHT I++ +L  +W    +  RDL   RYWRR DDG
Sbjct  293   MSMDVTRYEWDCSFQYGSLVEEVDGHTAILYHRLQLNWCSMLVWPRDLCYVRYWRRNDDG  352

Query  987   TYVILYHSVIHSKCPPQEGYVRATVKSGGHVITP---VNQGKSSTVKHMLSVDWK----S  1145
             +YV+L+ S  H  C PQ G+ RA+++SGG  I+P   VN    + V+H++ +D K    +
Sbjct  353   SYVVLFRSTEHQNCGPQPGFARASIESGGFKISPLKSVNGRPRTQVQHLMQIDLKGWGVN  412

Query  1146  YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVV  1325
             Y+      SL + ML  +A LRE F +++      P +  +T     P  + ++ + E  
Sbjct  413   YVTSFQYHSL-LQMLNCVAGLREYF-SQTDDIQTVPRIPVMTTMANAPSVKTDKKRQE--  468

Query  1326  ATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRP  1505
             A  + ++  + +  +  S +++ +   D+   VPE S +E  D+    S T         
Sbjct  469   ADSKTKQGDSAQADTENSDMIDEESEEDDDCQVPETSLEE--DNAKFDSDT---------  517

Query  1506  KLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFL  1685
             K S          DL+                 C+   + +D +      WA  D+  F 
Sbjct  518   KCSDPI-------DLS-----------------CFSGIIRQDTNEKSRNCWAVPDSKIFK  553

Query  1686  IRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVV  1865
             +R + + +D SK+++   L ++V  DW +   R D++A R G   Q   A ++  F FVV
Sbjct  554   VRSKNFSRDKSKVSAGKYLMELVAVDWFKDNTRMDHVANRKGCAAQ--VAAEKGMFSFVV  611

Query  1866  NIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSV  2045
             NIQ+PG++ YSL LY++ ++ L +  LL+RF +GDD FRNS+ KLIP + KGSWIV+QSV
Sbjct  612   NIQIPGSSHYSLVLYFVTRS-LKKGSLLQRFADGDDDFRNSRLKLIPSVPKGSWIVRQSV  670

Query  2046  GKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADT  2225
             G   CL+G++++ +Y +G  Y+E+DVD+GSS VA GV+ LV G + +LV++MAFL+QA+T
Sbjct  671   GSTPCLLGKAVDCSYIRGPEYMEVDVDIGSSAVANGVLGLVFGVVTSLVVDMAFLIQANT  730

Query  2226  EEELPEHLLGTCRLNHLDASKAVHTNSIS*EDESPSGH  2339
              +ELPE LLG  R +H++ S AV       ++ SP+GH
Sbjct  731   YDELPEQLLGAARFSHIEPSAAVVPKL---DNISPAGH  765



>ref|XP_010441699.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Camelina sativa]
Length=723

 Score =   347 bits (891),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 242/755 (32%), Positives = 374/755 (50%), Gaps = 100/755 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDNQLPIKTMVIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARW---IRCLRDAAINPEKNLRAPAIR  554
             +  H  + +  ++ N      ++   A + +EA  W   I C+    I+  +    P+ +
Sbjct  66    KTHHGHMVYVLSIYNKKEKHHRITMAAFNIQEALMWKEKIECV----IDQHQESLVPSGQ  121

Query  555   KWQPFRLSVSSRMARTDASS---TPVDAMTSD-----------VIGPCP-----------  659
             ++  F         RT +SS   +P  A+  +            IG  P           
Sbjct  122   QYVSFEYKPGMDAGRTASSSDHESPFSALEDEDDSRRDLLRRTTIGNGPPEAILDWTKEF  181

Query  660   ------------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTS  785
                               W++   QNGLRIF+E  + +   +      A+ AVGV++ T 
Sbjct  182   DAELSNQSSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATC  239

Query  786   EAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrry  965
             E IF+ +MS+  +R EWD  F  G +VE +DGHT I++ +L   W P  +  RDL   RY
Sbjct  240   EEIFELVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRY  299

Query  966   wrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD  1136
             WRR DDG+YV+L+ S  H  C PQ G+VRA ++SGG  I P+   N    + V+H++ +D
Sbjct  300   WRRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQID  359

Query  1137  ---WKSYLRKTTSKSLTIDMLGGIAALREMFKAKS--GSYFPDPAM-NELTIDIQLPVSE  1298
                W +       +   + ML  ++ LRE F      G     P M N  +  + L    
Sbjct  360   LKGWGAGYLPAFQQHCLLQMLNSVSGLREWFSQTDDRGQPIRIPVMVNMASSSLALRKGG  419

Query  1299  KEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTT  1478
             K + K+ +        D T    S  S +++ +   D+ F +P++               
Sbjct  420   KPQHKSSLSI------DQTNG-ASRNSVLMDEESDDDDEFQIPDSE--------------  458

Query  1479  PEYHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSW  1658
                   P P+ S      ++ Q+   +K  +E     +    C+   L  D + N    W
Sbjct  459   ------PEPETS------KQEQETDAKKTEEE--PALDIDLSCFSGNLRHDDNENARNCW  504

Query  1659  AAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQ  1838
               +D ++F +RG+ + +D  KI +   L  +V  DW +   R D++  R G   Q   A 
Sbjct  505   RISDGNNFKVRGKSFCEDKRKIPAGKHLMDLVAVDWFKDTKRMDHVVRRKGCAAQ--VAA  562

Query  1839  DRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISK  2018
             ++  F  VVN+QVPG+T YS+  Y++ K  L    L +RFV+GDD FRNS+ KLIP + K
Sbjct  563   EKGLFSMVVNVQVPGSTHYSMVFYFVTKE-LVPGSLFQRFVDGDDEFRNSRLKLIPLVPK  621

Query  2019  GSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIE  2198
             GSWIV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+E
Sbjct  622   GSWIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVE  681

Query  2199  MAFLVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             MAFLVQA+T EELPE L+G  R++H++ S A+  N
Sbjct  682   MAFLVQANTPEELPERLIGAVRVSHIELSSAIVPN  716



>ref|XP_010494667.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010494668.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Camelina sativa]
Length=723

 Score =   347 bits (891),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 244/755 (32%), Positives = 373/755 (49%), Gaps = 100/755 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDNQLPIKTMVIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARW---IRCLRDAAINPEKNLRAPAIR  554
             +  H  + +  ++ N      ++   A + +EA  W   I C+    I+  +    P+ +
Sbjct  66    KTHHGHMVYVLSVYNKKEKHHRITMAAFNIQEALMWKEKIECV----IDQHQESLVPSGQ  121

Query  555   KWQPFRLSVSSRMARTDASS---TPVDAMTSD-----------VIGPCP-----------  659
             ++  F         RT +SS   +P  A+  +            IG  P           
Sbjct  122   QYVSFEYKPGMDAGRTASSSDHESPFSALEDEDDSRRDLLRRTTIGNGPPEAILDWTKEF  181

Query  660   ------------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTS  785
                               W++   QNGLRIF+E  + +   +      A+ AVGV++ T 
Sbjct  182   DAELSNQSSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSR--AMKAVGVVEATC  239

Query  786   EAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrry  965
             E IF+ +MS+  +R EWD  F  G +VE +DGHT I++ +L   W P  +  RDL   RY
Sbjct  240   EEIFELVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRY  299

Query  966   wrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD  1136
             WRR DDG+YV+L+ S  H  C PQ G+VRA ++SGG  I P+   N    + V+H++ +D
Sbjct  300   WRRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQID  359

Query  1137  ---WKSYLRKTTSKSLTIDMLGGIAALREMFKAKS--GSYFPDPAM-NELTIDIQLPVSE  1298
                W S       +   + ML  +  LRE F      G     P M N  +  + L    
Sbjct  360   LKGWGSGYLPAFQQHCLLQMLNSVCGLREWFSQTDDRGQPIRIPVMVNMASSSLALSKGG  419

Query  1299  KEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTT  1478
             K + K+ +        D T    S  S +++ D   D+ F +P++               
Sbjct  420   KPQHKSSLSI------DQTNG-ASRNSVLMDEDSDDDDEFQIPDSE--------------  458

Query  1479  PEYHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSW  1658
                   P P+ S      ++ Q+   +K  +E     +    C+   L  D + N    W
Sbjct  459   ------PEPEAS------KQEQETDAKKTEEE--PALDIDLSCFSGNLRHDDNENARNCW  504

Query  1659  AAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQ  1838
               +D ++F +RG+ + +D  KI +   L  +V  DW +   R D++  R G   Q   A 
Sbjct  505   RISDGNNFKVRGKSFCEDKRKIPAGKHLMDLVAVDWFKDTKRIDHVVRRKGCAAQ--VAA  562

Query  1839  DRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISK  2018
             ++  F  VVN+QVPG+T YS+  Y++ K  L    L +RFV+GDD FRNS+ KLIP + K
Sbjct  563   EKGLFSMVVNVQVPGSTHYSMVFYFVTKE-LVPGSLFQRFVDGDDEFRNSRLKLIPLVPK  621

Query  2019  GSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIE  2198
             GSWIV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+E
Sbjct  622   GSWIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVE  681

Query  2199  MAFLVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             MAFLVQA+T EELPE L+G  R++H++ S A+  N
Sbjct  682   MAFLVQANTPEELPERLIGAVRVSHIELSSAIVPN  716



>ref|XP_011074904.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X2 [Sesamum 
indicum]
Length=727

 Score =   347 bits (891),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 239/746 (32%), Positives = 366/746 (49%), Gaps = 86/746 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  YK  P      P+++ +ID    V+D G 
Sbjct  9     EGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKKKP-QDNVVPIKTLLIDGNCRVEDRGL  67

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + +  I+  +  +A    K+ 
Sbjct  68    KTHHGHMVYVLSVYNKKEKYHRMTMAAFNIQEALIWKEKI-ELVIDQHQGSQAIDGNKYC  126

Query  564   PFRLSV--------------SSRMARTDASSTPVDAMTSDVIGPCP--------------  659
              F                  S   A  D  ++    +    IG  P              
Sbjct  127   SFEYKSGMGNGKNASSSDHESQFSAAEDEGNSHRSLVRRTTIGNGPPESVYDWTKELDTD  186

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   K      A+ AVGV++ T E I
Sbjct  187   FGNQNSDNQAFSRKYWRLLQCQNGLRIFEELLEVDFLPKSCS--RAMKAVGVVEATCEEI  244

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ +MS+  +R EWD  F  GS+VE +DGHT I++ +L   W P  +  RDL   RYWRR
Sbjct  245   FELVMSMDGTRCEWDCSFQYGSLVEEVDGHTAILYHKLQLDWFPMLVWPRDLCYIRYWRR  304

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKS  1145
              DDG+YV+L+ S  H+ C PQ G+VRA ++SGG  I+P+   N    + V+H++ +D K 
Sbjct  305   NDDGSYVVLFRSRDHANCSPQPGFVRAHIESGGFNISPLKPRNGRPRTQVQHLMQIDLKG  364

Query  1146  Y---LRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKN  1316
             +      +  +   + ML  +A LRE F A++      P +  +     +  S K   K 
Sbjct  365   WGVGYISSFQQHCLLKMLNCVAGLREYF-AQTDERTAAPRIPVMVNMTSISTSSKRSQKI  423

Query  1317  EVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHET  1496
             +  +       + ++  +A  + V LD          E SD+E    G  +  +P  +E 
Sbjct  424   QSTSAHH-RTPSLDQIHAANRNAVLLD----------EYSDEEEDFQGADQEVSPSANEA  472

Query  1497  PRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTS  1676
                K++S      ++       N +   G  + A+ C                W  +D +
Sbjct  473   EDKKIASEEEPQDEIDVSIFSGNLRR--GDHDNARNC----------------WILSDGN  514

Query  1677  SFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFF  1856
             +F +R + +  D SK+     L  +V  DW +   R D++A R G   Q   A DR  F 
Sbjct  515   NFRVRSKNFCFDKSKVXXXXXLMNLVAVDWFKDTKRMDHVARRSGCAAQ--VASDRGYFS  572

Query  1857  FVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVK  2036
              V N+QVPG+T YS+  Y++ K  L    LL+RFV+GDD FRNS+ KLIP + KGSWIV+
Sbjct  573   IVFNLQVPGSTHYSMVFYFVAKR-LVPGSLLQRFVDGDDEFRNSRLKLIPSVPKGSWIVR  631

Query  2037  QSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQ  2216
             QSVG   CL+G++++ NY +G NYLE+DVD+GSSTVA GV+ LV+G +  LV+EMAFLVQ
Sbjct  632   QSVGSTPCLLGKAVDCNYIRGLNYLEIDVDIGSSTVANGVLGLVIGVITTLVVEMAFLVQ  691

Query  2217  ADTEEELPEHLLGTCRLNHLDASKAV  2294
             A   EELPE L+G  R++H++ S A+
Sbjct  692   ATATEELPERLIGAVRISHIELSSAI  717



>ref|XP_009114402.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Brassica 
rapa]
Length=718

 Score =   347 bits (891),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 234/745 (31%), Positives = 370/745 (50%), Gaps = 90/745 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDNQLPIKTMVIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + +  I+  ++   P+ +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKI-EYVIDQHQDSLVPSGQQYV  124

Query  564   PFRLSVSSRMARTDASS---TPVDAMTSD-----------VIGPCP--------------  659
              F       + RT +SS   +P  A+  +            IG  P              
Sbjct  125   SFEYKPGMDVERTASSSDHESPFSALEDEDDSRPDLLRRTTIGNGPPESIFDWTKELGSE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E I
Sbjct  185   LSNHNSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEEI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             FK +MS+  +R EWD  F  G +VE +DGHT I++ +L   W P  +  RDL   RYWRR
Sbjct  243   FKLVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---  1136
              DDG+YV+L+ S  H+ C PQ G+VRA ++SGG  I P+   N    + V+H++ +D   
Sbjct  303   NDDGSYVVLFRSREHANCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQIDLKG  362

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKN  1316
             W +       +   + ML  ++ LRE F        P      + I + + ++      +
Sbjct  363   WGAGYLPAFQQHCLLQMLNSVSGLREWFLQTDERSHP------IRIPVMVNMAPSSLALS  416

Query  1317  EVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHET  1496
             +    +     + ++   A  + V +D+ +D+  +   A  ++  D   P +   +  E 
Sbjct  417   KGGKPQHKSSHSIDQTNGAGRNSVLMDEDSDDDDEFQIAESEQEPDTSKPETVAKKTEEE  476

Query  1497  PRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTS  1676
             P   +           DL+                 C+   L  D + N    W  +D +
Sbjct  477   PALDI-----------DLS-----------------CFSGNLRHDDNENGRNCWRISDGN  508

Query  1677  SFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFF  1856
             +F IRG+ + +D  K  +   L  +V  DW +   R D++A R G   Q   A ++  F 
Sbjct  509   NFKIRGQSFCEDKRKTPAGKHLMDLVAVDWFKDTTRIDHVARRKGCAAQ--VAAEKGLFS  566

Query  1857  FVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVK  2036
              VVN+QVPG+T YS+  Y++ K  L    L +RFV+GDD FRNS+ KLIP + KGSWIV+
Sbjct  567   LVVNVQVPGSTHYSMVFYFVTKE-LVPGSLFQRFVDGDDEFRNSRLKLIPLVPKGSWIVR  625

Query  2037  QSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQ  2216
             QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+EMAFLVQ
Sbjct  626   QSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVEMAFLVQ  685

Query  2217  ADTEEELPEHLLGTCRLNHLDASKA  2291
             A+T EELPE L+G  R++H++ S A
Sbjct  686   ANTPEELPERLIGAVRVSHIELSSA  710



>emb|CDY13045.1| BnaA09g17720D [Brassica napus]
Length=718

 Score =   347 bits (890),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 234/745 (31%), Positives = 370/745 (50%), Gaps = 90/745 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDNQLPIKTMVIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + +  I+  ++   P+ +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKI-EYVIDQHQDSLVPSGQQYV  124

Query  564   PFRLSVSSRMARTDASS---TPVDAMTSD-----------VIGPCP--------------  659
              F       + RT +SS   +P  A+  +            IG  P              
Sbjct  125   SFEYKPGMDVERTASSSDHESPFSALEDEDDSRPDLLRRTTIGNGPPESIFDWTKELGSE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E I
Sbjct  185   LSNHNSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEEI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             FK +MS+  +R EWD  F  G +VE +DGHT I++ +L   W P  +  RDL   RYWRR
Sbjct  243   FKLVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---  1136
              DDG+YV+L+ S  H+ C PQ G+VRA ++SGG  I P+   N    + V+H++ +D   
Sbjct  303   NDDGSYVVLFRSREHANCGPQPGFVRAHLESGGFNIAPLKPQNGRPRTQVQHLIQIDLKG  362

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKN  1316
             W +       +   + ML  ++ LRE F        P      + I + + ++      +
Sbjct  363   WGAGYLPAFQQHCLLQMLNSVSGLREWFLQTDERSHP------IRIPVMVNMAPSSLALS  416

Query  1317  EVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHET  1496
             +    +     + ++   A  + V +D+ +D+  +   A  ++  D   P +   +  E 
Sbjct  417   KGGKPQHKSSHSIDQTNGAGRNSVLMDEDSDDDDEFQIAESEQEPDTSKPETVAKKTEEE  476

Query  1497  PRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTS  1676
             P   +           DL+                 C+   L  D + N    W  +D +
Sbjct  477   PALDI-----------DLS-----------------CFSGNLRHDDNENGRNCWRISDGN  508

Query  1677  SFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFF  1856
             +F IRG+ + +D  K  +   L  +V  DW +   R D++A R G   Q   A ++  F 
Sbjct  509   NFKIRGQSFCEDKRKTPAGKHLMDLVAVDWFKDTTRIDHVARRKGCAAQ--VAAEKGLFS  566

Query  1857  FVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVK  2036
              VVN+QVPG+T YS+  Y++ K  L    L +RFV+GDD FRNS+ KLIP + KGSWIV+
Sbjct  567   LVVNVQVPGSTHYSMVFYFVTKE-LVPGSLFQRFVDGDDEFRNSRLKLIPLVPKGSWIVR  625

Query  2037  QSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQ  2216
             QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+EMAFLVQ
Sbjct  626   QSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVEMAFLVQ  685

Query  2217  ADTEEELPEHLLGTCRLNHLDASKA  2291
             A+T EELPE L+G  R++H++ S A
Sbjct  686   ANTPEELPERLIGAVRVSHIELSSA  710



>ref|NP_001170545.1| uncharacterized protein LOC100384563 [Zea mays]
 gb|ACR34007.1| unknown [Zea mays]
 gb|AFW75306.1| hypothetical protein ZEAMMB73_575407 [Zea mays]
Length=748

 Score =   348 bits (892),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 244/745 (33%), Positives = 378/745 (51%), Gaps = 99/745 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+L++  L  YK  P      PL+S IID    V+D G 
Sbjct  49    EGWMVRHGRRKIGRSFFHTRYFVLDNGVLAYYKKKP-RDHMIPLKSIIIDGNCRVEDRGL  107

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCL-----RDAAINPEKNLRAPA  548
             +  H ++ +   + N    ++Q+  G    E+A  W R +     +       KN +A A
Sbjct  108   KTHHGQMIYLLCIYNKKEKENQITMGGYDIEDALAWKRKIELLIDQQQDTTTAKNHKAFA  167

Query  549   -----IRKWQPFRLS------------VSSRMARTDASSTPVDAM---------------  632
                  I    PF  S              + + RT   + P D++               
Sbjct  168   SLDFDIDLGGPFSFSDHDSGPEDEEEPRPTLLRRTTIGNGPPDSVLDWTKEADSGLSNQN  227

Query  633   -TSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALM  809
              TS       W++   QNGLRIF+E  +     + +    A+ AVGV++ + EAIF  +M
Sbjct  228   ATSQAYSRKNWRLLRCQNGLRIFEELVEVEYLARSYSR--AMRAVGVVEASCEAIFGLVM  285

Query  810   SLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGT  989
             S+  SR EWD  F  GS+VE +DGHT I++ +L  +W    +  RDL   RYWRR DDG+
Sbjct  286   SMDASRYEWDCSFQYGSLVEEVDGHTAILYHRLQLNWFSMLVWPRDLCYVRYWRRNDDGS  345

Query  990   YVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWK----SY  1148
             YV+L+ S  +  C PQ G+VRA+++SGG  I+P+   N    + V+H++ +D +    +Y
Sbjct  346   YVVLFRSTENQNCGPQPGFVRASIESGGFKISPLKSLNGRPRTQVQHLMQIDVRGWGVNY  405

Query  1149  LRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVA  1328
             L      SL + ML  +A LRE F             +E+    ++PV         +  
Sbjct  406   LPSFQYYSL-LQMLNCVAGLREYFSQ----------TDEIHTVPRIPVMHTMVNAASMKK  454

Query  1329  TERIEE--DTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPR  1502
              + ++E    T++  +    +V+ +   D+ + VP+A  +E      P  +  +   +  
Sbjct  455   DQNLQEPDSKTKQADNKHLDMVDEESEDDDDYQVPDADVEEE-----PTKSDSDAKNSDP  509

Query  1503  PKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSF  1682
               LS  +  +R  QD              E ++ C                WA  D+  F
Sbjct  510   IDLSWFSGIIR--QDT------------NEKSRNC----------------WAVPDSKIF  539

Query  1683  LIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFV  1862
              +R + +  D SK+ +   L ++V  DW +   R D++A R GS VQ   A ++  F F+
Sbjct  540   KVRSKNFPHDKSKVPAGKYLMELVAVDWFKDAKRMDHVARRKGSAVQ--VAAEKGMFTFL  597

Query  1863  VNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQS  2042
             VNIQ+PG + YSL LY+ +   L +  LL+RF +GDD FRNS+ KLIP + KGSWIV+QS
Sbjct  598   VNIQIPGPSHYSLVLYF-VSNSLKKGSLLQRFADGDDDFRNSRLKLIPSVPKGSWIVRQS  656

Query  2043  VGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQAD  2222
             VG   CL+G++++ +Y +G +YLE+DVD+GSS VA GV+ LV G +  LV++MAFL+QA+
Sbjct  657   VGSTPCLLGKAVDCSYLRGPDYLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAFLIQAN  716

Query  2223  TEEELPEHLLGTCRLNHLDASKAVH  2297
             T +ELPE LLG  RL+H++ S AV+
Sbjct  717   TYDELPEQLLGAARLSHIEPSAAVY  741



>gb|KHG05863.1| StAR-related lipid transfer 5 [Gossypium arboreum]
Length=724

 Score =   347 bits (890),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 246/758 (32%), Positives = 374/758 (49%), Gaps = 110/758 (15%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE+  L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSFIHMRYFVLENRLLAYYKRKP-QDTQVPIKTMLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +  +     K+ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALMWKEKI-ESVIDKHQESQVANGNKYV  124

Query  564   PFRLSVSSRMARTDASS--------------TPVDAMTSDVIGPCP--------------  659
              F         RT +SS               P D +    IG  P              
Sbjct  125   SFEYKSGMDNGRTASSSDHESQFSAQEDEDDAPPDLLRRTTIGNGPPDSIFDWTQDFDSE  184

Query  660   ---------------WKIFGIQNGLRIFKE--AKDRNPNGKHWDGHPAIMAVGVIDGTSE  788
                            W++   QNGLRIF+E    D  P         A+ AVGV++ T E
Sbjct  185   LSNQNANNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRS----CSRAMKAVGVVEATCE  240

Query  789   AIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrryw  968
              IF  +MS+  +R EWD  F  GS+VE +DGHT I++ +L   W P  +  RDL   RYW
Sbjct  241   EIFGLVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPVFVWPRDLCYVRYW  300

Query  969   rrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVN--QGKSST-VKHMLSVDW  1139
             RR DDG+YV+L+ S  H  C PQ G+VRA V+SGG  I+P+    GK  T V+H++ +D 
Sbjct  301   RRNDDGSYVVLFRSREHENCGPQPGHVRAHVESGGFNISPMKSRNGKPRTQVQHLMQIDL  360

Query  1140  KSY---LRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEI  1310
             K +      +  +   + ML  +A LRE F A++      P +  +       VS K+  
Sbjct  361   KGWGVGYISSFQQHCLLQMLNSVAGLREWF-AQTDERIATPRIPVMVNMASSSVSSKK--  417

Query  1311  KNEVVATERIEEDTTEKYPS------ACSSIVELDDVADEFFD-VPEASDDEH---SDHG  1460
                   T+R+ E +    PS      A  + V +D+ +DE  + +PEA  + +   SD+ 
Sbjct  418   ------TQRMFELSVPSAPSLDQTNAANRNSVLMDEYSDEDEEQMPEAEQEAYPTKSDND  471

Query  1461  WPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASY  1640
             + R+      E P  K+           DL+                 C+   L +D   
Sbjct  472   FKRTA---LEEEPIEKI-----------DLS-----------------CFSGNLRRDDRD  500

Query  1641  NMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIV  1820
             N    W  +D ++F +R + +  + +KI +   L  +V  DW +   R D++  R G   
Sbjct  501   NSRNCWTISDGNNFRVRSQHFCYNKTKIPAGKHLMDLVAVDWFKDTKRMDHVVRRQGCAA  560

Query  1821  QKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKL  2000
             Q   A     F  V N+QVPG+T YS+  Y++ K  L    LL RFV+GDD FRNS+ KL
Sbjct  561   Q--IASQMGLFSLVFNVQVPGSTHYSMVFYFVTKE-LVPGSLLHRFVDGDDEFRNSRLKL  617

Query  2001  IPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYL  2180
             IP + KGSWIV+QSVG   CL+G++++ NY +G  YLE+D+D+GSSTVA GV+ LV+G +
Sbjct  618   IPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDIDIGSSTVANGVLGLVIGVI  677

Query  2181  NNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
               LV++MAFLVQA+T +ELPE L+G  R++H++ S A+
Sbjct  678   TTLVVDMAFLVQANTTDELPERLIGAVRVSHIELSSAI  715



>ref|XP_010481558.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Camelina sativa]
Length=723

 Score =   347 bits (889),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 241/755 (32%), Positives = 376/755 (50%), Gaps = 100/755 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDNQLPIKTMVIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARW---IRCLRDAAINPEKNLRAPAIR  554
             +  H  + +  ++ N      ++   A + +EA  W   I C+    I+  +    P+ +
Sbjct  66    KTHHGHMVYVLSVYNKKEKHHRITMAAFNIQEALMWKEKIECV----IDQHQESLVPSGQ  121

Query  555   KWQPFRLSVSSRMARTDASS---TPVDAMTSD-----------VIGPCP-----------  659
             ++  F         RT +SS   +P  A+  +            IG  P           
Sbjct  122   QYVSFEYKPGMDAGRTASSSDHESPFSALEDEDDSRRDLLRRTTIGNGPPEAILDWTKEF  181

Query  660   ------------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTS  785
                               W++   QNGLRIF+E  + +   +      A+ AVGV++ T 
Sbjct  182   DAELSNQSSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSR--AMKAVGVVEATC  239

Query  786   EAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrry  965
             E IF+ +MS+  +R EWD  F  G +VE +DGHT I++ +L   W P  +  RDL   RY
Sbjct  240   EEIFELVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRY  299

Query  966   wrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD  1136
             WRR DDG+YV+L+ S  H  C PQ G+VRA ++SGG  I P+   N    + V+H++ +D
Sbjct  300   WRRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQID  359

Query  1137  ---WKSYLRKTTSKSLTIDMLGGIAALREMFKAKS--GSYFPDPAM-NELTIDIQLPVSE  1298
                W +       +   + ML  ++ LRE F      G     P M N  +  + L    
Sbjct  360   LKGWGAGYLPAFQQHCLLQMLNSVSGLREWFSQTDDRGQPIRIPVMVNMASSSLALSKGG  419

Query  1299  KEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTT  1478
             K + K+ +     I++  +    S  S +++ +   D+ F +P++               
Sbjct  420   KPQHKSSL----SIDQTNS---ASRNSVLMDEESDDDDEFQIPDSE--------------  458

Query  1479  PEYHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSW  1658
                   P P+ S      ++ Q+   +K  +E     +    C+   L  D + N    W
Sbjct  459   ------PEPETS------KQEQETDAKKTEEE--PALDIDLSCFSGNLRHDDNENSRNCW  504

Query  1659  AAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQ  1838
               +D ++F +RG+ + +D  KI +   L  +V  DW +   R D++  R G   Q   A 
Sbjct  505   RISDGNNFKVRGKSFCEDKRKIPAGKHLMDLVAVDWFKDTKRIDHVVRRKGCAAQ--VAA  562

Query  1839  DRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISK  2018
             ++  F  VVN+QVPG+T YS+  Y++ K  L    L +RFV+GDD FRNS+ KLIP + K
Sbjct  563   EKGLFSMVVNVQVPGSTHYSMVFYFVTKE-LVPGSLFQRFVDGDDEFRNSRLKLIPLVPK  621

Query  2019  GSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIE  2198
             GSWIV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+E
Sbjct  622   GSWIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVE  681

Query  2199  MAFLVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             MAFLVQA+T EELPE L+G  R++H++ S A+  N
Sbjct  682   MAFLVQANTPEELPERLIGAVRVSHIELSSAIVPN  716



>ref|XP_009630335.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Nicotiana tomentosiformis]
Length=710

 Score =   346 bits (888),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 237/743 (32%), Positives = 374/743 (50%), Gaps = 96/743 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  YK  P  G   P+++  ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGKSFLHMRYFVLETRLLAYYKTKP-QGNAAPIKTLQIDGNFRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H ++ +  ++ N     DQ+   A + +++  W   + ++ I+  +  +     K+ 
Sbjct  66    KTHHGQMVYVLSVYNMKEKYDQITMAAFNIQDSLSWKEKI-ESVIDQHQEAQGGNRSKYN  124

Query  564   PFRLSVSSR------------------------MARTDASSTPVDAMT-------SDVIG  650
              F+    S                         M  T   + P +++        SD+  
Sbjct  125   EFKSGTDSTGRTASDHESPFSAADDEEDSQPNLMRGTTMGNGPPESVVDWTKESESDLAN  184

Query  651   PCPWKIFGIQNGLRIFKEA--KDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPS  824
             P   ++   QNGLRIF+E    D  P G       A+ AVGV++ T E IF+ +MS+  +
Sbjct  185   PKYRRLLYCQNGLRIFEELLNVDLLPKG----CSRAMKAVGVVEATCEEIFELVMSMDAT  240

Query  825   RSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILY  1004
             R EWD  F  GS+VE +DGHT I++ +L   W P  +  RDL   RYWRR DDG+YV+L+
Sbjct  241   RFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPRFIWPRDLCYVRYWRRNDDGSYVVLF  300

Query  1005  HSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKSY---LRKTTS  1166
              S  H  C P  GYVRA ++SGG  I+P+   N    + V+H++ +D K +      +  
Sbjct  301   RSREHKNCGPLPGYVRAHIESGGFNISPLKPRNGRPRTQVQHLMQIDLKGWGVGFIASFQ  360

Query  1167  KSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEE  1346
             +     ML  +A LRE F             +E     ++PV     + +  +++++ ++
Sbjct  361   QHCLFQMLNSVAGLREYFSQ----------TDERAAAPRIPV--MVNMTSPSISSKKSQK  408

Query  1347  DTTEKYPS------ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTP-EYHETPRP  1505
              +  + PS      A  +   +D+ +DE  D  + +D E S  G  + T      E P  
Sbjct  409   QSHHRTPSLDQIRAANRNASMMDEYSDEDEDF-QGTDQEVSSPGLDQDTIKTALEEEPLD  467

Query  1506  KLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFL  1685
             ++           DL+                  +   L +D + N    W  +D  +F 
Sbjct  468   QI-----------DLST-----------------FSGNLRRDENDNGRDCWTISDGKNFR  499

Query  1686  IRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVV  1865
             +RG+ +  D +K+ +   L  +V  DW +   R D++A R G   Q   A ++  F  V+
Sbjct  500   LRGKNFCSDKTKVPAGKPLMDLVAVDWFKDTKRMDHVARRTGCAAQ--VATEKGLFSLVI  557

Query  1866  NIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSV  2045
             N+QVPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KLIP + KGSWIV+QSV
Sbjct  558   NLQVPGSTHYSMIFYFVMKK-LIPGSLLQRFVDGDDEFRNSRMKLIPSVPKGSWIVRQSV  616

Query  2046  GKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADT  2225
             G   CL+G++++ NY +G  YLE+DVDVGSSTVA GV+ LV+G +  LV++MAF+VQ +T
Sbjct  617   GSSPCLLGKAVDCNYIRGPKYLEIDVDVGSSTVANGVMGLVIGVITTLVVDMAFVVQGNT  676

Query  2226  EEELPEHLLGTCRLNHLDASKAV  2294
              +ELPE L+G  R+ H++ S AV
Sbjct  677   PDELPEPLIGAARVCHIELSSAV  699



>ref|XP_006398233.1| hypothetical protein EUTSA_v10000794mg [Eutrema salsugineum]
 gb|ESQ39686.1| hypothetical protein EUTSA_v10000794mg [Eutrema salsugineum]
Length=716

 Score =   346 bits (888),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 238/750 (32%), Positives = 369/750 (49%), Gaps = 94/750 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRHGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDNQLPIKTMVIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + +  I+  +    P+ +++ 
Sbjct  66    KTHHGHMVYVLSIYNKKEKSHRITMAAFNIQEALMWKEKI-EYVIDQHQESLVPSGQQYI  124

Query  564   PFRLSVSSRMARTDASS---TPV---------DAMTSDVIGPCP----------------  659
              F       + RT +SS   +P          D +    IG  P                
Sbjct  125   SFEYKPGMDVGRTASSSDHESPALEDEDDARRDLLRRTTIGNGPPESIFDWTKEFDAELS  184

Query  660   -------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFK  800
                          W++   QNGLRIF+E  + +   +      A+ AVGV++ T E IF+
Sbjct  185   NQNSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEEIFE  242

Query  801   ALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrED  980
              +MS+  +R EWD  F  G +VE +DGHT I++ +L   W P  +  RDL   RYWRR D
Sbjct  243   LVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYWRRND  302

Query  981   DGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---WK  1142
             DG+YV+L+ S  H  C PQ G+VRA ++SGG  I P+   N    + V+H++ +D   W 
Sbjct  303   DGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQIDLKGWG  362

Query  1143  SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFP--DPAM-NELTIDIQLPVSEKEEIK  1313
             +       +   + ML  ++ LRE F        P   P M N  +  + L    K + K
Sbjct  363   AGYLPAFQQHCLLQMLNSVSGLREWFSQTDDRGHPIRIPVMVNMASSSLALGKGGKPQHK  422

Query  1314  NEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHE  1493
             + +   +           S  S +++ D   D+ F + E+  +  +    P +   +  E
Sbjct  423   SSLSIDQ-------SNGASRNSVLMDEDSDDDDEFQIAESEQEPETSK--PENLAKKTEE  473

Query  1494  TPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADT  1673
              P   +           DL+                 C+   L  D + N    W  +D 
Sbjct  474   EPALNI-----------DLS-----------------CFSGNLRHDDNENARNCWRISDG  505

Query  1674  SSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEF  1853
             ++F +RG+ + +D  KI +   L  +V  DW +   R D++  R G   Q   A ++  F
Sbjct  506   NNFKVRGKSFCEDKRKIPAGKHLMDLVAVDWFKDTKRMDHVVRRKGCAAQ--VAAEKGLF  563

Query  1854  FFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIV  2033
               VVN+QVPG+T YS+  Y++ K  L    L +RFV+GDD FRNS+ KLIP + KGSWIV
Sbjct  564   SLVVNVQVPGSTHYSMVFYFVAKE-LVPGSLFQRFVDGDDEFRNSRLKLIPLVPKGSWIV  622

Query  2034  KQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLV  2213
             +QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+EMAFLV
Sbjct  623   RQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVEMAFLV  682

Query  2214  QADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             QA+T EELPE L+G  R++H++ S A+  N
Sbjct  683   QANTPEELPERLIGAVRVSHIELSSAIVPN  712



>ref|XP_008448607.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Cucumis melo]
Length=727

 Score =   346 bits (888),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 240/750 (32%), Positives = 377/750 (50%), Gaps = 87/750 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  8     EGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKKKP-QDNQVPIKTMLIDGNCRVEDRGL  66

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + +  I+  +  + P   K+ 
Sbjct  67    KTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALLWKEKI-ELVIDLHQGSQVPNGNKFV  125

Query  564   PFRLSVSSRMARTDASSTPVDAMTSD--------------VIGPCP--------------  659
              F         RT +SS     +++                IG  P              
Sbjct  126   SFEYKSGMDNGRTASSSDHESQISAQEDEDDAHPNLLRRTTIGNGPPESVFDWTREIGSD  185

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   + +    A+ AVGV++ T E I
Sbjct  186   FSNQNANSQAFSRKHWRLVQCQNGLRIFEELVEVDYLPRSYS--RAMKAVGVVEATCEQI  243

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ +MS+  +R EWD  F  GS+VE +DGHT I++ +L   W P  +  RDL   RYWRR
Sbjct  244   FELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYWRR  303

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVN--QGKSST-VKHMLSVDWKS  1145
              DDG YV+L+ S  H  C PQ GYVRA ++SGG  I+P+    GK  T V+H++ +D K 
Sbjct  304   NDDGNYVVLFRSREHENCGPQPGYVRAHIESGGFNISPLKPRNGKPRTQVQHLMQIDLKG  363

Query  1146  ----YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIK  1313
                 YL       L + ML  +A LRE F A++      P +  +       VS ++ +K
Sbjct  364   WGVGYLSSFQQHCL-LQMLNSVAGLREWF-AQTDERTAPPRIPVMVNMASATVSSQKSLK  421

Query  1314  NEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHE  1493
              +  +       + ++  +A  + V LD+ +DE        D+E+          PE  +
Sbjct  422   TQGSSVH--ASSSIDQMNAANRNSVMLDEYSDE--------DEEYQ--------IPECEQ  463

Query  1494  TPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADT  1673
                P           ++ +AV++   + +         +   + +D        W  +D 
Sbjct  464   EVYPNEQE-----NDIKRIAVEEESTDPID-----LSSFSGNIRRDDRDGSRDCWRISDG  513

Query  1674  SSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEF  1853
             ++F +R + +  D +KI +   L  +V  DWL+   R D++A R G   Q   A ++  F
Sbjct  514   NNFRVRSKTFCFDKTKIPAGKHLMDLVAVDWLKDTKRMDHVARRQGCAAQ--VASEKGLF  571

Query  1854  FFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIV  2033
               V+N+QVPG+T YS+  Y++ K  L    LL+RFV+GDD FRNS+ KLIP + KGSWIV
Sbjct  572   SIVMNVQVPGSTHYSMIFYFVTKE-LIPGSLLQRFVDGDDEFRNSRLKLIPSVPKGSWIV  630

Query  2034  KQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLV  2213
             +QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G +  LV++MAFL+
Sbjct  631   RQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLI  690

Query  2214  QADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             QA+T EELPE L+G  R++H+  S A+ +N
Sbjct  691   QANTTEELPERLIGAVRVSHIQLSSAIPSN  720



>ref|XP_006398234.1| hypothetical protein EUTSA_v10000794mg [Eutrema salsugineum]
 gb|ESQ39687.1| hypothetical protein EUTSA_v10000794mg [Eutrema salsugineum]
Length=718

 Score =   346 bits (887),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 238/752 (32%), Positives = 370/752 (49%), Gaps = 96/752 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRHGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDNQLPIKTMVIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + +  I+  +    P+ +++ 
Sbjct  66    KTHHGHMVYVLSIYNKKEKSHRITMAAFNIQEALMWKEKI-EYVIDQHQESLVPSGQQYI  124

Query  564   PFRLSVSSRMARTDASS---TPVDAMTSD-----------VIGPCP--------------  659
              F       + RT +SS   +P  A+  +            IG  P              
Sbjct  125   SFEYKPGMDVGRTASSSDHESPFSALEDEDDARRDLLRRTTIGNGPPESIFDWTKEFDAE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E I
Sbjct  185   LSNQNSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEEI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ +MS+  +R EWD  F  G +VE +DGHT I++ +L   W P  +  RDL   RYWRR
Sbjct  243   FELVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---  1136
              DDG+YV+L+ S  H  C PQ G+VRA ++SGG  I P+   N    + V+H++ +D   
Sbjct  303   NDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQIDLKG  362

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFP--DPAM-NELTIDIQLPVSEKEE  1307
             W +       +   + ML  ++ LRE F        P   P M N  +  + L    K +
Sbjct  363   WGAGYLPAFQQHCLLQMLNSVSGLREWFSQTDDRGHPIRIPVMVNMASSSLALGKGGKPQ  422

Query  1308  IKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEY  1487
              K+ +   +           S  S +++ D   D+ F + E+  +  +    P +   + 
Sbjct  423   HKSSLSIDQ-------SNGASRNSVLMDEDSDDDDEFQIAESEQEPETSK--PENLAKKT  473

Query  1488  HETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAA  1667
              E P   +           DL+                 C+   L  D + N    W  +
Sbjct  474   EEEPALNI-----------DLS-----------------CFSGNLRHDDNENARNCWRIS  505

Query  1668  DTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRP  1847
             D ++F +RG+ + +D  KI +   L  +V  DW +   R D++  R G   Q   A ++ 
Sbjct  506   DGNNFKVRGKSFCEDKRKIPAGKHLMDLVAVDWFKDTKRMDHVVRRKGCAAQ--VAAEKG  563

Query  1848  EFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSW  2027
              F  VVN+QVPG+T YS+  Y++ K  L    L +RFV+GDD FRNS+ KLIP + KGSW
Sbjct  564   LFSLVVNVQVPGSTHYSMVFYFVAKE-LVPGSLFQRFVDGDDEFRNSRLKLIPLVPKGSW  622

Query  2028  IVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAF  2207
             IV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+EMAF
Sbjct  623   IVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVEMAF  682

Query  2208  LVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             LVQA+T EELPE L+G  R++H++ S A+  N
Sbjct  683   LVQANTPEELPERLIGAVRVSHIELSSAIVPN  714



>ref|XP_006646762.1| PREDICTED: uncharacterized protein LOC102699927 [Oryza brachyantha]
Length=776

 Score =   347 bits (891),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 239/743 (32%), Positives = 372/743 (50%), Gaps = 92/743 (12%)
 Frame = +3

Query  207   GWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGRE  386
             GW+      ++G  +   RYF+L+   L  YK  P      PL+S +ID    V+D G +
Sbjct  50    GWMVRYGRRKIGRSFFHTRYFVLDSRLLAYYKKKP-KDNMVPLKSLLIDGNCRVEDRGLK  108

Query  387   NFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQP  566
               H ++ +   + N    + Q+  GA   E+A  W + + +  I+ ++N+ A   + +  
Sbjct  109   THHGQMVYVLCVYNKKEKEHQITMGAYDIEDALAWKKNI-ELIIDQQENMTAKNRKAFAS  167

Query  567   --FRLSVSSRMARTDASSTPVDA------MTSDVIGPCP---------------------  659
               F + +  +   +D  S   D       +    IG  P                     
Sbjct  168   MDFDMELGGQFLFSDHDSAAEDEEERPTLIRRTTIGNGPPESIHDWTKEHDIGLANQTDP  227

Query  660   --------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSL  815
                     W++   QNGLRIF+E  + +   +      A+ AVGV+D T EAIF  +MS+
Sbjct  228   IQLSSKKNWRLLRCQNGLRIFEELLEFDYLARSCS--KAMRAVGVVDATCEAIFGLVMSM  285

Query  816   GPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYV  995
               +R EWD  F  GS+VE +DGHT +++ +L  HW P  +  RDL   RYWRR DDG+YV
Sbjct  286   DVTRYEWDCSFRYGSLVEEVDGHTAVLYHRLQLHWCPMIVWPRDLCYVRYWRRNDDGSYV  345

Query  996   ILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKSYLRKTTS  1166
             +L+ S  H  C  Q G+VRA ++SGG  I+P+   N    + V+H++ +D + ++   + 
Sbjct  346   VLFRSTEHPNCGRQRGFVRAFIESGGFKISPLKCRNGRPRTQVQHLMQIDLRGWVLNYSP  405

Query  1167  K---SLTIDMLGGIAALREMFKAKSGSY-FPDPAMNELTIDIQLPVSEKEEIKNEVVATE  1334
                    + +L  +A LRE F     ++  P   + E   D     S +++ K E V ++
Sbjct  406   SFQYHSLLQILNCVAGLREYFSQTDDTHIIPRIPVMENMFDAS---SAQKDGKTEEVDSK  462

Query  1335  RIEEDTTEKYPSACSSIVELDDVADEFFDVPEAS---DDEHSDHGWPRSTTPEYHETPRP  1505
                 D  +   S    I++ +   DE + VPEA+   D   SD+   R+  P       P
Sbjct  463   TKPADQGQA-DSKNMGIIDEETDEDEDYQVPEANIEEDPNRSDNNAKRADEP-------P  514

Query  1506  KLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFL  1685
             +    +CF                        G   C  P + S N    W   D+  F 
Sbjct  515   EKIDLSCF-----------------------SGILRCD-PDEKSRN---CWTVPDSKLFK  547

Query  1686  IRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVV  1865
             +R + +  D SKI +   L ++   DW +   R DN+  + G + Q   A ++    FV 
Sbjct  548   VRSKNFPHDKSKIPAASYLMELAAIDWFKDSKRMDNVGRQKGCVAQ--VAAEKGMHTFVA  605

Query  1866  NIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSV  2045
             NIQ+PG+T YSL +Y++ K+ L +  LL+RF +GDD FRNS+ KLIP + KGSWIV+QSV
Sbjct  606   NIQIPGSTHYSLVMYFVTKS-LKKGSLLQRFFDGDDEFRNSRLKLIPSVPKGSWIVRQSV  664

Query  2046  GKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADT  2225
             G   CL+G++++ +Y +G  YLE+DVD+GSS VA GV+ LV G +  LV++MAFL+QA+T
Sbjct  665   GSTPCLLGKAVDCSYVRGAGYLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAFLIQANT  724

Query  2226  EEELPEHLLGTCRLNHLDASKAV  2294
              EELPE ++G  RL H++ S A+
Sbjct  725   YEELPEQVIGAARLAHVEPSAAI  747



>ref|XP_009630333.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Nicotiana tomentosiformis]
Length=712

 Score =   345 bits (886),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 236/745 (32%), Positives = 370/745 (50%), Gaps = 98/745 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  YK  P  G   P+++  ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGKSFLHMRYFVLETRLLAYYKTKP-QGNAAPIKTLQIDGNFRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H ++ +  ++ N     DQ+   A + +++  W   + ++ I+  +  +     K+ 
Sbjct  66    KTHHGQMVYVLSVYNMKEKYDQITMAAFNIQDSLSWKEKI-ESVIDQHQEAQGGNRSKYN  124

Query  564   PFRLSVSSRMARTDASSTPVDAM---------------------------------TSDV  644
              F+    S         +P  A                                   SD+
Sbjct  125   EFKSGTDSTGRTASDHESPFSAADDEEDSQPNLMRGTTMGNVAGPPESVVDWTKESESDL  184

Query  645   IGPCPWKIFGIQNGLRIFKEA--KDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLG  818
               P   ++   QNGLRIF+E    D  P G       A+ AVGV++ T E IF+ +MS+ 
Sbjct  185   ANPKYRRLLYCQNGLRIFEELLNVDLLPKG----CSRAMKAVGVVEATCEEIFELVMSMD  240

Query  819   PSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVI  998
              +R EWD  F  GS+VE +DGHT I++ +L   W P  +  RDL   RYWRR DDG+YV+
Sbjct  241   ATRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPRFIWPRDLCYVRYWRRNDDGSYVV  300

Query  999   LYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKSY---LRKT  1160
             L+ S  H  C P  GYVRA ++SGG  I+P+   N    + V+H++ +D K +      +
Sbjct  301   LFRSREHKNCGPLPGYVRAHIESGGFNISPLKPRNGRPRTQVQHLMQIDLKGWGVGFIAS  360

Query  1161  TSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERI  1340
               +     ML  +A LRE F             +E     ++PV     + +  +++++ 
Sbjct  361   FQQHCLFQMLNSVAGLREYFSQ----------TDERAAAPRIPV--MVNMTSPSISSKKS  408

Query  1341  EEDTTEKYPS------ACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPE-YHETP  1499
             ++ +  + PS      A  +   +D+ +DE  D  + +D E S  G  + T      E P
Sbjct  409   QKQSHHRTPSLDQIRAANRNASMMDEYSDEDEDF-QGTDQEVSSPGLDQDTIKTALEEEP  467

Query  1500  RPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSS  1679
               ++           DL+                  +   L +D + N    W  +D  +
Sbjct  468   LDQI-----------DLST-----------------FSGNLRRDENDNGRDCWTISDGKN  499

Query  1680  FLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFF  1859
             F +RG+ +  D +K+ +   L  +V  DW +   R D++A R G   Q   A ++  F  
Sbjct  500   FRLRGKNFCSDKTKVPAGKPLMDLVAVDWFKDTKRMDHVARRTGCAAQ--VATEKGLFSL  557

Query  1860  VVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQ  2039
             V+N+QVPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KLIP + KGSWIV+Q
Sbjct  558   VINLQVPGSTHYSMIFYFVMKK-LIPGSLLQRFVDGDDEFRNSRMKLIPSVPKGSWIVRQ  616

Query  2040  SVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQA  2219
             SVG   CL+G++++ NY +G  YLE+DVDVGSSTVA GV+ LV+G +  LV++MAF+VQ 
Sbjct  617   SVGSSPCLLGKAVDCNYIRGPKYLEIDVDVGSSTVANGVMGLVIGVITTLVVDMAFVVQG  676

Query  2220  DTEEELPEHLLGTCRLNHLDASKAV  2294
             +T +ELPE L+G  R+ H++ S AV
Sbjct  677   NTPDELPEPLIGAARVCHIELSSAV  701



>ref|XP_010434468.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Camelina sativa]
Length=716

 Score =   345 bits (886),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 238/752 (32%), Positives = 366/752 (49%), Gaps = 98/752 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDYQVPIKTMLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +  + P  +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKI-ESVIDQHQESQVPNGQQYV  124

Query  564   PFRLSVSSRMARTDASS-------TPVDA-------MTSDVIGPCP--------------  659
              F         RT +SS        P D        M    IG  P              
Sbjct  125   SFEYKSGMDTGRTASSSEHESQYSAPEDEEDSRRSLMRRTTIGNGPPESVLDWTKEFDAE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E I
Sbjct  185   LANQNSNNQAFSRKHWRLLLCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEDI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ LMS+  +R EWD  F  GS+VE +DGHT +++ +L   W P  +  RDL   RYWRR
Sbjct  243   FELLMSMDGTRYEWDCSFQYGSLVEEVDGHTAVLYHKLLLDWFPMIVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---  1136
              DDG+YV+L+ S  H  C PQ G VRA ++SGG+ I+P+   N    + V+H++ +D   
Sbjct  303   NDDGSYVVLFRSREHENCGPQPGCVRAHLESGGYNISPLKPRNGRPRTQVQHLIQIDLKG  362

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPD--PAMNELTIDIQLPVSEKEEI  1310
             W +       +   + ML  +A LRE F        P   P M  +           + +
Sbjct  363   WGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGLPTRIPVMVNMASSSLSLSKSGKSL  422

Query  1311  KNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH  1490
                  + ++             S +++ D   D+ F + E+  +  +      S T    
Sbjct  423   NQSAFSLDQTNSVNRN------SVLMDEDSDDDDEFQIAESEQEPET------SKTENDF  470

Query  1491  ETPRPKLS-SAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAA  1667
             + P P      +CF   L+               E A+ C                W  +
Sbjct  471   KKPEPAHDIDLSCFSGNLKR-----------NENENARNC----------------WRTS  503

Query  1668  DTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRP  1847
             D ++F +RG+ +  D  KI +   L  +V  DW +   R D++A R G   Q   A ++ 
Sbjct  504   DGNNFKVRGKSFGGDKRKIPAGKHLMDLVAVDWFKDSKRMDHVARRKGCAAQ--VAAEKG  561

Query  1848  EFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSW  2027
              F  VVN+QVPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KLIP + KGSW
Sbjct  562   LFSMVVNVQVPGSTHYSMVFYFVMKE-LVPGSLLQRFVDGDDEFRNSRLKLIPLVPKGSW  620

Query  2028  IVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAF  2207
             IV+QSVG   CL+G++++ NY +G  YLE+D+D+GSSTVA GV+ LV+G + +LV+EMAF
Sbjct  621   IVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDIDIGSSTVANGVLGLVIGVITSLVVEMAF  680

Query  2208  LVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             LVQA+T EELPE L+G  R++H++ S A+  N
Sbjct  681   LVQANTPEELPERLIGAVRVSHIELSSAIVPN  712



>ref|XP_008680038.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Zea mays]
 gb|AFW66840.1| hypothetical protein ZEAMMB73_601591 [Zea mays]
Length=791

 Score =   347 bits (891),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 241/744 (32%), Positives = 374/744 (50%), Gaps = 100/744 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+L++  L  YK  P      PL S +ID    V+D G 
Sbjct  63    EGWMVRYGRRKIGRSFFHTRYFVLDNRLLAYYKKKP-KDNMVPLNSLLIDGNCRVEDRGL  121

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKW-  560
             +  H ++ +   + N    + Q+  GA   E+A  W + + +  I+ +++      RK  
Sbjct  122   KTLHGQMIYVLCIYNKKEKEHQITMGAYDIEDAMAWKKKI-ELIIDQQQDSMTAKNRKAF  180

Query  561   --QPFRLSVSSRMARTDASSTPVD------AMTSDVIGPCP-------------------  659
                 F + +  +   +D  ST  D            IG  P                   
Sbjct  181   ASMDFDMELGGQFLFSDHDSTAEDDEERPTLTRKTTIGNGPPDSIHDWTKEPDIGVSNQN  240

Query  660   ----------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALM  809
                       W++   QNGLRIF+E  + +   +      A+ AVGV++ T EAIF  +M
Sbjct  241   DPNQFCSKKNWRLLRCQNGLRIFEELLEVDYPAR--GCSRAMRAVGVVEATCEAIFGLIM  298

Query  810   SLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGT  989
             S+  +R EWD  F  GS+VE +DGHT I++ +L  HW P  +  RDL   RYWRR DDG+
Sbjct  299   SMDVTRYEWDCSFRNGSLVEEVDGHTAILYHRLHLHWCPMLVWPRDLCYARYWRRNDDGS  358

Query  990   YVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKSYLRKT  1160
             YV+L+ S  H KC  + G+VRA ++SGG  I+P+   N    + V+H++ +D K +    
Sbjct  359   YVVLFRSTEHLKCGRRRGFVRAFIESGGFKISPLKCRNGRPRTQVQHLMQIDLKGWFLNY  418

Query  1161  T---SKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVAT  1331
             +        + +L  +A L E F             +++ I  ++PV E     +     
Sbjct  419   SLSFQYHSLLQILNCVAGLCEYFSQ----------TDDIHITPRIPVMESMFDADSEPKN  468

Query  1332  ERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDE---HSDHGWPRSTTPEYHETPR  1502
              +++E  T+   +    +++ +   D+ + VPEA+ +E    S H   R+  P    T +
Sbjct  469   RKLQEFDTKANRNM--GMIDEESDDDDDYQVPEANIEEDVNKSHHDIKRTDEP----TEK  522

Query  1503  PKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSF  1682
               LS   CF+  L               EE ++ C                W   D+  F
Sbjct  523   IDLS---CFLSILHR-----------DPEEKSRNC----------------WTIPDSKIF  552

Query  1683  LIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFV  1862
              +R + + QD SKI +   L ++   DW +   R DN+A + G + Q   A DR    FV
Sbjct  553   KVRSKNFPQDKSKIPAASYLMELAAIDWFKDTKRMDNVARQKGCVAQ--VAADRGMHTFV  610

Query  1863  VNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQS  2042
             VNIQ+PG+T+YSL +Y++  T L +  LL+RF +GDD FRNS+ KLIP + KGSWIV+QS
Sbjct  611   VNIQIPGSTQYSLVMYFVTNT-LRKGSLLQRFFDGDDEFRNSRLKLIPSVPKGSWIVRQS  669

Query  2043  VGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQAD  2222
             VG   CL+G++++ +Y +G  YLE+DVD+GSS VA GV+ +V G +  LV++MAFL+QA+
Sbjct  670   VGSTPCLLGKAVDCSYVRGPAYLEVDVDIGSSAVANGVLGIVFGVVTTLVVDMAFLIQAN  729

Query  2223  TEEELPEHLLGTCRLNHLDASKAV  2294
             T EELPE ++G  RL H++ + AV
Sbjct  730   TYEELPEQVIGAARLAHVEPATAV  753



>gb|KGN55699.1| hypothetical protein Csa_3G006610 [Cucumis sativus]
Length=727

 Score =   346 bits (887),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 241/750 (32%), Positives = 376/750 (50%), Gaps = 87/750 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  8     EGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKKKP-QDNQVPIKTMLIDGNCRVEDRGL  66

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + +  I+  +  + P   K+ 
Sbjct  67    KTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALLWKEKI-ELVIDLHQGSQVPNGNKFV  125

Query  564   PFRLSVSSRMARTDASSTPVDAMTSD--------------VIGPCP--------------  659
              F         RT +SS     M++                IG  P              
Sbjct  126   SFEYKSGMDNGRTASSSDHESQMSAQEDEDDAHPNLLRRTTIGNGPPESVFDWTREIGSD  185

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   + +    A+ AVGV++ T E I
Sbjct  186   FSNQNANSQAFSRKHWRLVQCQNGLRIFEELVEVDYLPRSYS--RAMKAVGVVEATCEQI  243

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ +MS+  +R EWD  F  GS+VE +DGHT I++ +L   W P  +  RDL   RYWRR
Sbjct  244   FELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYWRR  303

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVN--QGKSST-VKHMLSVDWKS  1145
              DDG YV+L+ S  H  C PQ GYVRA ++SGG  I+P+    GK  T V+H++ +D K 
Sbjct  304   NDDGNYVVLFRSREHENCGPQPGYVRAHIESGGFNISPLKPRNGKPRTQVQHLMQIDLKG  363

Query  1146  ----YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIK  1313
                 YL       L + ML  +A LRE F A++      P +  +       VS ++ +K
Sbjct  364   WGVGYLSSFQQHCL-LQMLNSVAGLREWF-AQTDERTAPPRIPVMVNMASSTVSSQKSLK  421

Query  1314  NEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHE  1493
              +          + ++  +A  + V LD+ +DE        D+E+          PE  +
Sbjct  422   AQGSTVH--ASSSIDQMNAANRNSVLLDEYSDE--------DEEYQ--------IPESEQ  463

Query  1494  TPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADT  1673
                P           ++ +AV++   + +         +   + +D        W  +D 
Sbjct  464   EVYPNEQE-----NDIRRVAVEEESTDPID-----LSSFSGNIRRDDRDGSRDCWRISDG  513

Query  1674  SSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEF  1853
             ++F +R + +  D +KI +   L  +V  DWL+   R D++A R G   Q   A ++  F
Sbjct  514   NNFRVRSKTFCFDKTKIPAGKHLMDLVAVDWLKDTKRMDHVARRHGCAAQ--VASEKGLF  571

Query  1854  FFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIV  2033
               V+N+QVPG+T YS+  Y++ K  L    LL+RFV+GDD FRNS+ KLIP + KGSWIV
Sbjct  572   SIVMNVQVPGSTHYSMIFYFVTKE-LIPGSLLQRFVDGDDEFRNSRLKLIPSVPKGSWIV  630

Query  2034  KQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLV  2213
             +QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G +  LV++MAFL+
Sbjct  631   RQSVGSMPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLI  690

Query  2214  QADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             QA+T EELPE L+G  R++H+  S A+ +N
Sbjct  691   QANTTEELPERLIGAVRVSHIQLSSAIPSN  720



>emb|CDX99399.1| BnaC01g11530D [Brassica napus]
Length=718

 Score =   345 bits (886),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 235/755 (31%), Positives = 365/755 (48%), Gaps = 102/755 (14%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDYQVPIKTMLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +  + P  +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKHHRITMAAFNIQEALMWKEKI-ESVIDQHQESQVPNGQQYV  124

Query  564   PFRLSVSSRMARTDASS--------------TPVDAMTSDVIGPCP--------------  659
              F         RT +SS              +    M    IG  P              
Sbjct  125   SFEYKSGMDSGRTASSSDHESQFSAPEGEDGSRRSLMRRTTIGNGPPESVLDWTKEFDAE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E +
Sbjct  185   LANQNSDNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEEV  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ +MS+  +R EWD  F  GS+VE +DGHT +++ +L   W P  +  RDL   RYWRR
Sbjct  243   FELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAVLYHRLLLDWFPMVVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---  1136
              DDG+YV+L+ S  H  C PQ G VRA ++SGG+ I P+   N    + V+H++ +D   
Sbjct  303   NDDGSYVVLFRSREHDNCGPQPGCVRAHLESGGYNIAPLKPRNGRPRTQVQHLIQIDLKG  362

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKA--KSGSYFPDPAMNELTIDIQLPVSEKEEI  1310
             W +       +   + ML  +A LRE F    + G +   P M  +             +
Sbjct  363   WGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGVHTRIPVMVNMASSSLSLSKSGRSV  422

Query  1311  KNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH  1490
                  + ++             S +++ D   D+ F + E+  +                
Sbjct  423   HQSAFSVDQTNSANRN------SVLLDEDSDDDDEFQIAESEQE----------------  460

Query  1491  ETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKG----CYGCTLPKDASYNMPGSW  1658
                 P+ S     V+K +              EE A      C+   L ++ + N    W
Sbjct  461   ----PETSKTETDVKKTE--------------EEPAHNIDLSCFSGNLKRNENENARNCW  502

Query  1659  AAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQ  1838
               +D S+F +R + +  D  KI +   L  +V  DW +   R D++A R G   Q   A 
Sbjct  503   RTSDGSNFKVRSKSFCDDKRKIPAGKHLMDLVAVDWFKDSKRIDHVARRKGCAAQ--VAA  560

Query  1839  DRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISK  2018
             ++  F  VVN+QVPG+T YS+  Y++ K  L    LL+RFV+GDD FRNS+ KLIP + K
Sbjct  561   EKGLFSMVVNVQVPGSTHYSMVFYFVTKE-LVPGSLLQRFVDGDDEFRNSRLKLIPQVPK  619

Query  2019  GSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIE  2198
             GSWIV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+E
Sbjct  620   GSWIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVE  679

Query  2199  MAFLVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             MAFLVQA+T EELPE L+G  R++H++ S A+  N
Sbjct  680   MAFLVQANTPEELPERLIGAVRVSHIELSSAIVPN  714



>ref|XP_006361253.1| PREDICTED: uncharacterized protein LOC102580683 [Solanum tuberosum]
Length=714

 Score =   345 bits (886),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 237/740 (32%), Positives = 370/740 (50%), Gaps = 87/740 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  +K  P  G   P+++  ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGKSFLHMRYFVLETKLLAYFKTKP-QGNVSPIKTLEIDGNFRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H ++ +  ++ N     DQ+   A + +EA  W   + ++ I+  +     +  K+ 
Sbjct  66    KTHHGQMVYVLSVYNMKEKHDQITMAAFNIQEALIWKEKI-ESVIDQHQESVGGSRTKFN  124

Query  564   PFRLSVSSRMARTDASSTPVDAMT---------------------------------SDV  644
              F+    S    T    +P  A                                   SD+
Sbjct  125   DFKSGTESTGRTTSDQESPFSAAEDEDESQQNVLRGTTIANAIAPPESVVDWTKESESDL  184

Query  645   IGPCPWKIFGIQNGLRIFKEA--KDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLG  818
               P   ++   QNGLRIF+E    D  P G       A+ AVGV++ T E IF+ +MS+ 
Sbjct  185   ANPKYRRLLYCQNGLRIFEELLNVDLLPKG----CSRAMKAVGVVEATCEEIFELVMSMD  240

Query  819   PSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVI  998
              +R EWD  F  GS+VE +DGHT I++ +L   W P  +  RDL   RYWRR DDG+YV+
Sbjct  241   ATRFEWDCSFQYGSLVEEVDGHTAILYHRLRLDWFPSFIWPRDLCYVRYWRRNDDGSYVV  300

Query  999   LYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKSY---LRKT  1160
             L+ S  H  C P  GYVRA ++SGG  I+P+   N    + V+ ++ +D K +      +
Sbjct  301   LFRSREHKNCNPLPGYVRAHIESGGFNISPLKPCNGRPRTQVQQLMQIDLKGWGVGFIAS  360

Query  1161  TSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLP-VSEKEEIKNEVVATER  1337
               +     ML  +A LRE F +++      P +  + +++  P +S K+  K     T  
Sbjct  361   FQQHCLFQMLNSVAGLREYF-SQTDERAAAPRI-PVMVNMNPPSISSKKSQKQSHHRTPS  418

Query  1338  IEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPE-YHETPRPKLS  1514
             +++          +++  LD+ +DE  D  + +D E S  G    T      E P   + 
Sbjct  419   LDQIRAANR----NAVSMLDEYSDEDEDF-QCTDQEVSSPGLENDTIKTALEEEPIEHID  473

Query  1515  SAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRG  1694
              +                             +   L  D S N    W  +D ++F +RG
Sbjct  474   MST----------------------------FSGNLRHDDSDNGRDCWTISDGNNFRVRG  505

Query  1695  EKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQ  1874
             + +  D +K+++  +L  +V  DW +   R D++A  PG   Q   A ++  F  V+N+Q
Sbjct  506   KNFCSDKTKVSAGKSLMDLVAVDWFKDTKRMDHVARHPGCAAQ--VASEKGLFTLVINLQ  563

Query  1875  VPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKK  2054
             VPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KLIP + KGSWIV+QSVG  
Sbjct  564   VPGSTHYSMIFYFVMKK-LIPGSLLQRFVDGDDEFRNSRMKLIPSVPKGSWIVRQSVGSS  622

Query  2055  SCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEE  2234
              CL+G++++ NY +G  YLE+DVDVGSSTVA GV+ LV+G + +LV++MAF+VQ +T +E
Sbjct  623   PCLLGKAVDCNYIRGPKYLEIDVDVGSSTVANGVMGLVIGVITSLVVDMAFVVQGNTPDE  682

Query  2235  LPEHLLGTCRLNHLDASKAV  2294
             LPE L+G  R+ H++ S AV
Sbjct  683   LPEPLIGAARVCHIELSSAV  702



>ref|XP_006279863.1| hypothetical protein CARUB_v10028530mg [Capsella rubella]
 gb|EOA12761.1| hypothetical protein CARUB_v10028530mg [Capsella rubella]
Length=722

 Score =   345 bits (886),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 240/752 (32%), Positives = 367/752 (49%), Gaps = 92/752 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDNQLPIKTMVIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +    P+ +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKHHRITMAAFNIQEALMWKDKI-ESVIDQHQESLVPSGQQYV  124

Query  564   PFRLSVSSRMARTDASS---TPVDAM-----------TSDVIGPCP--------------  659
              F       + RT +SS   +P  A+               IG  P              
Sbjct  125   SFEYKPGMDVGRTASSSDHESPFSALEDDDDSRRDLLRRTTIGNGPPESILDWTKEFDAE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E I
Sbjct  185   LSNQSSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEEI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ +MS+  +R EWD  F  G +VE +DGHT I++ +L   W P  +  RDL   RYWRR
Sbjct  243   FELVMSMDGTRYEWDCSFQYGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---  1136
              DDG+YV+L+ S  H  C PQ G+VRA ++SGG  I P+   N    + V+H++ +D   
Sbjct  303   NDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQIDLKG  362

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKAKS--GSYFPDPAM-NELTIDIQLPVSEKEE  1307
             W +       +   + ML  ++ LRE F      G     P M N  +  + L    K +
Sbjct  363   WGAGYLPAFQQHCLLQMLNSVSGLREWFSQTDDRGQPIRIPVMVNMASSSLALGKGGKPQ  422

Query  1308  IKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEY  1487
              K+ +        D T    S  S +++ D   D+ F +P++  +  +      S   + 
Sbjct  423   HKSSLSI------DQTNG-ASRNSVLMDEDSDDDDEFQIPDSEQEAET------SKQEQE  469

Query  1488  HETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAA  1667
              ET   K          L                     C+   L  D + N    W  +
Sbjct  470   QETDAKKTEEEPALKIDL--------------------SCFSGNLRHDDNENSRNCWRIS  509

Query  1668  DTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRP  1847
             D  +F +RG+ +  D  KI +   L  +V  DW +   R D++  R G   Q   A ++ 
Sbjct  510   DGDNFKVRGKSFCDDKRKIPAGKHLMDLVAVDWFKDTKRMDHVVRRKGCAAQ--VAAEKG  567

Query  1848  EFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSW  2027
              F  VVN+QVPG+T YS+  Y++ K  L    L +RFV+GDD FRNS+ KLIP + KGSW
Sbjct  568   LFSMVVNVQVPGSTHYSMVFYFVTKE-LVPGSLFQRFVDGDDEFRNSRLKLIPLVPKGSW  626

Query  2028  IVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAF  2207
             IV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+EMAF
Sbjct  627   IVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVEMAF  686

Query  2208  LVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             LVQA+T EELPE L+G  R++H++ S A+  N
Sbjct  687   LVQANTPEELPERLIGAVRVSHIELSSAIVPN  718



>ref|XP_010439773.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X2 [Camelina 
sativa]
Length=716

 Score =   345 bits (885),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 238/754 (32%), Positives = 370/754 (49%), Gaps = 102/754 (14%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDYQVPIKTMLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +  + P  +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKI-ESVIDQHQESQVPNGQQYV  124

Query  564   PFRLSVSSRMARTDASS-------TPVDA-------MTSDVIGPCP--------------  659
              F         RT +SS        P D        M    IG  P              
Sbjct  125   SFEYKSGMDTGRTASSSEHESQYSAPEDEEDSRRSLMRRTTIGNGPPESVLDWTKEFDAE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E I
Sbjct  185   LANQNSNNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEDI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ LMS+  +R EWD  F  GS+VE +DGHT +++ +L   W P  +  RDL   RYWRR
Sbjct  243   FELLMSMDGTRYEWDCSFQYGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---  1136
              DDG+YV+L+ S  H  C PQ G VRA ++SGG+ I+P+   N    + V+H++ +D   
Sbjct  303   NDDGSYVVLFRSREHENCGPQPGCVRAHLESGGYNISPLKPRNGRPRTQVQHLIQIDLKG  362

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPD--PAMNELTIDIQLPVSEKEEI  1310
             W +       +   + ML  +A LRE F        P   P M  +           + +
Sbjct  363   WGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGLPTRIPVMVNMASSSLSLSKSGKSL  422

Query  1311  KNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH  1490
                  + ++             S +++ D   D+ F + E+  +       P ++  E +
Sbjct  423   HQSAFSLDQTNSVNRN------SVLMDEDSDDDDEFQIAESEQE-------PETSKTE-N  468

Query  1491  ETPRPKLS---SAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWA  1661
             +  RP+ +     +CF   L+               E A+ C                W 
Sbjct  469   DVKRPEPAHDIDLSCFSGNLKR-----------NENENARNC----------------WR  501

Query  1662  AADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQD  1841
              +D ++F +RG+ +  D  KI +   L  +V  DW +   R D++A R G   Q   A +
Sbjct  502   TSDGNNFKVRGKSFGGDKRKIPAGKHLMDLVAVDWFKDSKRIDHVARRKGCAAQ--VAAE  559

Query  1842  RPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKG  2021
             +  F  VVN+QVPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KLIP + KG
Sbjct  560   KGLFSMVVNVQVPGSTHYSMVFYFVMKE-LVPGSLLQRFVDGDDEFRNSRLKLIPLVPKG  618

Query  2022  SWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEM  2201
             SWIV+QSVG   CL+G++++ NY +G  YLE+D+D+GSSTVA GV+ LV+G + +LV+EM
Sbjct  619   SWIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDIDIGSSTVANGVLGLVIGVITSLVVEM  678

Query  2202  AFLVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             AFLVQA+T EELPE L+G  R++H++ S A+  N
Sbjct  679   AFLVQANTPEELPERLIGAVRVSHIELSSAIVPN  712



>ref|XP_010449418.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
Length=717

 Score =   345 bits (885),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 238/755 (32%), Positives = 370/755 (49%), Gaps = 103/755 (14%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDYQVPIKTMLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +  + P  +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKI-ESVIDQHQESQVPNGQQYV  124

Query  564   PFRLSVSSRMARTDASS-------TPVDA-------MTSDVIGPCP--------------  659
              F         RT +SS        P D        M    IG  P              
Sbjct  125   SFEYKSGMDTGRTASSSEHESQYSAPEDEEDSRRSLMRRTTIGNGPPESVLDWTKEFDAE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E I
Sbjct  185   LANQNSNNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEDI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ LMS+  +R EWD  F  GS+VE +DGHT +++ +L   W P  +  RDL   RYWRR
Sbjct  243   FELLMSMDGTRYEWDCSFQYGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---  1136
              DDG+YV+L+ S  H  C PQ G VRA ++SGG+ I+P+   N    + V+H++ +D   
Sbjct  303   NDDGSYVVLFRSREHENCGPQPGCVRAHLESGGYNISPLKPRNGRPRTQVQHLIQIDLKG  362

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPD--PAMNELTIDIQLPVSEKEEI  1310
             W +       +   + ML  +A LRE F        P   P M  +           + +
Sbjct  363   WGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGLPTRIPVMVNMASSSLSLSKSGKSL  422

Query  1311  KNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH  1490
                  + ++             S +++ D   D+ F + E+  +       P ++  E +
Sbjct  423   NQSAFSLDQTNSVNRN------SVLMDEDSDDDDEFQIAESEQE-------PETSKTE-N  468

Query  1491  ETPRPKLSS----AACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSW  1658
             +  RP+  +     +CF   L+               E A+ C                W
Sbjct  469   DVKRPEEPAHDIDLSCFSGNLKR-----------NENENARNC----------------W  501

Query  1659  AAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQ  1838
               +D ++F +RG+ +  D  KI +   L  +V  DW +   R D++A R G   Q   A 
Sbjct  502   RTSDGNNFKVRGKNFGGDKRKIPAGKHLMDLVAVDWFKDSKRIDHVARRKGCAAQ--VAA  559

Query  1839  DRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISK  2018
             ++  F  VVN+QVPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KLIP + K
Sbjct  560   EKGLFSMVVNVQVPGSTHYSMVFYFVMKE-LVPGSLLQRFVDGDDEFRNSRLKLIPLVPK  618

Query  2019  GSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIE  2198
             GSWIV+QSVG   CL+G++++ NY +G  YLE+D+D+GSSTVA GV+ LV+G + +LV+E
Sbjct  619   GSWIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDIDIGSSTVANGVLGLVIGVITSLVVE  678

Query  2199  MAFLVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             MAFLVQA+T EELPE L+G  R++H++ S A+  N
Sbjct  679   MAFLVQANTPEELPERLIGAVRVSHIELSSAIVPN  713



>ref|XP_004958589.1| PREDICTED: uncharacterized protein LOC101775477 [Setaria italica]
Length=787

 Score =   347 bits (890),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 245/742 (33%), Positives = 370/742 (50%), Gaps = 95/742 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  YK  P      PL+S +ID    V+D G 
Sbjct  65    EGWMVRYGRRKIGRSFFHTRYFVLESRLLAYYKKKP-KDNMVPLKSLLIDGNCRVEDRGL  123

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARW---IRCLRDAAINPE-KNLRAPAI  551
             +  H ++ +   + N    + Q+  GA+  E+A  W   I  L D   +P  KN +A A 
Sbjct  124   KTHHGQMIYVLCVYNQKEKEHQITMGAHDIEDALVWKKKIELLIDQKPDPAAKNHKAFAT  183

Query  552   RKWQ---PFRLSVSSRMARTDASSTPVDAMTSDVIGPCP---------------------  659
               +      + S+S R +  +             IG  P                     
Sbjct  184   MDFDMELGGQFSLSDRDSGAEEEEEQPTLTRRKTIGNGPPDSIHDWTKDADFGLSNQNDP  243

Query  660   --------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSL  815
                     W++   QNGLRIF+E  +     +      A+ AVGV++ T EAIF  +MS+
Sbjct  244   TQLYSKKNWRLLRCQNGLRIFEELLEVEYLARSCSR--AMRAVGVVEATCEAIFGLMMSM  301

Query  816   GPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYV  995
               +R EWD  F +GS+VE +DGHT +++ +L  HW P  +  RDL   RYWRR DDG+YV
Sbjct  302   DATRYEWDCSFRQGSLVEEVDGHTAVLYHRLQLHWCPRLIWPRDLCYVRYWRRNDDGSYV  361

Query  996   ILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKS-YLRKTT  1163
             +L+ S  H  C  Q GYVRA ++SGG  I P+   N    + V+H++ +D K  +L  +T
Sbjct  362   VLFRSTEHPNCSRQRGYVRAFIESGGFKICPLKSRNGRPRTQVQHLMQIDLKGWFLNYST  421

Query  1164  SKSL--TIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEK--EEIKNEV-VA  1328
             S      + +L  ++ LRE F             +++ I  ++P  E   +E  NEV   
Sbjct  422   SFQYHSLLQILNCVSGLREYFS----------QTDDIHITPRIPAMESMDDEKPNEVDPK  471

Query  1329  TERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPK  1508
             T+  ++D  E   +     ++ +   DE + VPEA  +E    G  +S     H    P+
Sbjct  472   TKPADQDHAE---NRNMGTIDEESDDDEDYQVPEADIEE----GPNKSDNEAKHTDEPPE  524

Query  1509  LSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLI  1688
                 +CF   L               +E ++ C                W   D+  F +
Sbjct  525   KIDLSCFSGILHH-----------DPDEKSRNC----------------WTVPDSKLFKV  557

Query  1689  RGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVN  1868
             R + +  D SKI +   L ++   DW +   R DN+  +   + Q   A D+    FVVN
Sbjct  558   RSKNFPHDKSKIPAASYLMELAAIDWFKDTKRMDNVGRQKNCVAQ--VAADKGMHTFVVN  615

Query  1869  IQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVG  2048
             +Q+PG+T YSL +Y++  + L +  LL+RF +GDD FRNS+ KLIP + KGSWIV+QSVG
Sbjct  616   LQIPGSTHYSLVMYFVTSS-LKKGSLLQRFFDGDDDFRNSRLKLIPSVPKGSWIVRQSVG  674

Query  2049  KKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTE  2228
                CL+G++++ +Y +G  YLE+DVD+GSS VA GV+ LV G +  LV++MAFL+QA+T 
Sbjct  675   STPCLLGKAVDCSYVRGPGYLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAFLIQANTY  734

Query  2229  EELPEHLLGTCRLNHLDASKAV  2294
             EELPE ++G  RL H++ S AV
Sbjct  735   EELPEQVIGAARLAHVEPSTAV  756



>ref|NP_001045600.1| Os02g0102800 [Oryza sativa Japonica Group]
 dbj|BAD07818.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD08201.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF07514.1| Os02g0102800 [Oryza sativa Japonica Group]
Length=804

 Score =   347 bits (890),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 235/745 (32%), Positives = 372/745 (50%), Gaps = 95/745 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+L+   L  YK  P      PL+S +ID    V+D G 
Sbjct  74    EGWMVRYGRRKIGRSFFHTRYFVLDSRLLAYYKKKP-KDNMVPLKSLLIDGNCRVEDRGL  132

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H ++ +   + N    + Q+  GA   E+A  W + + +  I+ ++N+ +   + + 
Sbjct  133   KTHHGQMVYVLCVYNKKEKEHQITMGAYDIEDALAWKKNI-ELIIDQQENMTSKNRKAFA  191

Query  564   P--FRLSVSSRMARTDASSTPVDA------MTSDVIGPCP--------------------  659
                F   +  +   +D  S   D       +    IG  P                    
Sbjct  192   SMDFDTELGGQFIFSDHDSAAEDEEERPMLIRRTTIGNGPPESIHDWTKEHDIGPPNQID  251

Query  660   ---------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMS  812
                      W++   QNGLRIF+E  + +   +      A+ AVGV++ T EAIF  +MS
Sbjct  252   PIQVSSKKNWRLLRCQNGLRIFEELLEFDYLARSCSR--AMRAVGVVEATCEAIFGLVMS  309

Query  813   LGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTY  992
             +  +R EWD  F  GS+VE +DGHT I++ +L  HW P  +  RDL   RYWRR DDG+Y
Sbjct  310   MDVTRYEWDCSFRYGSLVEEVDGHTAILYHKLQLHWCPMLVWPRDLCYVRYWRRNDDGSY  369

Query  993   VILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKSYLRKTT  1163
             V+L+ S  H  C  Q+GYVRA ++SGG  I+P+   N    + V+H++ +D + +L   +
Sbjct  370   VVLFRSTEHPNCGRQKGYVRAFIESGGFKISPLKCRNGRPRTQVQHLMQIDLRGWLLNYS  429

Query  1164  SKSLTIDML---GGIAALREMFKAKSGSYFPD--PAMNELTIDIQLPVSEK---EEIKNE  1319
                    +L     +A LRE F     ++     P M  +     +   +K   EE+ ++
Sbjct  430   PSFQYHSLLQIQNCVAGLREYFSQTDETHITPRIPVMENMVDTSAVQKDDKKSTEEVDSK  489

Query  1320  VVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETP  1499
                 +R + D      S    I++ +   DE + VPEA+ +E  +    R+  P      
Sbjct  490   TKTPDRGQAD------SKNMGIIDEETDEDEDYQVPEANIEEDPNKDAKRADEP------  537

Query  1500  RPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSS  1679
              P+    +CF   L+              +E ++ C                W   D+  
Sbjct  538   -PEKIDLSCFSGILR-----------CDADEKSRNC----------------WTVPDSKL  569

Query  1680  FLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFF  1859
             F +R + +  D SKI +   L ++   DW +   R DN+  + G + Q   A ++    F
Sbjct  570   FKVRSKNFPHDKSKIPAASYLMELAAIDWFKDSKRMDNVGRQKGCVAQ--VAAEKGMHTF  627

Query  1860  VVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQ  2039
             V NIQ+PG+T YSL +Y++ K+ L +  LL+RF +GDD FRNS+ KLIP + KGSWIV+Q
Sbjct  628   VANIQIPGSTHYSLVMYFVTKS-LKKGSLLQRFFDGDDEFRNSRLKLIPSVPKGSWIVRQ  686

Query  2040  SVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQA  2219
             SVG   CL+G++++ +Y +G  YLE+DVD+GSS VA GV+ LV G +  LV++MAFL+QA
Sbjct  687   SVGSTPCLLGKAVDCSYVRGAGYLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAFLIQA  746

Query  2220  DTEEELPEHLLGTCRLNHLDASKAV  2294
             +T EELPE ++G  RL H++ + A+
Sbjct  747   NTYEELPEQVIGAARLAHVEPAAAI  771



>ref|XP_010439772.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X1 [Camelina 
sativa]
Length=717

 Score =   344 bits (883),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 238/755 (32%), Positives = 370/755 (49%), Gaps = 103/755 (14%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDYQVPIKTMLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +  + P  +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKI-ESVIDQHQESQVPNGQQYV  124

Query  564   PFRLSVSSRMARTDASS-------TPVDA-------MTSDVIGPCP--------------  659
              F         RT +SS        P D        M    IG  P              
Sbjct  125   SFEYKSGMDTGRTASSSEHESQYSAPEDEEDSRRSLMRRTTIGNGPPESVLDWTKEFDAE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E I
Sbjct  185   LANQNSNNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEDI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ LMS+  +R EWD  F  GS+VE +DGHT +++ +L   W P  +  RDL   RYWRR
Sbjct  243   FELLMSMDGTRYEWDCSFQYGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---  1136
              DDG+YV+L+ S  H  C PQ G VRA ++SGG+ I+P+   N    + V+H++ +D   
Sbjct  303   NDDGSYVVLFRSREHENCGPQPGCVRAHLESGGYNISPLKPRNGRPRTQVQHLIQIDLKG  362

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPD--PAMNELTIDIQLPVSEKEEI  1310
             W +       +   + ML  +A LRE F        P   P M  +           + +
Sbjct  363   WGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGLPTRIPVMVNMASSSLSLSKSGKSL  422

Query  1311  KNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH  1490
                  + ++             S +++ D   D+ F + E+  +       P ++  E +
Sbjct  423   HQSAFSLDQTNSVNRN------SVLMDEDSDDDDEFQIAESEQE-------PETSKTE-N  468

Query  1491  ETPRPKLSS----AACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSW  1658
             +  RP+  +     +CF   L+               E A+ C                W
Sbjct  469   DVKRPEEPAHDIDLSCFSGNLKR-----------NENENARNC----------------W  501

Query  1659  AAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQ  1838
               +D ++F +RG+ +  D  KI +   L  +V  DW +   R D++A R G   Q   A 
Sbjct  502   RTSDGNNFKVRGKSFGGDKRKIPAGKHLMDLVAVDWFKDSKRIDHVARRKGCAAQ--VAA  559

Query  1839  DRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISK  2018
             ++  F  VVN+QVPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KLIP + K
Sbjct  560   EKGLFSMVVNVQVPGSTHYSMVFYFVMKE-LVPGSLLQRFVDGDDEFRNSRLKLIPLVPK  618

Query  2019  GSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIE  2198
             GSWIV+QSVG   CL+G++++ NY +G  YLE+D+D+GSSTVA GV+ LV+G + +LV+E
Sbjct  619   GSWIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDIDIGSSTVANGVLGLVIGVITSLVVE  678

Query  2199  MAFLVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             MAFLVQA+T EELPE L+G  R++H++ S A+  N
Sbjct  679   MAFLVQANTPEELPERLIGAVRVSHIELSSAIVPN  713



>ref|XP_006342495.1| PREDICTED: uncharacterized protein LOC102592298 [Solanum tuberosum]
Length=724

 Score =   344 bits (883),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 234/746 (31%), Positives = 371/746 (50%), Gaps = 87/746 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             +GW+      ++G  Y   RYF+LE   L  YK  P      P+++  ID    V+D G 
Sbjct  7     DGWMVRYGRRKIGRSYIHMRYFVLETRLLAYYKRKP-QDNVVPIKTLPIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N  +  +++   A + +EA  W   + ++ I+  +  +     K+ 
Sbjct  66    KTHHGHMVYVLSVYNKKDKYNRVTMAAFNIQEALIWKEKI-ESIIDQHQESQGTNGNKYN  124

Query  564   PFRLSVSSRMARTDASSTPVDAMTS--------------DVIGPCP--------------  659
              F         R  +SS     +++                IG  P              
Sbjct  125   SFEYKSDMDNGRNASSSDHESQLSAAEDEDDSHPNLLRRTTIGRGPPESVFDWTKEIDSD  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  D +   K      A+ AVGV++ + E I
Sbjct  185   LANQNGSNQVFSRKYWRLLQCQNGLRIFEELPDGDLLPKSCSR--AMKAVGVVEASCEDI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ +MS+  +R EWD  F  GS+VE +DGHT I++ +L   W P  +  RDL   RYWRR
Sbjct  243   FELVMSMDATRYEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPTLVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKS  1145
              DDG+YV+L+ S  H  C P  GYVRA ++SGG  I+P+   N    + V+H++ +D K 
Sbjct  303   NDDGSYVVLFRSREHENCGPLPGYVRAHIESGGFNISPLKPLNGRPRTQVQHLMQIDLKG  362

Query  1146  Y---LRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKN  1316
             +      +  +   + ML  +A LRE F +++      P +  +       VS K   K 
Sbjct  363   WGVGYVSSFQQHCLLQMLNSVAGLREYF-SQTDERTAAPRIPVMVNMTSASVSSKRNQKL  421

Query  1317  EVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHET  1496
             +     R       +  +  +S+++            E SD+E    G  +   P     
Sbjct  422   QETPHHRTRSLDQIRAANRNASMMD------------EYSDEEEDFQGADQEVMP-----  464

Query  1497  PRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTS  1676
             P P+        R+++  A+++   + +         +   L +D   N    W  +D +
Sbjct  465   PSPE--------REMKRTALEEEPLDQIDF-----SIFSGNLRRDDRDNSRNCWRISDGN  511

Query  1677  SFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFF  1856
             +F +R + +  D SKI +   L  +V ADW +   R D++A RPG   Q   A ++  F 
Sbjct  512   NFRVRSKNFCYDKSKIPAGKPLMDLVAADWFKDTKRMDHVARRPGCAAQ--VASEKGLFS  569

Query  1857  FVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVK  2036
              +VN+QVPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KLIP + KGSWIV+
Sbjct  570   LIVNVQVPGSTHYSMVFYFVMKE-LTSGSLLQRFVDGDDEFRNSRMKLIPSVPKGSWIVR  628

Query  2037  QSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQ  2216
             QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV++MAFLVQ
Sbjct  629   QSVGSTPCLLGKAVDCNYIRGPKYLEIDVDIGSSTVANGVLGLVIGVITSLVVDMAFLVQ  688

Query  2217  ADTEEELPEHLLGTCRLNHLDASKAV  2294
              +T +ELPE L+G  R +H++ S A+
Sbjct  689   GNTPDELPEQLIGAVRASHIELSAAI  714



>ref|XP_004146115.1| PREDICTED: uncharacterized protein LOC101209463 [Cucumis sativus]
 ref|XP_004163612.1| PREDICTED: uncharacterized LOC101209463 [Cucumis sativus]
Length=724

 Score =   343 bits (881),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 241/750 (32%), Positives = 375/750 (50%), Gaps = 90/750 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  8     EGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKKKP-QDNQVPIKTMLIDGNCRVEDRGL  66

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + +  I+  +  + P   K+ 
Sbjct  67    KTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALLWKEKI-ELVIDLHQGSQVPNGNKFV  125

Query  564   PFRLSVSSRMARTDASSTPVDAMTSD--------------VIGPCP--------------  659
              F         RT +SS     M++                IG  P              
Sbjct  126   SFEYKSGMDNGRTASSSDHESQMSAQEDEDDAHPNLLRRTTIGNGPPESVFDWTREIGSD  185

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   + +    A+ AVGV++ T E I
Sbjct  186   FSNQNANSQAFSRKHWRLVQCQNGLRIFEELVEVDYLPRSYS--RAMKAVGVVEATCEQI  243

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ +MS+  +R EWD  F  GS+VE +DGHT I++ +L   W  W    RDL   RYWRR
Sbjct  244   FELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFVW---PRDLCYVRYWRR  300

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVN--QGKSST-VKHMLSVDWKS  1145
              DDG YV+L+ S  H  C PQ GYVRA ++SGG  I+P+    GK  T V+H++ +D K 
Sbjct  301   NDDGNYVVLFRSREHENCGPQPGYVRAHIESGGFNISPLKPRNGKPRTQVQHLMQIDLKG  360

Query  1146  ----YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIK  1313
                 YL       L + ML  +A LRE F A++      P +  +       VS ++ +K
Sbjct  361   WGVGYLSSFQQHCL-LQMLNSVAGLREWF-AQTDERTAPPRIPVMVNMASSTVSSQKSLK  418

Query  1314  NEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHE  1493
              +          + ++  +A  + V LD+ +DE        D+E+          PE  +
Sbjct  419   AQGSTVH--ASSSIDQMNAANRNSVLLDEYSDE--------DEEYQ--------IPESEQ  460

Query  1494  TPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADT  1673
                P           ++ +AV++   + +         +   + +D        W  +D 
Sbjct  461   EVYPNEQE-----NDIRRVAVEEESTDPID-----LSSFSGNIRRDDRDGSRDCWRISDG  510

Query  1674  SSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEF  1853
             ++F +R + +  D +KI +   L  +V  DWL+   R D++A R G   Q   A ++  F
Sbjct  511   NNFRVRSKTFCFDKTKIPAGKHLMDLVAVDWLKDTKRMDHVARRHGCAAQ--VASEKGLF  568

Query  1854  FFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIV  2033
               V+N+QVPG+T YS+  Y++ K  L    LL+RFV+GDD FRNS+ KLIP + KGSWIV
Sbjct  569   SIVMNVQVPGSTHYSMIFYFVTKE-LIPGSLLQRFVDGDDEFRNSRLKLIPSVPKGSWIV  627

Query  2034  KQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLV  2213
             +QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G +  LV++MAFL+
Sbjct  628   RQSVGSMPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAFLI  687

Query  2214  QADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             QA+T EELPE L+G  R++H+  S A+ +N
Sbjct  688   QANTTEELPERLIGAVRVSHIQLSSAIPSN  717



>ref|XP_002867959.1| hypothetical protein ARALYDRAFT_492951 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44218.1| hypothetical protein ARALYDRAFT_492951 [Arabidopsis lyrata subsp. 
lyrata]
Length=718

 Score =   343 bits (880),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 244/752 (32%), Positives = 370/752 (49%), Gaps = 96/752 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDYQVPIKTMLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +  + P  +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKI-ESVIDQHQESQVPNGQQYV  124

Query  564   PFRLSVSSRMARTDASS-------TPVDA-------MTSDVIGPCP--------------  659
              F         RT +SS        P D        M    IG  P              
Sbjct  125   SFEYKSGMDTGRTASSSDHESQFSAPEDEEDSRRSLMRRTTIGNGPPESVLDWTKEFDAE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E I
Sbjct  185   LANQNSNNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEDI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ LMS+  +R EWD  F  GS+VE +DGHT +++ +L   W P  +  RDL   RYWRR
Sbjct  243   FELLMSMDGTRYEWDCSFQYGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---  1136
              DDG+YV+L+ S  H  C PQ G VRA ++SGG+ I+P+   N    + V+H++ +D   
Sbjct  303   NDDGSYVVLFRSREHENCGPQPGCVRAHLESGGYNISPLKPRNGRPRTQVQHLIQIDLKG  362

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPD--PAM-NELTIDIQLPVSEKEE  1307
             W +       +   + ML  +A LRE F        P   P M N  +  + L  S K  
Sbjct  363   WGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGVPTRIPVMVNMASSSLSLTKSGKSL  422

Query  1308  IKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEY  1487
              K+          D T    +  S +++ D   D+ F + E+  +  +         PE 
Sbjct  423   HKSA------FSLDQTNSV-NRNSVLMDEDSDDDDEFQIAESEQEPETSKTETDVKRPE-  474

Query  1488  HETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAA  1667
              E P   +   +CF   L+               E A+ C                W  +
Sbjct  475   -EEPAHNI-DLSCFSGNLKR-----------NENENARNC----------------WRTS  505

Query  1668  DTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRP  1847
             D ++F +RG+ +  +  KI +   L  +V  DW +   R D++A R G   Q   A ++ 
Sbjct  506   DGNNFKVRGKNFSVEKRKIPAGKHLMDLVAVDWFKDSKRIDHVARRKGCAAQ--VAAEKG  563

Query  1848  EFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSW  2027
              F  VVN+QVPG+T YS+  Y+++K  L    LL+RFV+GDD FRNS+ KLIP + KGSW
Sbjct  564   LFSMVVNVQVPGSTHYSMVFYFVMKE-LVPGSLLQRFVDGDDEFRNSRLKLIPLVPKGSW  622

Query  2028  IVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAF  2207
             IV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+EMAF
Sbjct  623   IVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVEMAF  682

Query  2208  LVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             LVQA+T EE PE L+G  R++H++ S A+  N
Sbjct  683   LVQANTAEEQPERLIGAVRVSHIELSSAIVPN  714



>emb|CAN74297.1| hypothetical protein VITISV_018694 [Vitis vinifera]
Length=203

 Score =   326 bits (835),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = +3

Query  1707  QDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGA  1886
             +  + I ++ TL Q+VGADWL+S  RED+LA RPGSIVQKYA   RPEFFFVVN+Q+PGA
Sbjct  4     KKKNSIKAQKTLMQLVGADWLRSNKREDDLAGRPGSIVQKYAEWSRPEFFFVVNLQLPGA  63

Query  1887  TRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLI  2066
             TRY+LALYYML+TPL + PLLE FVNGDDAFRNS+FKLIPYIS+GSWIVKQSVGKK+CL+
Sbjct  64    TRYNLALYYMLRTPLKDTPLLESFVNGDDAFRNSRFKLIPYISQGSWIVKQSVGKKACLV  123

Query  2067  GQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEH  2246
             GQ+LE+NYF+G+NYLEL +D GSSTVARGV+NLV+GYLNN+V EMAFL+QA+T+EELPE 
Sbjct  124   GQALEINYFQGKNYLELGIDAGSSTVARGVVNLVVGYLNNMVTEMAFLIQANTQEELPEV  183

Query  2247  LLGTCRLNHLDASKAV  2294
             LLGTCR NHLDASKAV
Sbjct  184   LLGTCRFNHLDASKAV  199



>emb|CDY23114.1| BnaC09g18680D [Brassica napus]
Length=718

 Score =   343 bits (879),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 232/745 (31%), Positives = 368/745 (49%), Gaps = 90/745 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDNQLPIKTMVIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + +  I+  ++   P+ +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKI-EYVIDQHQDSLVPSGQQYV  124

Query  564   PFRLSVSSRMARTDASS---TPVDAMTSD-----------VIGPCP--------------  659
              F       + RT +SS   +P  A+  +            IG  P              
Sbjct  125   SFEYKPGMDVERTASSSDHESPFSALEDEDDSRPDLLRRTTIGNGPPESIFDWTKELGSE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E I
Sbjct  185   LSNHNSSNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEEI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             FK +MS+  +R EWD  F  G +VE +DGHT I++ +L   W P  +  RDL   RYWRR
Sbjct  243   FKLVMSMDGTRYEWDCSFHNGRLVEEVDGHTAILYHRLLLDWFPMVVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---  1136
              DDG+YV+L+ S  H+ C PQ G+VRA ++SGG  I P+   N    + V+H++ +D   
Sbjct  303   NDDGSYVVLFRSREHANCGPQPGFVRAHLESGGFNIAPLKPRNGRPRTQVQHLIQIDLKG  362

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKN  1316
             W +       +   + ML  ++ LRE F        P      + I + + ++       
Sbjct  363   WGAGYLPAFQQHCLLQMLNSVSGLREWFLQTDERSHP------IRIPVMVNMAPSSLALG  416

Query  1317  EVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHET  1496
             +    +     + ++   A  + V +D+ +D+  +   A  ++  D   P +   +  E 
Sbjct  417   KGGKPQHKSSHSIDQTNGAGRNSVLMDEDSDDDDEFQIAESEQEPDTSKPETVAKKTEEE  476

Query  1497  PRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTS  1676
             P   +   +CF   L+                            D + N    W  +D +
Sbjct  477   PALDI-DLSCFSGNLR---------------------------HDDNENGRNCWRISDGN  508

Query  1677  SFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFF  1856
             +F IRG+ + +D  K  +   L  +V  DW +   R D++A R G   Q   A ++  F 
Sbjct  509   NFKIRGQSFCEDKRKTPAGKHLMDLVAVDWFKDTTRIDHVARRKGCAAQ--VAAEKGLFS  566

Query  1857  FVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVK  2036
              VVN+QVPG+T YS+  Y++ +  L    L +RFV+GDD FRNS+ KLIP + KGSWIV+
Sbjct  567   LVVNVQVPGSTHYSMIFYFVTRE-LVPGSLFQRFVDGDDEFRNSRLKLIPLVPKGSWIVR  625

Query  2037  QSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQ  2216
             QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+EMAFLVQ
Sbjct  626   QSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVEMAFLVQ  685

Query  2217  ADTEEELPEHLLGTCRLNHLDASKA  2291
             A+T EELPE L+G  R++H++ S A
Sbjct  686   ANTPEELPERLIGAVRVSHIELSSA  710



>ref|XP_004964369.1| PREDICTED: uncharacterized protein LOC101766909 [Setaria italica]
Length=747

 Score =   343 bits (880),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 241/745 (32%), Positives = 369/745 (50%), Gaps = 100/745 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGWL      ++G  +   RYF+L++  L  YK  P      PL+S +ID    V+D G 
Sbjct  49    EGWLVRHGRRKIGRSFFHMRYFVLDNKLLAYYKKKP-RDSMVPLKSILIDGNCRVEDRGL  107

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H ++ +   + N    ++Q+  GA   E+A  W R L       + ++ A   + + 
Sbjct  108   KTHHGQMIYFLCIYNKKQKENQITMGAYDIEDALTWKRKLEFLIDQQQDSMTAKNRKAFA  167

Query  564   P--FRLSVSSRMARTDASSTPVDA-------MTSDVIGPCP-------------------  659
                F + +    + +D  S P D        +    IG  P                   
Sbjct  168   SLDFDIDLGGPFSFSDHDSGPEDEEEPRPTLLRRTTIGNGPPDSVLDWTKEPDIGLSNQS  227

Query  660   ----------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALM  809
                       W++   QNGLRIF+E  +     +      A+ AVGV++ + EAIF  +M
Sbjct  228   DTNQAYSRKNWRLLRCQNGLRIFEELVEVEYLARSCSR--AMRAVGVVEASCEAIFGLVM  285

Query  810   SLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGT  989
              +  +R EWD  F  GS+VE +DGHT I++ +L  +W    +  RDL   RYWRR DDG+
Sbjct  286   GMDVTRYEWDCSFQYGSLVEEVDGHTAILYHRLQLNWCSMVVWPRDLCYVRYWRRNDDGS  345

Query  990   YVILYHSVIHSKCPPQEGYVRATVKSGGHVITP---VNQGKSSTVKHMLSVD---WK-SY  1148
             YV+L+ S  H  C PQ G+VRA ++SGG  I+P   +N    + V+H++ +D   W  +Y
Sbjct  346   YVVLFRSTEHQNCGPQPGFVRAIIESGGFKISPLKSLNGRPRTQVQHLMQIDLSGWGVNY  405

Query  1149  LRKTTSKSLTIDMLGGIAALREMFKAKSGSY-FPD-PAMNELTIDIQLPVSEKEEIKNEV  1322
                    SL + ML  +A LRE F      +  P  P M+ +   I +   +K +     
Sbjct  406   FPSFQYHSL-LQMLNCVAGLREYFSQTDEVHTVPRIPVMHAMVNTISMKKDQKLQ-----  459

Query  1323  VATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPR  1502
                   E DT  K       +V+ +   D+ + VP+A  +E      P  +  +   +  
Sbjct  460   ------EPDTKTKQTDKILDMVDEESEDDDDYQVPDADLEEE-----PTKSDSDAKSSDP  508

Query  1503  PKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSF  1682
               LS  +  +R  QD              E ++ C                W   D   F
Sbjct  509   IDLSWFSGIIR--QD------------ANEKSRNC----------------WTVPDNKVF  538

Query  1683  LIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFV  1862
              +R + +  D SK+ +   L ++V  DW +   R D++A R G   Q   A ++  F F+
Sbjct  539   KVRSKNFPHDKSKVPAGKYLMELVAIDWFKDTKRMDHVARRKGCAAQ--VAAEKGMFTFL  596

Query  1863  VNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQS  2042
             VNIQ+PG++ YSL LY+ + + L +  LL+RF +GDD FRNS+ KLIP + KGSWIV+QS
Sbjct  597   VNIQIPGSSHYSLVLYF-VSSSLKKGSLLQRFADGDDDFRNSRLKLIPSVPKGSWIVRQS  655

Query  2043  VGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQAD  2222
             VG   CL+G++++ +Y +G  YLE+DVD+GSS VA GV+ LV G +  LV++MAFL+QA+
Sbjct  656   VGSTPCLLGKAVDCSYLRGPEYLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAFLIQAN  715

Query  2223  TEEELPEHLLGTCRLNHLDASKAVH  2297
             T +ELPE LLG  RL+H++ S AV+
Sbjct  716   TYDELPEQLLGAARLSHIEPSAAVN  740



>ref|XP_010529240.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010529241.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Tarenaya hassleriana]
Length=722

 Score =   342 bits (878),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 241/750 (32%), Positives = 370/750 (49%), Gaps = 99/750 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  12    EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDNQLPIKTMVIDGNCRVEDRGL  70

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +       +++ 
Sbjct  71    KTHHGHMVYVLSVYNKKEKHHRITMAAFNIQEALMWKEKI-ESVIDQHQESPIANGQQYA  129

Query  564   PFRLSVSSRMARTDASS-------TPVDAMTSD-------VIGPCP--------------  659
              F       + RT +SS        P D   S         IG  P              
Sbjct  130   SFEYKSGMGITRTASSSDHESQFSAPEDEDNSHRSLLRRTTIGNGPPEQILDWTREFDAK  189

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E I
Sbjct  190   LSNQNTNNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEEI  247

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ +MS+  +R EWD  F  GS+VE +DGHT +++ +L   W P  +  RDL   RYWRR
Sbjct  248   FELVMSMDGTRYEWDSSFQYGSLVEEVDGHTAVLYHRLQLDWFPMVVWPRDLCYVRYWRR  307

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWK-  1142
              DDG+YV+L+ S  H  C  Q GYVRA ++SGG  I P+   N    + V+H++ +D K 
Sbjct  308   NDDGSYVVLFRSREHENCGQQPGYVRAHLESGGFNIAPLKPRNGKPRAQVQHLMQLDLKG  367

Query  1143  ---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPD--PAM-NELTIDIQLPVSEKE  1304
                 YL       L + ML  +A LRE F        P   P M N  +  + L  S K 
Sbjct  368   WGVGYLPAFQQHCL-LQMLNSVAGLREWFAQTDDRGVPPRIPVMVNMASTSLSLSRSGKP  426

Query  1305  EIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPE  1484
             +  + + A +           S  S +++ D   D+ F + E+  +       P +  PE
Sbjct  427   QHLSALCADQ-------ANASSRNSVLMDEDSDDDDEFQIAESEQE-------PETNKPE  472

Query  1485  YHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAA  1664
                            V++ ++ A   +             C+   L  + + N    W  
Sbjct  473   TD-------------VKRTEEPAHDIDL-----------SCFSGNLRHNNNENARNCWRT  508

Query  1665  ADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDR  1844
             +D ++F +R + +  D  K+ +   L  +V  DW +   R D++  R G   Q   A ++
Sbjct  509   SDGNNFKVRSKSFCDDKRKVPAGKHLMDLVAVDWFKDTKRMDHVVRRKGCAAQ--VAAEK  566

Query  1845  PEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGS  2024
               F  VVN+QVPG+T YS+  Y++ K  LA   LL+RFV+GDD FRNS+ KLIP + KGS
Sbjct  567   GLFSLVVNVQVPGSTHYSMVFYFVTKE-LAPGSLLQRFVDGDDEFRNSRLKLIPSVPKGS  625

Query  2025  WIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMA  2204
             WIV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+EMA
Sbjct  626   WIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGMITSLVVEMA  685

Query  2205  FLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             FLVQA+T+EELPE L+G  R++H++ S A+
Sbjct  686   FLVQANTQEELPERLIGVVRVSHVELSSAI  715



>gb|AFW69707.1| hypothetical protein ZEAMMB73_145444 [Zea mays]
Length=791

 Score =   344 bits (883),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 241/741 (33%), Positives = 372/741 (50%), Gaps = 94/741 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+L    L  YK  P      PL+S +ID    V+D G 
Sbjct  66    EGWMVRYGRRKIGTSFFHTRYFLLHSKLLAYYKKKP-KDNMVPLKSLLIDGNCRVEDRGL  124

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARW------IRCLRDAAINPEKNLRAP  545
               +H ++ +   + N    + Q+  GA   E+A  W      I  L+  +I   KN RA 
Sbjct  125   TTYHGQMIYVLCIYNKKEKEHQITMGAYDIEDAMTWKKKIELIIDLQQDSITA-KNRRAF  183

Query  546   AIRKWQ-----PFRLSVSSRMARTDASST-----------PVDAM-------------TS  638
             A   +       F  S     A  D   +           P D++              +
Sbjct  184   ASVDFDRELGGQFLFSDHDNTAEDDDERSTLTHRPTIGNGPPDSIHDWTKESDIGVTNQN  243

Query  639   DVIGPCP---WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALM  809
             D I  C    W++   QNGLRIF+E  + +   +      A+ AVGV + T EAIF  +M
Sbjct  244   DPIQFCSKKNWRLLRCQNGLRIFEELLEVDYLAR--SCSRAMKAVGVAEATCEAIFGLVM  301

Query  810   SLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGT  989
             S+  +R EWD  F  GS+VE +DGHT I++ +L  HW P  +  RDL   RYWRR DDG+
Sbjct  302   SMDVTRYEWDCSFRHGSLVEEVDGHTAILYHRLQLHWCPMLVWPRDLCYARYWRRNDDGS  361

Query  990   YVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV--NQGKSST-VKHMLSVDWKSYLRKT  1160
             YV+L+ S+ H  C  Q G+VRA ++SGG  I+P+  + G+  T V+H++ +D K +    
Sbjct  362   YVVLFRSIEHPNCGRQRGFVRAFIESGGFKISPLKCHNGRPRTQVQHLMQIDLKGWFLNY  421

Query  1161  T---SKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVAT  1331
             T        + +L  +A LRE F             +E+ I  ++ V E     +     
Sbjct  422   TLSFQYHSLLQILNCVAGLREYFS----------QTDEIHIIPRIHVMETMFDVDSKPKF  471

Query  1332  ERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKL  1511
              +++E  T++  +    I++ +   D+ + VPEA+ +E      P ++  +   T  P  
Sbjct  472   HKLQEVETKENKNM--GIIDEESDDDDDYQVPEANIEED-----PNTSDNDNKHTDEPP-  523

Query  1512  SSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIR  1691
                                      E+    C+   L +D        W   D+ +F +R
Sbjct  524   -------------------------EKIDLSCFSSILHRDPEEKSRNCWTVPDSKNFKVR  558

Query  1692  GEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNI  1871
              + + QD SKI +   L ++   DW +   R DN+A + G + Q   A ++    F+VNI
Sbjct  559   SKNFPQDKSKIPAASYLMELAAIDWFKDTKRMDNVARQKGCVAQ--VAAEKGMHTFIVNI  616

Query  1872  QVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGK  2051
             Q+PG+T+YSL +Y++  T L +  LL+RF +GDD F NS+ KLIP + KGSW+V+QSVG 
Sbjct  617   QIPGSTQYSLVMYFVTNT-LKKGSLLQRFFDGDDEFCNSRLKLIPSVPKGSWLVRQSVGS  675

Query  2052  KSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEE  2231
               CL+G++++ +Y +G  YLE+DVD+GSS VA GV+ LV G +  LV++MAFL+QA+T E
Sbjct  676   TPCLLGKAVDCSYVRGPAYLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAFLIQANTYE  735

Query  2232  ELPEHLLGTCRLNHLDASKAV  2294
             ELPE ++G  RL H++ + AV
Sbjct  736   ELPEQVIGAARLAHVEPATAV  756



>ref|XP_002304367.1| pleckstrin homology domain-containing family protein [Populus 
trichocarpa]
 gb|EEE79346.1| pleckstrin homology domain-containing family protein [Populus 
trichocarpa]
Length=723

 Score =   342 bits (877),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 239/750 (32%), Positives = 366/750 (49%), Gaps = 95/750 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +  +RYF+LE   L  YK  P   R  P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSFIHRRYFVLEPRLLAYYKKKPQDNRV-PIKTLLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H    +  ++ N  +  +++   A + +E   W   + +  I+  +  + P   K+ 
Sbjct  66    KVHHGHTLYVLSVYNKKDKYNRITMAAFNIQEVFIWKEKI-EFVIDQHQESQVPNGNKYV  124

Query  564   PFRLSVSSRMARTDASSTPVDAMTSD----------------VIGPCP------------  659
              F         RT +SS     +++                  +G  P            
Sbjct  125   SFEYKSGMDNGRTASSSDCESQLSAQEDEDENENHRNLLRRTTMGNGPPASVFDWTQEFD  184

Query  660   -----------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSE  788
                              W++   QNGLRIF+E  + +   +      A+ AVGV++ + E
Sbjct  185   SELTNQNPNNQVFSRKHWRLLQCQNGLRIFEELVEVDYLPR--SCSRAMKAVGVVEASCE  242

Query  789   AIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrryw  968
              IF+ +MS+  +R EWD  F  GSVVE +DGHT I+H  L   W P  +  RDL   RYW
Sbjct  243   EIFELIMSMDATRFEWDCSFQYGSVVEEVDGHTAILHHILQLDWFPTFVWPRDLCYVRYW  302

Query  969   rrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVN--QGKSST-VKHMLSVDW  1139
             RR DDG+YV+L+ S  H  C P+ GYVRA ++SGG  I+P+    GK  T V+H++ +D 
Sbjct  303   RRNDDGSYVVLFRSREHENCGPRPGYVRAHIESGGFNISPLKPRNGKLRTQVQHLMQIDL  362

Query  1140  KSY---LRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPD--PAMNELTIDIQLPVSEKE  1304
             K +      +  +   + ML  +A LRE F        P   PAM  +      P   K+
Sbjct  363   KGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPAMANMA---SAPALSKK  419

Query  1305  EIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPE  1484
              +         ++E +    P +             F  +  AS +     G+      E
Sbjct  420   NVM--------LQESSVHPTPPS-------------FNQINAASQNSVRRDGYSDQIAEE  458

Query  1485  YHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAA  1664
               E         AC  +   D     + +E V  ++    C+   L +D   N    W  
Sbjct  459   EQE---------ACQTKHENDAKRTASEEEPV--DQIDLSCFSGNLRRDDRDNTRDCWRI  507

Query  1665  ADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDR  1844
             +D ++F +R + +  D SK+ +   L  +V  DW +   R D++A R G   Q   A ++
Sbjct  508   SDGNNFRVRSKHFCFDKSKVPAGKHLLDLVAVDWFKDTKRMDHVARRQGCAAQ--VASEK  565

Query  1845  PEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGS  2024
               F  V N+QVPG+T YS+  Y++ K  L    LL+RFV+GDD FRNS+ KLIP + KGS
Sbjct  566   GLFSVVFNLQVPGSTHYSMVFYFVTKE-LVPGSLLQRFVDGDDEFRNSRLKLIPSVPKGS  624

Query  2025  WIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMA  2204
             WIV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G +  LV++MA
Sbjct  625   WIVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMA  684

Query  2205  FLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             FLVQA+T EELPE L+G  R++H++ S A+
Sbjct  685   FLVQANTTEELPERLIGAVRVSHIELSSAI  714



>ref|XP_009132490.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Brassica rapa]
 emb|CDX78916.1| BnaA01g09830D [Brassica napus]
Length=718

 Score =   342 bits (877),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 233/751 (31%), Positives = 363/751 (48%), Gaps = 94/751 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDYQVPIKTMLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +  + P  +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKHHRITMAAFNIQEALMWKEKI-ESVIDQHQESQVPNGQQYV  124

Query  564   PFRLSVSSRMARTDASS-------TPVDA-------MTSDVIGPCP--------------  659
              F         RT +SS        P D        M    IG  P              
Sbjct  125   SFEYKSGMDSGRTASSSDHESQFSAPEDEDGSRRSLMRRTTIGNGPPESVLDWTKEFDAE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E +
Sbjct  185   LANQNSDNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEEV  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ +MS+  +R EWD  F  GS+VE +DGHT +++ +L   W P  +  RDL   RYWRR
Sbjct  243   FELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAVLYHRLLLDWFPMVVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---  1136
              DDG+YV+L+ S  H  C PQ G VRA ++SGG+ I P+   N    + V+H++ +D   
Sbjct  303   NDDGSYVVLFRSREHDNCGPQPGCVRAHLESGGYNIAPLKPRNGRPRTQVQHLIQIDLKG  362

Query  1137  WKSYLRKTTSKSLTIDMLGGIAALREMFKA--KSGSYFPDPAMNELTIDIQLPVSEKEEI  1310
             W +       +   + ML  +A LRE F    + G +   P M  +             +
Sbjct  363   WGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGVHTRIPVMVNMASSSLSLSKSGRSV  422

Query  1311  KNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH  1490
                  + ++             S +++ D   D+ F + E+  +                
Sbjct  423   HQSAFSIDQTNSANRN------SVLLDEDSDDDDEFQIAESEQE----------------  460

Query  1491  ETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAAD  1670
                 P+ S     V+K ++            G           L ++ + N    W  +D
Sbjct  461   ----PETSKTETDVKKTEEEPAHNIDLSCFSG----------NLKRNENENARNCWRTSD  506

Query  1671  TSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPE  1850
              ++F +R + +  D  KI +   L  +V  DW +   R D++A R G   Q   A ++  
Sbjct  507   GNNFKVRSKSFCDDKRKIPAGKHLMDLVAVDWFKDSKRIDHVARRKGCAAQ--VAAEKGL  564

Query  1851  FFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWI  2030
             F  VVN+QVPG+T YS+  Y++ K  L    LL+RFV+GDD FRNS+ KLIP + KGSWI
Sbjct  565   FSMVVNVQVPGSTHYSMVFYFVTKE-LVPGSLLQRFVDGDDEFRNSRLKLIPQVPKGSWI  623

Query  2031  VKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFL  2210
             V+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+EMAFL
Sbjct  624   VRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVEMAFL  683

Query  2211  VQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             VQA+T EELPE L+G  R++H++ S A+  N
Sbjct  684   VQANTPEELPERLIGAVRVSHIELSSAIVPN  714



>ref|XP_002453121.1| hypothetical protein SORBIDRAFT_04g000380 [Sorghum bicolor]
 gb|EES06097.1| hypothetical protein SORBIDRAFT_04g000380 [Sorghum bicolor]
Length=702

 Score =   341 bits (874),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 231/703 (33%), Positives = 354/703 (50%), Gaps = 94/703 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+L+   L  YK  P      PL+S +ID    V+D G 
Sbjct  59    EGWMVRYGRRKIGRSFFHTRYFVLDSKLLAYYKKKP-KDNVVPLKSLLIDGNCRVEDRGL  117

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H ++ +   + N    + Q+  GA   E+A  W +                      
Sbjct  118   KTHHGQMIYVLCIYNKKEKEHQITMGAYDIEDAMTWKK----------------------  155

Query  564   PFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIFKEAKDRNPNGKHWDG  743
                L +  +     A + P D++      P          GLRIF+E  + +   +    
Sbjct  156   KIELIIDQQQDSMTAKNRPPDSIHDWTKEP--------DIGLRIFEELLEVDYLARSCSR  207

Query  744   HPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWL  923
               A+ AVGV++ T EAIF  +MS+  +R EWD  F  GS+VE +DGHT I++ +L  HW 
Sbjct  208   --AMRAVGVVEATCEAIFGLVMSMDVTRYEWDCSFRHGSLVEEVDGHTAILYHRLQLHWC  265

Query  924   PWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---N  1094
             P  +  RDL   RYWRR DDG+YV+L+ S+ H  C  Q G+VRA ++SGG  I+P+   N
Sbjct  266   PMLVWPRDLCYARYWRRNDDGSYVVLFRSIEHPNCGRQRGFVRAFIESGGFKISPLKCRN  325

Query  1095  QGKSSTVKHMLSVDWKSYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTI  1274
                 + V+H++ +D K +     + SL+             F+  S     +   +E+ I
Sbjct  326   GRPRTQVQHLMQIDLKGWF---LNYSLS-------------FQYHSLLQILNCVADEIHI  369

Query  1275  DIQLPVSEKEEIKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEA---SDDE  1445
               ++PV E     +      +++E  T+   +    +++ +   D+ + VPEA    D  
Sbjct  370   IPRIPVMETMFNADSEPKNHKLQEVDTKANKNM--GMIDEESDDDDDYQVPEADIEEDPN  427

Query  1446  HSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLP  1625
              SD+   R+  P       P+    +CF   L               EE ++ C      
Sbjct  428   KSDNDTKRTDEP-------PEKIDLSCFSSILHR-----------DPEEKSRNC------  463

Query  1626  KDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAAR  1805
                       W   D   F +R + + QD SKI +   L ++   DW +   R DN+A +
Sbjct  464   ----------WTVPDCKIFKVRSKTFPQDKSKIPAASYLMELAAIDWFKDTKRMDNVARQ  513

Query  1806  PGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRN  1985
              G + Q   A +R    FVVNIQ+PG+T+YSL +Y++  T L +  LL+RF +GDD FRN
Sbjct  514   KGCVAQ--VAAERGMHTFVVNIQIPGSTQYSLVMYFVTST-LKKGSLLQRFFDGDDEFRN  570

Query  1986  SKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINL  2165
             S+ KLIP + KGSWIV+QSVG   CL+G++++ +YF+G  YLE+DVD+GSS VA GV+ L
Sbjct  571   SRLKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCSYFRGPAYLEVDVDIGSSAVANGVLGL  630

Query  2166  VLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             V G +  LV++MAFL+QA+T EELPE ++G  RL H++ + AV
Sbjct  631   VFGVVTTLVVDMAFLIQANTYEELPEQVIGAARLAHVEPATAV  673



>ref|XP_003570763.2| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Brachypodium 
distachyon]
Length=750

 Score =   342 bits (876),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 237/751 (32%), Positives = 371/751 (49%), Gaps = 105/751 (14%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  YK  P      PL+S +ID    V+D G 
Sbjct  12    EGWMVRYGRRKIGRSFFHTRYFVLETKLLAYYKKKP-KDNMVPLKSLLIDGNCRVEDRGL  70

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H ++ +   + N    + Q+  GA   E+A  W   + +  I+ + ++ A   + + 
Sbjct  71    KTHHGQMIYVLCVYNKKEKEHQITMGAYDIEDALAWKNKI-ELIIDQQDSMTAKDRKAFA  129

Query  564   P--FRLSVSSRMARTDASSTPVDAMTSDV------IGPCP--------------------  659
                F + +  + + +D  S   D     +      IG  P                    
Sbjct  130   SMDFDMDLGGQFSFSDHDSAAEDEEERPILTRRTTIGNGPPESIHDWTKEPDIGGASNQN  189

Query  660   ----------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALM  809
                       W++    NGLRIF+E  + +   +      A+ AVGV++ T EAIF  +M
Sbjct  190   EPIQFSSKKNWRLLRCHNGLRIFEELLEVDYLARSCSR--AMRAVGVVEATCEAIFGLVM  247

Query  810   SLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGT  989
             S+  +R EWD  F  GS+VE +DGHT I++ +L  HW P  +  RDL   RYWRR DDG+
Sbjct  248   SMDVTRYEWDCSFRYGSLVEEVDGHTAILYHRLQLHWCPMLVWPRDLCYVRYWRRNDDGS  307

Query  990   YVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKSYLRKT  1160
             YV+L+ S+ H  C  Q GYVRA ++SGG  I+P+   N    + V+H++ +D + +L   
Sbjct  308   YVVLFRSIEHPNCGRQRGYVRAFIESGGFKISPLKCRNGRPRTQVQHLMQIDLRGWLLNY  367

Query  1161  TSKSLTIDML---GGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKNEVVAT  1331
             +       +L     +A LRE F             +EL I  ++PV E     + V   
Sbjct  368   SPSFQYHSLLQIQNCVAGLREYFS----------QTDELHITPRIPVMENMFDPSTVQKN  417

Query  1332  ERIEEDTTEKYP-------SACSSIVELDDVADEFFDVPEAS---DDEHSDHGWPRSTTP  1481
             ++  E  ++  P       S    I++ +   DE + VPEA+   D   SD    R+  P
Sbjct  418   QKNPEMESKTKPADRGQSDSKTMGIIDEESDEDEDYQVPEANIEEDTNKSDSDAKRTDEP  477

Query  1482  EYHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWA  1661
                    P+    +CF   L+              EE ++ C                W 
Sbjct  478   -------PEKIDLSCFSGILRR-----------DPEEKSRNC----------------WT  503

Query  1662  AADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQD  1841
               D++ F +R + +  D SKI +   L ++   DW +   R DN+  + G + Q   A +
Sbjct  504   VPDSTLFKVRSKNFPTDKSKIPAPNYLMELAAIDWFKDTKRMDNVGRQKGCVAQ--VAAE  561

Query  1842  RPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKG  2021
             +  + FV NIQ+PG+T YSL +Y++  + L +  LL+RF +GDD FRNS+ KLIP + KG
Sbjct  562   KGMYTFVANIQIPGSTHYSLVMYFVTSS-LKKGSLLQRFFDGDDEFRNSRLKLIPAVPKG  620

Query  2022  SWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEM  2201
             SWIV+QSVG   CL+G++++ +Y +   YLE+DVD+GSS VA GV+ LV G +  LV++M
Sbjct  621   SWIVRQSVGSTPCLLGKAVDCSYVRAPGYLEVDVDIGSSAVANGVLGLVFGVVTTLVVDM  680

Query  2202  AFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             AFL+QA+T +ELPE ++G  RL H++ + A+
Sbjct  681   AFLIQANTYDELPEQVIGAARLAHVEPAAAI  711



>ref|XP_008645141.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Zea mays]
Length=799

 Score =   343 bits (879),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 244/749 (33%), Positives = 372/749 (50%), Gaps = 102/749 (14%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+L    L  YK  P      PL+S +ID    V+D G 
Sbjct  66    EGWMVRYGRRKIGTSFFHTRYFLLHSKLLAYYKKKP-KDNMVPLKSLLIDGNCRVEDRGL  124

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARW------IRCLRDAAINPEKNLRAP  545
               +H ++ +   + N    + Q+  GA   E+A  W      I  L+  +I   KN RA 
Sbjct  125   TTYHGQMIYVLCIYNKKEKEHQITMGAYDIEDAMTWKKKIELIIDLQQDSITA-KNRRAF  183

Query  546   AIRKWQ-----PFRLSVSSRMARTDASST-----------PVDAM-------------TS  638
             A   +       F  S     A  D   +           P D++              +
Sbjct  184   ASVDFDRELGGQFLFSDHDNTAEDDDERSTLTHRPTIGNGPPDSIHDWTKESDIGVTNQN  243

Query  639   DVIGPCP---WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALM  809
             D I  C    W++   QNGLRIF+E  + +   +      A+ AVGV + T EAIF  +M
Sbjct  244   DPIQFCSKKNWRLLRCQNGLRIFEELLEVDYLAR--SCSRAMKAVGVAEATCEAIFGLVM  301

Query  810   SLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGT  989
             S+  +R EWD  F  GS+VE +DGHT I++ +L  HW P  +  RDL   RYWRR DDG+
Sbjct  302   SMDVTRYEWDCSFRHGSLVEEVDGHTAILYHRLQLHWCPMLVWPRDLCYARYWRRNDDGS  361

Query  990   YVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV--NQGKSST-VKHMLSVDWKSYLRKT  1160
             YV+L+ S+ H  C  Q G+VRA ++SGG  I+P+  + G+  T V+H++ +D K +    
Sbjct  362   YVVLFRSIEHPNCGRQRGFVRAFIESGGFKISPLKCHNGRPRTQVQHLMQIDLKGWFLNY  421

Query  1161  T---SKSLTIDMLGGIAALREMFKAKSGSY-FPDPAMNELTIDI-------QLPVSEKEE  1307
             T        + +L  +A LRE F      +  P   + E   D+       +L   E +E
Sbjct  422   TLSFQYHSLLQILNCVAGLREYFSQTDEIHIIPRIHVMETMFDVDSKPKFHKLQEVETKE  481

Query  1308  IKNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEY  1487
              KN  +  E  ++D   + P A    +   ++ ++    P  SD+++             
Sbjct  482   NKNMGIIDEESDDDDDYQVPEANIETLTKTNIQED----PNTSDNDNK------------  525

Query  1488  HETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAA  1667
             H    P+    +CF   L               EE ++ C                W   
Sbjct  526   HTDEPPEKIDLSCFSSILHR-----------DPEEKSRNC----------------WTVP  558

Query  1668  DTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRP  1847
             D+ +F +R + + QD SKI +   L ++   DW +   R DN+A + G + Q   A ++ 
Sbjct  559   DSKNFKVRSKNFPQDKSKIPAASYLMELAAIDWFKDTKRMDNVARQKGCVAQ--VAAEKG  616

Query  1848  EFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSW  2027
                F+VNIQ+PG+T+YSL +Y++  T L +  LL+RF +GDD F NS+ KLIP + KGSW
Sbjct  617   MHTFIVNIQIPGSTQYSLVMYFVTNT-LKKGSLLQRFFDGDDEFCNSRLKLIPSVPKGSW  675

Query  2028  IVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAF  2207
             +V+QSVG   CL+G++++ +Y +G  YLE+DVD+GSS VA GV+ LV G +  LV++MAF
Sbjct  676   LVRQSVGSTPCLLGKAVDCSYVRGPAYLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAF  735

Query  2208  LVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             L+QA+T EELPE ++G  RL H++ + AV
Sbjct  736   LIQANTYEELPEQVIGAARLAHVEPATAV  764



>ref|XP_010518854.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Tarenaya 
hassleriana]
 ref|XP_010518855.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Tarenaya 
hassleriana]
Length=717

 Score =   340 bits (873),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 236/753 (31%), Positives = 371/753 (49%), Gaps = 105/753 (14%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QDNQVPIKTMVIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N   H  ++   A + +EA  W   + ++ I+  ++      +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEHHHRITMAAFNIQEALMWKEKI-ESVIDQHQDSPLANGQQYV  124

Query  564   PFRLSVSSRMART--------------DASSTPVDAMTSDVIGPCP--------------  659
              F        ART              DA  +  + +    IG  P              
Sbjct  125   SFEYKSGMGSARTASSSDHESQFSALEDADDSRNNLLRRTTIGNGPPEQILDWTKEFEAE  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   +      A+ AVGV++ T E I
Sbjct  185   FSNQNTNNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEEI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ +MS+  +R EWD  F  GS+VE +DGHT +++ +L   W P  +  RDL   RYWRR
Sbjct  243   FELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAVLYHRLQLDWFPVAVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWK-  1142
              DDG+YV+L+ S  H  C  Q GYVRA ++SGG  I P+   N    + V+H++ +D K 
Sbjct  303   NDDGSYVVLFRSREHENCGSQPGYVRAHLESGGFNIAPLKPRNGRPRTQVQHLMQLDLKG  362

Query  1143  ---SYLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIK  1313
                 YL       L + ML  +A LRE F        P        I + + ++      
Sbjct  363   WGVGYLPAFQQHCL-LQMLNSVAGLREWFAQTDDRGVPP------RIPVMVNMASSSLGL  415

Query  1314  NEVVATERIEEDTTEKYPSAC--SSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEY  1487
             ++    + +   + ++  +A   S +++ D   D+ F + E+  +       P +  PE 
Sbjct  416   SKSGKPQHLPALSADQANAASRNSVLMDEDSDDDDEFQIAESEQE-------PETNKPE-  467

Query  1488  HETPRPKLSS----AACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGS  1655
             ++  R + S+     +CF   L+                           +D   N    
Sbjct  468   NDVKRTEESAHDIDLSCFSGNLR---------------------------RDDHENARNC  500

Query  1656  WAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAA  1835
             W  +D ++F +RG+ +  D  K+ +   L  +V  DW +   R D++  R G   Q   A
Sbjct  501   WRNSDGNNFKVRGKSFCNDKGKVPAGKHLMDLVAVDWFKDTKRMDHVVRRKGCAAQ--VA  558

Query  1836  QDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYIS  2015
              ++  F  VVN+QVPG+T YS+  Y++ K  L    LL+RFV+GDD FRNS+ KLIP + 
Sbjct  559   AEKGLFSLVVNVQVPGSTHYSMVFYFVTKD-LVPGSLLQRFVDGDDEFRNSRLKLIPLVP  617

Query  2016  KGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVI  2195
             KGSWIV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+
Sbjct  618   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVV  677

Query  2196  EMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             EMAFLVQA+T EELPE L+G  R++H++ S A+
Sbjct  678   EMAFLVQANTPEELPERLIGAVRVSHIELSSAI  710



>emb|CDX98603.1| BnaA03g43880D [Brassica napus]
Length=718

 Score =   340 bits (872),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 234/749 (31%), Positives = 363/749 (48%), Gaps = 90/749 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P    + P+++ +ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKP-QHSQVPIKTMLIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +  + P  +++ 
Sbjct  66    KTHHGHMVYVLSVYNKKEKHHRITMAAFNIQEALMWKEKI-ESVIDQHQESQVPNGQQYV  124

Query  564   PFRLSVSSRMARTDASS-----TPVDA---------MTSDVIGPCP--------------  659
              F         RT +SS      P D           T+   GP P              
Sbjct  125   AFEYKSGMDTGRTASSSDYESHAPEDEDDSRRRLVRRTTIGNGPPPSVLDWTKEFDAELA  184

Query  660   -------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFK  800
                          W++   QNGLRIF+E  + +   +      A+ AVGV++ T E +F+
Sbjct  185   NQNSDNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATCEEVFE  242

Query  801   ALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrrED  980
              +MS+  +R EWD  F  GS+VE +DGHT +++ +L   W P  +  RDL   RYWRR D
Sbjct  243   LVMSMDGTRYEWDCSFQYGSLVEEVDGHTAVLYHRLLLDWFPMVVWPRDLCYVRYWRRND  302

Query  981   DGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVD---WK  1142
             DG+YV+L+ S  H  C PQ G VRA ++SGG+ I P+   N    + V+H++ +D   W 
Sbjct  303   DGSYVVLFRSREHDNCGPQPGCVRAHLESGGYNIAPLKPRNGRPRTQVQHLIQIDLKGWG  362

Query  1143  SYLRKTTSKSLTIDMLGGIAALREMFKA--KSGSYFPDPAMNELTIDIQLPVSEKEEIKN  1316
             +       +   + ML  +A LRE F    + G +   P M  +             +  
Sbjct  363   AGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGVHTRIPVMVNMASSSLGLSKSGRFLHQ  422

Query  1317  EVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHET  1496
                + ++             S +++ D   D+ F + E+  +  +             E 
Sbjct  423   SAFSVDQTNAANRN------SVLMDEDSDDDDEFQIAESEQEGETSKIETDPVKGSNKEE  476

Query  1497  PRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTS  1676
             P  K+   +CF   L+               E A+ C                W  +D +
Sbjct  477   PAHKI-DLSCFSGNLKR-----------NENENARNC----------------WRTSDGN  508

Query  1677  SFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFF  1856
             +F +R + +  D  KI +   L  +V  DW +   R D++A R G   Q   A ++  F 
Sbjct  509   NFKVRSKNFCDDKRKIPAGKHLMDLVAVDWFKDSKRIDHVARRKGCAAQ--VAAEKGLFS  566

Query  1857  FVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVK  2036
              VVN+QVPG+T YS+  Y++ K  L    LL+RFV+GDD FRNS+ KLIP + KGSWIV+
Sbjct  567   MVVNVQVPGSTHYSMVFYFVTKE-LVPGSLLQRFVDGDDEFRNSRLKLIPLVPKGSWIVR  625

Query  2037  QSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQ  2216
             QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV+EMAFLVQ
Sbjct  626   QSVGSTPCLLGKAVDCNYIRGPTYLEIDVDIGSSTVANGVLGLVIGVITSLVVEMAFLVQ  685

Query  2217  ADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             A+  EELPE L+G  R++H++ S A+  N
Sbjct  686   ANAPEELPERLIGAVRVSHIELSSAIVPN  714



>ref|XP_009776801.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Nicotiana sylvestris]
Length=724

 Score =   340 bits (872),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 240/748 (32%), Positives = 374/748 (50%), Gaps = 91/748 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  Y   RYF+LE   L  YK  P      P+++  ID    V+D G 
Sbjct  7     EGWMVRYGRRKIGRSYIHMRYFVLETRLLAYYKRKP-QDNVVPIKTLPIDGNCRVEDRGL  65

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N  +  +++   A + +EA  W   + ++ I+  +  +     K+ 
Sbjct  66    KTHHGHMVYVLSVYNKKDKYNRVTMAAFNIQEALIWKEKI-ESIIDQHQESQGTNGNKYV  124

Query  564   PFRLSVSSRMARTDASS--------------TPVDAMTSDVIGPCP--------------  659
              F  +      R  +SS              +  + +    IG  P              
Sbjct  125   SFEYNSVMDNGRNASSSDHESQFSAAEDDDDSHPNLLRRTTIGRGPPESVFDWTKELDSD  184

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  D +   K      A+ AVGV++ + E I
Sbjct  185   LANQNGSNQAFSRKYWRLLQCQNGLRIFEELLDGDLLPKSCS--RAMKAVGVVEASCEDI  242

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ +MS+  +R EWD  F  GS+VE +DGHT I++ +L   W P  +  RDL   RYWRR
Sbjct  243   FELVMSMDATRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPALVWPRDLCYVRYWRR  302

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV---NQGKSSTVKHMLSVDWKS  1145
              DDG+YV+L+ S  H  C P  GYVRA ++SGG  I+P+   N    + V+H++ +D K 
Sbjct  303   NDDGSYVVLFRSREHENCGPLPGYVRAHIESGGFNISPLKPLNGRPRTQVQHLMQIDLKG  362

Query  1146  Y---LRKTTSKSLTIDMLGGIAALREMF-KAKSGSYFPD-PAMNELTIDIQLPVSEKEEI  1310
             +      +  +   + ML  +A LRE F +A   +  P  P M  +T      VS K   
Sbjct  363   WGVGYISSFQQHCLLQMLNSVAGLREYFSQADERTAAPRIPVMVNMT---SASVSSKRSQ  419

Query  1311  KNEVVATERIEEDTTEKYPSACSSIVELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYH  1490
             K +     R    + ++  +A  +   +D+ +DE  D  + +D E          +PE H
Sbjct  420   KFQETLHHRTR--SLDQIRAANRNASMMDEYSDEEEDF-QGADQE------VMPPSPE-H  469

Query  1491  ETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAAD  1670
             E  +  L          ++ + Q +F    G            L +D S      W  +D
Sbjct  470   EMKKTALE---------EEPSDQIDFSIFSG-----------NLRRDDSDKGRNCWRISD  509

Query  1671  TSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPE  1850
              ++F +R + +  D SKI +   L  +V  DW +   R D++A RPG   Q   A ++  
Sbjct  510   GNNFRVRSKNFCYDKSKIAAGKPLMDLVAVDWFKDTKRMDHVAKRPGCAAQ--VAAEKGL  567

Query  1851  FFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWI  2030
             F  V+N+QVPG+T YS+  Y+++K  L    L +RFV+GDD FRNS+ KLIP + KGSWI
Sbjct  568   FSLVINVQVPGSTHYSMVFYFVMKE-LTPGSLFQRFVDGDDEFRNSRMKLIPSVPKGSWI  626

Query  2031  VKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFL  2210
             V+QSVG   C++G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G + +LV++MAFL
Sbjct  627   VRQSVGSTPCILGKAVDCNYIRGPKYLEIDVDIGSSTVANGVLGLVIGVITSLVVDMAFL  686

Query  2211  VQADTEEELPEHLLGTCRLNHLDASKAV  2294
             VQ +T +ELPE L+G  R +H++ S A+
Sbjct  687   VQGNTPDELPEQLIGAVRASHIELSSAI  714



>gb|EEC72292.1| hypothetical protein OsI_05467 [Oryza sativa Indica Group]
Length=777

 Score =   341 bits (875),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 231/723 (32%), Positives = 365/723 (50%), Gaps = 76/723 (11%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+L+   L  YK  P      PL+S +ID    V+D G 
Sbjct  72    EGWMVRYGRRKIGRSFFHTRYFVLDSRLLAYYKKKP-KDNMVPLKSLLIDGNCRVEDRGL  130

Query  384   ENFHRKVFFTFTLCNTSNHDDQL-------------KFGANSPEEAARWIRCLRDAAINP  524
             +  H ++ +   + N    + Q+             + GA   E+A  W + +       
Sbjct  131   KTHHGQMVYVLCVYNKKEKEHQITRYISIYMTRFNSQMGAYDIEDALAWKKNIELIIDQQ  190

Query  525   EKNLRAPAIRKWQP--FRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIF  698
             ++N+ +   + +    F   +  +   +D  S   D        P   +   I NGLRIF
Sbjct  191   QENMTSKNRKAFASMDFDTELGGQFIFSDHDSAAEDEEER----PMLIRRTTIGNGLRIF  246

Query  699   KEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLD  878
             +E  + +   +      A+ AVGV++ T EAIF  +MS+  +R EWD  F  GS+VE +D
Sbjct  247   EELLEFDYLARSCS--RAMRAVGVVEATCEAIFGLVMSMDVTRYEWDCSFRYGSLVEEVD  304

Query  879   GHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRAT  1058
             GHT I++ +L  HW P  +  RDL   RYWRR DDG+YV+L+ S  H  C  Q+GYVRA 
Sbjct  305   GHTAILYHKLQLHWCPMLVWPRDLCYVRYWRRNDDGSYVVLFRSTEHPNCGRQKGYVRAF  364

Query  1059  VKSGGHVITPV---NQGKSSTVKHMLSVDWKSYLRKTTSKSLTIDML---GGIAALREMF  1220
             ++SGG  I+P+   N    + V+H++ +D + +L   +       +L     +A LRE F
Sbjct  365   IESGGFKISPLKCRNGRPRTQVQHLMQIDLRGWLLNYSPSFQYHSLLQIQNCVAGLREYF  424

Query  1221  KAKSGSYFPD--PAMNELTIDIQLPVSEK---EEIKNEVVATERIEEDTTEKYPSACSSI  1385
                  ++     P M  +     +   +K   EE+ ++    +R + D      S    I
Sbjct  425   SQTDETHITPRIPVMENMVDTSAVQKDDKKSTEEVDSKTKTPDRGQAD------SKNMGI  478

Query  1386  VELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQKN  1565
             ++ +   DE + VPEA+ +E  +    R+  P       P+    +CF   L+       
Sbjct  479   IDEETDEDEDYQVPEANIEEDPNKDAKRADEP-------PEKIDLSCFSGILR-------  524

Query  1566  FQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLT  1745
                    +E ++ C                W   D+  F +R + +  D SKI +   L 
Sbjct  525   ----CDADEKSRNC----------------WTVPDSKLFKVRSKNFPHDKSKIPAASYLM  564

Query  1746  QIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKT  1925
             ++   DW +   R DN+  + G + Q   A ++    FV NIQ+PG+T YSL +Y++ K+
Sbjct  565   ELAAIDWFKDSKRMDNVGRQKGCVAQ--VAAEKGMHTFVANIQIPGSTHYSLVMYFVTKS  622

Query  1926  PLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQN  2105
              L +  LL+RF +GDD FRNS+ KLIP + KGSWIV+QSVG   CL+G++++ +Y +G  
Sbjct  623   -LKKGSLLQRFFDGDDEFRNSRLKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCSYVRGAG  681

Query  2106  YLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDAS  2285
             YLE+DVD+GSS VA GV+ LV G +  LV++MAFL+QA+T EELPE ++G  RL H++ +
Sbjct  682   YLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAFLIQANTYEELPEQVIGAARLAHVEPA  741

Query  2286  KAV  2294
              A+
Sbjct  742   AAI  744



>gb|EEE56130.1| hypothetical protein OsJ_05003 [Oryza sativa Japonica Group]
Length=779

 Score =   341 bits (875),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 231/723 (32%), Positives = 365/723 (50%), Gaps = 76/723 (11%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+L+   L  YK  P      PL+S +ID    V+D G 
Sbjct  74    EGWMVRYGRRKIGRSFFHTRYFVLDSRLLAYYKKKP-KDNMVPLKSLLIDGNCRVEDRGL  132

Query  384   ENFHRKVFFTFTLCNTSNHDDQL-------------KFGANSPEEAARWIRCLRDAAINP  524
             +  H ++ +   + N    + Q+             + GA   E+A  W + +       
Sbjct  133   KTHHGQMVYVLCVYNKKEKEHQITRYISIYMTRFNSQMGAYDIEDALAWKKNIELIIDQQ  192

Query  525   EKNLRAPAIRKWQP--FRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIFGIQNGLRIF  698
             ++N+ +   + +    F   +  +   +D  S   D        P   +   I NGLRIF
Sbjct  193   QENMTSKNRKAFASMDFDTELGGQFIFSDHDSAAEDEEER----PMLIRRTTIGNGLRIF  248

Query  699   KEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLD  878
             +E  + +   +      A+ AVGV++ T EAIF  +MS+  +R EWD  F  GS+VE +D
Sbjct  249   EELLEFDYLARSCS--RAMRAVGVVEATCEAIFGLVMSMDVTRYEWDCSFRYGSLVEEVD  306

Query  879   GHTDIIHMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRAT  1058
             GHT I++ +L  HW P  +  RDL   RYWRR DDG+YV+L+ S  H  C  Q+GYVRA 
Sbjct  307   GHTAILYHKLQLHWCPMLVWPRDLCYVRYWRRNDDGSYVVLFRSTEHPNCGRQKGYVRAF  366

Query  1059  VKSGGHVITPV---NQGKSSTVKHMLSVDWKSYLRKTTSKSLTIDML---GGIAALREMF  1220
             ++SGG  I+P+   N    + V+H++ +D + +L   +       +L     +A LRE F
Sbjct  367   IESGGFKISPLKCRNGRPRTQVQHLMQIDLRGWLLNYSPSFQYHSLLQIQNCVAGLREYF  426

Query  1221  KAKSGSYFPD--PAMNELTIDIQLPVSEK---EEIKNEVVATERIEEDTTEKYPSACSSI  1385
                  ++     P M  +     +   +K   EE+ ++    +R + D      S    I
Sbjct  427   SQTDETHITPRIPVMENMVDTSAVQKDDKKSTEEVDSKTKTPDRGQAD------SKNMGI  480

Query  1386  VELDDVADEFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQKN  1565
             ++ +   DE + VPEA+ +E  +    R+  P       P+    +CF   L+       
Sbjct  481   IDEETDEDEDYQVPEANIEEDPNKDAKRADEP-------PEKIDLSCFSGILR-------  526

Query  1566  FQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLT  1745
                    +E ++ C                W   D+  F +R + +  D SKI +   L 
Sbjct  527   ----CDADEKSRNC----------------WTVPDSKLFKVRSKNFPHDKSKIPAASYLM  566

Query  1746  QIVGADWLQSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKT  1925
             ++   DW +   R DN+  + G + Q   A ++    FV NIQ+PG+T YSL +Y++ K+
Sbjct  567   ELAAIDWFKDSKRMDNVGRQKGCVAQ--VAAEKGMHTFVANIQIPGSTHYSLVMYFVTKS  624

Query  1926  PLAENPLLERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQN  2105
              L +  LL+RF +GDD FRNS+ KLIP + KGSWIV+QSVG   CL+G++++ +Y +G  
Sbjct  625   -LKKGSLLQRFFDGDDEFRNSRLKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCSYVRGAG  683

Query  2106  YLELDVDVGSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDAS  2285
             YLE+DVD+GSS VA GV+ LV G +  LV++MAFL+QA+T EELPE ++G  RL H++ +
Sbjct  684   YLEVDVDIGSSAVANGVLGLVFGVVTTLVVDMAFLIQANTYEELPEQVIGAARLAHVEPA  743

Query  2286  KAV  2294
              A+
Sbjct  744   AAI  746



>ref|XP_010661302.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Vitis vinifera]
Length=759

 Score =   341 bits (874),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 239/754 (32%), Positives = 380/754 (50%), Gaps = 100/754 (13%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  YK  P T  + P+++ +ID    V+D G 
Sbjct  39    EGWMVRCGRRKIGRAFIHMRYFVLEPQLLAYYKKKPQTN-QVPIKALVIDGNCRVEDRGM  97

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +   + N  +   Q+   A + +EA  W   + +  I+  +    P    + 
Sbjct  98    KAQHGNMVYVLCVYNKKDKSRQIMMAAFNIQEALMWKEKI-ELVIDQHQGSSIPDGNGYS  156

Query  564   PF--RLSVSSR-------------------------MARTDASSTPVDAM----------  632
              +   L+V S                          + RT   + P +++          
Sbjct  157   SYDNNLAVDSMKIGFHSDQESQYSALEDEDDHGPRLLRRTTFGNGPPESVLDWTGRFDED  216

Query  633   ------TSDVIGPCPWKIFGIQNGLRIFKE--AKDRNPNGKHWDGHPAIMAVGVIDGTSE  788
                   ++ V+    W++   QNGLRIF+E    D  P         A+ A+GV++ + E
Sbjct  217   LLNMNNSNQVVSRKHWRLLQCQNGLRIFEELLEADYLPRS----CSRAMGAIGVVEASCE  272

Query  789   AIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrryw  968
              IF+ +M++  +R EWD  F  GS+VE +DGHT +++ +L  +W P  +  RDL   RYW
Sbjct  273   EIFELVMNMDSTRFEWDCSFQYGSLVEEVDGHTAVLYHRLQLYWYPTFIWPRDLCYVRYW  332

Query  969   rrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPVN--QGK-SSTVKHMLSVDW  1139
             RR DDG+YV+L+ S  H  C PQ G+VRA ++SGG  I+P+    G+  S V+H++ +D 
Sbjct  333   RRNDDGSYVVLFRSREHEHCGPQPGFVRAHIESGGFNISPLKPRHGRPRSKVQHLMQIDL  392

Query  1140  KS----YLRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEE  1307
             K     YL       L + ML G+A LRE F ++S      P +  +       VS ++ 
Sbjct  393   KGWGVGYLSSFKQHCL-LQMLNGVAGLREWF-SQSDERHTAPRIPVMINMTSASVSSQKN  450

Query  1308  IKNEVVATERIEEDTTEKYPSACSSIVELDDVADE--FFDVPEASDDEHSDHGWPRSTTP  1481
              +N+  A +     + ++  SA  + + LD+ +DE   F V E   + +++      T  
Sbjct  451   QENQEPAGKGFP--SLDELHSASRNSMMLDEFSDEDEEFQVAEVEQEAYNE---VEQTAL  505

Query  1482  EYHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWA  1661
             E   T +  LS                              C+   L ++ + +    W 
Sbjct  506   EEDPTDQIDLS------------------------------CFSGNLRRNDNDDGRDCWT  535

Query  1662  AADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQD  1841
              +D ++F +R + +  D SKI +     ++V  DWL+   R D++A RPG  VQ   A +
Sbjct  536   ISDGNNFRVRSKHFFSDKSKIPAGKHTMELVAVDWLKDIKRIDHVARRPGCAVQ--VASE  593

Query  1842  RPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKG  2021
             +  F   +N+QVPG+T YS+ ++Y++   L    LL+ FV+GDD FRNS+ KLIP + KG
Sbjct  594   KGLFSLAINLQVPGSTHYSM-VFYLVTKQLVPGSLLQCFVDGDDEFRNSRLKLIPSVPKG  652

Query  2022  SWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEM  2201
             SWIV+QSVG   CL+G++++  Y +G  YLE+DVD+GSSTVA GV+ LV G +  LV++M
Sbjct  653   SWIVRQSVGSTPCLLGKAVDCTYIRGPKYLEIDVDIGSSTVANGVLGLVCGVITTLVVDM  712

Query  2202  AFLVQADTEEELPEHLLGTCRLNHLDASKAVHTN  2303
             AFLVQA+T EELPE LL   R++H++ S A+  N
Sbjct  713   AFLVQANTAEELPERLLSAVRVSHVELSSAIDPN  746



>ref|XP_002436375.1| hypothetical protein SORBIDRAFT_10g001380 [Sorghum bicolor]
 gb|EER87742.1| hypothetical protein SORBIDRAFT_10g001380 [Sorghum bicolor]
Length=689

 Score =   338 bits (868),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 237/715 (33%), Positives = 370/715 (52%), Gaps = 73/715 (10%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREE--PLRSAIIDSCIHVQDN  377
             EGW+      ++G  +   RYF+L++  L  YK  P   R+   PL+S +ID    V+D 
Sbjct  23    EGWMVRHGRRKIGRSFFHTRYFVLDNRVLAYYKKQP---RDSMIPLKSIVIDGNCRVEDR  79

Query  378   GRENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRK  557
             G +  H ++ +   + N    ++Q+  G  + ++   W R + +  I+ +++      RK
Sbjct  80    GLKTHHGQMIYLLCIYNKKEKENQITMGGYNIQDTLAWKRKI-ELLIDQQQDTTTAKHRK  138

Query  558   W---QPFRLSVSSRMARTDASSTPVDAMTSDVIGPCPWKIF----GIQNGLRIFKEAKDR  716
                   F + +    + +D  S  V     D     P         I NGLRIF+E  + 
Sbjct  139   AFASLDFDIDLGGPFSFSDHDSGQVKPEDEDDEEEEPRPTLLRRTTIGNGLRIFEELVEV  198

Query  717   NPNGKHWDGHPAIMAVGVIDGTSEAIFKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDII  896
                 +      A+ AVGV++ + EAIF  +MS+  +R EWD  F  GS+VE +DGHT I+
Sbjct  199   EYLARSCSR--AMRAVGVVEASCEAIFGLVMSMDVTRYEWDCSFQYGSLVEEVDGHTAIL  256

Query  897   HMQLTTHWLPWGlkrrdlllrrywrrEDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGH  1076
             + +L  +W    +  RDL   RYWRR DDG+YV+L+ S  H  C PQ G+VRA+++SGG 
Sbjct  257   YHRLQLNWCSMLVWPRDLCYLRYWRRNDDGSYVVLFRSTEHQNCGPQPGFVRASIESGGF  316

Query  1077  VITP---VNQGKSSTVKHMLSVDWK----SYLRKTTSKSLTIDMLGGIAALREMFKAKSG  1235
              I+P   +N    + V+H++ +D +    +YL      SL + ML  +A LRE F     
Sbjct  317   KISPLKSLNGRPRTQVQHLMQIDVRGWGVNYLPSFQYHSL-LQMLNCVAGLREYFS----  371

Query  1236  SYFPDPAMNELTIDIQLPVSEKEEIKNEVVATERIEE--DTTEKYPSACSSIVELDDVAD  1409
                     +E+    ++PV         +   + ++E    T++  S    +V+ +   D
Sbjct  372   ------QTDEVHTVPRIPVMHTMFNAVSMKKDQNLQEPDSKTKQTDSKHLDMVDEESEDD  425

Query  1410  EFFDVPEASDDEHSDHGWPRSTTPEYHETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGE  1589
             + +  PEA  +E      P  +  +   +    LS  +  +R  QD              
Sbjct  426   DDYQAPEADLEEE-----PTKSDSDAKSSDPIDLSWFSGTIR--QDT------------N  466

Query  1590  EGAKGCYGCTLPKDASYNMPGSWAAADTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWL  1769
             E ++ C                WA  D+  F +R + +  D SK+ +   L ++V  DW 
Sbjct  467   EKSRNC----------------WAVPDSKIFKVRSKTFPHDKSKVPAGKYLMELVAIDWF  510

Query  1770  QSEIREDNLAARPGSIVQKYAAQDRPEFFFVVNIQVPGATRYSLALYYMLKTPLAENPLL  1949
             +   R D++A R GS  Q   A D+  F F+VNIQ+PG + YSL LY+ +   L +  LL
Sbjct  511   KDTKRMDHVARRKGSAAQ--VAADKGMFTFLVNIQIPGPSHYSLVLYF-VSNSLEKGSLL  567

Query  1950  ERFVNGDDAFRNSKFKLIPYISKGSWIVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDV  2129
             +RF +GDD FRNS+ KLIP + KGSWIV+QSVG   CL+G++++ +Y +G +YLE+DVD+
Sbjct  568   QRFADGDDDFRNSRLKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCSYLRGPDYLEVDVDI  627

Query  2130  GSSTVARGVINLVLGYLNNLVIEMAFLVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             GSS VA GV+ LV G +  LV++MAFL+QA+T +ELPE LLG  RL+H++ S AV
Sbjct  628   GSSAVANGVLGLVFGVVTTLVVDMAFLIQANTYDELPEQLLGAARLSHIEPSAAV  682



>ref|XP_011092598.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Sesamum indicum]
 ref|XP_011092599.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Sesamum indicum]
 ref|XP_011092600.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Sesamum indicum]
Length=730

 Score =   339 bits (870),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 240/749 (32%), Positives = 369/749 (49%), Gaps = 93/749 (12%)
 Frame = +3

Query  204   EGWLYLIRLNRLGLQYCRKRYFILEDNCLKSYKAVPITGREEPLRSAIIDSCIHVQDNGR  383
             EGW+      ++G  +   RYF+LE   L  YK  P      P+++ +ID    V+D G 
Sbjct  9     EGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKKKP-QDNVVPIKTLLIDGNCRVEDRGL  67

Query  384   ENFHRKVFFTFTLCNTSNHDDQLKFGANSPEEAARWIRCLRDAAINPEKNLRAPAIRKWQ  563
             +  H  + +  ++ N      ++   A + +EA  W   + ++ I+  +  +A    K+ 
Sbjct  68    KTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKI-ESVIDQHQESQANG-NKYH  125

Query  564   PFRLSVSSRMARTDASSTPVDAMTS--------------DVIGPCP--------------  659
              F         RT +SS      ++                IG  P              
Sbjct  126   SFEYKSGMDNGRTASSSDHESQFSAAEDEDDARPNLARRTTIGNGPPEAVLDWTKELDSD  185

Query  660   ---------------WKIFGIQNGLRIFKEAKDRNPNGKHWDGHPAIMAVGVIDGTSEAI  794
                            W++   QNGLRIF+E  + +   K      A+ AVGV++ + E I
Sbjct  186   LANQNSSNQAFSRKYWRLLQCQNGLRIFEELLEVDFLPK--SCSRAMKAVGVVEASCEEI  243

Query  795   FKALMSLGPSRSEWDFCFCRGSVVEHLDGHTDIIHMQLTTHWLPWGlkrrdlllrrywrr  974
             F+ +MS+  +R EWD  F  GS+VE +DGHT I++ +L   W P  +  RDL   RYWRR
Sbjct  244   FELVMSMDATRCEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPTFVWPRDLCYVRYWRR  303

Query  975   EDDGTYVILYHSVIHSKCPPQEGYVRATVKSGGHVITPV--NQGKSST-VKHMLSVDWKS  1145
              DDG+YV+L+ S  H  C PQ GYVRA ++SGG  I+P+  + G+  T V+H++ +D K 
Sbjct  304   NDDGSYVVLFRSREHENCGPQPGYVRAHIESGGFNISPLKPHNGRPRTQVQHLMQIDLKG  363

Query  1146  Y---LRKTTSKSLTIDMLGGIAALREMFKAKSGSYFPDPAMNELTIDIQLPVSEKEEIKN  1316
             +      +  +   + ML  +A LRE F             +E T   ++PV     + N
Sbjct  364   WGVGYISSFQQYCLLQMLNSVAGLREYFSQ----------TDERTAAPRIPV-----MVN  408

Query  1317  EVVATERIEEDTTEKYPSACSSIVELDDVADEFFD---VPEASDDEHSDHGWPRSTTPEY  1487
                 +   +     +  S       LD +  E  +   + E SD++    G  +   P  
Sbjct  409   MTSVSGSSKRSHKLQSASVHHRTPSLDQIHAENRNAVLMDEYSDEDEDFQGADQEALPSA  468

Query  1488  HETPRPKLSSAACFVRKLQDLAVQKNFQEIVGGEEGAKGCYGCTLPKDASYNMPGSWAAA  1667
              E    + +    +  + +D   Q +F    G            L +DA       W  +
Sbjct  469   IEVEDKRTA----YEEENKD---QIDFSIFSG-----------NLRRDAHDKARDCWTLS  510

Query  1668  DTSSFLIRGEKYLQDHSKITSKGTLTQIVGADWLQSEIREDNLAARPGSIVQKYAAQDRP  1847
             D ++F +R +++  D SKI +   L  +V  DW +   R D++A R G   Q   A DR 
Sbjct  511   DGNNFRVRSKRFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRRGCAAQ--VASDRG  568

Query  1848  EFFFVVNIQVPGATRYSLALYYMLKTPLAENPLLERFVNGDDAFRNSKFKLIPYISKGSW  2027
              F  V N+QVPG+T YS+  Y++ K  L    LL+RFV+GDD FRNS+ KLIP + KGSW
Sbjct  569   HFSIVFNLQVPGSTHYSMVFYFVSKE-LVPGSLLQRFVDGDDEFRNSRLKLIPSVPKGSW  627

Query  2028  IVKQSVGKKSCLIGQSLEMNYFKGQNYLELDVDVGSSTVARGVINLVLGYLNNLVIEMAF  2207
             IV+QSVG   CL+G++++ NY +G  YLE+DVD+GSSTVA GV+ LV+G +  LV++MAF
Sbjct  628   IVRQSVGSTPCLLGKAVDCNYIRGPKYLEVDVDIGSSTVANGVLGLVIGVITTLVVDMAF  687

Query  2208  LVQADTEEELPEHLLGTCRLNHLDASKAV  2294
             LVQA+T +ELPE L+G  R++H++ S A+
Sbjct  688   LVQANTTDELPERLIGAVRVSHIELSSAI  716



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8107701448552