BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24040_g6_i2 len=1482 path=[28507:0-1009 29516:1010-1010
@12984@!:1011-1303 31621:1304-1386 29809:1387-1481]

Length=1482
                                                                      Score     E

gb|EYU39844.1|  hypothetical protein MIMGU_mgv1a003058mg                545   0.0      
ref|XP_009626094.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    548   0.0      
emb|CDO99749.1|  unnamed protein product                                538   0.0      
ref|XP_009791442.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    538   0.0      
gb|KDP44038.1|  hypothetical protein JCGZ_05505                         537   0.0      
ref|XP_006488076.1|  PREDICTED: uncharacterized protein LOC102622614    537   1e-180   
ref|XP_002529938.1|  conserved hypothetical protein                     534   4e-180   Ricinus communis
gb|KDO73328.1|  hypothetical protein CISIN_1g004508mg                   533   5e-180   
ref|XP_006424553.1|  hypothetical protein CICLE_v10027876mg             535   8e-180   
ref|XP_011076971.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    533   2e-179   
gb|KDO73324.1|  hypothetical protein CISIN_1g004508mg                   534   2e-179   
ref|XP_011076970.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    533   2e-179   
gb|KDO73323.1|  hypothetical protein CISIN_1g004508mg                   533   3e-179   
ref|XP_010651179.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    533   3e-179   
gb|KDO73326.1|  hypothetical protein CISIN_1g004508mg                   533   3e-179   
gb|KDO73327.1|  hypothetical protein CISIN_1g004508mg                   533   3e-179   
gb|KHG27546.1|  PCTP-like protein                                       533   4e-179   
ref|XP_011084323.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    531   1e-178   
ref|XP_011044395.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    529   1e-178   
ref|XP_007016767.1|  Pleckstrin (PH) and lipid-binding START doma...    524   9e-178   
gb|KCW65419.1|  hypothetical protein EUGRSUZ_G02842                     528   2e-177   
ref|XP_010067309.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    528   2e-177   
ref|XP_011044394.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    529   3e-177   
ref|XP_007016769.1|  Pleckstrin and lipid-binding START domains-c...    525   4e-177   
ref|XP_006409857.1|  hypothetical protein EUTSA_v10016308mg             526   1e-176   
ref|XP_006340183.1|  PREDICTED: uncharacterized protein LOC102585665    526   2e-176   
ref|XP_009621798.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    521   4e-176   
ref|XP_007016768.1|  Pleckstrin (PH) and lipid-binding START doma...    525   5e-176   
ref|XP_007016766.1|  Pleckstrin (PH) and lipid-binding START doma...    525   1e-175   
gb|KFK32308.1|  hypothetical protein AALP_AA6G225400                    523   5e-175   
gb|KFK32307.1|  hypothetical protein AALP_AA6G225400                    523   5e-175   
ref|XP_009621797.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    522   7e-175   
gb|KCW85749.1|  hypothetical protein EUGRSUZ_B02509                     521   8e-175   
ref|XP_007206425.1|  hypothetical protein PRUPE_ppa001967mg             521   1e-174   
gb|EYU36177.1|  hypothetical protein MIMGU_mgv1a003017mg                517   1e-174   
emb|CDY04553.1|  BnaA07g13790D                                          521   2e-174   
ref|XP_008245285.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    521   2e-174   
ref|XP_007150192.1|  hypothetical protein PHAVU_005G134300g             520   3e-174   
ref|XP_004487249.1|  PREDICTED: uncharacterized protein LOC101507747    520   4e-174   
ref|XP_004251144.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    520   5e-174   
ref|XP_006592703.1|  PREDICTED: uncharacterized protein LOC100779206    520   7e-174   
gb|KHG05026.1|  PCTP-like protein                                       519   1e-173   
emb|CDP07099.1|  unnamed protein product                                519   1e-173   
ref|XP_002314279.1|  pleckstrin homology domain-containing family...    517   1e-173   Populus trichocarpa [western balsam poplar]
ref|XP_010264664.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    519   1e-173   
emb|CDX71361.1|  BnaC04g15960D                                          518   2e-173   
ref|XP_010043759.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    521   2e-173   
ref|XP_010557337.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    517   7e-173   
ref|XP_010557338.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    517   7e-173   
gb|KEH39335.1|  pleckstrin-like (PH) and lipid-binding START doma...    514   1e-172   
ref|XP_003541992.1|  PREDICTED: uncharacterized protein LOC100812931    516   2e-172   
gb|KEH39334.1|  pleckstrin-like (PH) and lipid-binding START doma...    514   3e-172   
ref|XP_009103673.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    515   3e-172   
ref|XP_010089970.1|  hypothetical protein L484_008048                   516   4e-172   
ref|XP_011089926.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    514   8e-172   
gb|AES67511.2|  pleckstrin-like (PH) and lipid-binding START doma...    514   9e-172   
ref|XP_006354684.1|  PREDICTED: uncharacterized protein LOC102602856    512   3e-171   
emb|CBI31451.3|  unnamed protein product                                512   3e-171   
ref|NP_180399.2|  pleckstrin homology (PH) and lipid-binding STAR...    513   4e-171   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002274053.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    512   6e-171   Vitis vinifera
ref|XP_002880934.1|  hypothetical protein ARALYDRAFT_901677             512   8e-171   
ref|XP_003597260.1|  hypothetical protein MTR_2g094620                  513   1e-170   
ref|XP_006293758.1|  hypothetical protein CARUB_v10022718mg             511   1e-170   
gb|KDO73325.1|  hypothetical protein CISIN_1g004508mg                   511   1e-170   
ref|XP_010521753.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    511   2e-170   
ref|XP_007220231.1|  hypothetical protein PRUPE_ppa002022mg             510   3e-170   
ref|XP_010521754.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    510   3e-170   
ref|XP_010510641.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    509   4e-170   
ref|XP_010319624.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    508   6e-170   
ref|XP_010470101.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    509   9e-170   
gb|EYU39609.1|  hypothetical protein MIMGU_mgv1a002168mg                507   2e-169   
gb|KHN21511.1|  hypothetical protein glysoja_021091                     508   4e-169   
ref|XP_008233315.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    507   5e-169   
ref|XP_010906508.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    505   8e-169   
ref|XP_010414549.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    505   2e-168   
ref|XP_002316372.1|  pleckstrin homology domain-containing family...    505   2e-168   Populus trichocarpa [western balsam poplar]
ref|XP_008807464.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    502   4e-168   
gb|KDP44376.1|  hypothetical protein JCGZ_20056                         499   5e-168   
ref|XP_002311087.2|  pleckstrin homology domain-containing family...    504   9e-168   Populus trichocarpa [western balsam poplar]
ref|XP_004291708.1|  PREDICTED: uncharacterized protein LOC101295593    504   9e-168   
ref|XP_010322400.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    503   1e-167   
ref|XP_010906506.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    503   2e-167   
ref|XP_011031732.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    503   2e-167   
ref|XP_011031731.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    502   5e-167   
ref|XP_008807473.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    502   6e-167   
ref|XP_006365757.1|  PREDICTED: uncharacterized protein LOC102579740    501   9e-167   
ref|XP_010253703.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    500   2e-166   
ref|XP_009770311.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    500   3e-166   
ref|XP_011041016.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    494   7e-166   
ref|XP_004982841.1|  PREDICTED: uncharacterized protein LOC101786041    497   9e-165   
ref|XP_004496270.1|  PREDICTED: uncharacterized protein LOC101513040    495   1e-164   
ref|XP_009589980.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    495   1e-164   
ref|XP_011041015.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    495   2e-164   
dbj|BAK01993.1|  predicted protein                                      496   3e-164   
ref|XP_007009855.1|  Pleckstrin (PH) and lipid-binding START doma...    493   1e-163   
ref|XP_006436438.1|  hypothetical protein CICLE_v10030795mg             493   2e-163   
ref|XP_010234829.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    493   3e-163   
ref|XP_004149918.1|  PREDICTED: uncharacterized protein LOC101207368    492   4e-163   
ref|XP_009396972.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    492   5e-163   
ref|XP_006846792.1|  hypothetical protein AMTR_s00148p00054510          493   7e-163   
ref|XP_004308785.1|  PREDICTED: uncharacterized protein LOC101295576    491   9e-163   
ref|XP_010234828.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    493   9e-163   
ref|XP_008678703.1|  PREDICTED: uncharacterized protein LOC100192...    491   2e-162   
ref|XP_008678750.1|  PREDICTED: uncharacterized protein LOC100192...    491   2e-162   
ref|XP_010555822.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    489   3e-162   
gb|AAK21344.1|AC024594_8  unknown protein                               491   3e-162   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009344767.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    489   4e-162   
ref|XP_009400818.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    489   4e-162   
ref|XP_009396971.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    492   6e-162   
ref|XP_008791555.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    489   9e-162   
ref|XP_010920451.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    486   2e-161   
ref|XP_008791557.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    487   4e-161   
ref|XP_010920450.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    486   7e-161   
ref|XP_010920447.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    486   8e-161   
ref|XP_010920444.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    486   1e-160   
ref|XP_010920449.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    486   1e-160   
ref|XP_002876269.1|  hypothetical protein ARALYDRAFT_485890             485   2e-160   
ref|XP_010920448.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    484   4e-160   
ref|XP_008367183.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    484   5e-160   
ref|XP_007143713.1|  hypothetical protein PHAVU_007G095400g             483   6e-160   
ref|XP_008367239.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    484   6e-160   
ref|XP_006292259.1|  hypothetical protein CARUB_v10018468mg             483   1e-159   
ref|XP_008456489.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    483   1e-159   
ref|NP_191040.2|  Pleckstrin homology (PH) and lipid-binding STAR...    481   6e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006662447.1|  PREDICTED: uncharacterized protein LOC102718305    481   6e-159   
ref|XP_008385406.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    475   8e-159   
ref|XP_006403534.1|  hypothetical protein EUTSA_v10010151mg             479   4e-158   
gb|KHN17142.1|  hypothetical protein glysoja_011616                     478   6e-158   
ref|XP_006589424.1|  PREDICTED: uncharacterized protein LOC100802...    478   8e-158   
ref|XP_006589423.1|  PREDICTED: uncharacterized protein LOC100802...    478   8e-158   
dbj|BAC42639.1|  unknown protein                                        478   8e-158   Arabidopsis thaliana [mouse-ear cress]
emb|CDX67608.1|  BnaA07g16480D                                          478   1e-157   
ref|XP_009103932.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    478   1e-157   
ref|XP_010516021.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    476   6e-157   
ref|XP_008377573.1|  PREDICTED: LOW QUALITY PROTEIN: protein ENHA...    474   2e-156   
ref|XP_010427199.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    474   2e-156   
emb|CDX73448.1|  BnaC08g25550D                                          473   6e-156   
ref|XP_009116156.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    472   2e-155   
emb|CDY07523.1|  BnaC06g15410D                                          471   5e-155   
emb|CDX78263.1|  BnaA09g34580D                                          470   9e-155   
ref|XP_003591887.1|  hypothetical protein MTR_1g094890                  467   9e-154   
ref|XP_010504305.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    468   1e-153   
emb|CDY02892.1|  BnaC04g25940D                                          466   5e-153   
ref|XP_009139208.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    464   1e-152   
ref|XP_006599998.1|  PREDICTED: uncharacterized protein LOC100794533    459   1e-150   
gb|KHN32782.1|  hypothetical protein glysoja_024141                     452   8e-149   
ref|XP_010689527.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    448   1e-146   
ref|XP_010689526.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    449   1e-146   
ref|XP_010689525.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    449   2e-146   
ref|XP_002534384.1|  conserved hypothetical protein                     443   3e-145   Ricinus communis
gb|KHG25367.1|  Homeobox-leucine zipper ATHB-14 -like protein           440   8e-143   
ref|XP_010264665.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    432   2e-141   
ref|XP_009344768.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    435   2e-141   
ref|XP_008791558.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    433   1e-140   
emb|CAB77600.1|  putative protein                                       429   7e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010906507.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    427   1e-138   
ref|XP_010906510.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    423   2e-137   
ref|XP_008456490.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    415   7e-134   
ref|XP_009421353.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    416   9e-134   
ref|XP_009400820.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    404   3e-130   
gb|EMS46709.1|  hypothetical protein TRIUR3_29071                       400   1e-127   
gb|EPS61698.1|  hypothetical protein M569_13096                         381   6e-124   
ref|XP_002467069.1|  hypothetical protein SORBIDRAFT_01g019140          363   2e-113   Sorghum bicolor [broomcorn]
ref|XP_010092610.1|  hypothetical protein L484_002656                   353   2e-110   
gb|AAD20693.1|  unknown protein                                         340   6e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004173884.1|  PREDICTED: uncharacterized LOC101207368            337   1e-107   
gb|AAP54296.2|  pleckstriny domain-containing protein, putative, ...    325   1e-102   Oryza sativa Japonica Group [Japonica rice]
dbj|BAE98675.1|  hypothetical protein                                   325   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001759959.1|  predicted protein                                  320   7e-97    
ref|XP_002961222.1|  hypothetical protein SELMODRAFT_74418              312   4e-94    
gb|EMT33197.1|  hypothetical protein F775_21642                         308   2e-93    
ref|XP_002969204.1|  hypothetical protein SELMODRAFT_146206             302   1e-90    
ref|XP_006415101.1|  hypothetical protein EUTSA_v10008155mg             285   3e-88    
ref|XP_001755631.1|  predicted protein                                  296   3e-88    
ref|XP_001764317.1|  predicted protein                                  296   4e-88    
ref|XP_001767644.1|  predicted protein                                  296   7e-88    
gb|EEC67181.1|  hypothetical protein OsI_34049                          283   6e-86    Oryza sativa Indica Group [Indian rice]
gb|EEE51149.1|  hypothetical protein OsJ_31910                          282   2e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001782866.1|  predicted protein                                  283   5e-84    
ref|XP_009345389.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    268   1e-80    
ref|NP_001131246.1|  hypothetical protein                               261   2e-79    Zea mays [maize]
ref|XP_008362690.1|  PREDICTED: LOW QUALITY PROTEIN: protein ENHA...    264   4e-78    
gb|KDO44678.1|  hypothetical protein CISIN_1g0045761mg                  255   2e-77    
emb|CDY64695.1|  BnaA04g27680D                                          251   4e-75    
gb|KDO44676.1|  hypothetical protein CISIN_1g0045762mg                  253   3e-74    
gb|AAM98241.1|  unknown protein                                         243   2e-72    Arabidopsis thaliana [mouse-ear cress]
emb|CDY69875.1|  BnaAnng31850D                                          243   1e-70    
dbj|BAD94447.1|  hypothetical protein                                   221   9e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008349774.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    233   4e-66    
ref|XP_007151874.1|  hypothetical protein PHAVU_004G082900g             208   5e-58    
ref|XP_009396700.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    198   1e-55    
ref|XP_009396597.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    196   1e-54    
ref|XP_010278841.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    193   3e-54    
ref|XP_011092598.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    192   7e-54    
ref|XP_010906232.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    192   4e-53    
ref|XP_010906231.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    192   5e-53    
ref|XP_009776802.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    189   8e-53    
ref|XP_009776801.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    189   9e-53    
emb|CAN74297.1|  hypothetical protein VITISV_018694                     170   1e-52    Vitis vinifera
ref|XP_008813630.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    191   1e-52    
ref|XP_010661303.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    190   2e-52    
ref|XP_010661302.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    190   2e-52    
ref|XP_009401233.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    189   2e-52    
emb|CDP11764.1|  unnamed protein product                                184   3e-52    
ref|XP_010918068.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    189   5e-52    
ref|XP_008802965.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    188   6e-52    
ref|XP_008802967.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    188   6e-52    
ref|XP_010918070.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    188   6e-52    
ref|XP_008802966.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    188   6e-52    
ref|XP_009601910.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    185   1e-51    
ref|XP_009601911.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    185   1e-51    
ref|XP_002519855.1|  lipid binding protein, putative                    184   2e-51    Ricinus communis
ref|XP_009601912.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    185   2e-51    
ref|XP_009384748.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    181   4e-50    
ref|XP_003517072.1|  PREDICTED: uncharacterized protein LOC100806...    179   5e-50    
gb|EPS70366.1|  hypothetical protein M569_04394                         181   6e-50    
ref|XP_006587626.1|  PREDICTED: uncharacterized protein LOC100808...    179   6e-50    
ref|XP_004173695.1|  PREDICTED: uncharacterized protein LOC101227255    162   1e-49    
gb|AES95593.2|  pleckstrin-like (PH) and lipid-binding START doma...    177   2e-49    
ref|XP_003612635.1|  Kinase-START                                       177   2e-49    
ref|XP_007158193.1|  hypothetical protein PHAVU_002G132000g             177   3e-49    
ref|XP_010661304.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    190   3e-49    
ref|XP_009384749.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    178   4e-49    
ref|XP_009384747.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    177   5e-49    
ref|XP_006587627.1|  PREDICTED: uncharacterized protein LOC100808...    175   7e-49    
ref|XP_006573467.1|  PREDICTED: uncharacterized protein LOC100806...    175   8e-49    
ref|XP_006587625.1|  PREDICTED: uncharacterized protein LOC100808...    175   9e-49    
ref|XP_010054083.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    175   1e-48    
ref|XP_010054081.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    175   1e-48    
gb|KCW78456.1|  hypothetical protein EUGRSUZ_D026091                    175   2e-48    
gb|EYU29082.1|  hypothetical protein MIMGU_mgv1a002092mg                171   2e-48    
gb|KDO44679.1|  hypothetical protein CISIN_1g0045761mg                  175   3e-48    
ref|XP_002463332.1|  hypothetical protein SORBIDRAFT_02g041955          178   1e-47    Sorghum bicolor [broomcorn]
ref|XP_010918069.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    166   3e-45    
gb|KDP32754.1|  hypothetical protein JCGZ_12046                         167   6e-44    
ref|XP_010687748.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    164   2e-43    
ref|XP_010687749.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    164   2e-43    
ref|XP_001780427.1|  predicted protein                                  157   4e-43    
ref|XP_003549700.1|  PREDICTED: uncharacterized protein LOC100780...    160   6e-43    
gb|KHN18589.1|  hypothetical protein glysoja_007002                     159   1e-42    
ref|XP_003542620.1|  PREDICTED: uncharacterized protein LOC100801...    155   2e-41    
ref|XP_004242555.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    155   3e-41    
gb|KHN22102.1|  hypothetical protein glysoja_033416                     154   3e-41    
ref|XP_006343695.1|  PREDICTED: uncharacterized protein LOC102603249    152   2e-40    
ref|XP_001768121.1|  predicted protein                                  152   8e-40    
emb|CBI38216.3|  unnamed protein product                                147   1e-39    
ref|XP_010049876.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    148   2e-39    
ref|XP_010049875.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    148   2e-39    
gb|KCW82684.1|  hypothetical protein EUGRSUZ_C040621                    148   3e-39    
ref|XP_003574547.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    160   5e-39    
ref|XP_001784821.1|  predicted protein                                  148   9e-39    
emb|CDP10522.1|  unnamed protein product                                149   1e-38    
ref|XP_001767276.1|  predicted protein                                  145   2e-38    
ref|XP_011084030.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    146   3e-38    
ref|XP_011084029.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    146   3e-38    
ref|XP_009771482.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    146   4e-38    
gb|EPS71915.1|  hypothetical protein M569_02843                         145   5e-38    
ref|XP_010929462.1|  PREDICTED: LOW QUALITY PROTEIN: protein ENHA...    147   8e-38    
gb|KEH37839.1|  pleckstrin-like (PH) and lipid-binding START doma...    141   2e-37    
ref|XP_006848773.1|  hypothetical protein AMTR_s00026p00072550          144   2e-37    
ref|XP_010092609.1|  hypothetical protein L484_002655                   120   4e-37    
ref|NP_001061897.1|  Os08g0439100                                       155   5e-37    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009623347.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    142   5e-37    
ref|XP_010656555.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    142   7e-37    
ref|XP_004508389.1|  PREDICTED: uncharacterized protein LOC101503113    139   8e-37    
ref|XP_002325156.2|  hypothetical protein POPTR_0018s12110g             142   9e-37    Populus trichocarpa [western balsam poplar]
gb|EEE68762.1|  hypothetical protein OsJ_27461                          154   9e-37    Oryza sativa Japonica Group [Japonica rice]
gb|EEC83635.1|  hypothetical protein OsI_29366                          153   3e-36    Oryza sativa Indica Group [Indian rice]
gb|KEH32165.1|  pleckstrin-like (PH) and lipid-binding START doma...    137   3e-36    
ref|XP_011078691.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    139   7e-36    
ref|XP_011017957.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    139   7e-36    
ref|XP_004973540.1|  PREDICTED: uncharacterized protein LOC101779643    151   9e-36    
ref|XP_009760467.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    138   1e-35    
ref|XP_007204631.1|  hypothetical protein PRUPE_ppa002030mg             135   1e-35    
ref|XP_004488257.1|  PREDICTED: uncharacterized protein LOC101499...    134   2e-35    
ref|XP_002523536.1|  lipid binding protein, putative                    137   2e-35    Ricinus communis
ref|XP_004139274.1|  PREDICTED: uncharacterized protein LOC101212304    137   3e-35    
ref|XP_008242887.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    133   7e-35    
ref|XP_010245531.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    135   7e-35    
ref|XP_008456782.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    135   7e-35    
emb|CDY41766.1|  BnaA08g07210D                                          134   8e-35    
ref|XP_004287222.1|  PREDICTED: uncharacterized protein LOC101292535    135   9e-35    
emb|CDY58454.1|  BnaC08g47190D                                          134   9e-35    
ref|XP_010265691.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    135   9e-35    
ref|XP_009108058.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    134   1e-34    
ref|XP_010265692.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    135   1e-34    
ref|XP_008806307.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    134   1e-34    
ref|XP_002444409.1|  hypothetical protein SORBIDRAFT_07g021510          148   1e-34    
ref|XP_010245529.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    135   1e-34    
ref|XP_010245530.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    135   2e-34    
gb|KHN41720.1|  hypothetical protein glysoja_003460                     132   2e-34    
ref|XP_007012015.1|  Uncharacterized protein isoform 2                  131   3e-34    
ref|XP_007012014.1|  Uncharacterized protein isoform 1                  131   3e-34    
gb|KDP38628.1|  hypothetical protein JCGZ_03981                         132   1e-33    
ref|XP_009108057.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    130   1e-33    
gb|EYU31802.1|  hypothetical protein MIMGU_mgv1a023986mg                132   1e-33    
ref|XP_010450356.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    129   4e-33    
gb|EMT20912.1|  hypothetical protein F775_52417                         125   5e-33    
ref|XP_009372765.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    127   6e-33    
ref|XP_008348097.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    129   6e-33    
ref|XP_010434468.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    121   1e-32    
ref|NP_001190769.1|  protein ENHANCED DISEASE RESISTANCE 2              121   1e-32    
ref|XP_010435404.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    127   2e-32    
ref|XP_010434467.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    120   2e-32    
gb|KFK28575.1|  hypothetical protein AALP_AA7G014500                    120   2e-32    
ref|XP_010439773.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    120   2e-32    
ref|XP_010449418.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    120   3e-32    
ref|XP_010434469.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    120   3e-32    
ref|XP_010439772.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    120   3e-32    
ref|NP_001119010.1|  protein ENHANCED DISEASE RESISTANCE 2              120   3e-32    
ref|XP_010439774.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    120   3e-32    
ref|NP_193639.2|  protein ENHANCED DISEASE RESISTANCE 2                 120   3e-32    
ref|XP_002867959.1|  hypothetical protein ARALYDRAFT_492951             119   3e-32    
ref|XP_006661824.1|  PREDICTED: uncharacterized protein LOC102710...    117   4e-32    
ref|XP_006342495.1|  PREDICTED: uncharacterized protein LOC102592298    119   5e-32    
dbj|BAD95241.1|  hypothetical protein                                   120   5e-32    
ref|XP_003557176.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    122   5e-32    
ref|XP_009785635.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    119   5e-32    
ref|XP_009785636.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    119   6e-32    
ref|XP_010441699.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    118   8e-32    
ref|XP_010481558.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    118   1e-31    
ref|XP_010441700.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    118   1e-31    
emb|CDX99399.1|  BnaC01g11530D                                          117   1e-31    
ref|XP_006279863.1|  hypothetical protein CARUB_v10028530mg             117   1e-31    
ref|XP_009136985.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    117   1e-31    
ref|XP_009136984.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    117   1e-31    
ref|XP_006398234.1|  hypothetical protein EUTSA_v10000794mg             117   1e-31    
ref|XP_010494667.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    117   1e-31    
ref|XP_010481559.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    117   2e-31    
ref|XP_006398233.1|  hypothetical protein EUTSA_v10000794mg             117   2e-31    
ref|XP_009136986.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    117   2e-31    
emb|CDY01578.1|  BnaC07g35680D                                          117   2e-31    
ref|XP_010494670.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    117   2e-31    
ref|XP_009132490.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    117   2e-31    
gb|ABB47745.1|  pleckstriny domain-containing protein, putative, ...    115   3e-31    
ref|XP_006361253.1|  PREDICTED: uncharacterized protein LOC102580683    116   3e-31    
ref|XP_002865237.1|  hypothetical protein ARALYDRAFT_494427             116   3e-31    
gb|EEC67085.1|  hypothetical protein OsI_33873                          115   3e-31    
ref|XP_004983507.1|  PREDICTED: uncharacterized protein LOC101785910    115   3e-31    
gb|EEE51070.1|  hypothetical protein OsJ_31765                          115   3e-31    
ref|XP_010518854.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    116   3e-31    
ref|XP_002436375.1|  hypothetical protein SORBIDRAFT_10g001380          117   3e-31    
ref|NP_199369.2|  ENHANCED DISEASE RESISTANCE 2-like protein            116   3e-31    
ref|XP_006414020.1|  hypothetical protein EUTSA_v10024539mg             116   4e-31    
ref|XP_010234787.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    114   4e-31    
emb|CDX98603.1|  BnaA03g43880D                                          115   5e-31    
ref|XP_010529240.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    115   8e-31    
ref|XP_006854205.1|  hypothetical protein AMTR_s00048p00211630          115   8e-31    
ref|XP_009630333.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    114   1e-30    
ref|XP_009630335.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    114   1e-30    
ref|XP_006285256.1|  hypothetical protein CARUB_v10006627mg             114   1e-30    
ref|XP_010677461.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    114   1e-30    
ref|XP_010677463.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    114   1e-30    
ref|XP_004253088.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    116   1e-30    
ref|XP_010265693.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    135   1e-30    
ref|XP_009114402.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    114   2e-30    
emb|CDY13045.1|  BnaA09g17720D                                          114   2e-30    
gb|ACN31350.1|  unknown                                                 112   2e-30    
ref|XP_010314821.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    116   2e-30    
ref|XP_002467413.1|  hypothetical protein SORBIDRAFT_01g027640          112   2e-30    
ref|NP_001170545.1|  uncharacterized protein LOC100384563               114   3e-30    
gb|AFW69055.1|  hypothetical protein ZEAMMB73_502219                    112   3e-30    
ref|XP_008648200.1|  PREDICTED: uncharacterized protein LOC100384...    114   3e-30    
gb|EEE64990.1|  hypothetical protein OsJ_19910                          115   4e-30    
gb|EEC79883.1|  hypothetical protein OsI_21390                          115   4e-30    
ref|XP_010940820.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    119   4e-30    
emb|CDY23114.1|  BnaC09g18680D                                          112   5e-30    
ref|XP_006368312.1|  pleckstrin homology domain-containing family...    112   7e-30    
ref|XP_010533084.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    117   7e-30    
ref|XP_011018434.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    111   8e-30    
ref|XP_010533085.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    117   8e-30    
ref|XP_006432592.1|  hypothetical protein CICLE_v10000699mg             132   9e-30    
ref|XP_009605739.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    111   1e-29    
ref|XP_009605741.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    111   1e-29    
ref|XP_008777360.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    117   1e-29    
ref|XP_010110435.1|  hypothetical protein L484_022841                   110   1e-29    
ref|XP_008777364.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    117   1e-29    
ref|XP_010056185.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    108   1e-29    
ref|XP_006473955.1|  PREDICTED: uncharacterized protein LOC102620805    118   1e-29    
ref|XP_009605742.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    111   1e-29    
ref|XP_009365730.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    110   1e-29    
ref|XP_008373446.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    110   1e-29    
ref|XP_008777361.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    116   1e-29    
ref|XP_009365728.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    110   1e-29    
gb|KDP29586.1|  hypothetical protein JCGZ_19352                         111   2e-29    
ref|XP_009605745.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    111   2e-29    
ref|XP_011074904.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    108   2e-29    
ref|XP_009605743.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    111   2e-29    
ref|XP_004964369.1|  PREDICTED: uncharacterized protein LOC101766909    112   2e-29    
ref|XP_009605744.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    111   3e-29    
ref|XP_008238112.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    109   3e-29    
ref|XP_008238111.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    109   4e-29    
ref|XP_007209042.1|  hypothetical protein PRUPE_ppa002681mg             110   4e-29    
ref|XP_008680038.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    112   4e-29    
ref|XP_002453121.1|  hypothetical protein SORBIDRAFT_04g000380          109   5e-29    
ref|XP_008680039.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    112   5e-29    
ref|XP_006453685.1|  hypothetical protein CICLE_v10007533mg             115   7e-29    
emb|CBI37373.3|  unnamed protein product                                108   8e-29    
ref|XP_010664750.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    108   1e-28    
gb|KDO59374.1|  hypothetical protein CISIN_1g0042401mg                  115   1e-28    
gb|EEE56130.1|  hypothetical protein OsJ_05003                          110   1e-28    
gb|EEC72292.1|  hypothetical protein OsI_05467                          110   1e-28    
ref|XP_010242519.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    107   1e-28    
ref|XP_010242523.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    107   1e-28    
ref|NP_001045600.1|  Os02g0102800                                       110   1e-28    
ref|XP_009384750.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    109   1e-28    
ref|XP_009384752.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    109   2e-28    
gb|KHG05863.1|  StAR-related lipid transfer 5                           107   2e-28    
gb|KDO59377.1|  hypothetical protein CISIN_1g0042401mg                  115   2e-28    
ref|XP_009384751.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    108   2e-28    
ref|XP_007040789.1|  Enhanced disease resistance 2 isoform 1            107   2e-28    
ref|XP_002304367.1|  pleckstrin homology domain-containing family...    107   2e-28    
ref|XP_003570763.2|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    111   2e-28    
ref|XP_006646762.1|  PREDICTED: uncharacterized protein LOC102699927    109   2e-28    
ref|NP_001142021.1|  uncharacterized protein LOC100274175               106   3e-28    
emb|CAH10188.1|  START domain-containing protein                        108   3e-28    
ref|XP_006471537.1|  PREDICTED: uncharacterized protein LOC102619961    107   3e-28    
ref|XP_008806306.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    113   3e-28    
ref|XP_006380218.1|  pleckstrin homology domain-containing family...    104   3e-28    
ref|XP_007040790.1|  Enhanced disease resistance 2 isoform 2            107   4e-28    
ref|XP_002993106.1|  hypothetical protein SELMODRAFT_431226             110   4e-28    
ref|XP_008448607.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    105   4e-28    
emb|CAH10187.1|  START domain-containing protein                        108   5e-28    
ref|XP_004146115.1|  PREDICTED: uncharacterized protein LOC101209463    105   6e-28    
ref|XP_004300154.1|  PREDICTED: uncharacterized protein LOC101306049    105   7e-28    
gb|KGN55699.1|  hypothetical protein Csa_3G006610                       105   7e-28    
gb|AGV54816.1|  kinase start                                            105   8e-28    
gb|EYU23271.1|  hypothetical protein MIMGU_mgv1a001973mg                104   1e-27    
ref|XP_009417437.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    111   1e-27    
ref|XP_004958589.1|  PREDICTED: uncharacterized protein LOC101775477    107   1e-27    
gb|KHG18655.1|  PCTP-like protein                                       109   1e-27    
ref|XP_004307095.1|  PREDICTED: uncharacterized protein LOC101301...    112   1e-27    
ref|XP_004512421.1|  PREDICTED: uncharacterized protein LOC101490...    104   1e-27    
gb|EYU24297.1|  hypothetical protein MIMGU_mgv1a010003mg                104   1e-27    
ref|XP_004512420.1|  PREDICTED: uncharacterized protein LOC101490...    104   1e-27    
ref|XP_002975423.1|  hypothetical protein SELMODRAFT_415477             110   1e-27    
ref|XP_009358498.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    108   1e-27    
ref|XP_004307096.1|  PREDICTED: uncharacterized protein LOC101301...    111   1e-27    
ref|XP_009338430.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    108   1e-27    
ref|XP_009358500.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    108   1e-27    
ref|XP_009338432.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    108   1e-27    
ref|XP_009358499.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    108   1e-27    
ref|XP_009338431.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    108   2e-27    
ref|XP_008231688.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    111   2e-27    
ref|XP_008231686.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    111   2e-27    
ref|XP_002960563.1|  hypothetical protein SELMODRAFT_74959              110   2e-27    
ref|XP_002969451.1|  hypothetical protein SELMODRAFT_91721              109   2e-27    
ref|XP_008645141.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    107   3e-27    
gb|AFW69707.1|  hypothetical protein ZEAMMB73_145444                    107   3e-27    
ref|XP_008645142.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    107   4e-27    
ref|XP_008361102.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    107   4e-27    
ref|XP_008361103.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    107   4e-27    
emb|CCH47229.1|  hypothetical protein                                   103   4e-27    
ref|XP_008337206.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    107   1e-26    
ref|XP_011028070.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    101   1e-26    
ref|XP_010435406.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    107   1e-26    
ref|XP_010435403.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    107   1e-26    
ref|XP_006659442.1|  PREDICTED: uncharacterized protein LOC102718013    123   1e-26    
gb|EMT14669.1|  hypothetical protein F775_00627                         106   2e-26    
ref|XP_003056584.1|  predicted protein                                  112   2e-26    
gb|EMS54329.1|  hypothetical protein TRIUR3_20085                     98.6    3e-26    
ref|XP_001771663.1|  predicted protein                                  103   4e-26    
ref|XP_007138432.1|  hypothetical protein PHAVU_009G208400g             105   5e-26    
ref|XP_007138431.1|  hypothetical protein PHAVU_009G208400g             105   5e-26    
ref|XP_004488258.1|  PREDICTED: uncharacterized protein LOC101499...    104   6e-26    
ref|XP_006285758.1|  hypothetical protein CARUB_v10007232mg             105   6e-26    
ref|XP_008337207.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    104   6e-26    
ref|XP_002868410.1|  hypothetical protein ARALYDRAFT_330172             104   7e-26    
ref|XP_006403058.1|  hypothetical protein EUTSA_v10003438mg             104   7e-26    
ref|XP_006403059.1|  hypothetical protein EUTSA_v10003438mg             104   7e-26    
gb|KDO59378.1|  hypothetical protein CISIN_1g0042401mg                  117   7e-26    
ref|XP_006403057.1|  hypothetical protein EUTSA_v10003438mg             104   7e-26    
gb|EPS60685.1|  hypothetical protein M569_14116                         115   9e-26    
ref|XP_006598487.1|  PREDICTED: uncharacterized protein LOC100786048    105   1e-25    
ref|XP_001783766.1|  predicted protein                                  102   1e-25    
ref|NP_001119310.1|  uncharacterized protein                            103   1e-25    
ref|NP_568526.1|  uncharacterized protein                               103   1e-25    
dbj|BAA98203.1|  unnamed protein product                                103   1e-25    
ref|NP_001154747.1|  uncharacterized protein                            103   1e-25    
ref|XP_006403060.1|  hypothetical protein EUTSA_v10003438mg             104   1e-25    
ref|XP_008647481.1|  PREDICTED: uncharacterized protein LOC100502...    117   2e-25    
dbj|BAB11194.1|  unnamed protein product                                118   6e-25    
gb|EMS68050.1|  hypothetical protein TRIUR3_09587                       100   8e-25    
gb|KHG10870.1|  Steroidogenic acute regulatory protein, mitochond...  94.4    1e-24    
gb|KHG10869.1|  Steroidogenic acute regulatory protein, mitochond...  94.4    1e-24    
ref|XP_006494217.1|  PREDICTED: uncharacterized protein LOC102606932  98.2    3e-24    
gb|KHG30650.1|  StAR-related lipid transfer 5                         91.7    9e-24    
ref|XP_010677464.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    114   9e-24    
ref|XP_001779209.1|  predicted protein                                89.4    2e-23    
dbj|BAD07819.1|  unknown protein                                        109   2e-23    
emb|CAA16761.1|  hypothetical protein                                   112   5e-23    
ref|XP_010664779.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    105   1e-22    
ref|XP_002262861.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    105   1e-22    
ref|XP_010664771.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...    105   1e-22    
ref|XP_002971596.1|  hypothetical protein SELMODRAFT_67228            95.9    2e-22    
ref|XP_008445284.1|  PREDICTED: protein ENHANCED DISEASE RESISTAN...  90.1    6e-22    
ref|XP_006471434.1|  PREDICTED: uncharacterized protein LOC102631125  85.9    6e-22    
ref|NP_001183606.1|  uncharacterized protein LOC100502200               103   6e-22    
ref|XP_001784674.1|  predicted protein                                89.7    6e-22    
ref|XP_002991637.1|  hypothetical protein SELMODRAFT_448504           93.6    7e-22    



>gb|EYU39844.1| hypothetical protein MIMGU_mgv1a003058mg [Erythranthe guttata]
Length=611

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/445 (66%), Positives = 340/445 (76%), Gaps = 10/445 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGVI+  SE VFRTLMSLG SR+EWDFCF RGSV+EHLDGHTDIIH+QLYNHW
Sbjct  73    DHPAIMAVGVINGASETVFRTLMSLGASRTEWDFCFYRGSVVEHLDGHTDIIHIQLYNHW  132

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPW M RRDLLLRRYWRRE+DGTYVILYHSV H+KCPPQ  Y+RACLKSGG+VI+P + G
Sbjct  133   LPWAMQRRDLLLRRYWRRENDGTYVILYHSVFHRKCPPQDGYVRACLKSGGYVISPSQQG  192

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K  V+KHMLAVDWK WKS+LK++SSRSITI MLG VAAL E FRAK GN S+   +   E
Sbjct  193   KDCVIKHMLAVDWKFWKSYLKKSSSRSITICMLGKVAALAEFFRAKCGNMSNE--YLSGE  250

Query  542   MTIDieapigeeerreegaVDPTRC--------EDGMEELLSEPSSLVGLESACDEFYDV  697
             ++IDI      E+   +  V+  R         E    +  + PSSL  L  A DEF+DV
Sbjct  251   LSIDIGVAPENEKEEIKTEVNCKRVVSNETAEDESSRPQHSATPSSLTALSDAADEFFDV  310

Query  698   LEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              EPSDD+  E    S+ TS    V+  Q K+SSA   +KK H LAVQKKGY+DLQE+  E
Sbjct  311   PEPSDDEAFENAWHSNTTSDLSYVEMYQPKLSSAANFVKKLHGLAVQKKGYMDLQEISRE  370

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             ES  CCYG TL +DS+++ PCSWA  DPSSFLIR + Y  D++K KAK TLMQMVAADWL
Sbjct  371   ESVSCCYGSTLAKDSSFNMPCSWAAADPSSFLIRAENYLVDNQKTKAKGTLMQMVAADWL  430

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SD+R+DDLAGR GGIVQK+AA   PEFF ++NIQVPG+TTY+LALYYMLK PL DTPLL
Sbjct  431   RSDKREDDLAGRYGGIVQKYAARGGPEFFFVINIQVPGATTYNLALYYMLKTPLADTPLL  490

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
             ERFVNGDDAFRNSRFKLIPYISK S
Sbjct  491   ERFVNGDDAFRNSRFKLIPYISKGS  515


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKK+CL+GQALEVNYF+GKNYL
Sbjct  513   KGSWIVKQSVGKKSCLVGQALEVNYFRGKNYL  544



>ref|XP_009626094.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Nicotiana 
tomentosiformis]
Length=729

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/437 (68%), Positives = 350/437 (80%), Gaps = 7/437 (2%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++MAVGVI+ TSEA+FRTLM LGPSRSEWDF F RG V+EHLDGHTDI+H+QLYNHWLPW
Sbjct  199   AVMAVGVIEGTSEAIFRTLMCLGPSRSEWDFSFYRGCVVEHLDGHTDIVHIQLYNHWLPW  258

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS  370
             G  RRDLLLRRYWRREDDGTYVILYHSV+H KCPPQ  Y+RAC+KSGGHVITP K GK S
Sbjct  259   GSKRRDLLLRRYWRREDDGTYVILYHSVIHSKCPPQNGYVRACIKSGGHVITPTKHGKPS  318

Query  371   VVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAEMTI  550
             +VKHMLA+DWK WK +LK+ +S SITIR+L  +AALREMFRAK GN+ S LS   A +T 
Sbjct  319   IVKHMLAIDWKFWKPYLKKGASVSITIRVLERIAALREMFRAKGGNYFSELS--PAALTR  376

Query  551   DieapigeeerreegaVDPTRCEDGMEELLSEPSS--LVGLESACDEFYDVLEPSdddde  724
             DIE P+ E+E  +         +D +      P+S  L+GL+ A DEFYDV EPSDD+  
Sbjct  377   DIELPVSEKEEIKTEVDYKMIKDDKVTNDGKNPASSNLMGLDDAADEFYDVPEPSDDEHS  436

Query  725   egegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
             +   W+S  SPE  C+D+   K+++A  ++KK HDLAVQKKGYVDLQE+  EES   CYG
Sbjct  437   DHA-WTSNASPEVGCMDSYHTKLTTAN-IVKKLHDLAVQKKGYVDLQEMAREESVSLCYG  494

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
              TL +D N++ PCSWA  DPSSFLIR + Y  D EK+KAK+TLMQMVAADWL+SDRR+DD
Sbjct  495   ATLPKDQNFNMPCSWAAADPSSFLIRAESYLADQEKVKAKSTLMQMVAADWLRSDRREDD  554

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             LAGRPGGIVQ++AA  RPEFF I+NIQVPG+TTY+LALYYML++PLE+TPLLERFVNGDD
Sbjct  555   LAGRPGGIVQRYAAQGRPEFFFIINIQVPGATTYNLALYYMLRSPLEETPLLERFVNGDD  614

Query  1262  AFRNSRFKLIPYISKVS  1312
             +FRNSRFKLIPYISK S
Sbjct  615   SFRNSRFKLIPYISKGS  631


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV+YF+GKNYL
Sbjct  629   KGSWIVKQSVGKKACLVGQALEVHYFRGKNYL  660



>emb|CDO99749.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/443 (65%), Positives = 343/443 (77%), Gaps = 10/443 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV++ TSEA+FRT+MS+GPSRSEWDFC  +G+V+EHLDGHTDI+H++LY+HW
Sbjct  196   DHPAIMAVGVVEGTSEAIFRTIMSVGPSRSEWDFCIYKGNVVEHLDGHTDILHIKLYSHW  255

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             L WGM RRDLL+RRYWRREDDGTYVILYHSVVH+KCPPQ  Y+RACLKSGG VI+P+  G
Sbjct  256   LSWGMKRRDLLVRRYWRREDDGTYVILYHSVVHRKCPPQPGYVRACLKSGGFVISPLNQG  315

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLAVDWK WK + ++AS+RSITIR+LG +AALRE+FRAK G  S    FSL E
Sbjct  316   KESVVKHMLAVDWKFWKLYRRKASARSITIRLLGRIAALRELFRAKAGKFS--YEFSLGE  373

Query  542   MTID----ieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPS  709
              T D           ++  +   +   + E+ +E   S  SSLV L  A DEF+DV EPS
Sbjct  374   STRDIGLPQNEFEEIKKEVDLKMIQEDKIENEVENPRSGSSSLVELNDAADEFFDVPEPS  433

Query  710   ddddeegegWSSATSPE--FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             DDD E G  W   TSP+  +  +    K+SSA   +K FHDLAVQKKGY+DL E   E++
Sbjct  434   DDDLEHG--WGMNTSPDLRYLQETYPPKLSSAANFVKIFHDLAVQKKGYMDLHETIWEDN  491

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               C YG TL +DSN S PCSWA GDPSSFLIRG  Y +DH+KIKAK+TLMQMVAADW++S
Sbjct  492   ISCHYGATLAKDSNCSMPCSWAAGDPSSFLIRGSTYLEDHQKIKAKSTLMQMVAADWIRS  551

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL GRPGGIVQK+AA   PEFF I+NIQVPG+T YSLALYYML +PLE+ PLLER
Sbjct  552   DKREDDLGGRPGGIVQKYAAQGGPEFFFIINIQVPGTTQYSLALYYMLTSPLEEAPLLER  611

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             FVNGDDAFRNSRFKLIPYISK S
Sbjct  612   FVNGDDAFRNSRFKLIPYISKGS  634


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV+YF+GKNYL
Sbjct  632   KGSWIVKQSVGKKACLVGQALEVHYFRGKNYL  663



>ref|XP_009791442.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Nicotiana 
sylvestris]
Length=729

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/440 (66%), Positives = 349/440 (79%), Gaps = 13/440 (3%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++MAVGVI+ TSEA+FRTLM LGPSRSEWDF F RG V+EHLDGHTDI+H+QLYNHWLPW
Sbjct  199   AVMAVGVIEGTSEAIFRTLMCLGPSRSEWDFSFYRGCVVEHLDGHTDIVHIQLYNHWLPW  258

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS  370
             G  RRDLLLRRYWRREDDGTYVILYHSV+H KCPPQ  Y+RAC+KSGGHVITP K GK S
Sbjct  259   GSKRRDLLLRRYWRREDDGTYVILYHSVIHSKCPPQNGYVRACIKSGGHVITPTKHGKPS  318

Query  371   VVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAEMTI  550
             +VKHMLA+DWK WK +LK+ +S SITIR+L  +AALREMFRAKEGN+ S LS +     I
Sbjct  319   IVKHMLAIDWKFWKPYLKKGASVSITIRVLERIAALREMFRAKEGNYFSELSPAALTRDI  378

Query  551   DieapigeeerreegaVDPTRCEDGMEELLSE-----PSSLVGLESACDEFYDVLEPSdd  715
             D+     EE + E   VD    ED  +++ ++      S+L GL+ A DEFYDV EPSDD
Sbjct  379   DLPVSEKEEIKTE---VDYKMIED--DKVTNDGKNPASSNLTGLDDAADEFYDVPEPSDD  433

Query  716   ddeegegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
             +  +   W+S  SPE   +D+   K+++A  ++KK HDLAVQKKGY+DLQE+  EES   
Sbjct  434   EHSDHA-WTSNASPEVGFMDSFHTKLTTAN-IVKKLHDLAVQKKGYMDLQEMAREESVSL  491

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
             CYG TL +D +++ PCSWA  DPSSFLIR + Y  D EK+KAK+TLMQMVAADWL+SDRR
Sbjct  492   CYGATLPKDQSFNMPCSWAAADPSSFLIRAESYLADQEKVKAKSTLMQMVAADWLRSDRR  551

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDLAGRPG IVQ++AA  RPEFF I+NIQVPG+TTY+LALYYML++PLE+TPLLERF++
Sbjct  552   EDDLAGRPGSIVQRYAAQGRPEFFFIINIQVPGATTYNLALYYMLRSPLEETPLLERFIS  611

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDD+FRNSRFKLIPYISK S
Sbjct  612   GDDSFRNSRFKLIPYISKGS  631


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV+YF+G+NYL
Sbjct  629   KGSWIVKQSVGKKACLVGQALEVHYFRGRNYL  660



>gb|KDP44038.1| hypothetical protein JCGZ_05505 [Jatropha curcas]
Length=714

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/447 (65%), Positives = 345/447 (77%), Gaps = 21/447 (5%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +GSV+EHLDGHTDIIH  LYN W
Sbjct  185   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIIHKMLYNDW  244

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQK Y+R+CLKSGG+VI+P+  G
Sbjct  245   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRSCLKSGGYVISPVNQG  304

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK WKS+L+ +S+RSITIRMLG VAALRE+FRAK GN  S+  FS  E
Sbjct  305   KRSVVKHMLAIDWKFWKSYLRTSSARSITIRMLGRVAALRELFRAKLGNCPSS-DFSSGE  363

Query  542   MTIDieapigeeerreegaVDPTRCEDG---------MEELLSEPSSLVGLESACDEFYD  694
             +T +++  +GE         + T  EDG         +E+  SE +SLVGL+ A DEF+D
Sbjct  364   LTRNVKLHLGE---------EDTMVEDGKIKGYQSEEVEKTPSEHASLVGLDDAADEFFD  414

Query  695   VLEPSddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             V EP+D +  E   WS     E +  +  Q ++S+A   +KK HDLAVQK+GYVDLQE+ 
Sbjct  415   VPEPTDHELSENG-WSYDFGHETYTQEIRQPRLSTAAGFVKKLHDLAVQKRGYVDLQEMA  473

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
              E+S  CCYG TL +D   + P SW   DPSSFLIRGK Y +D +K+KAK TLMQMVAAD
Sbjct  474   REDSISCCYGTTLPKDPACTMPSSWTAADPSSFLIRGKNYLEDQKKVKAKGTLMQMVAAD  533

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             WL+SD+R+DDLAGRPG IVQK+AA   PEFF I+NIQVPGSTTYSLALYYM+  PLE  P
Sbjct  534   WLRSDKREDDLAGRPGSIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYMMTIPLEKAP  593

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLERFV GDDA+RNSRFKLIPYISK S
Sbjct  594   LLERFVKGDDAYRNSRFKLIPYISKGS  620


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+G NYL
Sbjct  618   KGSWIVKQSVGKKACLIGQALEINYFRGNNYL  649



>ref|XP_006488076.1| PREDICTED: uncharacterized protein LOC102622614 [Citrus sinensis]
Length=748

 Score =   537 bits (1384),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 288/441 (65%), Positives = 340/441 (77%), Gaps = 6/441 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLG SRSEWDFCF RG V+EHLDGHTDIIH QLY+ W
Sbjct  202   DHPAIMAVGVVDGTSEAIFQTLMSLGASRSEWDFCFYRGCVVEHLDGHTDIIHKQLYSDW  261

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCP QK  +RACLKSGG+VITP+  G
Sbjct  262   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVRACLKSGGYVITPMNHG  321

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWKCW+S+L+ +S+RSITIRMLG VAALRE+FRAK+GN+SS   F   E
Sbjct  322   KISVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFRAKQGNYSSP-EFLSGE  380

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLEPSd  712
             +T ++     +    +    D    ++  EE+    SE +SLVGL  A DEF+DV EPSD
Sbjct  381   LTRNMRMHQTDGNMVQMPTEDGNSKKNTSEEVDQVSSEHASLVGLNDAADEFFDVPEPSD  440

Query  713   dddeegegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEP  889
              DD E   W+S   PE    D    KIS+A   ++K HDLAVQK+GYVDLQ    E++  
Sbjct  441   YDDSENG-WTSDFGPEMNSQDTRHPKISTAAGFVRKLHDLAVQKRGYVDLQGTAKEDNFS  499

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
             CCYG TLQ+D   + PCSW   DPS+FLIRGK Y +D +K+KAK TLMQMVAADWLKSD+
Sbjct  500   CCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDRQKVKAKGTLMQMVAADWLKSDK  559

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFV  1249
             R+DDL GRPGGIVQK+A    PEFF I+NIQVPGSTTYSLALYYM+  P++D PLLE F+
Sbjct  560   REDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTYSLALYYMMTTPVKDAPLLESFI  619

Query  1250  NGDDAFRNSRFKLIPYISKVS  1312
             NGDDA+RNSRFKLIPYIS+ S
Sbjct  620   NGDDAYRNSRFKLIPYISEGS  640


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF GKNYL
Sbjct  638   EGSWIVKQSVGKKACLIGQALEINYFHGKNYL  669



>ref|XP_002529938.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32446.1| conserved hypothetical protein [Ricinus communis]
Length=689

 Score =   534 bits (1375),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 290/438 (66%), Positives = 340/438 (78%), Gaps = 3/438 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +GSV+EHLDGHTDIIH  LYN W
Sbjct  160   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIIHKMLYNDW  219

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+P+  G
Sbjct  220   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPVNQG  279

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK WKS+L+ +S+RSITIRMLG VAALRE+FRAK G   S+  FS  E
Sbjct  280   KRSVVKHMLAIDWKFWKSYLRTSSARSITIRMLGRVAALRELFRAKLGTCPSS-EFSSGE  338

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             +T +I+    EE+R+           + +++  SE +SL GL  A DEF+DV EPS D +
Sbjct  339   LTRNIKLHQSEEDRKVGDGKTKEYLSEEVDKAPSEHASLGGLNDAADEFFDVPEPS-DHE  397

Query  722   eegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCY  898
             +   GWS    PE +  D  Q K+ +A   +KK HDLAVQK+GYVDLQE+  E+S  CCY
Sbjct  398   QSDSGWSYDFGPETYSQDMRQPKLCTAAGFVKKLHDLAVQKRGYVDLQEMAREDSISCCY  457

Query  899   GGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQD  1078
             G TL +D   S   SW   DPS+FLIRG+ Y +D +K KAK TLMQMVAADWL+S++R+D
Sbjct  458   GTTLPKDPTCSMLSSWTAADPSTFLIRGENYLEDQKKFKAKGTLMQMVAADWLRSNKRED  517

Query  1079  DLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGD  1258
             DLAGRPG IVQK+AA   PEFF I+NIQVPGSTTYSLALYYM+  PLED PLLERFV GD
Sbjct  518   DLAGRPGSIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYMMTTPLEDAPLLERFVKGD  577

Query  1259  DAFRNSRFKLIPYISKVS  1312
             DAFRNSRFKLIPYISK S
Sbjct  578   DAFRNSRFKLIPYISKGS  595


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+G+NYL
Sbjct  593   KGSWIVKQSVGKKACLIGQALEINYFRGENYL  624



>gb|KDO73328.1| hypothetical protein CISIN_1g004508mg [Citrus sinensis]
Length=675

 Score =   533 bits (1373),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 287/441 (65%), Positives = 338/441 (77%), Gaps = 6/441 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLG SRS WDFCF RG V+EHLDGHTDIIH QLY+ W
Sbjct  202   DHPAIMAVGVVDGTSEAIFQTLMSLGASRSVWDFCFYRGCVVEHLDGHTDIIHKQLYSDW  261

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCP QK  +RACLKSGG+VITP+  G
Sbjct  262   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVRACLKSGGYVITPMNHG  321

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWKCW+S+L+ +S+RSITIRMLG VAALRE+FRAK+GN+SS   F   E
Sbjct  322   KKSVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFRAKQGNYSSP-EFLSGE  380

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLEPSd  712
             +T ++     +    +    D    ++  EE+    SE +SLVGL  A DEF+DV EPSD
Sbjct  381   LTRNMRMHQTDGNMVQMPTEDGNSKKNTSEEVDQVSSEHASLVGLNDAADEFFDVPEPSD  440

Query  713   dddeegegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEP  889
              DD E   W+S   PE    D    KIS+A   ++K HDLAVQK+GYVDLQ    E++  
Sbjct  441   YDDSENG-WTSDFGPEMNSQDTRHPKISTAAGFVRKLHDLAVQKRGYVDLQGTAKEDNFS  499

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
             CCYG TLQ+D   + PCSW   DPS+FLIRGK Y +D  K+KAK TLMQMVAADWLKSD+
Sbjct  500   CCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDRHKVKAKGTLMQMVAADWLKSDK  559

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFV  1249
             R+DDL GRPGGIVQK+A    PEFF I+NIQVPGSTTYSLALYYM+  P++D PLLE F+
Sbjct  560   REDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTYSLALYYMMTTPVKDAPLLESFI  619

Query  1250  NGDDAFRNSRFKLIPYISKVS  1312
             NGDDA+RNSRFKLIPYIS+ S
Sbjct  620   NGDDAYRNSRFKLIPYISEGS  640


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF GKNYL
Sbjct  638   EGSWIVKQSVGKKACLIGQALEINYFHGKNYL  669



>ref|XP_006424553.1| hypothetical protein CICLE_v10027876mg [Citrus clementina]
 gb|ESR37793.1| hypothetical protein CICLE_v10027876mg [Citrus clementina]
Length=748

 Score =   535 bits (1379),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 288/441 (65%), Positives = 338/441 (77%), Gaps = 6/441 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLG SRS WDFCF RG V+EHLDGHTDIIH QLY+ W
Sbjct  202   DHPAIMAVGVVDGTSEAIFQTLMSLGASRSVWDFCFYRGCVVEHLDGHTDIIHKQLYSDW  261

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCP QK  +RACLKSGG+VITP+  G
Sbjct  262   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVRACLKSGGYVITPMNHG  321

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWKCW+S+L+ +S+RSITIRMLG VAALRE+FRAK+GN+SS   F   E
Sbjct  322   KKSVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFRAKQGNYSSP-EFLSGE  380

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLEPSd  712
             +T ++     +    +    D    E+  EE+    SE +SLVGL  A DEF+DV EPSD
Sbjct  381   LTRNMRMHQTDGNMVQMPTEDGNSKENTSEEVDQVSSEHASLVGLNDAADEFFDVPEPSD  440

Query  713   dddeegegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEP  889
              DD E   W+S   PE    D    KIS+A   ++K HDLAVQK+GYVDLQ    E++  
Sbjct  441   YDDSENG-WTSDFGPEMNSQDTRHPKISTAAGFVRKLHDLAVQKRGYVDLQGTAKEDNFS  499

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
             CCYG TLQ+D   + PCSW   DPS+FLIRGK Y +D  K+KAK TLMQMVAADWLKSD+
Sbjct  500   CCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDRHKVKAKGTLMQMVAADWLKSDK  559

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFV  1249
             R+DDL GRPGGIVQK+A    PEFF I+NIQVPGSTTYSLALYYM+  P++D PLLE F+
Sbjct  560   REDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTYSLALYYMMTTPVKDAPLLESFI  619

Query  1250  NGDDAFRNSRFKLIPYISKVS  1312
             NGDDA+RNSRFKLIPYIS+ S
Sbjct  620   NGDDAYRNSRFKLIPYISEGS  640


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF GKNYL
Sbjct  638   EGSWIVKQSVGKKACLIGQALEINYFHGKNYL  669



>ref|XP_011076971.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Sesamum indicum]
Length=711

 Score =   533 bits (1373),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 292/440 (66%), Positives = 337/440 (77%), Gaps = 6/440 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMA+G ID TSEAVF TLMSLG SR+EWDFCF +G+V+EHLDGHTDIIH+QLYNHW
Sbjct  177   DHPAIMAIGAIDGTSEAVFHTLMSLGTSRTEWDFCFYKGTVVEHLDGHTDIIHVQLYNHW  236

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPW   RRD LLRRYWRREDDGTYVILYHSVVH+KCPPQ  Y+RACLKSGG+VITPIK G
Sbjct  237   LPWATKRRDFLLRRYWRREDDGTYVILYHSVVHKKCPPQSGYVRACLKSGGYVITPIKQG  296

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSN-LSFSL-  535
             +  V+KHMLAVDWK W+S+L++AS+RSITI+MLG VAAL EMFRAK GN S   LS  L 
Sbjct  297   RECVIKHMLAVDWKFWRSYLRKASARSITIQMLGRVAALSEMFRAKAGNLSHGFLSGDLP  356

Query  536   AEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdd  715
              ++ I        +       +   +  +      S  SSLVGL  A DEF+DV EP+DD
Sbjct  357   MDIGIPESEKEEIKTEVSLNRIQ-KKTSNETPRQRSGASSLVGLNDA-DEFFDVPEPADD  414

Query  716   ddeegegWSSATSPEFC-VDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
             D  E   WS  T PE C VD  Q K+SSA +L+KK   LAVQKKGYVDLQ +  EES   
Sbjct  415   DLLENG-WSLNTVPESCYVDKYQPKLSSAASLVKKLQGLAVQKKGYVDLQGISWEESVLS  473

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
             CYG TL +D+ ++TPCSW+  DPSSFLIRG  Y +DH+KI AK TLMQMVAADWL+SD+R
Sbjct  474   CYGSTLPKDTTFNTPCSWSASDPSSFLIRGANYLEDHQKITAKGTLMQMVAADWLRSDKR  533

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDLAGR G IVQK+AA   PEFF I+NIQVPGS TY+LALYYMLK PL +TPLLERFVN
Sbjct  534   EDDLAGRSGSIVQKYAARGGPEFFFIINIQVPGSITYNLALYYMLKTPLHETPLLERFVN  593

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GD+AFRNSRFKLIPYISK S
Sbjct  594   GDNAFRNSRFKLIPYISKGS  613


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVG+KACL+GQALE+NYF+G NYL
Sbjct  611   KGSWIVKQSVGRKACLVGQALEINYFRGTNYL  642



>gb|KDO73324.1| hypothetical protein CISIN_1g004508mg [Citrus sinensis]
Length=742

 Score =   534 bits (1376),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 287/441 (65%), Positives = 338/441 (77%), Gaps = 6/441 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLG SRS WDFCF RG V+EHLDGHTDIIH QLY+ W
Sbjct  196   DHPAIMAVGVVDGTSEAIFQTLMSLGASRSVWDFCFYRGCVVEHLDGHTDIIHKQLYSDW  255

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCP QK  +RACLKSGG+VITP+  G
Sbjct  256   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVRACLKSGGYVITPMNHG  315

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWKCW+S+L+ +S+RSITIRMLG VAALRE+FRAK+GN+SS   F   E
Sbjct  316   KKSVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFRAKQGNYSSP-EFLSGE  374

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLEPSd  712
             +T ++     +    +    D    ++  EE+    SE +SLVGL  A DEF+DV EPSD
Sbjct  375   LTRNMRMHQTDGNMVQMPTEDGNSKKNTSEEVDQVSSEHASLVGLNDAADEFFDVPEPSD  434

Query  713   dddeegegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEP  889
              DD E   W+S   PE    D    KIS+A   ++K HDLAVQK+GYVDLQ    E++  
Sbjct  435   YDDSENG-WTSDFGPEMNSQDTRHPKISTAAGFVRKLHDLAVQKRGYVDLQGTAKEDNFS  493

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
             CCYG TLQ+D   + PCSW   DPS+FLIRGK Y +D  K+KAK TLMQMVAADWLKSD+
Sbjct  494   CCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDRHKVKAKGTLMQMVAADWLKSDK  553

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFV  1249
             R+DDL GRPGGIVQK+A    PEFF I+NIQVPGSTTYSLALYYM+  P++D PLLE F+
Sbjct  554   REDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTYSLALYYMMTTPVKDAPLLESFI  613

Query  1250  NGDDAFRNSRFKLIPYISKVS  1312
             NGDDA+RNSRFKLIPYIS+ S
Sbjct  614   NGDDAYRNSRFKLIPYISEGS  634


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF GKNYL
Sbjct  632   EGSWIVKQSVGKKACLIGQALEINYFHGKNYL  663



>ref|XP_011076970.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Sesamum indicum]
Length=728

 Score =   533 bits (1374),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 292/440 (66%), Positives = 337/440 (77%), Gaps = 6/440 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMA+G ID TSEAVF TLMSLG SR+EWDFCF +G+V+EHLDGHTDIIH+QLYNHW
Sbjct  194   DHPAIMAIGAIDGTSEAVFHTLMSLGTSRTEWDFCFYKGTVVEHLDGHTDIIHVQLYNHW  253

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPW   RRD LLRRYWRREDDGTYVILYHSVVH+KCPPQ  Y+RACLKSGG+VITPIK G
Sbjct  254   LPWATKRRDFLLRRYWRREDDGTYVILYHSVVHKKCPPQSGYVRACLKSGGYVITPIKQG  313

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSN-LSFSL-  535
             +  V+KHMLAVDWK W+S+L++AS+RSITI+MLG VAAL EMFRAK GN S   LS  L 
Sbjct  314   RECVIKHMLAVDWKFWRSYLRKASARSITIQMLGRVAALSEMFRAKAGNLSHGFLSGDLP  373

Query  536   AEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdd  715
              ++ I        +       +   +  +      S  SSLVGL  A DEF+DV EP+DD
Sbjct  374   MDIGIPESEKEEIKTEVSLNRIQ-KKTSNETPRQRSGASSLVGLNDA-DEFFDVPEPADD  431

Query  716   ddeegegWSSATSPEFC-VDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
             D  E   WS  T PE C VD  Q K+SSA +L+KK   LAVQKKGYVDLQ +  EES   
Sbjct  432   DLLENG-WSLNTVPESCYVDKYQPKLSSAASLVKKLQGLAVQKKGYVDLQGISWEESVLS  490

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
             CYG TL +D+ ++TPCSW+  DPSSFLIRG  Y +DH+KI AK TLMQMVAADWL+SD+R
Sbjct  491   CYGSTLPKDTTFNTPCSWSASDPSSFLIRGANYLEDHQKITAKGTLMQMVAADWLRSDKR  550

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDLAGR G IVQK+AA   PEFF I+NIQVPGS TY+LALYYMLK PL +TPLLERFVN
Sbjct  551   EDDLAGRSGSIVQKYAARGGPEFFFIINIQVPGSITYNLALYYMLKTPLHETPLLERFVN  610

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GD+AFRNSRFKLIPYISK S
Sbjct  611   GDNAFRNSRFKLIPYISKGS  630


 Score = 65.5 bits (158),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVG+KACL+GQALE+NYF+G NYL
Sbjct  628   KGSWIVKQSVGRKACLVGQALEINYFRGTNYL  659



>gb|KDO73323.1| hypothetical protein CISIN_1g004508mg [Citrus sinensis]
Length=730

 Score =   533 bits (1373),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 287/441 (65%), Positives = 338/441 (77%), Gaps = 6/441 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLG SRS WDFCF RG V+EHLDGHTDIIH QLY+ W
Sbjct  184   DHPAIMAVGVVDGTSEAIFQTLMSLGASRSVWDFCFYRGCVVEHLDGHTDIIHKQLYSDW  243

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCP QK  +RACLKSGG+VITP+  G
Sbjct  244   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVRACLKSGGYVITPMNHG  303

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWKCW+S+L+ +S+RSITIRMLG VAALRE+FRAK+GN+SS   F   E
Sbjct  304   KKSVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFRAKQGNYSSP-EFLSGE  362

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLEPSd  712
             +T ++     +    +    D    ++  EE+    SE +SLVGL  A DEF+DV EPSD
Sbjct  363   LTRNMRMHQTDGNMVQMPTEDGNSKKNTSEEVDQVSSEHASLVGLNDAADEFFDVPEPSD  422

Query  713   dddeegegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEP  889
              DD E   W+S   PE    D    KIS+A   ++K HDLAVQK+GYVDLQ    E++  
Sbjct  423   YDDSENG-WTSDFGPEMNSQDTRHPKISTAAGFVRKLHDLAVQKRGYVDLQGTAKEDNFS  481

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
             CCYG TLQ+D   + PCSW   DPS+FLIRGK Y +D  K+KAK TLMQMVAADWLKSD+
Sbjct  482   CCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDRHKVKAKGTLMQMVAADWLKSDK  541

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFV  1249
             R+DDL GRPGGIVQK+A    PEFF I+NIQVPGSTTYSLALYYM+  P++D PLLE F+
Sbjct  542   REDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTYSLALYYMMTTPVKDAPLLESFI  601

Query  1250  NGDDAFRNSRFKLIPYISKVS  1312
             NGDDA+RNSRFKLIPYIS+ S
Sbjct  602   NGDDAYRNSRFKLIPYISEGS  622


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF GKNYL
Sbjct  620   EGSWIVKQSVGKKACLIGQALEINYFHGKNYL  651



>ref|XP_010651179.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Vitis 
vinifera]
 emb|CBI16325.3| unnamed protein product [Vitis vinifera]
Length=734

 Score =   533 bits (1374),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 284/446 (64%), Positives = 344/446 (77%), Gaps = 13/446 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +G+V+EHLDGHTDI+H QLY  W
Sbjct  199   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIVHKQLYRDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV+H+KCPPQ+ Y+RACLKSGG+V++P+  G
Sbjct  259   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVIHKKCPPQRGYVRACLKSGGYVVSPVNQG  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S+L+ +S+RSITIRMLG VAALRE+FRAK GN+ S+  FS  E
Sbjct  319   KQSVVKHMLAIDWKFWRSYLQTSSARSITIRMLGRVAALRELFRAKLGNYPSS-DFSSGE  377

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELL---------SEPSSLVGLESACDEFYD  694
             +T ++  P  E++ + E     T  E+  EE +         SE +SLVGL  A DEF+D
Sbjct  378   LTSNVRLPQSEQDVKTEAQ---TLAEEKTEEDIEDREVDKTPSEHASLVGLNDAADEFFD  434

Query  695   VLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDS  874
             V EPSD D  E    S   S  +  D    K+S+A   +KK HDLA+QK+GY+DLQEV  
Sbjct  435   VPEPSDSDLAENGWPSDFGSEMYSQDIRHPKLSTAAGFVKKLHDLAIQKRGYMDLQEVAR  494

Query  875   EESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADW  1054
             E+  PCCYG TL +D   +  CSW   DPS+FLIRGK Y +DH+K+KAK TLM+MVAADW
Sbjct  495   EDRIPCCYGATLPKDPTCNLACSWTEADPSTFLIRGKNYLEDHQKVKAKGTLMKMVAADW  554

Query  1055  LKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPL  1234
             L+SD+R+DDL GRP  IVQK+AA   PEFF IVNIQVPGSTTYSLALYYM+  P+ED+PL
Sbjct  555   LRSDKREDDLGGRPESIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDSPL  614

Query  1235  LERFVNGDDAFRNSRFKLIPYISKVS  1312
             LE F+ GDDA+RNSRFKLIPYIS+ S
Sbjct  615   LESFIKGDDAYRNSRFKLIPYISQGS  640


 Score = 69.3 bits (168),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             QGSWIVKQSVGKKACL+GQALE+NYF GKNYL
Sbjct  638   QGSWIVKQSVGKKACLVGQALEINYFHGKNYL  669



>gb|KDO73326.1| hypothetical protein CISIN_1g004508mg [Citrus sinensis]
Length=748

 Score =   533 bits (1374),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 287/441 (65%), Positives = 338/441 (77%), Gaps = 6/441 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLG SRS WDFCF RG V+EHLDGHTDIIH QLY+ W
Sbjct  202   DHPAIMAVGVVDGTSEAIFQTLMSLGASRSVWDFCFYRGCVVEHLDGHTDIIHKQLYSDW  261

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCP QK  +RACLKSGG+VITP+  G
Sbjct  262   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVRACLKSGGYVITPMNHG  321

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWKCW+S+L+ +S+RSITIRMLG VAALRE+FRAK+GN+SS   F   E
Sbjct  322   KKSVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFRAKQGNYSSP-EFLSGE  380

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLEPSd  712
             +T ++     +    +    D    ++  EE+    SE +SLVGL  A DEF+DV EPSD
Sbjct  381   LTRNMRMHQTDGNMVQMPTEDGNSKKNTSEEVDQVSSEHASLVGLNDAADEFFDVPEPSD  440

Query  713   dddeegegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEP  889
              DD E   W+S   PE    D    KIS+A   ++K HDLAVQK+GYVDLQ    E++  
Sbjct  441   YDDSENG-WTSDFGPEMNSQDTRHPKISTAAGFVRKLHDLAVQKRGYVDLQGTAKEDNFS  499

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
             CCYG TLQ+D   + PCSW   DPS+FLIRGK Y +D  K+KAK TLMQMVAADWLKSD+
Sbjct  500   CCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDRHKVKAKGTLMQMVAADWLKSDK  559

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFV  1249
             R+DDL GRPGGIVQK+A    PEFF I+NIQVPGSTTYSLALYYM+  P++D PLLE F+
Sbjct  560   REDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTYSLALYYMMTTPVKDAPLLESFI  619

Query  1250  NGDDAFRNSRFKLIPYISKVS  1312
             NGDDA+RNSRFKLIPYIS+ S
Sbjct  620   NGDDAYRNSRFKLIPYISEGS  640


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF GKNYL
Sbjct  638   EGSWIVKQSVGKKACLIGQALEINYFHGKNYL  669



>gb|KDO73327.1| hypothetical protein CISIN_1g004508mg [Citrus sinensis]
Length=739

 Score =   533 bits (1374),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 287/441 (65%), Positives = 338/441 (77%), Gaps = 6/441 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLG SRS WDFCF RG V+EHLDGHTDIIH QLY+ W
Sbjct  202   DHPAIMAVGVVDGTSEAIFQTLMSLGASRSVWDFCFYRGCVVEHLDGHTDIIHKQLYSDW  261

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCP QK  +RACLKSGG+VITP+  G
Sbjct  262   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVRACLKSGGYVITPMNHG  321

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWKCW+S+L+ +S+RSITIRMLG VAALRE+FRAK+GN+SS   F   E
Sbjct  322   KKSVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFRAKQGNYSSP-EFLSGE  380

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLEPSd  712
             +T ++     +    +    D    ++  EE+    SE +SLVGL  A DEF+DV EPSD
Sbjct  381   LTRNMRMHQTDGNMVQMPTEDGNSKKNTSEEVDQVSSEHASLVGLNDAADEFFDVPEPSD  440

Query  713   dddeegegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEP  889
              DD E   W+S   PE    D    KIS+A   ++K HDLAVQK+GYVDLQ    E++  
Sbjct  441   YDDSENG-WTSDFGPEMNSQDTRHPKISTAAGFVRKLHDLAVQKRGYVDLQGTAKEDNFS  499

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
             CCYG TLQ+D   + PCSW   DPS+FLIRGK Y +D  K+KAK TLMQMVAADWLKSD+
Sbjct  500   CCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDRHKVKAKGTLMQMVAADWLKSDK  559

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFV  1249
             R+DDL GRPGGIVQK+A    PEFF I+NIQVPGSTTYSLALYYM+  P++D PLLE F+
Sbjct  560   REDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTYSLALYYMMTTPVKDAPLLESFI  619

Query  1250  NGDDAFRNSRFKLIPYISKVS  1312
             NGDDA+RNSRFKLIPYIS+ S
Sbjct  620   NGDDAYRNSRFKLIPYISEGS  640


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF GKNYL
Sbjct  638   EGSWIVKQSVGKKACLIGQALEINYFHGKNYL  669



>gb|KHG27546.1| PCTP-like protein [Gossypium arboreum]
Length=736

 Score =   533 bits (1373),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 280/443 (63%), Positives = 341/443 (77%), Gaps = 7/443 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +GSV+EHLDGHTDI+H QLY+ W
Sbjct  201   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIVHKQLYSDW  260

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSVVH+KCPPQK Y+RA LKSGG+VI+P+  G
Sbjct  261   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVVHKKCPPQKSYVRASLKSGGYVISPVTEG  320

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLSFSLA  538
             K SVVKHMLA+DWK WKS+L+ ++ RSITIRML  VAALRE+F+AK+GN+ +++LS    
Sbjct  321   KHSVVKHMLAIDWKFWKSYLRTSAVRSITIRMLERVAALRELFKAKQGNYPTADLSSGEL  380

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEELL----SEPSSLVGLESACDEFYDVLEP  706
                + +     +        ++  + ++ M E +    SE SSLVGL  A DEF+DV EP
Sbjct  381   MRNVRLHQSEEDGIVDMCTEIEAGKTKENMNEAMERASSEHSSLVGLNDAADEFFDVPEP  440

Query  707   SddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             ++ D  E   W+S   PE +  D  Q K+S+A   +KK HDLAVQK+GY+DLQ++  E+ 
Sbjct  441   TEHDRAEDG-WASDFGPEVYSQDTRQLKLSTAAVFVKKIHDLAVQKRGYMDLQDMTREDG  499

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               C YG TL +D   + PCSW   +PS+FLIRGK Y +D +K KAK TLMQMVAADWL+S
Sbjct  500   VCCSYGNTLSKDPTCTLPCSWTAAEPSTFLIRGKNYLEDQKKFKAKGTLMQMVAADWLRS  559

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL GRPGGIVQK+AA   PEFF IVNIQVPGSTTYSLALYYM+  P+ED+PLL  
Sbjct  560   DKREDDLGGRPGGIVQKYAARGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDSPLLHN  619

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             FVNGDDA+RNSRFKLIPYISK S
Sbjct  620   FVNGDDAYRNSRFKLIPYISKGS  642


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIG ALE+NYF GKNYL
Sbjct  640   KGSWIVKQSVGKKACLIGHALEMNYFHGKNYL  671



>ref|XP_011084323.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Sesamum indicum]
Length=725

 Score =   531 bits (1369),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 283/438 (65%), Positives = 338/438 (77%), Gaps = 6/438 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVG ID +SEAVFRTLMSLG SR+EWDFCF RGSV+E+LDGHTDIIH+QLYNHW
Sbjct  195   DHPAIMAVGTIDASSEAVFRTLMSLGTSRTEWDFCFYRGSVVENLDGHTDIIHIQLYNHW  254

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPW M RRDLLLRRYWRRE+DGTYVILYHSVVH+KCPPQ  YIRACLKSGG++ITP++ G
Sbjct  255   LPWAMKRRDLLLRRYWRREEDGTYVILYHSVVHRKCPPQDGYIRACLKSGGYLITPMQQG  314

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K  V+KHMLAVDWK W+S+LK+ S+RSITIRMLG VAALRE+F+A  GN S    +   E
Sbjct  315   KECVIKHMLAVDWKVWRSYLKKESARSITIRMLGKVAALRELFKANAGNTSP--EYITGE  372

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
               ID+       ++      +    ED +  L +  SSL  L  A DEF+DV EPSDD+ 
Sbjct  373   RKIDMARNHESGKQEINRIHNEP--EDEVMRLQTVSSSLTALSDAADEFFDVPEPSDDEA  430

Query  722   eegegWSSATSPEFC-VDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCY  898
              E   W+S  SPE   +D  Q K+SSA   +KK HDLAV KKGY DLQ++  EE+   CY
Sbjct  431   LENG-WTSEMSPEISYLDNYQPKLSSAANFVKKLHDLAVPKKGYTDLQDISREEAVSPCY  489

Query  899   GGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQD  1078
             G TL +DS+++ PCSWA  DPSSFLIRG  Y  D++K+KAK TL+QMV ADWL+S++R+D
Sbjct  490   GCTLPKDSSFNMPCSWATADPSSFLIRGPNYLVDNQKVKAKGTLLQMVGADWLRSEKRED  549

Query  1079  DLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGD  1258
             D+AGR G IVQK+AA    EFF ++NIQVPG++TY LALYYMLK+PLE+TPLLERFVNGD
Sbjct  550   DIAGRYGSIVQKYAACGGSEFFFVINIQVPGTSTYHLALYYMLKSPLEETPLLERFVNGD  609

Query  1259  DAFRNSRFKLIPYISKVS  1312
             DAFRNSRFKLIPYISK S
Sbjct  610   DAFRNSRFKLIPYISKGS  627


 Score = 68.6 bits (166),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKK+CLIGQALEVNYF+GKNYL
Sbjct  625   KGSWIVKQSVGKKSCLIGQALEVNYFRGKNYL  656



>ref|XP_011044395.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X2 [Populus 
euphratica]
Length=657

 Score =   529 bits (1362),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 290/447 (65%), Positives = 343/447 (77%), Gaps = 15/447 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRS+WDFCF +GSV+EHLDGH DIIH +LYN W
Sbjct  122   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSKWDFCFYKGSVVEHLDGHMDIIHKELYNDW  181

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD LLRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+P+   
Sbjct  182   LPWGMKRRDFLLRRYWRREDDGTYVILYHSVYHKKCPPQKGYVRACLKSGGYVISPVNHE  241

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + SVVKHMLAVDWK WKS+L+ +S+RSITIRMLG VAALRE+F+AK GN  S+  FS  E
Sbjct  242   RRSVVKHMLAVDWKSWKSYLRTSSARSITIRMLGRVAALRELFKAKLGNCPSS-DFSSGE  300

Query  542   MTIDieapigeeerreegaVDPTRCEDGM------EELLSEPS---SLVGLESACDEFYD  694
             +  ++     E ++R +     T   DGM      EE+   PS   SLVGL    DEF+D
Sbjct  301   LVGNMRLHQIEGDQRIDAQ---TPTNDGMTKECMNEEVDKTPSEYASLVGLNDPADEFFD  357

Query  695   VLEPSddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             V EPSD D  E + WSS   PE +  DA Q K+S+A   +KK H+LAVQK+GY+DLQE+ 
Sbjct  358   VPEPSDYDQLEND-WSSDFDPEMYSQDARQPKLSTAAGFVKKLHELAVQKRGYMDLQEMV  416

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
              E+S  CCYG TL +D  ++ P SWA  DPSSFLIRGK Y +D +K KA  TLMQMVAAD
Sbjct  417   REDSISCCYGTTLLKDPTFTLPSSWAMADPSSFLIRGKNYLEDQKKFKANGTLMQMVAAD  476

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             W++SD+R+DDLAGRPG IVQK+AA   PEFF IVNIQVPGSTTYSLALYYM+  P+ED P
Sbjct  477   WIRSDKREDDLAGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAP  536

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLE F+ GDDA+RNSRFKLIPYISK S
Sbjct  537   LLESFIKGDDAYRNSRFKLIPYISKGS  563


 Score = 65.5 bits (158),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNYL
Sbjct  561   KGSWIVKQSVGKKACLIGQALEMNYFRGKNYL  592



>ref|XP_007016767.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
isoform 2 [Theobroma cacao]
 gb|EOY34386.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
isoform 2 [Theobroma cacao]
Length=575

 Score =   524 bits (1349),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 276/443 (62%), Positives = 340/443 (77%), Gaps = 7/443 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +GSV+EHLDGHTDI+H QLY+ W
Sbjct  40    DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIVHKQLYSDW  99

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQK  +RACLKSGG+VI+P+  G
Sbjct  100   LPWGMRRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKSCVRACLKSGGYVISPVNEG  159

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLSFSLA  538
             K SVVKHMLA+DWK WKS+L+ +++RSITIRML  VAALRE+F+AK+G + S++LS    
Sbjct  160   KHSVVKHMLAIDWKFWKSYLRTSAARSITIRMLERVAALRELFKAKQGKYPSADLSSREL  219

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEELL----SEPSSLVGLESACDEFYDVLEP  706
                + +     +        ++  + ++ M E++    SE SSLVGL  A DEF+DV EP
Sbjct  220   IRNVRLHQSEEDGMVDMCTQIEAGKIKENMCEVMERAPSEHSSLVGLNDAADEFFDVPEP  279

Query  707   SddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             +D D  E   W+S   PE +  D    K+S+A   +KK HDLAVQK+GYVDLQ++  E+ 
Sbjct  280   TDYDQSEDG-WASDFGPEGYSQDTRHPKLSTAAVFVKKLHDLAVQKRGYVDLQDMMREDG  338

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               C YG TL +D   + PCSW   +PS+FLIRG+ Y +D +K KA  TLMQMVAADWL+S
Sbjct  339   IFCSYGNTLPKDPTCTLPCSWTAAEPSTFLIRGENYLEDRKKFKATGTLMQMVAADWLRS  398

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL GRPGGIVQK+AA   PEFF I+NIQVPGSTTYSLALYYM+  P+ED+PLL+ 
Sbjct  399   DKREDDLGGRPGGIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYMMNTPVEDSPLLQN  458

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             F+NGDDA+RNSRFKLIPYISK S
Sbjct  459   FINGDDAYRNSRFKLIPYISKGS  481


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNYL
Sbjct  479   KGSWIVKQSVGKKACLIGQALEINYFRGKNYL  510



>gb|KCW65419.1| hypothetical protein EUGRSUZ_G02842 [Eucalyptus grandis]
Length=723

 Score =   528 bits (1360),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 286/445 (64%), Positives = 336/445 (76%), Gaps = 10/445 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FR LMSLG SRSEWDFCF RGSV+EHLDGHTDIIH+QLY+ W
Sbjct  187   DHPAIMAVGVVDGTSEAIFRCLMSLGSSRSEWDFCFYRGSVVEHLDGHTDIIHMQLYSDW  246

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KC PQ+ Y+RACLKSGG+VI+PI  G
Sbjct  247   LPWGMRRRDLLLRRYWRREDDGTYVILYHSVFHKKCRPQRGYVRACLKSGGYVISPINQG  306

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLS-----  526
             K S+VKHML++DWK WK +L+ +S+RS TIRML  VAALREMF++K GN SS+ S     
Sbjct  307   KQSMVKHMLSIDWKFWKMYLRPSSARSTTIRMLERVAALREMFKSKAGNFSSDYSCGDLM  366

Query  527   --FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVL  700
                 L ++  +      E+  +     +    ED  E   S+ SSL+GL  A DEF+DV 
Sbjct  367   RDIGLPQIVKEDVKTEVEDHEKIVKIQEVKFTEDQSERPPSQSSSLMGLNDADDEFFDVP  426

Query  701   EPSddddeegegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
             EP+D D  E   WSS   PE    +  Q K+SS    +KK HDLAVQKKGY+DLQE+  E
Sbjct  427   EPTDYDQLEN--WSSELIPELHAPNMYQPKLSSTAIFVKKLHDLAVQKKGYMDLQELARE  484

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             +S  C YG TLQ D + + PCSW   DPS+FLIRG+ Y KDH KIKAK TLMQMV ADWL
Sbjct  485   DSIACTYGSTLQCDPSCNLPCSWTTTDPSTFLIRGENYLKDHRKIKAKGTLMQMVGADWL  544

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SD+R+DDLAGRPGG+VQ++AA   PEFF IVNIQVPGSTTY+LALYYM+K PLE+ PLL
Sbjct  545   RSDKREDDLAGRPGGVVQEYAALGGPEFFFIVNIQVPGSTTYNLALYYMMKTPLEENPLL  604

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
              RFVNGDD FRNSRFKLIPYISK S
Sbjct  605   HRFVNGDDTFRNSRFKLIPYISKGS  629


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKK CL+GQAL +NYF+GKNYL
Sbjct  627   KGSWIVKQSVGKKVCLVGQALAINYFRGKNYL  658



>ref|XP_010067309.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Eucalyptus 
grandis]
Length=731

 Score =   528 bits (1360),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 286/445 (64%), Positives = 336/445 (76%), Gaps = 10/445 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FR LMSLG SRSEWDFCF RGSV+EHLDGHTDIIH+QLY+ W
Sbjct  195   DHPAIMAVGVVDGTSEAIFRCLMSLGSSRSEWDFCFYRGSVVEHLDGHTDIIHMQLYSDW  254

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KC PQ+ Y+RACLKSGG+VI+PI  G
Sbjct  255   LPWGMRRRDLLLRRYWRREDDGTYVILYHSVFHKKCRPQRGYVRACLKSGGYVISPINQG  314

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLS-----  526
             K S+VKHML++DWK WK +L+ +S+RS TIRML  VAALREMF++K GN SS+ S     
Sbjct  315   KQSMVKHMLSIDWKFWKMYLRPSSARSTTIRMLERVAALREMFKSKAGNFSSDYSCGDLM  374

Query  527   --FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVL  700
                 L ++  +      E+  +     +    ED  E   S+ SSL+GL  A DEF+DV 
Sbjct  375   RDIGLPQIVKEDVKTEVEDHEKIVKIQEVKFTEDQSERPPSQSSSLMGLNDADDEFFDVP  434

Query  701   EPSddddeegegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
             EP+D D  E   WSS   PE    +  Q K+SS    +KK HDLAVQKKGY+DLQE+  E
Sbjct  435   EPTDYDQLEN--WSSELIPELHAPNMYQPKLSSTAIFVKKLHDLAVQKKGYMDLQELARE  492

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             +S  C YG TLQ D + + PCSW   DPS+FLIRG+ Y KDH KIKAK TLMQMV ADWL
Sbjct  493   DSIACTYGSTLQCDPSCNLPCSWTTTDPSTFLIRGENYLKDHRKIKAKGTLMQMVGADWL  552

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SD+R+DDLAGRPGG+VQ++AA   PEFF IVNIQVPGSTTY+LALYYM+K PLE+ PLL
Sbjct  553   RSDKREDDLAGRPGGVVQEYAALGGPEFFFIVNIQVPGSTTYNLALYYMMKTPLEENPLL  612

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
              RFVNGDD FRNSRFKLIPYISK S
Sbjct  613   HRFVNGDDTFRNSRFKLIPYISKGS  637


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKK CL+GQAL +NYF+GKNYL
Sbjct  635   KGSWIVKQSVGKKVCLVGQALAINYFRGKNYL  666



>ref|XP_011044394.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X1 [Populus 
euphratica]
Length=746

 Score =   529 bits (1362),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 290/447 (65%), Positives = 343/447 (77%), Gaps = 15/447 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRS+WDFCF +GSV+EHLDGH DIIH +LYN W
Sbjct  211   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSKWDFCFYKGSVVEHLDGHMDIIHKELYNDW  270

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD LLRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+P+   
Sbjct  271   LPWGMKRRDFLLRRYWRREDDGTYVILYHSVYHKKCPPQKGYVRACLKSGGYVISPVNHE  330

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + SVVKHMLAVDWK WKS+L+ +S+RSITIRMLG VAALRE+F+AK GN  S+  FS  E
Sbjct  331   RRSVVKHMLAVDWKSWKSYLRTSSARSITIRMLGRVAALRELFKAKLGNCPSS-DFSSGE  389

Query  542   MTIDieapigeeerreegaVDPTRCEDGM------EELLSEPS---SLVGLESACDEFYD  694
             +  ++     E ++R +     T   DGM      EE+   PS   SLVGL    DEF+D
Sbjct  390   LVGNMRLHQIEGDQRIDAQ---TPTNDGMTKECMNEEVDKTPSEYASLVGLNDPADEFFD  446

Query  695   VLEPSddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             V EPSD D  E + WSS   PE +  DA Q K+S+A   +KK H+LAVQK+GY+DLQE+ 
Sbjct  447   VPEPSDYDQLEND-WSSDFDPEMYSQDARQPKLSTAAGFVKKLHELAVQKRGYMDLQEMV  505

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
              E+S  CCYG TL +D  ++ P SWA  DPSSFLIRGK Y +D +K KA  TLMQMVAAD
Sbjct  506   REDSISCCYGTTLLKDPTFTLPSSWAMADPSSFLIRGKNYLEDQKKFKANGTLMQMVAAD  565

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             W++SD+R+DDLAGRPG IVQK+AA   PEFF IVNIQVPGSTTYSLALYYM+  P+ED P
Sbjct  566   WIRSDKREDDLAGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAP  625

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLE F+ GDDA+RNSRFKLIPYISK S
Sbjct  626   LLESFIKGDDAYRNSRFKLIPYISKGS  652


 Score = 68.6 bits (166),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNYL
Sbjct  650   KGSWIVKQSVGKKACLIGQALEMNYFRGKNYL  681



>ref|XP_007016769.1| Pleckstrin and lipid-binding START domains-containing protein 
isoform 4 [Theobroma cacao]
 gb|EOY34388.1| Pleckstrin and lipid-binding START domains-containing protein 
isoform 4 [Theobroma cacao]
Length=649

 Score =   525 bits (1352),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 276/442 (62%), Positives = 340/442 (77%), Gaps = 7/442 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +GSV+EHLDGHTDI+H QLY+ W
Sbjct  199   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIVHKQLYSDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQK  +RACLKSGG+VI+P+  G
Sbjct  259   LPWGMRRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKSCVRACLKSGGYVISPVNEG  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLSFSLA  538
             K SVVKHMLA+DWK WKS+L+ +++RSITIRML  VAALRE+F+AK+G + S++LS    
Sbjct  319   KHSVVKHMLAIDWKFWKSYLRTSAARSITIRMLERVAALRELFKAKQGKYPSADLSSREL  378

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEELL----SEPSSLVGLESACDEFYDVLEP  706
                + +     +        ++  + ++ M E++    SE SSLVGL  A DEF+DV EP
Sbjct  379   IRNVRLHQSEEDGMVDMCTQIEAGKIKENMCEVMERAPSEHSSLVGLNDAADEFFDVPEP  438

Query  707   SddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             +D D  E   W+S   PE +  D    K+S+A   +KK HDLAVQK+GYVDLQ++  E+ 
Sbjct  439   TDYDQSEDG-WASDFGPEGYSQDTRHPKLSTAAVFVKKLHDLAVQKRGYVDLQDMMREDG  497

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               C YG TL +D   + PCSW   +PS+FLIRG+ Y +D +K KA  TLMQMVAADWL+S
Sbjct  498   IFCSYGNTLPKDPTCTLPCSWTAAEPSTFLIRGENYLEDRKKFKATGTLMQMVAADWLRS  557

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL GRPGGIVQK+AA   PEFF I+NIQVPGSTTYSLALYYM+  P+ED+PLL+ 
Sbjct  558   DKREDDLGGRPGGIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYMMNTPVEDSPLLQN  617

Query  1244  FVNGDDAFRNSRFKLIPYISKV  1309
             F+NGDDA+RNSRFKLIPYISKV
Sbjct  618   FINGDDAYRNSRFKLIPYISKV  639



>ref|XP_006409857.1| hypothetical protein EUTSA_v10016308mg [Eutrema salsugineum]
 gb|ESQ51310.1| hypothetical protein EUTSA_v10016308mg [Eutrema salsugineum]
Length=735

 Score =   526 bits (1356),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 281/441 (64%), Positives = 333/441 (76%), Gaps = 4/441 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +F+TL+SLGPSRSEWDFCF +GSV+EHLDGHTDIIH QLY+ W
Sbjct  201   DHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDGHTDIIHKQLYSDW  260

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD  LRRYWRREDDGTYVILYHSV H+KCPPQK YIRACLKSGG+VI+PI  G
Sbjct  261   LPWGMKRRDFSLRRYWRREDDGTYVILYHSVYHKKCPPQKGYIRACLKSGGYVISPIDNG  320

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSF---S  532
             K SVVKHMLAVDWK W+S++K + +RSIT++MLG ++ALRE+FRAK G+  SNLS    S
Sbjct  321   KQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAKHGSFPSNLSLGESS  380

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
              + +    E  +  +    E  +      D  ++  SE SSLV L    DEF+DV EPSD
Sbjct  381   RSALLNQNEDGVFGDSSLRESELFKDTANDERDKFPSERSSLVDLNDGVDEFFDVPEPSD  440

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE-P  889
             +D  +    S   S  +  ++ Q K++SAT+L+KK HDLAVQK+GYVDL E   EES  P
Sbjct  441   NDQLDESWTSDFDSDTYSQESRQPKLNSATSLVKKLHDLAVQKRGYVDLHEKAREESSTP  500

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
             CCYG TL  D   + PCSW   DPS+FLIRGK Y  D +K+KAK TLM+MVAADWLKSD+
Sbjct  501   CCYGTTLPTDPTCALPCSWTTTDPSTFLIRGKTYLSDQKKVKAKGTLMEMVAADWLKSDK  560

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFV  1249
             R+DDL  RPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ PLL  FV
Sbjct  561   REDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEHPLLVSFV  620

Query  1250  NGDDAFRNSRFKLIPYISKVS  1312
             NGDDA+RNSRFKLIPYISK S
Sbjct  621   NGDDAYRNSRFKLIPYISKGS  641


 Score = 68.2 bits (165),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  639   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  670



>ref|XP_006340183.1| PREDICTED: uncharacterized protein LOC102585665 [Solanum tuberosum]
Length=732

 Score =   526 bits (1354),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 280/439 (64%), Positives = 333/439 (76%), Gaps = 3/439 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVG++D TSEA+F+TLMSLGPSRSEWDFC+ +GSVIEHLDGHTDI+H  L   W
Sbjct  201   DHPAIMAVGIVDGTSEAIFQTLMSLGPSRSEWDFCYYKGSVIEHLDGHTDIVHKLLNQDW  260

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLL+RYWRREDDGTYVILYHSV HQKC PQK Y+RACLKSGG+VI+P+  G
Sbjct  261   LPWGMTRRDLLLQRYWRREDDGTYVILYHSVFHQKCAPQKGYVRACLKSGGYVISPVNQG  320

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLSFSLA  538
             K SVVKHMLA+DWK WKS+++ +++RSITIRMLG +AALRE+F AK GN+  S++S  L 
Sbjct  321   KGSVVKHMLAIDWKFWKSYVRTSAARSITIRMLGRLAALRELFSAKIGNYLPSDVSGELV  380

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSddd  718
             +     +     +   +    +     D  EE +  PSSL+GL  A DEF+DV EP  D 
Sbjct  381   KSKRLCQVEEEIKLEVQTRLENGNNVADLEEEAVKTPSSLLGLNDASDEFFDVSEP-LDY  439

Query  719   deegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCC  895
             D+   GWSS   PE +  DA   K+S+A   +KK HDLAVQKKGYVDL E+  E++  C 
Sbjct  440   DQSENGWSSDFGPETYSQDARHPKLSTAAVFVKKLHDLAVQKKGYVDLHEMAKEDASFCH  499

Query  896   YGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQ  1075
             YG TL +DS  + PCSW   DPS+FLIRG+ Y  D +KIKAK TLMQMV ADWLKSD+R+
Sbjct  500   YGSTLPKDSTCNLPCSWTETDPSTFLIRGETYLDDRKKIKAKGTLMQMVGADWLKSDKRE  559

Query  1076  DDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNG  1255
             DDL GRPGGIVQK+AA   PEFF IVNIQVPG TTY+LALYYM+  PLED+PLLE FV G
Sbjct  560   DDLGGRPGGIVQKYAAKGGPEFFFIVNIQVPGLTTYTLALYYMMDTPLEDSPLLESFVKG  619

Query  1256  DDAFRNSRFKLIPYISKVS  1312
             DDA+RNSRFKLIPYISK S
Sbjct  620   DDAYRNSRFKLIPYISKGS  638


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  636   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  667



>ref|XP_009621798.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Nicotiana tomentosiformis]
Length=623

 Score =   521 bits (1342),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 281/437 (64%), Positives = 331/437 (76%), Gaps = 3/437 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +GSVIEHLDGHTDI+H  L   W
Sbjct  92    DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVIEHLDGHTDIVHKLLNRDW  151

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLL+RYWRREDDGTYVILYHSV HQKCPPQK YIRACLKSGG+VI+P+   
Sbjct  152   LPWGMGRRDLLLQRYWRREDDGTYVILYHSVFHQKCPPQKGYIRACLKSGGYVISPVNQE  211

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLSFSLA  538
             K SVVKHMLA+DWK WKS+++ +++RSITI MLG +AALRE+F AK GN+  S++S  L 
Sbjct  212   KRSVVKHMLAIDWKFWKSYVRTSAARSITICMLGRLAALRELFSAKIGNYLPSDVSGELV  271

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSddd  718
             +     +     +   +    +     D  EE++  PSSL+GL  A DEF+DV EP  D 
Sbjct  272   KSKRLRQVEEEIKLEVQTRLENGKNLADLEEEVVKTPSSLMGLNDAADEFFDVSEP-LDY  330

Query  719   deegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCC  895
             D+   GW S   PE +  DA   K+SSA   +KK HDLAVQK+GYVDL E+  E++  C 
Sbjct  331   DQSENGWPSDFGPETYSQDARHPKLSSAAVFVKKLHDLAVQKRGYVDLHEMAKEDTSSCH  390

Query  896   YGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQ  1075
             YG TL +DS  S PCSW   DPS+FLIRG  Y  D +KIKAK TLMQMV ADWLKSD+R+
Sbjct  391   YGSTLPKDSTCSLPCSWTETDPSTFLIRGLTYLDDRKKIKAKGTLMQMVGADWLKSDKRE  450

Query  1076  DDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNG  1255
             DDL GRPGGIVQK+AA   PEFF IV+IQVPG+TTYSLALYYM+  PLED+PLLE FV G
Sbjct  451   DDLGGRPGGIVQKYAAKGGPEFFFIVHIQVPGTTTYSLALYYMMDTPLEDSPLLESFVKG  510

Query  1256  DDAFRNSRFKLIPYISK  1306
             DDA+RNSRFKLIPYISK
Sbjct  511   DDAYRNSRFKLIPYISK  527


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G WIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  527   KGPWIVKQSVGKKACLIGQALEINYFRGKNYI  558



>ref|XP_007016768.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
isoform 3 [Theobroma cacao]
 gb|EOY34387.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
isoform 3 [Theobroma cacao]
Length=734

 Score =   525 bits (1352),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 276/443 (62%), Positives = 340/443 (77%), Gaps = 7/443 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +GSV+EHLDGHTDI+H QLY+ W
Sbjct  199   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIVHKQLYSDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQK  +RACLKSGG+VI+P+  G
Sbjct  259   LPWGMRRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKSCVRACLKSGGYVISPVNEG  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLSFSLA  538
             K SVVKHMLA+DWK WKS+L+ +++RSITIRML  VAALRE+F+AK+G + S++LS    
Sbjct  319   KHSVVKHMLAIDWKFWKSYLRTSAARSITIRMLERVAALRELFKAKQGKYPSADLSSREL  378

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEELL----SEPSSLVGLESACDEFYDVLEP  706
                + +     +        ++  + ++ M E++    SE SSLVGL  A DEF+DV EP
Sbjct  379   IRNVRLHQSEEDGMVDMCTQIEAGKIKENMCEVMERAPSEHSSLVGLNDAADEFFDVPEP  438

Query  707   SddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             +D D  E   W+S   PE +  D    K+S+A   +KK HDLAVQK+GYVDLQ++  E+ 
Sbjct  439   TDYDQSEDG-WASDFGPEGYSQDTRHPKLSTAAVFVKKLHDLAVQKRGYVDLQDMMREDG  497

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               C YG TL +D   + PCSW   +PS+FLIRG+ Y +D +K KA  TLMQMVAADWL+S
Sbjct  498   IFCSYGNTLPKDPTCTLPCSWTAAEPSTFLIRGENYLEDRKKFKATGTLMQMVAADWLRS  557

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL GRPGGIVQK+AA   PEFF I+NIQVPGSTTYSLALYYM+  P+ED+PLL+ 
Sbjct  558   DKREDDLGGRPGGIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYMMNTPVEDSPLLQN  617

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             F+NGDDA+RNSRFKLIPYISK S
Sbjct  618   FINGDDAYRNSRFKLIPYISKGS  640


 Score = 68.9 bits (167),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNYL
Sbjct  638   KGSWIVKQSVGKKACLIGQALEINYFRGKNYL  669



>ref|XP_007016766.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
isoform 1 [Theobroma cacao]
 gb|EOY34385.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
isoform 1 [Theobroma cacao]
Length=760

 Score =   525 bits (1352),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 276/443 (62%), Positives = 340/443 (77%), Gaps = 7/443 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +GSV+EHLDGHTDI+H QLY+ W
Sbjct  199   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVVEHLDGHTDIVHKQLYSDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQK  +RACLKSGG+VI+P+  G
Sbjct  259   LPWGMRRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKSCVRACLKSGGYVISPVNEG  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLSFSLA  538
             K SVVKHMLA+DWK WKS+L+ +++RSITIRML  VAALRE+F+AK+G + S++LS    
Sbjct  319   KHSVVKHMLAIDWKFWKSYLRTSAARSITIRMLERVAALRELFKAKQGKYPSADLSSREL  378

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEELL----SEPSSLVGLESACDEFYDVLEP  706
                + +     +        ++  + ++ M E++    SE SSLVGL  A DEF+DV EP
Sbjct  379   IRNVRLHQSEEDGMVDMCTQIEAGKIKENMCEVMERAPSEHSSLVGLNDAADEFFDVPEP  438

Query  707   SddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             +D D  E   W+S   PE +  D    K+S+A   +KK HDLAVQK+GYVDLQ++  E+ 
Sbjct  439   TDYDQSEDG-WASDFGPEGYSQDTRHPKLSTAAVFVKKLHDLAVQKRGYVDLQDMMREDG  497

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               C YG TL +D   + PCSW   +PS+FLIRG+ Y +D +K KA  TLMQMVAADWL+S
Sbjct  498   IFCSYGNTLPKDPTCTLPCSWTAAEPSTFLIRGENYLEDRKKFKATGTLMQMVAADWLRS  557

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL GRPGGIVQK+AA   PEFF I+NIQVPGSTTYSLALYYM+  P+ED+PLL+ 
Sbjct  558   DKREDDLGGRPGGIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYMMNTPVEDSPLLQN  617

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             F+NGDDA+RNSRFKLIPYISK S
Sbjct  618   FINGDDAYRNSRFKLIPYISKGS  640


 Score = 68.9 bits (167),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNYL
Sbjct  638   KGSWIVKQSVGKKACLIGQALEINYFRGKNYL  669



>gb|KFK32308.1| hypothetical protein AALP_AA6G225400 [Arabis alpina]
Length=744

 Score =   523 bits (1346),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 281/447 (63%), Positives = 335/447 (75%), Gaps = 16/447 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +F+TL+SLGPSRSEWDFCF +GSV+EHLDGHTDIIH QLY+ W
Sbjct  210   DHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDGHTDIIHKQLYSDW  269

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD  LRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+PI  G
Sbjct  270   LPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPIDNG  329

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLAVDWK W+S+LK + +RSIT++MLG ++ALRE+FRAK G+  +NLS     
Sbjct  330   KQSVVKHMLAVDWKSWRSYLKPSLARSITVKMLGRLSALRELFRAKHGSFPTNLS-----  384

Query  542   MTIDieapigeeerreegaVDPTRCEDGM---------EELLSEPSSLVGLESACDEFYD  694
              + ++       +  + G  D +  E GM         E+  SE SSLV L    DEF+D
Sbjct  385   -SGELIRSARLSQNEDGGFGDSSLSESGMFKDNANAEAEKFPSERSSLVDLNDGVDEFFD  443

Query  695   VLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDS  874
             V EPSD+D  +    S   S  +  ++ Q K++SAT+L+KK HDLAVQK+GYVDL E   
Sbjct  444   VPEPSDNDHLDDSWTSDFDSDRYSQESRQPKLNSATSLVKKLHDLAVQKRGYVDLHERAR  503

Query  875   EE-SEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
             EE S PCCYG TL  D   + PCSW   DPS+FLIRGK Y +D +K+KAK  LM+MVAAD
Sbjct  504   EEISVPCCYGSTLPTDPTCALPCSWTTTDPSTFLIRGKTYLEDQKKVKAKGKLMEMVAAD  563

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             WLKSD+R+DDL  RPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ P
Sbjct  564   WLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEHP  623

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LL  FVNGDDA+RNSRFKLIPYISK S
Sbjct  624   LLVSFVNGDDAYRNSRFKLIPYISKGS  650


 Score = 68.2 bits (165),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  648   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  679



>gb|KFK32307.1| hypothetical protein AALP_AA6G225400 [Arabis alpina]
Length=742

 Score =   523 bits (1346),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 281/447 (63%), Positives = 335/447 (75%), Gaps = 16/447 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +F+TL+SLGPSRSEWDFCF +GSV+EHLDGHTDIIH QLY+ W
Sbjct  208   DHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDGHTDIIHKQLYSDW  267

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD  LRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+PI  G
Sbjct  268   LPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPIDNG  327

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLAVDWK W+S+LK + +RSIT++MLG ++ALRE+FRAK G+  +NLS     
Sbjct  328   KQSVVKHMLAVDWKSWRSYLKPSLARSITVKMLGRLSALRELFRAKHGSFPTNLS-----  382

Query  542   MTIDieapigeeerreegaVDPTRCEDGM---------EELLSEPSSLVGLESACDEFYD  694
              + ++       +  + G  D +  E GM         E+  SE SSLV L    DEF+D
Sbjct  383   -SGELIRSARLSQNEDGGFGDSSLSESGMFKDNANAEAEKFPSERSSLVDLNDGVDEFFD  441

Query  695   VLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDS  874
             V EPSD+D  +    S   S  +  ++ Q K++SAT+L+KK HDLAVQK+GYVDL E   
Sbjct  442   VPEPSDNDHLDDSWTSDFDSDRYSQESRQPKLNSATSLVKKLHDLAVQKRGYVDLHERAR  501

Query  875   EE-SEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
             EE S PCCYG TL  D   + PCSW   DPS+FLIRGK Y +D +K+KAK  LM+MVAAD
Sbjct  502   EEISVPCCYGSTLPTDPTCALPCSWTTTDPSTFLIRGKTYLEDQKKVKAKGKLMEMVAAD  561

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             WLKSD+R+DDL  RPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ P
Sbjct  562   WLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEHP  621

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LL  FVNGDDA+RNSRFKLIPYISK S
Sbjct  622   LLVSFVNGDDAYRNSRFKLIPYISKGS  648


 Score = 68.2 bits (165),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  646   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  677



>ref|XP_009621797.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Nicotiana tomentosiformis]
Length=730

 Score =   522 bits (1344),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 281/437 (64%), Positives = 331/437 (76%), Gaps = 3/437 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +GSVIEHLDGHTDI+H  L   W
Sbjct  199   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVIEHLDGHTDIVHKLLNRDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLL+RYWRREDDGTYVILYHSV HQKCPPQK YIRACLKSGG+VI+P+   
Sbjct  259   LPWGMGRRDLLLQRYWRREDDGTYVILYHSVFHQKCPPQKGYIRACLKSGGYVISPVNQE  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLSFSLA  538
             K SVVKHMLA+DWK WKS+++ +++RSITI MLG +AALRE+F AK GN+  S++S  L 
Sbjct  319   KRSVVKHMLAIDWKFWKSYVRTSAARSITICMLGRLAALRELFSAKIGNYLPSDVSGELV  378

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSddd  718
             +     +     +   +    +     D  EE++  PSSL+GL  A DEF+DV EP  D 
Sbjct  379   KSKRLRQVEEEIKLEVQTRLENGKNLADLEEEVVKTPSSLMGLNDAADEFFDVSEP-LDY  437

Query  719   deegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCC  895
             D+   GW S   PE +  DA   K+SSA   +KK HDLAVQK+GYVDL E+  E++  C 
Sbjct  438   DQSENGWPSDFGPETYSQDARHPKLSSAAVFVKKLHDLAVQKRGYVDLHEMAKEDTSSCH  497

Query  896   YGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQ  1075
             YG TL +DS  S PCSW   DPS+FLIRG  Y  D +KIKAK TLMQMV ADWLKSD+R+
Sbjct  498   YGSTLPKDSTCSLPCSWTETDPSTFLIRGLTYLDDRKKIKAKGTLMQMVGADWLKSDKRE  557

Query  1076  DDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNG  1255
             DDL GRPGGIVQK+AA   PEFF IV+IQVPG+TTYSLALYYM+  PLED+PLLE FV G
Sbjct  558   DDLGGRPGGIVQKYAAKGGPEFFFIVHIQVPGTTTYSLALYYMMDTPLEDSPLLESFVKG  617

Query  1256  DDAFRNSRFKLIPYISK  1306
             DDA+RNSRFKLIPYISK
Sbjct  618   DDAYRNSRFKLIPYISK  634


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G WIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  634   KGPWIVKQSVGKKACLIGQALEINYFRGKNYI  665



>gb|KCW85749.1| hypothetical protein EUGRSUZ_B02509 [Eucalyptus grandis]
 gb|KCW85750.1| hypothetical protein EUGRSUZ_B02509 [Eucalyptus grandis]
Length=716

 Score =   521 bits (1343),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 277/437 (63%), Positives = 326/437 (75%), Gaps = 4/437 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH ++MAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +G+V+EHLDGHTDIIH QLY+ W
Sbjct  190   DHPAVMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGTVVEHLDGHTDIIHKQLYSDW  249

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM  RDLLLRRYWRREDDGTYVILYHSV H+KC PQK ++RACLKSGG+VITP+  G
Sbjct  250   LPWGMKCRDLLLRRYWRREDDGTYVILYHSVFHKKCLPQKGFVRACLKSGGYVITPVNQG  309

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + SVVKHMLA+DWK WKS+++ +S RSITI+MLG VAALRE+F AK GN  SN  FS  E
Sbjct  310   EQSVVKHMLAIDWKYWKSYIRTSSGRSITIKMLGRVAALRELFLAKIGNFCSN--FSSGE  367

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             ++ ++        +            DG  +  SE +SLV L  A DEF+DV EPSDD  
Sbjct  368   LSRNVMLHDDRLVQSLRDGRAAEEMSDGSAKAPSEHASLVSLNDAADEFFDVPEPSDDQS  427

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
             E    WS    PE        ++S+A   ++K HDLAVQK+GYVDLQE+  E+   CCYG
Sbjct  428   ESS--WSHDFVPEISPQGRHPRLSTAAGFVRKLHDLAVQKRGYVDLQEMVIEDIVSCCYG  485

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
              TL +D       SW   DPS+FLIRGK Y KDH+K+KAK TLMQMVAADWL+SD+R+DD
Sbjct  486   TTLPKDPTCMLTSSWTAADPSTFLIRGKNYLKDHQKVKAKGTLMQMVAADWLRSDKREDD  545

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             L GRPG IVQK+AA    EFF IVNIQVPGSTTYSLALYYM+  PL+D PLLE FV GDD
Sbjct  546   LGGRPGSIVQKYAAQGGAEFFFIVNIQVPGSTTYSLALYYMMSTPLKDAPLLENFVKGDD  605

Query  1262  AFRNSRFKLIPYISKVS  1312
             A+RNSRFKLIPYISK S
Sbjct  606   AYRNSRFKLIPYISKGS  622


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQAL++NYF G NYL
Sbjct  620   KGSWIVKQSVGKKACLIGQALQINYFYGSNYL  651



>ref|XP_007206425.1| hypothetical protein PRUPE_ppa001967mg [Prunus persica]
 gb|EMJ07624.1| hypothetical protein PRUPE_ppa001967mg [Prunus persica]
Length=735

 Score =   521 bits (1343),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 278/443 (63%), Positives = 338/443 (76%), Gaps = 7/443 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +G+V+EHLDGHTDIIH QLY+ W
Sbjct  199   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQLYSDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+P+  G
Sbjct  259   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPVNQG  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK WKS+L+ +S+RS+TI+MLG VAALRE+FRAK GN+SS+  FS  E
Sbjct  319   KQSVVKHMLAIDWKFWKSYLQTSSARSMTIKMLGRVAALRELFRAKLGNYSSS-EFSSGE  377

Query  542   M--TIDieapigeeerreegaVDPTRCEDGMEELL----SEPSSLVGLESACDEFYDVLE  703
             +     +    G+ E          R ++ + E +    SE +SL+ L  A DEF+DV E
Sbjct  378   LRRNFRLHQNEGDGEADVPTLTGNERTKENIAEEVEKSPSEHASLISLNDASDEFFDVPE  437

Query  704   PSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             P   D  E +      S  +  D +  K+S+A   +K+ HDLAVQK+GYVDLQE+  E++
Sbjct  438   PPYSDQSETDWTPDFGSEMYSQDTHHPKLSTAAGFVKRLHDLAVQKRGYVDLQEMAREDN  497

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               C YG TL +DS  +  CSW   DPS+FLIRGK Y +D++K+KAK TLMQMVAADWL+S
Sbjct  498   MSCYYGSTLPKDSTCNLACSWTASDPSTFLIRGKNYLEDNKKVKAKGTLMQMVAADWLRS  557

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL GRPG IVQK+AA    EFF IVNIQVPGSTTYSLALYYM+ +P+ED PLLE 
Sbjct  558   DKREDDLGGRPGSIVQKYAAQGGREFFFIVNIQVPGSTTYSLALYYMMNSPVEDAPLLES  617

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             F+ GDDA+RNSRFKLIPYISK S
Sbjct  618   FIKGDDAYRNSRFKLIPYISKGS  640


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF GKNYL
Sbjct  638   KGSWIVKQSVGKKACLIGQALEINYFHGKNYL  669



>gb|EYU36177.1| hypothetical protein MIMGU_mgv1a003017mg [Erythranthe guttata]
Length=615

 Score =   517 bits (1332),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 279/447 (62%), Positives = 337/447 (75%), Gaps = 16/447 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFC+ +GSVIEHLDGH+DI+H+ LY HW
Sbjct  81    DHPAIMAVGVVDATSEAIFQTLMSLGPSRSEWDFCYYKGSVIEHLDGHSDIVHMLLYRHW  140

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV+H KCPP++ Y+RACLKSGG+VI+P   G
Sbjct  141   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVIHHKCPPKRHYVRACLKSGGYVISPANQG  200

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               SVVKHMLA+DWK WKS+++ +++RSITI MLG +AALRE+FRAK    +S+  FS  E
Sbjct  201   NRSVVKHMLAIDWKFWKSYVQTSAARSITISMLGRLAALRELFRAKLDCSASD--FSSGE  258

Query  542   MTIDieapigeeerreegaVDPTRCEDG---------MEELLSEPSSLVGLESACDEFYD  694
             +  +       +E + E      R E+G         M +  SE SSLVGL  A DEF+D
Sbjct  259   LMSNNSTQQTRKELKVEVQ---ARLENGQNRRSMDEDMVKTPSERSSLVGLNDAADEFFD  315

Query  695   VLEPSddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             V EP  + D+   GW S  +P+ +  DA Q K+SSA   +K+ HDLAVQKKGY DL EV 
Sbjct  316   VPEP-IEYDQSENGWPSDFAPDSYSQDARQPKLSSAAVFVKRLHDLAVQKKGYADLHEVA  374

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
              E+S  C YG TL +D   ++ CSW   DPS+FLIRGK Y  D +KIKA+ TLM+MV AD
Sbjct  375   REDSLSCKYGYTLSKDPTCNSLCSWTSTDPSTFLIRGKTYLDDRKKIKARGTLMEMVGAD  434

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             WL+SD+R+DDL GRPGGIVQK+AA   PEFF IVNIQVPGSTTY+LALYYM+  PLE+ P
Sbjct  435   WLRSDKREDDLGGRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYNLALYYMMNTPLEEAP  494

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLE FVNGDD++RNSRFKLIPYISK S
Sbjct  495   LLESFVNGDDSYRNSRFKLIPYISKGS  521


 Score = 65.9 bits (159),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+GKNYL
Sbjct  519   KGSWIVKQSVGKKACLVGQALEINYFRGKNYL  550



>emb|CDY04553.1| BnaA07g13790D [Brassica napus]
Length=731

 Score =   521 bits (1342),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 279/439 (64%), Positives = 328/439 (75%), Gaps = 4/439 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +F+TL+SLGPSRSEWDFCF +GSV+EHLDGHTDIIH QLY+ W
Sbjct  199   DHPAIMAVGVVDGTSENIFQTLLSLGPSRSEWDFCFFQGSVVEHLDGHTDIIHKQLYSDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD  LRRYWRREDDGTYVILYHSV H+KCPPQK YIRACLKSGG+VI+PI  G
Sbjct  259   LPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYIRACLKSGGYVISPIDNG  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSL-A  538
             K SVVKHMLAVDWK W+S++K + +RSIT++MLG ++ALRE+FRAK G+  S+   S  A
Sbjct  319   KQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAKHGSFPSSGELSRSA  378

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSddd  718
              +  +            E   DP   E   ++  SE SSLV L    DEF+DV EPSD+D
Sbjct  379   RLNQESGFGESSSLTECEMYKDPANEE--RDKFPSERSSLVDLNDGVDEFFDVPEPSDND  436

Query  719   deegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE-PCC  895
               +    S   S  +  D  Q K++SA++L++K HDLAVQK+GYVDL E   EES  PCC
Sbjct  437   HLDDNWASDFDSDTYSQDTRQPKLNSASSLVRKIHDLAVQKRGYVDLHERAREESSTPCC  496

Query  896   YGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQ  1075
             YG TL  D   + PCSW   DPS+FLIRGK Y  D +K+ AK TLMQMVAADWLKSD+R+
Sbjct  497   YGTTLPTDPTCALPCSWTTTDPSTFLIRGKTYLSDQKKVTAKGTLMQMVAADWLKSDKRE  556

Query  1076  DDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNG  1255
             DDL  RPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ PLL  FVNG
Sbjct  557   DDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEHPLLVSFVNG  616

Query  1256  DDAFRNSRFKLIPYISKVS  1312
             DDA+RNSRFKLIPYISK S
Sbjct  617   DDAYRNSRFKLIPYISKGS  635


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+GKNY+
Sbjct  633   KGSWIVKQSVGKKACLVGQALEINYFRGKNYI  664



>ref|XP_008245285.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Prunus mume]
Length=738

 Score =   521 bits (1342),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 278/443 (63%), Positives = 338/443 (76%), Gaps = 7/443 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +G+V+EHLDGHTDIIH QLY+ W
Sbjct  202   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQLYSDW  261

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+P+  G
Sbjct  262   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPVNQG  321

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK WKS+L+ +S+RS+TI+MLG VAALRE+FRAK GN+SS+  FS  E
Sbjct  322   KQSVVKHMLAIDWKFWKSYLQTSSARSMTIKMLGRVAALRELFRAKLGNYSSS-EFSSGE  380

Query  542   M--TIDieapigeeerreegaVDPTRCEDGMEELL----SEPSSLVGLESACDEFYDVLE  703
             +     +    G+ E      +   R ++ + E +    SE +SL+ L  A DEF+DV E
Sbjct  381   LRRNFRLHQNEGDGEADVPTLMGNERTKENIAEEVEKSPSEHASLISLNDASDEFFDVPE  440

Query  704   PSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             P   D  E +      S  +  D +  K+S+A   +K+ HDLAVQK+GYVDLQE+  E+S
Sbjct  441   PPYSDQSETDWTPDFGSEMYSQDMHHPKLSTAAGFVKRLHDLAVQKRGYVDLQEMAREDS  500

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               C YG TL +DS  +  CSW   DPS+FLIRGK Y +D++K+KAK TLMQMVAADWL+S
Sbjct  501   MSCYYGSTLPKDSTCNLACSWTASDPSTFLIRGKNYLEDNKKVKAKGTLMQMVAADWLRS  560

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL GRPG IVQK+AA    EFF IVNIQVPGSTTYSL LYYM+ +P+ED PLLE 
Sbjct  561   DKREDDLGGRPGSIVQKYAAQGGREFFFIVNIQVPGSTTYSLVLYYMMNSPVEDAPLLES  620

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             F+ GDDA+RNSRFKLIPYISK S
Sbjct  621   FIKGDDAYRNSRFKLIPYISKGS  643


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSW+VKQSVGKKACLIGQALE+NYF GKNYL
Sbjct  641   KGSWLVKQSVGKKACLIGQALEINYFHGKNYL  672



>ref|XP_007150192.1| hypothetical protein PHAVU_005G134300g [Phaseolus vulgaris]
 gb|ESW22186.1| hypothetical protein PHAVU_005G134300g [Phaseolus vulgaris]
Length=734

 Score =   520 bits (1340),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 287/444 (65%), Positives = 336/444 (76%), Gaps = 9/444 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +G V+EHLDGHTDIIH QL++ W
Sbjct  199   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGIVVEHLDGHTDIIHKQLFSDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+P+  G
Sbjct  259   LPWGMQRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPVNKG  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWKCW+S+LK +S+ SITI+MLG VAALRE+F+AK GN SS+  +S  E
Sbjct  319   KQSVVKHMLAIDWKCWRSYLKSSSAHSITIQMLGRVAALRELFKAKLGNCSSS-DYSSGE  377

Query  542   MTIDie---apigeeerreegaVDPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLE  703
             +T   E      G      E   D    ++ +EE+    SE +SLV L  A DEFYDV E
Sbjct  378   LTTKSELHGKEEGITNSDTEIQADENNHDNSVEEVDQTQSEHASLVTLNDADDEFYDVPE  437

Query  704   PSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             PS D DE   GW +  S +   D   QK+S+A   +K+ HDLAVQK+GYVDLQE+  E+S
Sbjct  438   PS-DYDESENGWMTECSHQKSQDIRHQKLSTAANFVKRLHDLAVQKRGYVDLQEMVREDS  496

Query  884   E-PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLK  1060
                C YG TL QD   + PCS    DPS+FLIRG+ Y  D  KIKAK TLMQMVAADW++
Sbjct  497   SITCSYGSTLPQDPTCTLPCSLTEADPSTFLIRGENYLDDRLKIKAKGTLMQMVAADWVR  556

Query  1061  SDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLE  1240
             SD+R+DDL GRPG IVQK+AA   PEFF IVNIQVPGSTTYSLALYYM+  P+ED PLLE
Sbjct  557   SDKREDDLGGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPLLE  616

Query  1241  RFVNGDDAFRNSRFKLIPYISKVS  1312
              F+ GDD FRNSRFKLIPYISK S
Sbjct  617   SFIKGDDTFRNSRFKLIPYISKGS  640


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+GKNYL
Sbjct  638   KGSWIVKQSVGKKACLVGQALEINYFQGKNYL  669



>ref|XP_004487249.1| PREDICTED: uncharacterized protein LOC101507747 [Cicer arietinum]
Length=731

 Score =   520 bits (1339),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 280/442 (63%), Positives = 337/442 (76%), Gaps = 16/442 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +G+V+EHLDGHTDIIH QLY+ W
Sbjct  207   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQLYSDW  266

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCP Q  Y+RACLKSGG+VI+P   G
Sbjct  267   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQIGYVRACLKSGGYVISPANKG  326

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWKCW+S+LK +S+ S+TI+MLG VAALRE+FR ++GN + +  +S  E
Sbjct  327   KQSVVKHMLAIDWKCWRSYLKSSSAYSMTIQMLGRVAALRELFRTRQGNCTLS-DYSSGE  385

Query  542   MTIDieapigeeerree-----gaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEP  706
             +T +  +               G VDPT+         SE +SLV L  A DEFYDV+EP
Sbjct  386   LTRNTSSDTQILADENSHDNSIGEVDPTQ---------SEHASLVSLNDADDEFYDVMEP  436

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE  886
             S+ D+ E E W +  S +   D+  QK S+A   ++K HDLAVQKKGYVDLQE+  E+S 
Sbjct  437   SNCDESENE-WLTECSYQKSQDSRHQKFSTAANFVRKLHDLAVQKKGYVDLQEMVREDSI  495

Query  887   PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSD  1066
              C YG TL +D   + PCS    DPS+FLIRG+ Y +DH KIKAK TLMQMVAADWL+SD
Sbjct  496   TCPYGSTLLKDPTCTLPCSLTEADPSTFLIRGENYLEDHLKIKAKGTLMQMVAADWLRSD  555

Query  1067  RRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERF  1246
             +R+DDL GRPG IVQK+AA   PEFF I+NIQVPGSTTYSLALYYM+  P+ED+P+LE F
Sbjct  556   KREDDLGGRPGSIVQKYAAQGGPEFFFIINIQVPGSTTYSLALYYMMNTPVEDSPMLESF  615

Query  1247  VNGDDAFRNSRFKLIPYISKVS  1312
             + GD+AFRNSRFKLIPYISK S
Sbjct  616   IKGDNAFRNSRFKLIPYISKGS  637


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+GKNYL
Sbjct  635   KGSWIVKQSVGKKACLVGQALEINYFQGKNYL  666



>ref|XP_004251144.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Solanum 
lycopersicum]
Length=730

 Score =   520 bits (1339),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 278/439 (63%), Positives = 332/439 (76%), Gaps = 3/439 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLG SRSEWDFCF +GSVIEHLDGHTDI+H  L   W
Sbjct  199   DHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYKGSVIEHLDGHTDIVHKLLNQDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLL+RYWRREDDGTYVILYHSV HQKC PQK Y+RACLKSGG+VI+P+  G
Sbjct  259   LPWGMTRRDLLLQRYWRREDDGTYVILYHSVFHQKCAPQKGYVRACLKSGGYVISPVNQG  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLSFSLA  538
             K SVVKHMLA+DWK WKS+++ +++RSITIRMLG +AALRE+F AK GN+  S++S  L 
Sbjct  319   KGSVVKHMLAIDWKFWKSYVRTSAARSITIRMLGRLAALRELFSAKIGNYLPSDVSGELI  378

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSddd  718
             +     +     +   +    +     D  EE++  PSSL+GL  A DEF+DV EP  D 
Sbjct  379   KSKRLCQVEEEIKLEVQTRLENGKSVADLEEEVVKTPSSLMGLNDAADEFFDVSEP-LDY  437

Query  719   deegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCC  895
             D+    WSS    E +  DA   K+S+A  ++K+ HDLAVQKKGYVDL E+  E++  C 
Sbjct  438   DQTENDWSSDFGLETYSQDARHPKLSTAAVIVKRLHDLAVQKKGYVDLHEMVKEDASFCH  497

Query  896   YGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQ  1075
             YG TL +DS  + PCSW   DPS+FLIRG+ Y  D +KIKAK TLMQMV ADWLKSD+R+
Sbjct  498   YGSTLPKDSTCNLPCSWTETDPSTFLIRGETYLDDRKKIKAKGTLMQMVGADWLKSDKRE  557

Query  1076  DDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNG  1255
             DDL GRPGGIVQK+AA   PEFF IVNIQVPG TTY+LALYYM+  PLED+PLLE FV G
Sbjct  558   DDLGGRPGGIVQKYAAKGGPEFFFIVNIQVPGLTTYTLALYYMMDTPLEDSPLLESFVKG  617

Query  1256  DDAFRNSRFKLIPYISKVS  1312
             DDA+RNSRFKLIPYISK S
Sbjct  618   DDAYRNSRFKLIPYISKGS  636


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  634   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  665



>ref|XP_006592703.1| PREDICTED: uncharacterized protein LOC100779206 [Glycine max]
 gb|KHN11217.1| hypothetical protein glysoja_034446 [Glycine soja]
Length=736

 Score =   520 bits (1338),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 281/443 (63%), Positives = 336/443 (76%), Gaps = 8/443 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +G+V+EHLDGHTDIIH QL++ W
Sbjct  202   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQLFSDW  261

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+P+  G
Sbjct  262   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPVNKG  321

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWKCW+S+LK +S+ SITIRMLG VAALRE+F+A+ GN SS+  +S  E
Sbjct  322   KQSVVKHMLAIDWKCWRSYLKSSSAHSITIRMLGRVAALRELFKARLGNCSSS-DYSSGE  380

Query  542   MTIDie---apigeeerreegaVDPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLE  703
             +T + E             E   D    ++ + E+    SE + LV L  A DEFYDV E
Sbjct  381   LTRNSELHIKEEVIINSDTEIQADENNHDNSVGEVDQTQSEHACLVTLNDADDEFYDVPE  440

Query  704   PSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             PS D DE   GW +  S +   D   QK+S+A   +K+ HDLAVQK+GYVDLQE+  E+S
Sbjct  441   PS-DCDESENGWMTECSQQKSQDIRHQKLSTAANFVKRLHDLAVQKRGYVDLQEMVREDS  499

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               C YG TL QD   + PCS    DP +FLIRG+ Y +D +K+KAK TLM+MVAADW++S
Sbjct  500   ITCSYGSTLPQDPTCTLPCSLTETDPYTFLIRGENYLEDRQKVKAKGTLMKMVAADWVRS  559

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL GRPG I QK+AA   PEFF IVNIQVPGSTTYSLALYYM+  P+ED PLLE 
Sbjct  560   DKREDDLGGRPGSIAQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPLLES  619

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             F+ GDDAFRNSRFKLIPYISK S
Sbjct  620   FIKGDDAFRNSRFKLIPYISKGS  642


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  640   KGSWIVKQSVGKKACLVGQALEINYFQGSNYL  671



>gb|KHG05026.1| PCTP-like protein [Gossypium arboreum]
Length=734

 Score =   519 bits (1337),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 277/443 (63%), Positives = 337/443 (76%), Gaps = 7/443 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGVID TSEA+F+TLMSLGPSRSEWDFCF +GSVIEHLDGHTDIIH +LY  W
Sbjct  199   DHPAIMAVGVIDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVIEHLDGHTDIIHKRLYGDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LP GM RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQK YIRACLKSGG+VI+P+   
Sbjct  259   LPMGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKSYIRACLKSGGYVISPLNEE  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLSFSLA  538
             K SVVKHMLA+DWK WK +LK +++RSITIRML  VAALRE+F+AK+G + S+++S    
Sbjct  319   KHSVVKHMLAIDWKFWKFYLKTSAARSITIRMLERVAALRELFKAKQGKYPSADISSGEL  378

Query  539   EMTIDieapigeeerreegaVDPTRCED----GMEELLSEPSSLVGLESACDEFYDVLEP  706
                + ++    +        ++  + ++    GME+  SE SSLVGL  A DEF+DV EP
Sbjct  379   IQAVRLQRSEEDCVVDMCTQIEAGKSKENLSEGMEKASSEHSSLVGLNDAADEFFDVPEP  438

Query  707   SddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             +D D      W S  +PE +  D  Q K+S+A   +KK HDLAVQK+GY+DLQ++  E+ 
Sbjct  439   TDYDQSTDG-WDSDYAPEVYSQDTRQTKLSTAAVFVKKLHDLAVQKRGYMDLQDMTKEDG  497

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               C YG TL +D   + PCSW   +PS+FLIRG+ Y +D +K KAK TLMQMVAADWL+S
Sbjct  498   ICCSYGNTLPKDPTCTLPCSWTAAEPSTFLIRGENYLEDCKKFKAKGTLMQMVAADWLRS  557

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL GRPGGIVQK+AA   PEFF IVNIQVPGS TYSLALYY++  P+ED+PLL  
Sbjct  558   DKREDDLGGRPGGIVQKYAAQGGPEFFFIVNIQVPGSATYSLALYYIMNTPVEDSPLLYN  617

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             F+NGDDA+RNSRFKLIPYISK S
Sbjct  618   FINGDDAYRNSRFKLIPYISKGS  640


 Score = 68.6 bits (166),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNYL
Sbjct  638   KGSWIVKQSVGKKACLIGQALEINYFRGKNYL  669



>emb|CDP07099.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   519 bits (1336),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 290/448 (65%), Positives = 336/448 (75%), Gaps = 16/448 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGVID +SEA+F+TLMSLGPSRSEWDFC  +GSVIEHLDGHTDI+H  LY +W
Sbjct  188   DHPAIMAVGVIDGSSEAIFQTLMSLGPSRSEWDFCLYKGSVIEHLDGHTDIVHKLLYRNW  247

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM  RDLLLRRYWRREDDGTYVILYHSV HQ+CPPQ  Y+RACLKSGG VI+P+  G
Sbjct  248   LPWGMKPRDLLLRRYWRREDDGTYVILYHSVFHQRCPPQVGYVRACLKSGGFVISPVNQG  307

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVV+HMLA+DWK WKS+L+ +S+RSITIRMLG +AALRE+FRAK GN+S +  FS  E
Sbjct  308   KQSVVRHMLAIDWKFWKSYLQTSSARSITIRMLGRLAALRELFRAKLGNNSVS-DFSSGE  366

Query  542   MTIDieapigeeerreegaVDPTRCEDGM-------EELLSEPS---SLVGLESACDEFY  691
             +T +       E  R E    PTR E          EE++  PS   SL+GL  A DEF+
Sbjct  367   LTKESRLHQIGEGLRIEV---PTRLETRKSIDDAEGEEVVKTPSEHASLLGLNDAADEFF  423

Query  692   DVLEPSddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEV  868
             DV EP  D D+   GWSS  S E +  D    K+S+A   +KK HDLAVQK+GYVDLQE+
Sbjct  424   DVPEP-LDYDQSENGWSSDFSSETYSQDTRTPKLSTAAVFVKKLHDLAVQKRGYVDLQEM  482

Query  869   DSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
               E+S  C YG TL +D   +   SW   DPS+FLIRGK Y  DH+KIKA  TLMQMVAA
Sbjct  483   AREDSMSCNYGFTLPKDQTCNLLSSWTETDPSTFLIRGKTYLDDHKKIKANGTLMQMVAA  542

Query  1049  DWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             DWL+SD+R+DDLAGRPG IVQK+AA   PEFF IVNIQVPGSTTY+LALYYM+ + LED 
Sbjct  543   DWLRSDKREDDLAGRPGSIVQKYAAKGGPEFFFIVNIQVPGSTTYNLALYYMMSSSLEDA  602

Query  1229  PLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             PLLERFV GDDA RNSRFKLIPYISK S
Sbjct  603   PLLERFVKGDDADRNSRFKLIPYISKGS  630


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF GKNY+
Sbjct  628   KGSWIVKQSVGKKACLIGQALEINYFHGKNYI  659



>ref|XP_002314279.1| pleckstrin homology domain-containing family protein [Populus 
trichocarpa]
 gb|EEE88234.1| pleckstrin homology domain-containing family protein [Populus 
trichocarpa]
Length=675

 Score =   517 bits (1331),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 278/437 (64%), Positives = 326/437 (75%), Gaps = 32/437 (7%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRS+WDFCF +GSV+EHLDGH DIIH +LYN W
Sbjct  177   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSKWDFCFYKGSVVEHLDGHMDIIHKELYNDW  236

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD LLRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+P+   
Sbjct  237   LPWGMKRRDFLLRRYWRREDDGTYVILYHSVYHKKCPPQKGYVRACLKSGGYVISPVNHE  296

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + SVVKHMLAVDWK WKS+L+ +S+RSITIRML  VAALRE+F+AK GN  S+  FS  E
Sbjct  297   RRSVVKHMLAVDWKSWKSYLRTSSARSITIRMLERVAALRELFKAKLGNCPSS-DFSSGE  355

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             +                         + +++  SE +SLVGL    DEF+DV EPSD   
Sbjct  356   LEC---------------------MNEEVDKTPSEHASLVGLNDPADEFFDVPEPSDY--  392

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                         EF  DA Q K+S+A   +KK H+LAVQK+GYVDLQE+  E+S  CCYG
Sbjct  393   -------DQLENEF-QDARQPKLSTAAGFVKKLHELAVQKRGYVDLQEMVREDSISCCYG  444

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
              TL +D  ++ P SWA  DPSSFLIRGK Y +D +K KA  TLMQMVAADWL+SD+R+DD
Sbjct  445   TTLLKDPTFTLPSSWATADPSSFLIRGKNYLEDQKKFKANGTLMQMVAADWLRSDKREDD  504

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             LAGRPG IVQK+AA   PEFF IVNIQVPGSTTYSLALYYM+  P+ED PLLE F+ GDD
Sbjct  505   LAGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPLLESFIEGDD  564

Query  1262  AFRNSRFKLIPYISKVS  1312
             A+RNSRFKLIPYISK S
Sbjct  565   AYRNSRFKLIPYISKGS  581


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNYL
Sbjct  579   KGSWIVKQSVGKKACLIGQALEMNYFRGKNYL  610



>ref|XP_010264664.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Nelumbo nucifera]
Length=738

 Score =   519 bits (1336),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 278/447 (62%), Positives = 331/447 (74%), Gaps = 12/447 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRTLMSLGPSRSEWDFC  RGSV+EHLDGHTDIIH QL ++W
Sbjct  200   DHPAIMAVGVVDGTSEAIFRTLMSLGPSRSEWDFCIYRGSVVEHLDGHTDIIHKQLNDNW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLL+RYWRREDDGTYVILYHSV  +KC PQK Y+RACLKSGG+VI+P+  G
Sbjct  260   LPWGMRKRDLLLKRYWRREDDGTYVILYHSVFQKKCQPQKGYVRACLKSGGYVISPVNQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DW+ WK +++ +S+RSITIRMLG +AALRE F+AK GN+ S   FS  E
Sbjct  320   KQSVVKHMLAIDWRFWKCYIRTSSARSITIRMLGRIAALREFFKAKVGNYPS-FEFSSGE  378

Query  542   MT---------IDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYD  694
             +T         I+      +         +    ++ +E+  S+ +SL+ L    DEF+D
Sbjct  379   LTQCIGLPQNEIEDLKVEVQTPSENIMTKEVDLMKEEVEKQSSKSASLLVLNDVADEFFD  438

Query  695   VLEPSddddeegegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             V EPSD D  E   WSS  SPE    D    K+S+AT  +KK HDLAVQK+GY+DLQE+ 
Sbjct  439   VPEPSDFDPSENG-WSSNMSPEIHPQDLRHPKLSTATGFVKKLHDLAVQKRGYMDLQEMA  497

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
              E+S  CCYG TL +DS  +  CSW   DPS+FLIRG  Y  DH+K+KAK TLMQMV AD
Sbjct  498   REDSISCCYGATLPKDSCCNLACSWTTADPSTFLIRGDNYLIDHQKMKAKGTLMQMVGAD  557

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             WLKSD+R+DDL GRPGGIVQ+ A    PEFF IVNIQVPGST YSL LYYM+  PLEDTP
Sbjct  558   WLKSDKREDDLGGRPGGIVQQSATKGGPEFFFIVNIQVPGSTKYSLVLYYMMSTPLEDTP  617

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLE FVNGDD +RNSRFK+IPYISK S
Sbjct  618   LLESFVNGDDTYRNSRFKIIPYISKGS  644


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQAL++NYF GKNYL
Sbjct  642   KGSWIVKQSVGKKACLVGQALKINYFHGKNYL  673



>emb|CDX71361.1| BnaC04g15960D [Brassica napus]
Length=733

 Score =   518 bits (1335),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 279/439 (64%), Positives = 331/439 (75%), Gaps = 2/439 (0%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +F+TL+SLGPSRSEWDFCF +GSV+EHLDGHTDIIH QLY+ W
Sbjct  199   DHPAIMAVGVVDGTSENIFQTLLSLGPSRSEWDFCFFQGSVVEHLDGHTDIIHKQLYSDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD  LRRYWRREDDGTYVILYHSV H+KCPPQK YIRACLKSGG+VI+PI  G
Sbjct  259   LPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYIRACLKSGGYVISPIDNG  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSL-A  538
             K SVVKHMLAVDWK W+S++K + +RSIT++MLG ++ALRE+FRAK G+  S+   S  A
Sbjct  319   KQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAKHGSFPSSGELSRSA  378

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSddd  718
              +  + E+  GE     E  +      +  ++  SE SSLV L    DEF+DV EPSD+D
Sbjct  379   RLNQNEESGFGESSSLTECEMYKDPANEERDKFPSERSSLVDLNDGVDEFFDVPEPSDND  438

Query  719   deegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE-PCC  895
               +    S   S  +  D  Q K++SA++L++K HDLAVQK+GYVDL E   EES  PCC
Sbjct  439   HLDDNWASDFDSDTYSQDTRQPKLNSASSLVRKIHDLAVQKRGYVDLHERAREESSTPCC  498

Query  896   YGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQ  1075
             YG TL  D   + PCSW   DPS+FLIRGK Y  D +K+ AK TLMQMVAADWLKSD+R+
Sbjct  499   YGTTLPTDPTCALPCSWTTTDPSTFLIRGKTYLSDQKKVTAKGTLMQMVAADWLKSDKRE  558

Query  1076  DDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNG  1255
             DDL  RPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ PLL  FVNG
Sbjct  559   DDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEHPLLVSFVNG  618

Query  1256  DDAFRNSRFKLIPYISKVS  1312
             DDA+RNSRFKLIPYISK S
Sbjct  619   DDAYRNSRFKLIPYISKGS  637


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+GKNY+
Sbjct  635   KGSWIVKQSVGKKACLVGQALEINYFRGKNYI  666



>ref|XP_010043759.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Eucalyptus 
grandis]
Length=826

 Score =   521 bits (1343),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 277/437 (63%), Positives = 326/437 (75%), Gaps = 4/437 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH ++MAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +G+V+EHLDGHTDIIH QLY+ W
Sbjct  300   DHPAVMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGTVVEHLDGHTDIIHKQLYSDW  359

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM  RDLLLRRYWRREDDGTYVILYHSV H+KC PQK ++RACLKSGG+VITP+  G
Sbjct  360   LPWGMKCRDLLLRRYWRREDDGTYVILYHSVFHKKCLPQKGFVRACLKSGGYVITPVNQG  419

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + SVVKHMLA+DWK WKS+++ +S RSITI+MLG VAALRE+F AK GN  SN  FS  E
Sbjct  420   EQSVVKHMLAIDWKYWKSYIRTSSGRSITIKMLGRVAALRELFLAKIGNFCSN--FSSGE  477

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             ++ ++        +            DG  +  SE +SLV L  A DEF+DV EPSDD  
Sbjct  478   LSRNVMLHDDRLVQSLRDGRAAEEMSDGSAKAPSEHASLVSLNDAADEFFDVPEPSDDQS  537

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
             E    WS    PE        ++S+A   ++K HDLAVQK+GYVDLQE+  E+   CCYG
Sbjct  538   ESS--WSHDFVPEISPQGRHPRLSTAAGFVRKLHDLAVQKRGYVDLQEMVIEDIVSCCYG  595

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
              TL +D       SW   DPS+FLIRGK Y KDH+K+KAK TLMQMVAADWL+SD+R+DD
Sbjct  596   TTLPKDPTCMLTSSWTAADPSTFLIRGKNYLKDHQKVKAKGTLMQMVAADWLRSDKREDD  655

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             L GRPG IVQK+AA    EFF IVNIQVPGSTTYSLALYYM+  PL+D PLLE FV GDD
Sbjct  656   LGGRPGSIVQKYAAQGGAEFFFIVNIQVPGSTTYSLALYYMMSTPLKDAPLLENFVKGDD  715

Query  1262  AFRNSRFKLIPYISKVS  1312
             A+RNSRFKLIPYISK S
Sbjct  716   AYRNSRFKLIPYISKGS  732


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQAL++NYF G NYL
Sbjct  730   KGSWIVKQSVGKKACLIGQALQINYFYGSNYL  761



>ref|XP_010557337.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Tarenaya hassleriana]
Length=737

 Score =   517 bits (1331),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 277/443 (63%), Positives = 334/443 (75%), Gaps = 6/443 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH ++MAVGV+D TSEA+F+TLMSLG SRSEWDFCF +G V+EHLDGH+DIIH QLY+ W
Sbjct  201   DHPAVMAVGVVDGTSEAIFQTLMSLGTSRSEWDFCFYKGCVVEHLDGHSDIIHKQLYSDW  260

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQK YIRACLKSGG+VI+P+  G
Sbjct  261   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYIRACLKSGGYVISPVSNG  320

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLSFSLA  538
             K SVVKHMLAVDWK W+S+LK A +RSIT+RMLG ++ALRE+FRAK G   SS++     
Sbjct  321   KHSVVKHMLAVDWKSWRSYLKPALARSITVRMLGRISALRELFRAKHGGFPSSDMPSGEF  380

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEE----LLSEPSSLVGLESACDEFYDVLEP  706
               ++ + + + +         +  R ++   E    L SE SSLVGL  A DEF+DV EP
Sbjct  381   SRSVRLNSSLEDRAIANSSRRECGRFKETANEETDKLPSEHSSLVGLNDAADEFFDVPEP  440

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE  886
             SD+D       S      +C +++Q K++ A  L+KK HDLAVQK+GYVDL E+  EES 
Sbjct  441   SDNDCPNDSWTSDFDLDTYCQESHQPKLTGAAGLVKKLHDLAVQKRGYVDLHEMTREESS  500

Query  887   -PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
              PCCYG TL  D   + PCSW   DPS+FLIRGK Y +D +K+KAK TLM+M+AADWLKS
Sbjct  501   TPCCYGTTLPNDPTCNVPCSWTETDPSTFLIRGKTYLEDRKKVKAKGTLMKMIAADWLKS  560

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL  RPGGIVQK+A    PEFF IVNIQVPGSTTYSL LYY++  P+E+ PLL  
Sbjct  561   DKREDDLGSRPGGIVQKYAEKGGPEFFFIVNIQVPGSTTYSLVLYYVMSTPIEEHPLLYS  620

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             FVNGDDA+RNSRFKLIPYISK S
Sbjct  621   FVNGDDAYRNSRFKLIPYISKGS  643


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQAL++NYF+GKNY+
Sbjct  641   KGSWIVKQSVGKKACLIGQALDMNYFRGKNYI  672



>ref|XP_010557338.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Tarenaya hassleriana]
Length=735

 Score =   517 bits (1331),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 277/443 (63%), Positives = 334/443 (75%), Gaps = 6/443 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH ++MAVGV+D TSEA+F+TLMSLG SRSEWDFCF +G V+EHLDGH+DIIH QLY+ W
Sbjct  199   DHPAVMAVGVVDGTSEAIFQTLMSLGTSRSEWDFCFYKGCVVEHLDGHSDIIHKQLYSDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQK YIRACLKSGG+VI+P+  G
Sbjct  259   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPPQKGYIRACLKSGGYVISPVSNG  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLSFSLA  538
             K SVVKHMLAVDWK W+S+LK A +RSIT+RMLG ++ALRE+FRAK G   SS++     
Sbjct  319   KHSVVKHMLAVDWKSWRSYLKPALARSITVRMLGRISALRELFRAKHGGFPSSDMPSGEF  378

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEE----LLSEPSSLVGLESACDEFYDVLEP  706
               ++ + + + +         +  R ++   E    L SE SSLVGL  A DEF+DV EP
Sbjct  379   SRSVRLNSSLEDRAIANSSRRECGRFKETANEETDKLPSEHSSLVGLNDAADEFFDVPEP  438

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE  886
             SD+D       S      +C +++Q K++ A  L+KK HDLAVQK+GYVDL E+  EES 
Sbjct  439   SDNDCPNDSWTSDFDLDTYCQESHQPKLTGAAGLVKKLHDLAVQKRGYVDLHEMTREESS  498

Query  887   -PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
              PCCYG TL  D   + PCSW   DPS+FLIRGK Y +D +K+KAK TLM+M+AADWLKS
Sbjct  499   TPCCYGTTLPNDPTCNVPCSWTETDPSTFLIRGKTYLEDRKKVKAKGTLMKMIAADWLKS  558

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL  RPGGIVQK+A    PEFF IVNIQVPGSTTYSL LYY++  P+E+ PLL  
Sbjct  559   DKREDDLGSRPGGIVQKYAEKGGPEFFFIVNIQVPGSTTYSLVLYYVMSTPIEEHPLLYS  618

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             FVNGDDA+RNSRFKLIPYISK S
Sbjct  619   FVNGDDAYRNSRFKLIPYISKGS  641


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQAL++NYF+GKNY+
Sbjct  639   KGSWIVKQSVGKKACLIGQALDMNYFRGKNYI  670



>gb|KEH39335.1| pleckstrin-like (PH) and lipid-binding START domain protein [Medicago 
truncatula]
Length=666

 Score =   514 bits (1323),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 275/442 (62%), Positives = 338/442 (76%), Gaps = 7/442 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +G+V+EHLDGHTDIIH QLY+ W
Sbjct  194   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQLYSDW  253

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWG+ RRDLLLRRYWRREDDGTYVILYHSV H+KCP QK Y+RACLKSGG+VI+P  +G
Sbjct  254   LPWGIKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGYVRACLKSGGYVISPANMG  313

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S+LK +S+ S+TI+MLG VAALRE+FR + GN + +  +S  E
Sbjct  314   KQSVVKHMLAIDWKSWRSYLKSSSAYSMTIQMLGRVAALRELFRTRLGNCTLS-DYSSGE  372

Query  542   MTIDieapigeeerreegaV--DPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLEP  706
             +T +      EE    +  +  D    ++ + E+    SE +SLV L  A DEFYDV+EP
Sbjct  373   LTRNRRNSPKEEYASSDTQIQADENNHDNSIGEVEPTQSEHASLVSLNDADDEFYDVMEP  432

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE  886
             S+ D+ E   W +  S +   D   QK+S+A   ++K HDLAV K+GY+DLQE+  EES 
Sbjct  433   SNCDESEKG-WMTECSHQKSQDIRHQKLSTAANFVRKLHDLAVHKRGYMDLQEMVREESI  491

Query  887   PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSD  1066
              C YG TL +D   + PCS    DPS+FLIRG+ Y +DH+K+KAK TLMQMVAADWL+SD
Sbjct  492   SCPYGSTLPKDPTCTLPCSLTEADPSTFLIRGENYLEDHQKVKAKGTLMQMVAADWLRSD  551

Query  1067  RRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERF  1246
             RR+DDL GRPG IVQK+AA   PEFF IVNIQVPGSTTYSLALYYM+  P+ED PLL+ F
Sbjct  552   RREDDLGGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPLLDSF  611

Query  1247  VNGDDAFRNSRFKLIPYISKVS  1312
             + GD+AFRNSRFKLIPYIS+ S
Sbjct  612   IKGDNAFRNSRFKLIPYISEGS  633


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+GKNYL
Sbjct  631   EGSWIVKQSVGKKACLVGQALEINYFQGKNYL  662



>ref|XP_003541992.1| PREDICTED: uncharacterized protein LOC100812931 [Glycine max]
Length=738

 Score =   516 bits (1329),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 284/443 (64%), Positives = 339/443 (77%), Gaps = 8/443 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +G+V+EHLDGHTDIIH QL++ W
Sbjct  204   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQLFSDW  263

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHS+ H+KCPPQK Y+RACLKSGG+VI+P+  G
Sbjct  264   LPWGMKRRDLLLRRYWRREDDGTYVILYHSMFHKKCPPQKGYVRACLKSGGYVISPVNKG  323

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWKCW+ +LK +S+ SITI+MLG VAALRE+F+AK GN SS+  +S  E
Sbjct  324   KQSVVKHMLAIDWKCWRLYLKSSSAHSITIQMLGRVAALRELFKAKLGNCSSS-DYSSGE  382

Query  542   MTIDieapigee---erreegaVDPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLE  703
             +T + E  I EE       E   D    +  + E+    SE +SLV L  A DEFYDV E
Sbjct  383   LTRNRELHIKEEHIINSDTEIQADENNHDISVGEVDQTQSEHASLVTLNDADDEFYDVPE  442

Query  704   PSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             PSD D  E   W +  S +   +   QK+S+A   +K+ HDLAVQK+GYVDLQE+  E+S
Sbjct  443   PSDCDVSENG-WMTECSHQKSQEIRHQKLSTAANFVKRLHDLAVQKRGYVDLQEMVREDS  501

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               C YG TL QDS  + PCS    DPS+FLIRG+ Y +D  K+KAK TLM+MVAADW++S
Sbjct  502   ITCSYGSTLPQDSTCTLPCSLTETDPSTFLIRGENYLEDRLKVKAKGTLMKMVAADWVRS  561

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL GRPG IVQK+AA   PEFF IVNIQVPGSTTYSLALYYM+  P+ED PLLE 
Sbjct  562   DKREDDLGGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPLLES  621

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             F+ GDDAFRNSRFKLIPYISK S
Sbjct  622   FIKGDDAFRNSRFKLIPYISKGS  644


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  642   KGSWIVKQSVGKKACLVGQALEINYFQGSNYL  673



>gb|KEH39334.1| pleckstrin-like (PH) and lipid-binding START domain protein [Medicago 
truncatula]
Length=693

 Score =   514 bits (1324),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 275/442 (62%), Positives = 338/442 (76%), Gaps = 7/442 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +G+V+EHLDGHTDIIH QLY+ W
Sbjct  194   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQLYSDW  253

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWG+ RRDLLLRRYWRREDDGTYVILYHSV H+KCP QK Y+RACLKSGG+VI+P  +G
Sbjct  254   LPWGIKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGYVRACLKSGGYVISPANMG  313

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S+LK +S+ S+TI+MLG VAALRE+FR + GN + +  +S  E
Sbjct  314   KQSVVKHMLAIDWKSWRSYLKSSSAYSMTIQMLGRVAALRELFRTRLGNCTLS-DYSSGE  372

Query  542   MTIDieapigeeerreegaV--DPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLEP  706
             +T +      EE    +  +  D    ++ + E+    SE +SLV L  A DEFYDV+EP
Sbjct  373   LTRNRRNSPKEEYASSDTQIQADENNHDNSIGEVEPTQSEHASLVSLNDADDEFYDVMEP  432

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE  886
             S+ D+ E   W +  S +   D   QK+S+A   ++K HDLAV K+GY+DLQE+  EES 
Sbjct  433   SNCDESEKG-WMTECSHQKSQDIRHQKLSTAANFVRKLHDLAVHKRGYMDLQEMVREESI  491

Query  887   PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSD  1066
              C YG TL +D   + PCS    DPS+FLIRG+ Y +DH+K+KAK TLMQMVAADWL+SD
Sbjct  492   SCPYGSTLPKDPTCTLPCSLTEADPSTFLIRGENYLEDHQKVKAKGTLMQMVAADWLRSD  551

Query  1067  RRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERF  1246
             RR+DDL GRPG IVQK+AA   PEFF IVNIQVPGSTTYSLALYYM+  P+ED PLL+ F
Sbjct  552   RREDDLGGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPLLDSF  611

Query  1247  VNGDDAFRNSRFKLIPYISKVS  1312
             + GD+AFRNSRFKLIPYIS+ S
Sbjct  612   IKGDNAFRNSRFKLIPYISEGS  633


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+GKNYL
Sbjct  631   EGSWIVKQSVGKKACLVGQALEINYFQGKNYL  662



>ref|XP_009103673.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Brassica 
rapa]
Length=733

 Score =   515 bits (1327),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 278/439 (63%), Positives = 330/439 (75%), Gaps = 2/439 (0%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +F+TL+SLGPSRSEWDFCF +GSV+EHLDGHTDIIH QLY+ W
Sbjct  199   DHPAIMAVGVVDGTSENIFQTLLSLGPSRSEWDFCFFQGSVVEHLDGHTDIIHKQLYSDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD  LRRYWRREDDGTYVILYHSV H+KCPPQK YIRACLKSGG+VI+PI  G
Sbjct  259   LPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYIRACLKSGGYVISPIDNG  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSL-A  538
             K SVVKHMLAVDWK W+S++K + +RSIT++MLG ++ALRE+FRAK G+  S+   S  A
Sbjct  319   KQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAKHGSFPSSGELSRSA  378

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSddd  718
              +  + E+  GE     E  +      +  ++  SE SSLV L    DEF+DV EPSD+D
Sbjct  379   RLNQNEESGFGESSSLTECEMYKDPANEERDKFPSERSSLVDLNDGVDEFFDVPEPSDND  438

Query  719   deegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE-PCC  895
               +    S   S  +  D  Q K++SA++L++K HDLAVQK+GYVDL E   EES  PCC
Sbjct  439   HLDDNWASDFDSDTYSQDTRQPKLNSASSLVRKIHDLAVQKRGYVDLHERAREESSTPCC  498

Query  896   YGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQ  1075
             YG TL  D   + PCSW   D S+FLIRGK Y  D +K+ AK TLMQMVAADWLKSD+R+
Sbjct  499   YGTTLPTDPTCALPCSWTTTDSSTFLIRGKTYLSDQKKVTAKGTLMQMVAADWLKSDKRE  558

Query  1076  DDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNG  1255
             DDL  RPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ PLL  FVNG
Sbjct  559   DDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEHPLLVSFVNG  618

Query  1256  DDAFRNSRFKLIPYISKVS  1312
             DDA+RNSRFKLIPYISK S
Sbjct  619   DDAYRNSRFKLIPYISKGS  637


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+GKNY+
Sbjct  635   KGSWIVKQSVGKKACLVGQALEINYFRGKNYI  666



>ref|XP_010089970.1| hypothetical protein L484_008048 [Morus notabilis]
 gb|EXB38684.1| hypothetical protein L484_008048 [Morus notabilis]
Length=787

 Score =   516 bits (1330),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 289/457 (63%), Positives = 337/457 (74%), Gaps = 27/457 (6%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRS+WDFCF  GSV+EHLDGHTDIIH QLY+ W
Sbjct  180   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSQWDFCFYEGSVVEHLDGHTDIIHKQLYSDW  239

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+P+  G
Sbjct  240   LPWGMQRRDLLLRRYWRREDDGTYVILYHSVSHKKCPPQKGYVRACLKSGGYVISPVNQG  299

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK WKS+L+ +S+R+ITIRMLG VAALRE+FRAK+G HSS   +S  E
Sbjct  300   KQSVVKHMLAIDWKFWKSYLRTSSARAITIRMLGRVAALRELFRAKQGYHSSE--YSSGE  357

Query  542   MTIDieapigeeerreegaV---DPTRCEDGMEELLSEPS---SLVGLESACDEFYDVLE  703
             +T +I A   E +   +      D +   +  EE+   PS   SLV L  A DEF+DV E
Sbjct  358   LTRNIGANQNEVDDMFDVRTVTGDGSSMGNIAEEVDKTPSEHASLVSLNDAADEFFDVPE  417

Query  704   PSddddeegegWSSATSPEFCVDANQQ-----KISSATTLMKKFHDLAVQKKGYVDLQEV  868
             P  D D+    W     PEF  + N Q     K+S+A   +KK HDLA+QK+GYVDLQE+
Sbjct  418   PP-DYDQSEADW----VPEFVPEQNLQDVRHPKLSTAAGFVKKLHDLAIQKRGYVDLQEM  472

Query  869   DSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
               E+S  CCYG TL +D   + PCSW   DPS+FLIRGK Y +D  K+KAK TLMQMV A
Sbjct  473   AMEDSVSCCYGSTLPKDPTCALPCSWTTTDPSTFLIRGKSYLEDRLKVKAKGTLMQMVGA  532

Query  1049  DWLKSDRRQDDLAGRPGGIV---------QKHAADDRPEFFLIVNIQVPGSTTYSLALYY  1201
             DWL+SD+R+DDLAGRPG IV         QK+A    PEFF IVNIQVPGS TYSLALYY
Sbjct  533   DWLRSDKREDDLAGRPGSIVQAGLKVFLLQKYAVQGGPEFFFIVNIQVPGSMTYSLALYY  592

Query  1202  MLKAPLEDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             M+   LED PLLE FV GDDAFRNSRFKLIPYISK S
Sbjct  593   MMNTRLEDAPLLESFVKGDDAFRNSRFKLIPYISKGS  629


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF GKNYL
Sbjct  627   KGSWIVKQSVGKKACLIGQALEINYFHGKNYL  658



>ref|XP_011089926.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Sesamum indicum]
Length=730

 Score =   514 bits (1324),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 284/446 (64%), Positives = 335/446 (75%), Gaps = 14/446 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +GSVIEHLDGHTDI+H  LY HW
Sbjct  196   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGSVIEHLDGHTDIVHKILYRHW  255

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV HQKCPP++ Y+RACLKSGG+VI+P+  G
Sbjct  256   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHQKCPPKRGYVRACLKSGGYVISPVNQG  315

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S+L+ +S+RSITI MLG +AALRE+F+AK    S +  FS  E
Sbjct  316   KRSVVKHMLAIDWKFWRSYLQTSSARSITISMLGRLAALRELFKAKVDCSSPD--FSSGE  373

Query  542   MTIDieapigeeerreegaVDPTRCEDGM------EELL---SEPSSLVGLESACDEFYD  694
             +  +      ++E + E     TR E+G       EE +   SE SSLVGL  A DEF+D
Sbjct  374   LMSNNSIQQCKKELKVEVQ---TRVENGQNWEDVEEETVKTPSERSSLVGLHDASDEFFD  430

Query  695   VLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDS  874
             V EP D D  E    S   S  +  DA Q K+S+A   +K+ H+LAVQKKGYVDL E+  
Sbjct  431   VSEPLDYDQSENGWPSDFGSEVYSQDARQPKLSTAAVFVKRLHELAVQKKGYVDLHEMAR  490

Query  875   EESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADW  1054
             E+S  C YG TL +D   +  CSW   DPS+FLIRGK Y  D +KIKAK TLM+MV ADW
Sbjct  491   EDSLSCKYGCTLPKDPTCNLLCSWTETDPSTFLIRGKTYLDDRKKIKAKGTLMEMVGADW  550

Query  1055  LKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPL  1234
             L+SD+R+DDL GRPGGIVQK+AA   PEFF IVNIQVPGSTTY+LALYYM+  P+ED PL
Sbjct  551   LRSDKREDDLGGRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYNLALYYMMSTPIEDAPL  610

Query  1235  LERFVNGDDAFRNSRFKLIPYISKVS  1312
             LE FV GDDA+RNSRFKLIPYISK S
Sbjct  611   LESFVKGDDAYRNSRFKLIPYISKGS  636


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF GKNYL
Sbjct  634   KGSWIVKQSVGKKACLVGQALEINYFHGKNYL  665



>gb|AES67511.2| pleckstrin-like (PH) and lipid-binding START domain protein [Medicago 
truncatula]
Length=727

 Score =   514 bits (1323),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 275/442 (62%), Positives = 338/442 (76%), Gaps = 7/442 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +G+V+EHLDGHTDIIH QLY+ W
Sbjct  194   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQLYSDW  253

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWG+ RRDLLLRRYWRREDDGTYVILYHSV H+KCP QK Y+RACLKSGG+VI+P  +G
Sbjct  254   LPWGIKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGYVRACLKSGGYVISPANMG  313

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S+LK +S+ S+TI+MLG VAALRE+FR + GN + +  +S  E
Sbjct  314   KQSVVKHMLAIDWKSWRSYLKSSSAYSMTIQMLGRVAALRELFRTRLGNCTLS-DYSSGE  372

Query  542   MTIDieapigeeerreegaV--DPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLEP  706
             +T +      EE    +  +  D    ++ + E+    SE +SLV L  A DEFYDV+EP
Sbjct  373   LTRNRRNSPKEEYASSDTQIQADENNHDNSIGEVEPTQSEHASLVSLNDADDEFYDVMEP  432

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE  886
             S+ D+ E   W +  S +   D   QK+S+A   ++K HDLAV K+GY+DLQE+  EES 
Sbjct  433   SNCDESEKG-WMTECSHQKSQDIRHQKLSTAANFVRKLHDLAVHKRGYMDLQEMVREESI  491

Query  887   PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSD  1066
              C YG TL +D   + PCS    DPS+FLIRG+ Y +DH+K+KAK TLMQMVAADWL+SD
Sbjct  492   SCPYGSTLPKDPTCTLPCSLTEADPSTFLIRGENYLEDHQKVKAKGTLMQMVAADWLRSD  551

Query  1067  RRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERF  1246
             RR+DDL GRPG IVQK+AA   PEFF IVNIQVPGSTTYSLALYYM+  P+ED PLL+ F
Sbjct  552   RREDDLGGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPLLDSF  611

Query  1247  VNGDDAFRNSRFKLIPYISKVS  1312
             + GD+AFRNSRFKLIPYIS+ S
Sbjct  612   IKGDNAFRNSRFKLIPYISEGS  633


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+GKNYL
Sbjct  631   EGSWIVKQSVGKKACLVGQALEINYFQGKNYL  662



>ref|XP_006354684.1| PREDICTED: uncharacterized protein LOC102602856 [Solanum tuberosum]
Length=721

 Score =   512 bits (1319),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 268/437 (61%), Positives = 334/437 (76%), Gaps = 12/437 (3%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             +IMAVGVI+ TSEA+FRTLM LGPSR EWDF F RG V+EHLDGHTDI+H+QLYNHWLPW
Sbjct  196   AIMAVGVIEGTSEAIFRTLMCLGPSRIEWDFSFYRGCVVEHLDGHTDIVHIQLYNHWLPW  255

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS  370
             G  RRDLLLRRYWRRE+DGTYVILYHSV+H KCPPQ  Y+RAC+KSGGHVITP K  K S
Sbjct  256   GTKRRDLLLRRYWRREEDGTYVILYHSVIHSKCPPQNGYVRACIKSGGHVITPTKHDKPS  315

Query  371   VVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAEMTI  550
             ++KHM+A+DWK WK ++K+ ++ S+TIR L  +AALREMF+AKEGN+ S LS ++    I
Sbjct  316   IIKHMIAIDWKLWKPYMKKGATVSMTIRFLERIAALREMFKAKEGNYFSELSPTVLTRDI  375

Query  551   D--ieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddde  724
             D  +      +   +   +   R ++  +  +S  S+L  L+ A DEFYDV EPSD++  
Sbjct  376   DLPVSEKEEIKTEVDYKMITDERVKNEAKNPVS--SNLTRLDDAADEFYDVPEPSDNEHH  433

Query  725   egegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD-SEESEPCCYG  901
                 W+S  SPE   ++   K+++A  ++KK HDL VQK+GY+DLQE+   +E    CYG
Sbjct  434   A---WASNASPE---ESYHTKLTTAN-IVKKLHDLTVQKRGYMDLQEMAWDQECVSFCYG  486

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
              TLQ+D ++  PCSWA  DPSSFLIR   Y  D EK+KAK+TLMQMVAADWL+S+RR+DD
Sbjct  487   ATLQKDQSFGMPCSWAAADPSSFLIRADSYLADQEKVKAKSTLMQMVAADWLRSNRREDD  546

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             LA RPGGI Q++A+  RPEFF I+NIQVPG+TTY+LALYYML +PLE+TPLLERFVN DD
Sbjct  547   LASRPGGIAQRYASQGRPEFFFIINIQVPGATTYNLALYYMLTSPLEETPLLERFVNEDD  606

Query  1262  AFRNSRFKLIPYISKVS  1312
             +FRNSRFKLIPYISK S
Sbjct  607   SFRNSRFKLIPYISKGS  623


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV+YF+G+NYL
Sbjct  621   KGSWIVKQSVGKKACLVGQALEVHYFRGRNYL  652



>emb|CBI31451.3| unnamed protein product [Vitis vinifera]
Length=728

 Score =   512 bits (1319),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 271/444 (61%), Positives = 331/444 (75%), Gaps = 7/444 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D T EA+FR LMSLGPSRSEWDFCF +GSV+EHLDGHTDI+H Q Y  W
Sbjct  191   DHPAIMAVGVVDATPEAIFRVLMSLGPSRSEWDFCFYQGSVVEHLDGHTDIVHEQFYRDW  250

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLL++RYWRREDDGTYVIL HSV H+KCP Q+ Y+RACLKSGG+VITP+  G
Sbjct  251   LPWGMKRRDLLMQRYWRREDDGTYVILQHSVFHKKCPQQRSYVRACLKSGGYVITPMDHG  310

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLS-----  526
             K S+VKHMLA DWK WK  L  +S+RSITIRML  VAALRE+F++K G+  S L+     
Sbjct  311   KRSLVKHMLAADWKFWKCCLPASSARSITIRMLERVAALRELFKSKAGSCPSELTSGKLQ  370

Query  527   --FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVL  700
                 L +   D      +++   +        EDG E+L S P+S VGL  A DEF+D  
Sbjct  371   RDMELPQSQEDSIKVEVQKQEEIKKKEKVDLMEDGAEKLPSRPASFVGLNDAADEFFDFP  430

Query  701   EPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEE  880
             E SD ++ E E  S   S    +D +Q K+SSA + +K+ HDLAVQKKGY+DL+EV  E+
Sbjct  431   ELSDGNELENEWPSEQCSSLHSLDIHQPKLSSAASFVKRLHDLAVQKKGYMDLKEVSRED  490

Query  881   SEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLK  1060
                CCYG TL++D N +  CSWA  DPS+FLIRG  Y  DH+KIKA+ TLMQ+V ADWL+
Sbjct  491   DISCCYGSTLEKDPNCTLDCSWAEADPSTFLIRGDNYLVDHQKIKAQKTLMQLVGADWLR  550

Query  1061  SDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLE  1240
             S++R+DDLAGRPG IVQK+A   RPEFF +VN+Q+PG+T Y+LALYYML+ PL+DTPLLE
Sbjct  551   SNKREDDLAGRPGSIVQKYAEWSRPEFFFVVNLQLPGATRYNLALYYMLRTPLKDTPLLE  610

Query  1241  RFVNGDDAFRNSRFKLIPYISKVS  1312
              FVNGDDAFRNSRFKLIPYIS+ S
Sbjct  611   SFVNGDDAFRNSRFKLIPYISQGS  634


 Score = 69.3 bits (168),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             QGSWIVKQSVGKKACL+GQALE NYF+GKNYL
Sbjct  632   QGSWIVKQSVGKKACLVGQALETNYFRGKNYL  663



>ref|NP_180399.2| pleckstrin homology (PH) and lipid-binding START domain-containing 
protein [Arabidopsis thaliana]
 gb|AEC08107.1| pleckstrin homology (PH) and lipid-binding START domain-containing 
protein [Arabidopsis thaliana]
Length=737

 Score =   513 bits (1320),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 282/448 (63%), Positives = 335/448 (75%), Gaps = 16/448 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +F+TL+SLGPSRSEWDFCF +GSV+EHLDGHTDIIH QLY+ W
Sbjct  201   DHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDGHTDIIHKQLYSDW  260

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD  LRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+PI  G
Sbjct  261   LPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPIDNG  320

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFS---  532
             K SVVKHMLAVDWK W+S++K + +RSIT++MLG ++ALRE+FRAK G+   NLS     
Sbjct  321   KQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAKHGSFPPNLSSGELS  380

Query  533   -LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPS  709
               A +T + +   G+   RE      T  E+  ++  SE SSLV L    DEF+DV EPS
Sbjct  381   RSARLTQNEDGVFGDSSLRENEMFKDTANEE-RDKFPSERSSLVDL----DEFFDVPEPS  435

Query  710   ddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE-  886
             D+D+ +    S       C ++ Q K++SAT+L+KK HDLAVQK+GYVDL E   EES  
Sbjct  436   DNDNLDDSWTSDFDLDTCCQESRQPKLNSATSLVKKLHDLAVQKRGYVDLHERAKEESSP  495

Query  887   ------PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
                   PCCYG TL  D +   PCSW   DPS+FLIRGK Y  D +K+KAK TLM+MVAA
Sbjct  496   HATCNPPCCYGTTLPTDPSCDLPCSWTTTDPSTFLIRGKTYLDDQKKVKAKGTLMEMVAA  555

Query  1049  DWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             DWLKSD+R+DDL  RPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ 
Sbjct  556   DWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEH  615

Query  1229  PLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             PLL  FVNGDDA+RNSRFKLIPYISK S
Sbjct  616   PLLVSFVNGDDAYRNSRFKLIPYISKGS  643


 Score = 68.2 bits (165),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  641   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  672



>ref|XP_002274053.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Vitis 
vinifera]
Length=737

 Score =   512 bits (1318),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 271/444 (61%), Positives = 331/444 (75%), Gaps = 7/444 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D T EA+FR LMSLGPSRSEWDFCF +GSV+EHLDGHTDI+H Q Y  W
Sbjct  200   DHPAIMAVGVVDATPEAIFRVLMSLGPSRSEWDFCFYQGSVVEHLDGHTDIVHEQFYRDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLL++RYWRREDDGTYVIL HSV H+KCP Q+ Y+RACLKSGG+VITP+  G
Sbjct  260   LPWGMKRRDLLMQRYWRREDDGTYVILQHSVFHKKCPQQRSYVRACLKSGGYVITPMDHG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLS-----  526
             K S+VKHMLA DWK WK  L  +S+RSITIRML  VAALRE+F++K G+  S L+     
Sbjct  320   KRSLVKHMLAADWKFWKCCLPASSARSITIRMLERVAALRELFKSKAGSCPSELTSGKLQ  379

Query  527   --FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVL  700
                 L +   D      +++   +        EDG E+L S P+S VGL  A DEF+D  
Sbjct  380   RDMELPQSQEDSIKVEVQKQEEIKKKEKVDLMEDGAEKLPSRPASFVGLNDAADEFFDFP  439

Query  701   EPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEE  880
             E SD ++ E E  S   S    +D +Q K+SSA + +K+ HDLAVQKKGY+DL+EV  E+
Sbjct  440   ELSDGNELENEWPSEQCSSLHSLDIHQPKLSSAASFVKRLHDLAVQKKGYMDLKEVSRED  499

Query  881   SEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLK  1060
                CCYG TL++D N +  CSWA  DPS+FLIRG  Y  DH+KIKA+ TLMQ+V ADWL+
Sbjct  500   DISCCYGSTLEKDPNCTLDCSWAEADPSTFLIRGDNYLVDHQKIKAQKTLMQLVGADWLR  559

Query  1061  SDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLE  1240
             S++R+DDLAGRPG IVQK+A   RPEFF +VN+Q+PG+T Y+LALYYML+ PL+DTPLLE
Sbjct  560   SNKREDDLAGRPGSIVQKYAEWSRPEFFFVVNLQLPGATRYNLALYYMLRTPLKDTPLLE  619

Query  1241  RFVNGDDAFRNSRFKLIPYISKVS  1312
              FVNGDDAFRNSRFKLIPYIS+ S
Sbjct  620   SFVNGDDAFRNSRFKLIPYISQGS  643


 Score = 69.3 bits (168),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             QGSWIVKQSVGKKACL+GQALE NYF+GKNYL
Sbjct  641   QGSWIVKQSVGKKACLVGQALETNYFRGKNYL  672



>ref|XP_002880934.1| hypothetical protein ARALYDRAFT_901677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57193.1| hypothetical protein ARALYDRAFT_901677 [Arabidopsis lyrata subsp. 
lyrata]
Length=737

 Score =   512 bits (1318),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 282/448 (63%), Positives = 334/448 (75%), Gaps = 16/448 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +F+TL+SLGPSRSEWDFCF +GSV+EHLDGHTDIIH QLY+ W
Sbjct  201   DHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDGHTDIIHKQLYSDW  260

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD  LRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+PI  G
Sbjct  261   LPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPIDNG  320

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFS---  532
             K SVVKHMLAVDWK W+S++K + +RSIT++MLG ++ALRE+FRAK G+   NLS     
Sbjct  321   KQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAKHGSFPPNLSSGELS  380

Query  533   -LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPS  709
               A +T + +   G+   RE      T  E+  ++  SE SSLV L    DEF+DV EPS
Sbjct  381   RSAGLTQNEDGVFGDSSLRESEMFKDTANEE-RDKFPSERSSLVDL----DEFFDVPEPS  435

Query  710   ddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE-  886
             D+D  +    S       C ++ Q K++SAT+L+KK HDLAVQK+GYVDL E   EES  
Sbjct  436   DNDHLDDSWTSDFDLDTCCQESRQPKLNSATSLVKKLHDLAVQKRGYVDLHERAREESSP  495

Query  887   ------PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
                   PCCYG TL  D +   PCSW   DPS+FLIRGK Y  D +K+KAK TLM+MVAA
Sbjct  496   HAARSPPCCYGTTLPTDPSCDLPCSWTTTDPSTFLIRGKTYLDDQKKVKAKGTLMEMVAA  555

Query  1049  DWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             DWLKSD+R+DDL  RPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ 
Sbjct  556   DWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEH  615

Query  1229  PLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             PLL  FVNGDDA+RNSRFKLIPYISK S
Sbjct  616   PLLVSFVNGDDAYRNSRFKLIPYISKGS  643


 Score = 68.2 bits (165),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  641   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  672



>ref|XP_003597260.1| hypothetical protein MTR_2g094620 [Medicago truncatula]
Length=800

 Score =   513 bits (1322),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 275/442 (62%), Positives = 338/442 (76%), Gaps = 7/442 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +G+V+EHLDGHTDIIH QLY+ W
Sbjct  217   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQLYSDW  276

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWG+ RRDLLLRRYWRREDDGTYVILYHSV H+KCP QK Y+RACLKSGG+VI+P  +G
Sbjct  277   LPWGIKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGYVRACLKSGGYVISPANMG  336

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S+LK +S+ S+TI+MLG VAALRE+FR + GN + +  +S  E
Sbjct  337   KQSVVKHMLAIDWKSWRSYLKSSSAYSMTIQMLGRVAALRELFRTRLGNCTLS-DYSSGE  395

Query  542   MTIDieapigeeerreegaV--DPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLEP  706
             +T +      EE    +  +  D    ++ + E+    SE +SLV L  A DEFYDV+EP
Sbjct  396   LTRNRRNSPKEEYASSDTQIQADENNHDNSIGEVEPTQSEHASLVSLNDADDEFYDVMEP  455

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE  886
             S+ D+ E   W +  S +   D   QK+S+A   ++K HDLAV K+GY+DLQE+  EES 
Sbjct  456   SNCDESEKG-WMTECSHQKSQDIRHQKLSTAANFVRKLHDLAVHKRGYMDLQEMVREESI  514

Query  887   PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSD  1066
              C YG TL +D   + PCS    DPS+FLIRG+ Y +DH+K+KAK TLMQMVAADWL+SD
Sbjct  515   SCPYGSTLPKDPTCTLPCSLTEADPSTFLIRGENYLEDHQKVKAKGTLMQMVAADWLRSD  574

Query  1067  RRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERF  1246
             RR+DDL GRPG IVQK+AA   PEFF IVNIQVPGSTTYSLALYYM+  P+ED PLL+ F
Sbjct  575   RREDDLGGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAPLLDSF  634

Query  1247  VNGDDAFRNSRFKLIPYISKVS  1312
             + GD+AFRNSRFKLIPYIS+ S
Sbjct  635   IKGDNAFRNSRFKLIPYISEGS  656


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+GKNYL
Sbjct  654   EGSWIVKQSVGKKACLVGQALEINYFQGKNYL  685



>ref|XP_006293758.1| hypothetical protein CARUB_v10022718mg [Capsella rubella]
 gb|EOA26656.1| hypothetical protein CARUB_v10022718mg [Capsella rubella]
Length=731

 Score =   511 bits (1316),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 281/442 (64%), Positives = 332/442 (75%), Gaps = 10/442 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +F+TL+SLGPSRSEWDFCF +GSV+EHLDGHTDIIH QLY+ W
Sbjct  201   DHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDGHTDIIHKQLYSDW  260

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD  LRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+PI  G
Sbjct  261   LPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPIDNG  320

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFS---  532
             K SVVKHMLAVDWK W+++++ + +RSIT++MLG ++ALRE+FRAK G+   NLS     
Sbjct  321   KQSVVKHMLAVDWKSWRAYMRPSLARSITVKMLGRLSALRELFRAKHGSFPPNLSSGELS  380

Query  533   -LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPS  709
               A +T + +   G+   RE      T  E+  ++  SE SSLV L    DEF+DV EPS
Sbjct  381   RSARLTQNEDGVFGDSSLRESEMFKDTANEE-RDKFPSERSSLVDL----DEFFDVPEPS  435

Query  710   ddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE-  886
             D+D  E    S       C ++ Q K++SAT L+KK HDLAVQK+GYVDL E   EES  
Sbjct  436   DNDYLEESWTSDFDLDTCCQESRQPKLNSATNLVKKLHDLAVQKRGYVDLHERAREESST  495

Query  887   PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSD  1066
             PCCYG TL  D +   PCSW   DPS+FLIRGK Y  D +K KAK TLM+MVAADWLKSD
Sbjct  496   PCCYGTTLPTDPSCGLPCSWTVTDPSTFLIRGKTYLDDQKKFKAKGTLMEMVAADWLKSD  555

Query  1067  RRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERF  1246
             +R+DDL  RPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ PLL  F
Sbjct  556   KREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEHPLLLSF  615

Query  1247  VNGDDAFRNSRFKLIPYISKVS  1312
             VNGDDA+RNSRFKLIPYISK S
Sbjct  616   VNGDDAYRNSRFKLIPYISKGS  637


 Score = 68.2 bits (165),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  635   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  666



>gb|KDO73325.1| hypothetical protein CISIN_1g004508mg [Citrus sinensis]
Length=741

 Score =   511 bits (1317),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 281/441 (64%), Positives = 332/441 (75%), Gaps = 13/441 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLG SRS        G V+EHLDGHTDIIH QLY+ W
Sbjct  202   DHPAIMAVGVVDGTSEAIFQTLMSLGASRSV-------GCVVEHLDGHTDIIHKQLYSDW  254

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCP QK  +RACLKSGG+VITP+  G
Sbjct  255   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKKCPRQKGSVRACLKSGGYVITPMNHG  314

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWKCW+S+L+ +S+RSITIRMLG VAALRE+FRAK+GN+SS   F   E
Sbjct  315   KKSVVKHMLAIDWKCWRSYLQPSSARSITIRMLGRVAALRELFRAKQGNYSSP-EFLSGE  373

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLEPSd  712
             +T ++     +    +    D    ++  EE+    SE +SLVGL  A DEF+DV EPSD
Sbjct  374   LTRNMRMHQTDGNMVQMPTEDGNSKKNTSEEVDQVSSEHASLVGLNDAADEFFDVPEPSD  433

Query  713   dddeegegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEP  889
              DD E   W+S   PE    D    KIS+A   ++K HDLAVQK+GYVDLQ    E++  
Sbjct  434   YDDSENG-WTSDFGPEMNSQDTRHPKISTAAGFVRKLHDLAVQKRGYVDLQGTAKEDNFS  492

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
             CCYG TLQ+D   + PCSW   DPS+FLIRGK Y +D  K+KAK TLMQMVAADWLKSD+
Sbjct  493   CCYGTTLQKDPTCTLPCSWTSTDPSTFLIRGKNYLQDRHKVKAKGTLMQMVAADWLKSDK  552

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFV  1249
             R+DDL GRPGGIVQK+A    PEFF I+NIQVPGSTTYSLALYYM+  P++D PLLE F+
Sbjct  553   REDDLGGRPGGIVQKYAEQGGPEFFFIINIQVPGSTTYSLALYYMMTTPVKDAPLLESFI  612

Query  1250  NGDDAFRNSRFKLIPYISKVS  1312
             NGDDA+RNSRFKLIPYIS+ S
Sbjct  613   NGDDAYRNSRFKLIPYISEGS  633


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF GKNYL
Sbjct  631   EGSWIVKQSVGKKACLIGQALEINYFHGKNYL  662



>ref|XP_010521753.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Tarenaya hassleriana]
Length=740

 Score =   511 bits (1315),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 276/443 (62%), Positives = 335/443 (76%), Gaps = 6/443 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVG++D TSEA+F TLMSLG SRSEWDFCF +GSV+EHLDGHTDIIH +LY+ W
Sbjct  204   DHPAIMAVGIVDGTSEAIFETLMSLGNSRSEWDFCFYKGSVVEHLDGHTDIIHKKLYSDW  263

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCP QK YIRACLKSGG+VI+P+K G
Sbjct  264   LPWGMQRRDLLLRRYWRREDDGTYVILYHSVFHKKCPSQKGYIRACLKSGGYVISPVKNG  323

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLSFSLA  538
             K SVVKHMLAVDWK W+S+LK + +RSIT+RMLG ++ALRE+FRAK G+  +S LS    
Sbjct  324   KQSVVKHMLAVDWKSWRSYLKPSLARSITVRMLGRISALRELFRAKHGSFPTSVLSSGEL  383

Query  539   EMTIDieapigeeerreegaVDPTR----CEDGMEELLSEPSSLVGLESACDEFYDVLEP  706
               ++ + + + +         +  R      + M++L SE SSLV L  + DEF+DV EP
Sbjct  384   SRSLRLNSNLEDGAIGSSSHKESGRFKEITNEEMDKLPSEHSSLVDLNDSADEFFDVPEP  443

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE  886
             SD+D  +    S       C +++  K++ A +L+KK HDLAVQK+GYV+L E+  EES 
Sbjct  444   SDNDYSDDSWTSDFDLDTCCPESHHPKLTGAASLVKKLHDLAVQKRGYVELHEMTREESS  503

Query  887   -PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
              PCCYG TL  D   S PCSW   DPS+FLIRG  Y +D +K+KAK TL++MVAADWLKS
Sbjct  504   MPCCYGTTLPNDLTCSVPCSWTETDPSTFLIRGNTYLEDRKKVKAKGTLLKMVAADWLKS  563

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL   PGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+ AP+E+ PLL  
Sbjct  564   DKREDDLGSHPGGIVQKYAAQGGPEFFFIVNIQVPGSTTYSLVLYYMMSAPIEEHPLLYS  623

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             FVNGDDA+RNSRFKLIPYISK S
Sbjct  624   FVNGDDAYRNSRFKLIPYISKGS  646


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  644   KGSWIVKQSVGKKACLIGQALELNYFRGKNYI  675



>ref|XP_007220231.1| hypothetical protein PRUPE_ppa002022mg [Prunus persica]
 gb|EMJ21430.1| hypothetical protein PRUPE_ppa002022mg [Prunus persica]
Length=727

 Score =   510 bits (1313),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 272/445 (61%), Positives = 334/445 (75%), Gaps = 10/445 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMA+G++D TSEA+FRTL+SLGPSRSEWDFCF RGSV+EHLDGHTDI+H +LY+ W
Sbjct  191   DHPAIMAIGLVDGTSEAIFRTLLSLGPSRSEWDFCFYRGSVVEHLDGHTDIVHQKLYSDW  250

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLL+RRYWRREDDGTYVILYHSV H+KCPP++ Y+RACLKSGG+VITP+  G
Sbjct  251   LPWGMQRRDLLVRRYWRREDDGTYVILYHSVSHKKCPPKRGYVRACLKSGGYVITPVNQG  310

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K S+V+HMLA+DWK WK +L+ +S+RSITIRML  VAALRE+F AK GN SS   FS  +
Sbjct  311   KQSLVRHMLAIDWKFWKLYLRPSSARSITIRMLERVAALRELFGAKTGNCSSE--FSSGD  368

Query  542   MTIDieapigeeerreegaVDP---TRCEDGM--EELLSEP---SSLVGLESACDEFYDV  697
             +T DI      +   +     P    + EDG+  E+ + +P   +SL GL  A DEF+DV
Sbjct  369   LTRDIRLSQSGKNNIKTEVQHPGEVRKIEDGLLVEDEVEKPEGRASLKGLHDAADEFFDV  428

Query  698   LEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              EP++ D  E E  +  +  +   +    K+SSA  L+KK H+L VQKKGY+DLQEV  E
Sbjct  429   PEPTEYDQFENEWPADLSMEQHSTNIQHPKLSSAAVLVKKLHELRVQKKGYMDLQEVSRE  488

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             E+  C YG TLQ+D + + PCSW   DPSSFLIRG  Y +D +KIKAKNTLMQ+V  DWL
Sbjct  489   ENISCSYGATLQKDPSCALPCSWGSADPSSFLIRGPSYLQDRQKIKAKNTLMQLVGVDWL  548

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SD+R+DDL  R GGIVQK+A     EFF IVNIQVPG+T Y+LA YYMLK PLE+ PLL
Sbjct  549   RSDKREDDLGSRYGGIVQKYAERGGSEFFFIVNIQVPGTTMYTLAFYYMLKTPLEENPLL  608

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
               FVNGDD++RNSRFKLIPYISK S
Sbjct  609   HNFVNGDDSYRNSRFKLIPYISKGS  633


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV+YF+GKNYL
Sbjct  631   KGSWIVKQSVGKKACLVGQALEVHYFRGKNYL  662



>ref|XP_010521754.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Tarenaya hassleriana]
Length=737

 Score =   510 bits (1314),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 276/443 (62%), Positives = 335/443 (76%), Gaps = 6/443 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVG++D TSEA+F TLMSLG SRSEWDFCF +GSV+EHLDGHTDIIH +LY+ W
Sbjct  201   DHPAIMAVGIVDGTSEAIFETLMSLGNSRSEWDFCFYKGSVVEHLDGHTDIIHKKLYSDW  260

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KCP QK YIRACLKSGG+VI+P+K G
Sbjct  261   LPWGMQRRDLLLRRYWRREDDGTYVILYHSVFHKKCPSQKGYIRACLKSGGYVISPVKNG  320

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLSFSLA  538
             K SVVKHMLAVDWK W+S+LK + +RSIT+RMLG ++ALRE+FRAK G+  +S LS    
Sbjct  321   KQSVVKHMLAVDWKSWRSYLKPSLARSITVRMLGRISALRELFRAKHGSFPTSVLSSGEL  380

Query  539   EMTIDieapigeeerreegaVDPTR----CEDGMEELLSEPSSLVGLESACDEFYDVLEP  706
               ++ + + + +         +  R      + M++L SE SSLV L  + DEF+DV EP
Sbjct  381   SRSLRLNSNLEDGAIGSSSHKESGRFKEITNEEMDKLPSEHSSLVDLNDSADEFFDVPEP  440

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE  886
             SD+D  +    S       C +++  K++ A +L+KK HDLAVQK+GYV+L E+  EES 
Sbjct  441   SDNDYSDDSWTSDFDLDTCCPESHHPKLTGAASLVKKLHDLAVQKRGYVELHEMTREESS  500

Query  887   -PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
              PCCYG TL  D   S PCSW   DPS+FLIRG  Y +D +K+KAK TL++MVAADWLKS
Sbjct  501   MPCCYGTTLPNDLTCSVPCSWTETDPSTFLIRGNTYLEDRKKVKAKGTLLKMVAADWLKS  560

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL   PGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+ AP+E+ PLL  
Sbjct  561   DKREDDLGSHPGGIVQKYAAQGGPEFFFIVNIQVPGSTTYSLVLYYMMSAPIEEHPLLYS  620

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             FVNGDDA+RNSRFKLIPYISK S
Sbjct  621   FVNGDDAYRNSRFKLIPYISKGS  643


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  641   KGSWIVKQSVGKKACLIGQALELNYFRGKNYI  672



>ref|XP_010510641.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
Length=731

 Score =   509 bits (1312),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 280/442 (63%), Positives = 329/442 (74%), Gaps = 10/442 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +F+TL+SLGPSRSEWDFCF +GSV+EHLDGHTDIIH Q Y+ W
Sbjct  201   DHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDGHTDIIHKQFYSDW  260

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD  LRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+PI  G
Sbjct  261   LPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPIDNG  320

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFS---  532
               SVVKHMLAVDWK W+S++K + +RSIT++MLG ++ALRE+FRAK G+   NLS     
Sbjct  321   TQSVVKHMLAVDWKSWRSYMKPSLARSITVKMLGRLSALRELFRAKHGSFPPNLSSGELS  380

Query  533   -LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPS  709
               A +T + +   G+   RE      T  E+  ++  SE SSLV L    DEF+DV EPS
Sbjct  381   RSARLTQNEDGEFGDSSLRESEMFKDTANEE-RDKFPSERSSLVDL----DEFFDVPEPS  435

Query  710   ddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE-  886
             D D  E    S   +   C ++ Q K++SAT L+KK HDLAVQK+GYVDL E   EES  
Sbjct  436   DSDYLEDSWTSDFDTETCCQESRQPKLNSATNLVKKLHDLAVQKRGYVDLHERAREESST  495

Query  887   PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSD  1066
              CCYG TL  D   + PCSW   DPS+FLIRGK Y  D +K KAK TLM+MVAADWLKSD
Sbjct  496   SCCYGTTLPTDPTCALPCSWTTTDPSTFLIRGKTYLDDQKKFKAKGTLMEMVAADWLKSD  555

Query  1067  RRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERF  1246
             +R+DDL  RPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ PLL  F
Sbjct  556   KREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEHPLLLSF  615

Query  1247  VNGDDAFRNSRFKLIPYISKVS  1312
             VNGDDA+RNSRFKLIPYISK S
Sbjct  616   VNGDDAYRNSRFKLIPYISKGS  637


 Score = 68.2 bits (165),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  635   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  666



>ref|XP_010319624.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Solanum 
lycopersicum]
Length=700

 Score =   508 bits (1309),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 273/438 (62%), Positives = 334/438 (76%), Gaps = 9/438 (2%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++MAVGVI+ TSEA+FRTLM LG SR EWDF F RG V+EHLDGHTDI+H+QLYNHWLPW
Sbjct  170   AVMAVGVIEGTSEAIFRTLMCLGQSRIEWDFSFYRGCVVEHLDGHTDIVHIQLYNHWLPW  229

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS  370
             G  RRDLLLRRYWRRE+DGTYVILYHSV+H KCPPQ  Y+RAC+KSGGHVITP K  K S
Sbjct  230   GTKRRDLLLRRYWRREEDGTYVILYHSVIHSKCPPQNGYVRACIKSGGHVITPTKHDKPS  289

Query  371   VVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAEMTI  550
             +VKHM+++DWK WK ++K+ ++ S+TIR L  +AALREMF+AKEGN+ S LS ++    I
Sbjct  290   IVKHMISIDWKLWKPYMKKGATVSMTIRFLERIAALREMFKAKEGNYFSELSPAVLTSDI  349

Query  551   DieapigeeerreegaVDPTRCEDGMEELLSEP--SSLVGLESACDEFYDVLEPSdddde  724
             D+     EE + E   VD     D        P  S+L  L+ A DEFYDV EPSDD+  
Sbjct  350   DLPVIEKEEIKIE---VDYKMITDERVNEAKNPVSSNLTRLDDAADEFYDVPEPSDDEHS  406

Query  725   egegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEV-DSEESEPCCY  898
             +   W+S  SPE  C+++   K+++A  ++KK  DL VQKKGY+DLQE+   +E     Y
Sbjct  407   DLA-WASNASPEVGCMESYHTKLTTAN-IVKKLQDLTVQKKGYMDLQEMARDQECVSFFY  464

Query  899   GGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQD  1078
             G TLQ+D ++  PCSWA  DPSSFLIR   Y  D EK+KAK+TL+QMVAADWL+SDRR+D
Sbjct  465   GATLQKDKSFGIPCSWAAADPSSFLIRADSYLADQEKVKAKSTLLQMVAADWLRSDRRED  524

Query  1079  DLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGD  1258
             DLA RPGGIVQ++A+  R EFF I+NIQVPG+TTY+LALYYML +PLE+TPLLERFVNGD
Sbjct  525   DLASRPGGIVQRYASQGRAEFFFIINIQVPGATTYNLALYYMLTSPLEETPLLERFVNGD  584

Query  1259  DAFRNSRFKLIPYISKVS  1312
             D+FRNSRFKLIPYISK S
Sbjct  585   DSFRNSRFKLIPYISKGS  602


 Score = 65.9 bits (159),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV+YF+G+NYL
Sbjct  600   KGSWIVKQSVGKKACLVGQALEVHYFQGRNYL  631



>ref|XP_010470101.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
Length=731

 Score =   509 bits (1310),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 281/443 (63%), Positives = 331/443 (75%), Gaps = 12/443 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +F+TL+SLGPSRSEWDFCF +GSV+EHLDGHTDIIH Q Y+ W
Sbjct  201   DHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDGHTDIIHKQFYSDW  260

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD  LRRYWRREDDGTYVILYHSV H+KCPPQK Y+RACLKSGG+VI+PI  G
Sbjct  261   LPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQKGYVRACLKSGGYVISPIDNG  320

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFS---  532
               SVVKHMLAVDWK W+S++K + +RSIT++MLG ++ALRE+FRAK G+   NLS     
Sbjct  321   TQSVVKHMLAVDWKSWRSYMKPSLARSITVKMLGRLSALRELFRAKHGSFPPNLSSGELS  380

Query  533   -LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPS  709
               A +T + +   G+   RE      T  E+  ++  SE SSLV L    DEF+DV EPS
Sbjct  381   RSARLTQNEDGVFGDSSLRESEMFKDTANEE-RDKFPSERSSLVDL----DEFFDVPEPS  435

Query  710   ddddeegegWSSATSPEFCV-DANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE  886
              D D   + W+S    E C  D+ Q K++SAT L+KK HDLAVQK+GYVDL E   EES 
Sbjct  436   -DSDYLEDSWTSDFDLETCCQDSRQPKLNSATNLVKKLHDLAVQKRGYVDLHERAREESS  494

Query  887   -PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               CCYG TL  D   + PCSW   DPS+FLIRGK Y  D +K KAK TLM+MVAADWLKS
Sbjct  495   TSCCYGTTLPTDPTCALPCSWTTTDPSTFLIRGKTYLDDQKKFKAKGTLMEMVAADWLKS  554

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DD+  RPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ PLL  
Sbjct  555   DKREDDVGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEHPLLLS  614

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             FVNGDDA+RNSRFKLIPYISK S
Sbjct  615   FVNGDDAYRNSRFKLIPYISKGS  637


 Score = 68.2 bits (165),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  635   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  666



>gb|EYU39609.1| hypothetical protein MIMGU_mgv1a002168mg [Erythranthe guttata]
Length=706

 Score =   507 bits (1306),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 278/438 (63%), Positives = 328/438 (75%), Gaps = 16/438 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             +H +IMAVGV++  SE VF TLM+LG SR+EWDFC  +G+V+E LDGHTDIIHLQLYNHW
Sbjct  188   NHPAIMAVGVVNGDSETVFHTLMNLGHSRTEWDFCIYKGNVVEQLDGHTDIIHLQLYNHW  247

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPW M RRDLLLRRYWRREDDGTYVILYHSV H+KCPPQ  Y+RACLKSGG+VITP   G
Sbjct  248   LPWAMKRRDLLLRRYWRREDDGTYVILYHSVFHEKCPPQNGYVRACLKSGGYVITPTNQG  307

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K  VVKHML++DWK WKS++++A+SRSITIRM+G VAALRE+ RAK GN S +  F   E
Sbjct  308   KECVVKHMLSIDWKFWKSYVRKAASRSITIRMVGRVAALRELLRAKSGNTSQD--FLSGE  365

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             +TIDI  P   +E  +    + T+  D   EL S   SL GL  A DEF+DV EPSD   
Sbjct  366   LTIDIGVPRIGKEVIKR---EATQENDKSGEL-SGTYSLAGLSDAADEFFDVPEPSD---  418

Query  722   eegegWSSATSPEFC-VDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCY  898
                         E C V+  Q K+SSA   +KK HDLAVQKKGYVDLQ +  EES    Y
Sbjct  419   ------DDPFDNESCYVEKYQPKLSSAANFVKKLHDLAVQKKGYVDLQAISWEESISYYY  472

Query  899   GGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQD  1078
             G TL +D+++  PCSW+  +PSSFLIRG  Y +D +KI A  TLMQMV ADW+KSD+R+D
Sbjct  473   GATLTKDTSFKIPCSWSISEPSSFLIRGDNYLEDRQKITANGTLMQMVGADWIKSDKRED  532

Query  1079  DLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGD  1258
             DL GR GGIV+K+AA   PEFF I+NIQVPGSTTY+LALYYMLK PL+DTPLLE FVNGD
Sbjct  533   DLGGRFGGIVEKYAAKGGPEFFFIINIQVPGSTTYNLALYYMLKTPLKDTPLLEHFVNGD  592

Query  1259  DAFRNSRFKLIPYISKVS  1312
             ++FRNSRFKLIPYISK S
Sbjct  593   NSFRNSRFKLIPYISKGS  610


 Score = 65.9 bits (159),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVG+KACLIGQAL++NYF+GKNYL
Sbjct  608   KGSWIVKQSVGRKACLIGQALQINYFRGKNYL  639



>gb|KHN21511.1| hypothetical protein glysoja_021091 [Glycine soja]
Length=742

 Score =   508 bits (1307),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 283/447 (63%), Positives = 339/447 (76%), Gaps = 12/447 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFCF +G+V+EHLDGHTDIIH QL++ W
Sbjct  204   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQLFSDW  263

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHS+ H+KCPPQK Y+RACLKSGG+VI+P+  G
Sbjct  264   LPWGMKRRDLLLRRYWRREDDGTYVILYHSMFHKKCPPQKGYVRACLKSGGYVISPVNKG  323

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWKCW+ +LK +S+ SITI+MLG VAALRE+F+AK GN SS+  +S  E
Sbjct  324   KQSVVKHMLAIDWKCWRLYLKSSSAHSITIQMLGRVAALRELFKAKLGNCSSS-DYSSGE  382

Query  542   MTIDieapigee---erreegaVDPTRCEDGMEEL---LSEPSSLVGLESACDEFYDVLE  703
             +T + E  I EE       E   D    +  + E+    SE +SLV L  A DEFYDV E
Sbjct  383   LTRNRELHIKEEHIINSDTEIQADENNHDISVGEVDQTQSEHASLVTLNDADDEFYDVPE  442

Query  704   PSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLA----VQKKGYVDLQEVD  871
             PSD D  E   W +  S +   +   QK+S+A   +K+ HDLA    VQK+GYVDLQE+ 
Sbjct  443   PSDCDVSENG-WMTECSHQKSQEIRHQKLSTAANFVKRLHDLADPVAVQKRGYVDLQEMV  501

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
              E+S  C YG TL QDS  + PCS    DPS+FLIRG+ Y +D  K+KAK TLM+MVAAD
Sbjct  502   REDSITCSYGSTLPQDSTCTLPCSLTETDPSTFLIRGENYLEDRLKVKAKGTLMKMVAAD  561

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             W++SD+R+DDL GRPG IVQK+AA   PEFF IVNIQVPGSTTYSLALYYM+  P+ED P
Sbjct  562   WVRSDKREDDLGGRPGSIVQKYAAQGGPEFFFIVNIQVPGSTTYSLALYYMMNTPVEDAP  621

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLE F+ GDDAFR+SRFKLIPYISK S
Sbjct  622   LLESFIKGDDAFRDSRFKLIPYISKGS  648


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  646   KGSWIVKQSVGKKACLVGQALEINYFQGSNYL  677



>ref|XP_008233315.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Prunus 
mume]
Length=736

 Score =   507 bits (1306),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 274/446 (61%), Positives = 335/446 (75%), Gaps = 12/446 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMA+G++D TSEA+FRTL+SLGPSRSEWDFCF RGSV+EHLDGHTDI+H +LY+ W
Sbjct  200   DHPAIMAIGLVDGTSEAIFRTLLSLGPSRSEWDFCFYRGSVVEHLDGHTDIVHQKLYSDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLL+RRYWRREDDGTYVILYHSV H+KCPP++ Y+RACLKSGG+VITP+  G
Sbjct  260   LPWGMQRRDLLVRRYWRREDDGTYVILYHSVSHKKCPPKRGYVRACLKSGGYVITPVNQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K S+V+HMLA+DWK WK +L+ +S+RSITIRML  VAALRE+F AK GN SS   FS  +
Sbjct  320   KQSLVRHMLAIDWKFWKLYLRPSSARSITIRMLERVAALRELFGAKTGNCSSE--FSSGD  377

Query  542   MTIDieapigeeerreegaVDP---TRCEDGM--EELLSEP---SSLVGLESACDEFYDV  697
              T D+      +   +     P    + E+G+  E+ + +P   +SL GL  A DEF+DV
Sbjct  378   FTGDVRLSQSGKNNIKTEVQHPGEVRKIEEGLLVEDEVEKPEGRASLKGLHDAADEFFDV  437

Query  698   LEPSddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDS  874
              EP++ D  E E WS+  S E    +    K+SSA  L+KK H+L VQKKGY+DLQEV  
Sbjct  438   PEPTEYDQFENE-WSADLSMEQHSTNIQHPKLSSAAVLVKKLHELRVQKKGYMDLQEVSR  496

Query  875   EESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADW  1054
             EE+  C YG TLQ+D + + PCSW   DPSSFLIRG  Y +D +KIKAKNTLMQ+V  DW
Sbjct  497   EENISCSYGATLQKDPSCALPCSWGSADPSSFLIRGPSYLQDRQKIKAKNTLMQLVGVDW  556

Query  1055  LKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPL  1234
             L+SD+R+DDL  R GGIVQK+A     EFF IVNIQVPG+T Y+LA YYMLK PLE+ PL
Sbjct  557   LRSDKREDDLGSRYGGIVQKYAERGGSEFFFIVNIQVPGTTLYTLAFYYMLKTPLEENPL  616

Query  1235  LERFVNGDDAFRNSRFKLIPYISKVS  1312
             L  FVNGDD++RNSRFKLIPYISK S
Sbjct  617   LYNFVNGDDSYRNSRFKLIPYISKGS  642


 Score = 65.9 bits (159),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV+YF+GKNYL
Sbjct  640   KGSWIVKQSVGKKACLVGQALEVHYFRGKNYL  671



>ref|XP_010906508.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X3 [Elaeis guineensis]
Length=698

 Score =   505 bits (1301),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 275/444 (62%), Positives = 329/444 (74%), Gaps = 19/444 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D T EA+FRT+MSLGPSRSEWDFCF  GSVIEHLDGHTDIIH +L++ W
Sbjct  206   DHPAIMAVGVVDATPEAIFRTVMSLGPSRSEWDFCFAHGSVIEHLDGHTDIIHKKLHSDW  265

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV HQ C P++ YIRACLKSGG+VI+P   G
Sbjct  266   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPANQG  325

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               SVVKHMLA+DWK WKS+L  +S+  ITIRMLG VAALRE+FR K GN+S +  FS  +
Sbjct  326   NVSVVKHMLAIDWKFWKSYLFASSAIYITIRMLGRVAALRELFRVKLGNYS-HTDFSSGD  384

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPS----SLVGLESACDEFYDVLEPS  709
             M  +++ P    +  E          +G E   ++P+    S + L  A DEF+DVL+ S
Sbjct  385   MEPEVQLPGENSKSEEFI--------EGSENSSAKPAKTGGSFLQLNDAADEFFDVLDES  436

Query  710   ddddeegegWSS--ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             + +  E   W S     P+   D  Q K+S+A   +++ HDLAVQKKGYVDLQE   E+S
Sbjct  437   EYEQTEAM-WPSDAGMQPQ---DQRQPKLSTAAVFVRRLHDLAVQKKGYVDLQEASMEDS  492

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
              PCCYG TLQ+DS+++  CSWA  DPS+FLIR K Y +D +KIKA  TLMQMVAADWLKS
Sbjct  493   MPCCYGATLQKDSSFTIACSWASADPSTFLIRSKTYLQDRQKIKANGTLMQMVAADWLKS  552

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
              +R+DDL GR GGIVQK+AA    EFF IVNIQVPGSTTYSLALYYM+  P+ED PLLE 
Sbjct  553   SKREDDLGGRAGGIVQKYAAQGGREFFFIVNIQVPGSTTYSLALYYMMDTPVEDVPLLES  612

Query  1244  FVNGDDAFRNSRFKLIPYISKVSI  1315
             F+  DDA+RNSRFKLIPYISK+ I
Sbjct  613   FIREDDAYRNSRFKLIPYISKLGI  636



>ref|XP_010414549.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
Length=731

 Score =   505 bits (1301),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 280/443 (63%), Positives = 330/443 (74%), Gaps = 12/443 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +F+TL+SLGPSRSEWDFCF +GSV+EHLDGHTDIIH Q Y+ W
Sbjct  201   DHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFFQGSVVEHLDGHTDIIHKQFYSDW  260

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD  LRRYWRREDDGTYVILYHSV H+KC PQK Y+RACLKSGG+VI+PI  G
Sbjct  261   LPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCSPQKGYVRACLKSGGYVISPIDNG  320

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFS---  532
               SVVKHMLAVDWK W+S++K + +RSIT++MLG ++ALRE+FRAK G+   NLS     
Sbjct  321   TQSVVKHMLAVDWKSWRSYMKPSLARSITVKMLGRLSALRELFRAKHGSFPPNLSSGELS  380

Query  533   -LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPS  709
               A +T + +   G+   RE      +  E+  ++  SE SSLV L    DEF+DV EPS
Sbjct  381   RSARLTQNEDGVFGDSSLRESEMFKDSANEE-RDKFPSERSSLVDL----DEFFDVPEPS  435

Query  710   ddddeegegWSSATSPEFCV-DANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE  886
              D D   + W+S    E C  D+ Q K++SAT L+KK HDLAVQK+GYVDL E   EES 
Sbjct  436   -DSDYLEDSWTSDFDLETCCQDSRQPKLNSATNLVKKLHDLAVQKRGYVDLHERAREESS  494

Query  887   -PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               CCYG TL  D   + PCSW   DPS+FLIRGK Y  D +K KAK TLM+MVAADWLKS
Sbjct  495   TSCCYGTTLPTDPTCALPCSWTTTDPSTFLIRGKTYLDDQKKFKAKGTLMEMVAADWLKS  554

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL  RPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ PLL  
Sbjct  555   DKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEHPLLLS  614

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             FVNGDDA+RNSRFKLIPYISK S
Sbjct  615   FVNGDDAYRNSRFKLIPYISKGS  637


 Score = 68.2 bits (165),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  635   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  666



>ref|XP_002316372.1| pleckstrin homology domain-containing family protein [Populus 
trichocarpa]
 gb|EEF02543.1| pleckstrin homology domain-containing family protein [Populus 
trichocarpa]
Length=725

 Score =   505 bits (1300),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 269/449 (60%), Positives = 334/449 (74%), Gaps = 16/449 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D T EA+FRTLMSLG SRSEWDFCF RGSV+EHLDGHTDI+H +LY++W
Sbjct  189   DHPAIMAVGVVDGTPEAIFRTLMSLGASRSEWDFCFYRGSVVEHLDGHTDILHKKLYSNW  248

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRRE+DGTYVILYHSV+H+KCPPQK Y+RACLKSGG+VITP+  G
Sbjct  249   LPWGMRRRDLLLRRYWRREEDGTYVILYHSVIHKKCPPQKGYVRACLKSGGYVITPVNQG  308

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-------SSN  520
             + S+VKHMLA+DWK WK +L+  S+RSITIRML  +AALRE+FRAK GNH        S+
Sbjct  309   RESLVKHMLAIDWKFWKVYLRPPSARSITIRMLERIAALRELFRAKSGNHPSDFSSSDSS  368

Query  521   LSFSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVL  700
             +   L +  ++      + +++ E   D    E+  E+  S   SL+ L  A DEF+D  
Sbjct  369   VKTMLPQDGMEDIESEDKGQQKFEQNADLK--ENEAEKTNSGRRSLMSLNDASDEFFDF-  425

Query  701   EPSddddeegegWSSATSPEFCVDAN-----QQKISSATTLMKKFHDLAVQKKGYVDLQE  865
              P  ++D + +   +   PE   +       Q ++SSA   +KK HDLAVQKKGY+D QE
Sbjct  426   -PDSNEDIDFDLLENGWYPEKSQEQPTSHICQHRLSSAAVFVKKLHDLAVQKKGYIDFQE  484

Query  866   VDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVA  1045
             +  EE+    YG TLQ+DS YS PCSWA  +PS+FLIRG+ Y KD++KIKAK +LMQMV 
Sbjct  485   LPKEENVATSYGNTLQKDSTYSLPCSWATAEPSTFLIRGENYLKDNQKIKAKGSLMQMVG  544

Query  1046  ADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLED  1225
             ADWL+SD R+DDL  RP  I+QK+AA  RPEFF ++NIQVPG+T Y++ALYYMLK PLE+
Sbjct  545   ADWLRSDHREDDLGSRPESIIQKYAAQGRPEFFFVINIQVPGATQYTIALYYMLKTPLEE  604

Query  1226  TPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             TPLL  FV+GDDAFRNSRFKLIPYISK S
Sbjct  605   TPLLHSFVHGDDAFRNSRFKLIPYISKGS  633


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE++YF+GKNYL
Sbjct  631   KGSWIVKQSVGKKACLVGQALEIHYFRGKNYL  662



>ref|XP_008807464.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Phoenix dactylifera]
Length=656

 Score =   502 bits (1292),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 273/441 (62%), Positives = 327/441 (74%), Gaps = 15/441 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D T EA+FRT+MSLGPSRSEWDFCF RGSVIEHLDGHTDIIH +L++ W
Sbjct  132   DHPAIMAVGVVDATPEAIFRTVMSLGPSRSEWDFCFARGSVIEHLDGHTDIIHKKLHSDW  191

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV HQ C P++ YIRACLKSGG+VI+P   G
Sbjct  192   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPANQG  251

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               SVVKHMLA+DWK WKS+L  +S+  ITIRMLG VAALRE+FR K GN+S +  FS  +
Sbjct  252   NISVVKHMLAIDWKFWKSYLFASSAICITIRMLGRVAALRELFRVKLGNYS-HTDFSSHD  310

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPS----SLVGLESACDEFYDVLEPS  709
                +++      +  E          +G E+  ++P+    S + L  A DEF+DVL+ S
Sbjct  311   TEPEVQLAGENSKSEEFL--------EGSEKSPAKPAKTSGSFLQLNDAADEFFDVLDES  362

Query  710   ddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEP  889
             + D  E   W+S    +   D  Q K+S+A  L+++ HDLAVQK+GYVDLQ+   E++ P
Sbjct  363   EYDQTEVM-WTSDAGMQ-SQDQRQPKLSTAAVLVRRLHDLAVQKRGYVDLQDASMEDAIP  420

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
             CCYG TLQ DS+++  CSWA  DPS+FLIR K Y +D +KIKA  TLMQMVAADWLKS +
Sbjct  421   CCYGATLQNDSSFTIACSWASADPSTFLIRSKTYLQDRQKIKANGTLMQMVAADWLKSSK  480

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFV  1249
             R+DDL  R GGIVQK+A     EFF IVNIQVPGSTTYSLALYYM+  PLED PLLE FV
Sbjct  481   REDDLGSRAGGIVQKYATQGGREFFFIVNIQVPGSTTYSLALYYMMDTPLEDVPLLENFV  540

Query  1250  NGDDAFRNSRFKLIPYISKVS  1312
              GDDA+RNSRFKLIPYISK S
Sbjct  541   RGDDAYRNSRFKLIPYISKGS  561


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  559   KGSWIVKQSVGKKACLVGQALEINYFRGGNYL  590



>gb|KDP44376.1| hypothetical protein JCGZ_20056 [Jatropha curcas]
Length=585

 Score =   499 bits (1285),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 271/442 (61%), Positives = 333/442 (75%), Gaps = 8/442 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH++IMAVGV+D TSEA+FRTLMSLGP RSEWDFCF RGS++EHLDGHTDIIH QLY+ W
Sbjct  55    DHAAIMAVGVVDGTSEAIFRTLMSLGPLRSEWDFCFFRGSMVEHLDGHTDIIHKQLYSDW  114

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LP  M RRDLLLRRYWRREDDGTYVILYHSV+H+KCPPQ  Y+RACLKSGG VITPI  G
Sbjct  115   LPRWMKRRDLLLRRYWRREDDGTYVILYHSVIHKKCPPQNGYVRACLKSGGFVITPINQG  174

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + S+VKHMLAVDWK WK +L+ ++ R++TIRML  VAALRE+F +++ N++  LS    E
Sbjct  175   RRSLVKHMLAVDWKSWKLYLRPSAERAMTIRMLERVAALRELFNSRDENYADFLSGDSTE  234

Query  542   MTI--DieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdd  715
               +   IE    + E +    ++    ++ +E+     +SL  L S+ DEF+DV + +D 
Sbjct  235   QVVLPQIEKLDFKLEVKGSENIESNLTQNEVEK---TSTSLTCLNSSPDEFFDVPDANDM  291

Query  716   d--deegegWSSATSPEFCVDA-NQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE  886
                +  G  WSS  SPE    + +  ++SSA  ++KK HDLAVQKKGY DL E   E+S 
Sbjct  292   MDFEHMGNDWSSKISPEIQTPSIHPPRLSSAAGIVKKLHDLAVQKKGYTDLHEAAKEDSI  351

Query  887   PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSD  1066
              C +G TLQ+D   S PC+WA  +PSSFLIRG+ Y KD EK+KAK TLMQMV ADWL+SD
Sbjct  352   SCSFGSTLQKDPTCSLPCTWAAAEPSSFLIRGQNYLKDREKVKAKGTLMQMVGADWLRSD  411

Query  1067  RRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERF  1246
             +R+DDL GRP  IVQK+A+ +RPEFF IVNIQVPGST Y+LALYYMLK PLE+TP+L  F
Sbjct  412   QREDDLGGRPESIVQKYASQNRPEFFFIVNIQVPGSTLYTLALYYMLKTPLEETPVLYNF  471

Query  1247  VNGDDAFRNSRFKLIPYISKVS  1312
             VNGDDA+RNSRFKLIPYISK S
Sbjct  472   VNGDDAYRNSRFKLIPYISKGS  493


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE +Y +GKNYL
Sbjct  491   KGSWIVKQSVGKKACLVGQALESHYIRGKNYL  522



>ref|XP_002311087.2| pleckstrin homology domain-containing family protein [Populus 
trichocarpa]
 gb|EEE88454.2| pleckstrin homology domain-containing family protein [Populus 
trichocarpa]
Length=734

 Score =   504 bits (1297),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 271/445 (61%), Positives = 332/445 (75%), Gaps = 8/445 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV++ T EA+F TLMSLG SRSEWDFCF RGSV+EHLDGHTDI+H +LY++W
Sbjct  198   DHPAIMAVGVLNGTPEAIFHTLMSLGASRSEWDFCFYRGSVVEHLDGHTDILHAKLYSNW  257

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD LLRRYWRRE+DGTYVILYHSV+H+KCPPQ  Y+RACLKSGG+VITP+  G
Sbjct  258   LPWGMMRRDFLLRRYWRREEDGTYVILYHSVIHKKCPPQNGYVRACLKSGGYVITPVNKG  317

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + S+VKHMLAV+WK WK +L+Q S RSITIRML  +AALREMF+AK GN+ S+ S + +E
Sbjct  318   RESLVKHMLAVNWKFWKVYLRQPSGRSITIRMLERLAALREMFQAKAGNYPSDFSSADSE  377

Query  542   MTI-----DieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEP  706
             + I     ++E    E++ +++  ++    ED  E+  S   SL+ L  A DEF+DV + 
Sbjct  378   VKIMLPQDEVEDIKSEDKSQQKFELNADLEEDEAEKTTSGRRSLMSLNDASDEFFDVPDS  437

Query  707   Sdddde--egegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              +         GW    S E+   + +Q ++SSA   +KK HDLAVQKKGY+D QE+  E
Sbjct  438   GEVIAFDHLENGWFPEVSQEWPASNMSQPRLSSAAVFVKKLHDLAVQKKGYMDFQELAKE  497

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             E+    +G TLQ+DS  S PCSWA  DP++FLIRG+ Y KD+ KIKA  TLMQMV ADWL
Sbjct  498   ENVATSFGNTLQKDSACSLPCSWATADPTTFLIRGENYFKDNLKIKATGTLMQMVGADWL  557

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SDRR+DDL  R   IVQK AA  RPEFF IVNIQVPG T ++LALYYMLK PLE+TPLL
Sbjct  558   RSDRREDDLGSRAESIVQKFAAQGRPEFFFIVNIQVPGVTQHTLALYYMLKTPLEETPLL  617

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
               FVNGDDAFRNSRFKLIPYISK S
Sbjct  618   HSFVNGDDAFRNSRFKLIPYISKGS  642


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+GKNYL
Sbjct  640   KGSWIVKQSVGKKACLVGQALEMNYFRGKNYL  671



>ref|XP_004291708.1| PREDICTED: uncharacterized protein LOC101295593 [Fragaria vesca 
subsp. vesca]
Length=734

 Score =   504 bits (1297),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 273/443 (62%), Positives = 328/443 (74%), Gaps = 7/443 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+  TSEA+F+TLMSLGPSRSEWDFCF  GSV+EHLDGHTDIIH QLY+ W
Sbjct  199   DHPAIMAVGVVGGTSEAIFQTLMSLGPSRSEWDFCFYNGSVVEHLDGHTDIIHKQLYSDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM  RDLLLRRYWRREDDGTYVILYHSV H+KCP QK Y+RACLKSGG+VI+P+  G
Sbjct  259   LPWGMKPRDLLLRRYWRREDDGTYVILYHSVFHKKCPSQKGYVRACLKSGGYVISPVNQG  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK WKS+L+ +SSR++TI+MLG VAALRE+F+ K GN+SS+  FS  E
Sbjct  319   KHSVVKHMLAIDWKYWKSYLQTSSSRAMTIKMLGRVAALRELFKTKVGNYSSS-EFSSGE  377

Query  542   MTIDieapigeeerreegaV---DPTRCEDGMEELLSEPS---SLVGLESACDEFYDVLE  703
             + I+      +     +      D +  E   EE+   PS   SLV L  A DEF+DV E
Sbjct  378   LRINFGVHQNDGYGEADALTLTGDESTNEHVSEEVERSPSEHASLVSLNDASDEFFDVPE  437

Query  704   PSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             P + D+ E +      S  +  D    K+S+A   +K+ HDLAVQK+GYVDL E+  E+S
Sbjct  438   PPNHDESETDWTPDFGSDIYSQDIRHPKLSTAAGFVKRLHDLAVQKRGYVDLLEMAKEDS  497

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               C YG TL +DS     CSW   DPS+FLIR K Y +D +K+KAK TLMQMVAADWL+S
Sbjct  498   MSCYYGSTLPKDSTCFLACSWTETDPSTFLIRSKSYLEDRKKVKAKGTLMQMVAADWLRS  557

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL  RPG IVQK+AA    EFF IVNIQVPGSTTYSLALYYM+ +P+ED PLLE 
Sbjct  558   DKREDDLGRRPGSIVQKYAAKGGSEFFFIVNIQVPGSTTYSLALYYMMSSPIEDAPLLEN  617

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             F+ GDDA+RNSRFKLIPYIS+ S
Sbjct  618   FIKGDDAYRNSRFKLIPYISQGS  640


 Score = 69.3 bits (168),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             QGSWIVKQSVGKKACLIGQALE+NYF GKNYL
Sbjct  638   QGSWIVKQSVGKKACLIGQALEINYFHGKNYL  669



>ref|XP_010322400.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Solanum 
lycopersicum]
Length=732

 Score =   503 bits (1296),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 283/445 (64%), Positives = 331/445 (74%), Gaps = 17/445 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFC  +GSVIEHLDGHTDI+H  L   W
Sbjct  199   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCHYKGSVIEHLDGHTDIVHKLLRRDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPW M +RDLLL+RYWRREDDGTYVILYHSV HQKCP QK Y+RACLKSGG+VI+P+   
Sbjct  259   LPWSMRKRDLLLQRYWRREDDGTYVILYHSVFHQKCPSQKGYVRACLKSGGYVISPVNQK  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DW+ WKS+L+ +S+R ITI MLG +AALRE+F AK G+ SS  S  L E
Sbjct  319   KQSVVKHMLAIDWRFWKSNLQTSSARYITIHMLGRLAALRELFIAKLGDCSS--SHFLEE  376

Query  542   MTIDieapigeeerreegaVDPTRCEDG-----MEELL----SEPSSLVGLESACDEFYD  694
                D      EE + E      TR E+G     MEE +    SE +SL+GL  A DEF+D
Sbjct  377   HVRDKRLHQIEEVKVEIQ----TRVENGKNMADMEEEVAKSPSEHASLMGLNDASDEFFD  432

Query  695   VLEPSddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             V EP  D D+  +GW S   PE +  D    K+SSA   +KK HDLAV K+GYVDL E  
Sbjct  433   VSEP-LDYDQSEDGWPSDFGPEMYSQDTRHAKLSSAAGFVKKLHDLAVHKRGYVDLHEKA  491

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
              E++  C YG TL +D  ++ PCSWA  DPS+FLIRG+ Y +D +KIKAK TLMQMVAAD
Sbjct  492   KEDALLCHYGSTLPKDPTFNLPCSWAQTDPSTFLIRGETYLEDRKKIKAKGTLMQMVAAD  551

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             WLKSD+R+DDL GRPG IVQK+AA   PEFF IVNIQVPGSTTYSLALYYM+  P+E+ P
Sbjct  552   WLKSDKREDDLGGRPGSIVQKYAAKGGPEFFFIVNIQVPGSTTYSLALYYMMDTPIENAP  611

Query  1232  LLERFVNGDDAFRNSRFKLIPYISK  1306
             LLE FV GDDAFRNSRFKLIPYISK
Sbjct  612   LLESFVKGDDAFRNSRFKLIPYISK  636


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G WIVKQSVGKKACL+G ALE+NYF+GKNYL
Sbjct  636   KGPWIVKQSVGKKACLVGPALEINYFRGKNYL  667



>ref|XP_010906506.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Elaeis guineensis]
Length=730

 Score =   503 bits (1295),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 275/443 (62%), Positives = 328/443 (74%), Gaps = 19/443 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D T EA+FRT+MSLGPSRSEWDFCF  GSVIEHLDGHTDIIH +L++ W
Sbjct  206   DHPAIMAVGVVDATPEAIFRTVMSLGPSRSEWDFCFAHGSVIEHLDGHTDIIHKKLHSDW  265

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV HQ C P++ YIRACLKSGG+VI+P   G
Sbjct  266   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPANQG  325

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               SVVKHMLA+DWK WKS+L  +S+  ITIRMLG VAALRE+FR K GN+S +  FS  +
Sbjct  326   NVSVVKHMLAIDWKFWKSYLFASSAIYITIRMLGRVAALRELFRVKLGNYS-HTDFSSGD  384

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPS----SLVGLESACDEFYDVLEPS  709
             M  +++ P    +  E          +G E   ++P+    S + L  A DEF+DVL+ S
Sbjct  385   MEPEVQLPGENSKSEEFI--------EGSENSSAKPAKTGGSFLQLNDAADEFFDVLDES  436

Query  710   ddddeegegWSS--ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             + +  E   W S     P+   D  Q K+S+A   +++ HDLAVQKKGYVDLQE   E+S
Sbjct  437   EYEQTEAM-WPSDAGMQPQ---DQRQPKLSTAAVFVRRLHDLAVQKKGYVDLQEASMEDS  492

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
              PCCYG TLQ+DS+++  CSWA  DPS+FLIR K Y +D +KIKA  TLMQMVAADWLKS
Sbjct  493   MPCCYGATLQKDSSFTIACSWASADPSTFLIRSKTYLQDRQKIKANGTLMQMVAADWLKS  552

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
              +R+DDL GR GGIVQK+AA    EFF IVNIQVPGSTTYSLALYYM+  P+ED PLLE 
Sbjct  553   SKREDDLGGRAGGIVQKYAAQGGREFFFIVNIQVPGSTTYSLALYYMMDTPVEDVPLLES  612

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             F+  DDA+RNSRFKLIPYISK S
Sbjct  613   FIREDDAYRNSRFKLIPYISKGS  635


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF G NYL
Sbjct  633   KGSWIVKQSVGKKACLVGQALEINYFHGGNYL  664



>ref|XP_011031732.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Populus euphratica]
Length=726

 Score =   503 bits (1294),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 268/442 (61%), Positives = 333/442 (75%), Gaps = 10/442 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV++ T EA+F TLMSLG SRSEWDFCF RGSV+EHLDGHTDI+H +LY++W
Sbjct  198   DHPAIMAVGVLNGTPEAIFHTLMSLGASRSEWDFCFYRGSVVEHLDGHTDILHAKLYSNW  257

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD LLRRYWRRE+DGTYVILYHSV+H+KCPPQ  Y+RACLKSGG+VITP+  G
Sbjct  258   LPWGMMRRDFLLRRYWRREEDGTYVILYHSVIHKKCPPQNGYVRACLKSGGYVITPVNKG  317

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + S+VKHMLAV+WK WK +L+Q S RS+TIRML  +AALREMF+AK GN+ S+ S + +E
Sbjct  318   RESLVKHMLAVNWKFWKVYLRQPSGRSLTIRMLERLAALREMFQAKAGNYPSDFSSADSE  377

Query  542   MTI-----DieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEP  706
             + I     ++E    E++ +++  ++    ED  E+  S   SL+ L  A DEF+DV  P
Sbjct  378   VKIMLPQDEVEDIKSEDKSQQKFELNADLEEDEAEKTTSGRRSLMSLNDASDEFFDV--P  435

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE  886
                +    +   +   PE   + +Q ++SSA   +KK HDLAVQKKGY+D QE+  EE+ 
Sbjct  436   DSGEMIAFDHLENGWFPE---NMSQPRLSSAAVFVKKLHDLAVQKKGYMDFQELAKEENV  492

Query  887   PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSD  1066
                +G TLQ+DS  S PCSWA  DP++FLIRG+ Y +D++KIKA+ TLMQMV ADWL+SD
Sbjct  493   VTSFGNTLQKDSACSLPCSWAPADPTTFLIRGENYFEDNQKIKAEGTLMQMVGADWLRSD  552

Query  1067  RRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERF  1246
             RR+DDL  R   IVQK AA  RPEFF IVNIQVPG T ++LALYYMLK PLE+TPLL  F
Sbjct  553   RREDDLGSRAESIVQKFAARGRPEFFFIVNIQVPGVTQHTLALYYMLKTPLEETPLLHSF  612

Query  1247  VNGDDAFRNSRFKLIPYISKVS  1312
             VNGDDAFRNSRFKLIPYISK S
Sbjct  613   VNGDDAFRNSRFKLIPYISKGS  634


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+GKNYL
Sbjct  632   KGSWIVKQSVGKKACLVGQALEMNYFRGKNYL  663



>ref|XP_011031731.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Populus euphratica]
Length=734

 Score =   502 bits (1292),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 269/445 (60%), Positives = 334/445 (75%), Gaps = 8/445 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV++ T EA+F TLMSLG SRSEWDFCF RGSV+EHLDGHTDI+H +LY++W
Sbjct  198   DHPAIMAVGVLNGTPEAIFHTLMSLGASRSEWDFCFYRGSVVEHLDGHTDILHAKLYSNW  257

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD LLRRYWRRE+DGTYVILYHSV+H+KCPPQ  Y+RACLKSGG+VITP+  G
Sbjct  258   LPWGMMRRDFLLRRYWRREEDGTYVILYHSVIHKKCPPQNGYVRACLKSGGYVITPVNKG  317

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + S+VKHMLAV+WK WK +L+Q S RS+TIRML  +AALREMF+AK GN+ S+ S + +E
Sbjct  318   RESLVKHMLAVNWKFWKVYLRQPSGRSLTIRMLERLAALREMFQAKAGNYPSDFSSADSE  377

Query  542   MTI-----DieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEP  706
             + I     ++E    E++ +++  ++    ED  E+  S   SL+ L  A DEF+DV + 
Sbjct  378   VKIMLPQDEVEDIKSEDKSQQKFELNADLEEDEAEKTTSGRRSLMSLNDASDEFFDVPDS  437

Query  707   Sdddde--egegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              +         GW    S E+   + +Q ++SSA   +KK HDLAVQKKGY+D QE+  E
Sbjct  438   GEMIAFDHLENGWFPEVSQEWPASNMSQPRLSSAAVFVKKLHDLAVQKKGYMDFQELAKE  497

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             E+    +G TLQ+DS  S PCSWA  DP++FLIRG+ Y +D++KIKA+ TLMQMV ADWL
Sbjct  498   ENVVTSFGNTLQKDSACSLPCSWAPADPTTFLIRGENYFEDNQKIKAEGTLMQMVGADWL  557

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SDRR+DDL  R   IVQK AA  RPEFF IVNIQVPG T ++LALYYMLK PLE+TPLL
Sbjct  558   RSDRREDDLGSRAESIVQKFAARGRPEFFFIVNIQVPGVTQHTLALYYMLKTPLEETPLL  617

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
               FVNGDDAFRNSRFKLIPYISK S
Sbjct  618   HSFVNGDDAFRNSRFKLIPYISKGS  642


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+GKNYL
Sbjct  640   KGSWIVKQSVGKKACLVGQALEMNYFRGKNYL  671



>ref|XP_008807473.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Phoenix dactylifera]
Length=736

 Score =   502 bits (1292),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 273/441 (62%), Positives = 327/441 (74%), Gaps = 15/441 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D T EA+FRT+MSLGPSRSEWDFCF RGSVIEHLDGHTDIIH +L++ W
Sbjct  212   DHPAIMAVGVVDATPEAIFRTVMSLGPSRSEWDFCFARGSVIEHLDGHTDIIHKKLHSDW  271

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV HQ C P++ YIRACLKSGG+VI+P   G
Sbjct  272   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPANQG  331

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               SVVKHMLA+DWK WKS+L  +S+  ITIRMLG VAALRE+FR K GN+S +  FS  +
Sbjct  332   NISVVKHMLAIDWKFWKSYLFASSAICITIRMLGRVAALRELFRVKLGNYS-HTDFSSHD  390

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPS----SLVGLESACDEFYDVLEPS  709
                +++      +  E          +G E+  ++P+    S + L  A DEF+DVL+ S
Sbjct  391   TEPEVQLAGENSKSEEFL--------EGSEKSPAKPAKTSGSFLQLNDAADEFFDVLDES  442

Query  710   ddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEP  889
             + D  E   W+S    +   D  Q K+S+A  L+++ HDLAVQK+GYVDLQ+   E++ P
Sbjct  443   EYDQTEVM-WTSDAGMQ-SQDQRQPKLSTAAVLVRRLHDLAVQKRGYVDLQDASMEDAIP  500

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
             CCYG TLQ DS+++  CSWA  DPS+FLIR K Y +D +KIKA  TLMQMVAADWLKS +
Sbjct  501   CCYGATLQNDSSFTIACSWASADPSTFLIRSKTYLQDRQKIKANGTLMQMVAADWLKSSK  560

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFV  1249
             R+DDL  R GGIVQK+A     EFF IVNIQVPGSTTYSLALYYM+  PLED PLLE FV
Sbjct  561   REDDLGSRAGGIVQKYATQGGREFFFIVNIQVPGSTTYSLALYYMMDTPLEDVPLLENFV  620

Query  1250  NGDDAFRNSRFKLIPYISKVS  1312
              GDDA+RNSRFKLIPYISK S
Sbjct  621   RGDDAYRNSRFKLIPYISKGS  641


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  639   KGSWIVKQSVGKKACLVGQALEINYFRGGNYL  670



>ref|XP_006365757.1| PREDICTED: uncharacterized protein LOC102579740 [Solanum tuberosum]
Length=732

 Score =   501 bits (1290),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 277/441 (63%), Positives = 327/441 (74%), Gaps = 9/441 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFC  +GSVIEHLDGHTDI+H  L   W
Sbjct  199   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCHYKGSVIEHLDGHTDIVHKLLRRDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPW M +RDLLL+RYWRREDDGTYVILYHSV HQKCP QK Y+RACLKSGG+VI+P+   
Sbjct  259   LPWSMRKRDLLLQRYWRREDDGTYVILYHSVFHQKCPCQKGYVRACLKSGGYVISPVNQK  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DW+ WKS+L+ +S+R ITI MLG +AALRE+F AK G+ SS  S+ L E
Sbjct  319   KQSVVKHMLAIDWRFWKSNLQTSSTRYITIHMLGRLAALRELFIAKLGDCSS--SYFLEE  376

Query  542   MTIDieapigeeerreegaV--DPTRCEDGMEELLSEPS---SLVGLESACDEFYDVLEP  706
                D      EE + E   +  +     D  EE+   PS   SL+GL  A DEF+DV EP
Sbjct  377   HVRDKRLQQIEEVKVEIQTIVENGKNMADMEEEVAKSPSEHASLMGLNDASDEFFDVSEP  436

Query  707   SddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
               D D+   GW S   PE +  D    ++SSA   +KK HDLAV K+GYVDL E   E++
Sbjct  437   -LDYDQSENGWPSDFGPEMYSQDTRHARLSSAAGFVKKLHDLAVHKRGYVDLHEKAKEDA  495

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               C YG TL +D  ++ PCSWA  DPS+FLIRG+ Y +D +KIKAK TLMQMVAADWLKS
Sbjct  496   LLCHYGSTLPKDPTFNLPCSWAQTDPSTFLIRGETYLEDRKKIKAKGTLMQMVAADWLKS  555

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+R+DDL GRPG IVQK+AA   PEFF IVNIQVPGSTTY+LALYYM+  P+E+ PLLE 
Sbjct  556   DKREDDLGGRPGSIVQKYAAKGGPEFFFIVNIQVPGSTTYTLALYYMMDTPIENAPLLES  615

Query  1244  FVNGDDAFRNSRFKLIPYISK  1306
             FV GDDAFRNSRFKLIPYISK
Sbjct  616   FVKGDDAFRNSRFKLIPYISK  636


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G WIVKQSVGKKACL+G ALE+NYF+GKNYL
Sbjct  636   KGPWIVKQSVGKKACLVGPALEINYFRGKNYL  667



>ref|XP_010253703.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Nelumbo 
nucifera]
Length=735

 Score =   500 bits (1288),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 268/444 (60%), Positives = 323/444 (73%), Gaps = 11/444 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             +H + MAVG++D TSEA+FR LM LGPSRSEWDFC  +GSVIEHLDGHTDIIH +L   W
Sbjct  198   EHPATMAVGIVDGTSEAIFRALMCLGPSRSEWDFCVYQGSVIEHLDGHTDIIHKELTGDW  257

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWG+ RRDLLLRRYWRRE+DGTYVILYHSV H+KC PQK Y+RACLKSGG+VI+P+  G
Sbjct  258   LPWGVRRRDLLLRRYWRREEDGTYVILYHSVFHKKCLPQKGYVRACLKSGGYVISPVNQG  317

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               SVVKHML++DWK WKS++  +S+RSITI+ML  VAALRE F+AKEGN  S   FS  E
Sbjct  318   NQSVVKHMLSIDWKFWKSYVNTSSARSITIQMLERVAALREFFQAKEGNCPSE--FSSGE  375

Query  542   MTIDieapigeeerreegaVDPTRCEDG---------MEELLSEPSSLVGLESACDEFYD  694
             +T DI      +E  +     P +   G         +E+   +P+SL+ L+   DEF+D
Sbjct  376   LTRDIGLSRSLKEDIKVEIQTPMKSRRGENDDSMVEKVEKQFPKPASLIELDDVADEFFD  435

Query  695   VLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDS  874
             V EPS+ D  +    +  +      D    K+S+AT  +KK HDLAVQK+GY+DLQE   
Sbjct  436   VPEPSEYDLSDTGWPADESQDMHPQDLCHPKLSTATCFVKKLHDLAVQKRGYIDLQETTR  495

Query  875   EESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADW  1054
             E++ PCCYG TL +D   +  CSW   DPS+FLIRG  Y  D++KIKAK TLMQMVAADW
Sbjct  496   EDNIPCCYGDTLPKDPCCNLACSWTTPDPSTFLIRGDNYLVDNQKIKAKGTLMQMVAADW  555

Query  1055  LKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPL  1234
             L+SD+R+DDL GRPG IVQK+A    PEFF IVNIQVPG TTYSLALYYML  PLED+PL
Sbjct  556   LRSDKREDDLGGRPGSIVQKYAQKGGPEFFFIVNIQVPGMTTYSLALYYMLSTPLEDSPL  615

Query  1235  LERFVNGDDAFRNSRFKLIPYISK  1306
             LE FV GDD +RNSRFKLIPYISK
Sbjct  616   LESFVKGDDTYRNSRFKLIPYISK  639


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G WIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  639   KGPWIVKQSVGKKACLVGQALEINYFRGNNYL  670



>ref|XP_009770311.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Nicotiana sylvestris]
Length=730

 Score =   500 bits (1287),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 276/441 (63%), Positives = 328/441 (74%), Gaps = 8/441 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFC+ RGSVIEHLDGHTDI+H  L   W
Sbjct  196   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCYYRGSVIEHLDGHTDIVHKLLRRDW  255

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPW M RRDLLLRRYWRREDDGTYVILYHSV HQKCP QKDY+RACLKSGG+VI+P+   
Sbjct  256   LPWSMKRRDLLLRRYWRREDDGTYVILYHSVFHQKCPRQKDYVRACLKSGGYVISPVNQR  315

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DW+ WKS+L+ +S+R ITI ML  +AALRE+FRAK G+ SS+  F   +
Sbjct  316   KQSVVKHMLAIDWRFWKSYLRTSSARCITIHMLERLAALRELFRAKLGDCSSSY-FLEEQ  374

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEE--LLSEPS---SLVGLESACDEFYDVLEP  706
             M       I E +   +  ++  + +  MEE  ++  PS   SL+GL  A DEF+DV EP
Sbjct  375   MRNKRLHQIEEVKVEIQNRLENRKNKADMEEEEVVKSPSEHASLMGLNDASDEFFDVSEP  434

Query  707   SddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
               D DE   GW S   PE +  D    ++SSA   +KK HDLAVQK+GY+DL E   E +
Sbjct  435   -LDYDESENGWPSDFGPETYSQDTRHARLSSAAVFVKKLHDLAVQKRGYIDLHEKAKEST  493

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
               C YG TL +D   + PCSW   DPS+FLIRG+ Y +D +KIKAK TLMQMVAADWLKS
Sbjct  494   LLCYYGSTLTKDPTCNLPCSWTQTDPSTFLIRGETYLEDRKKIKAKGTLMQMVAADWLKS  553

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             D+++DDL GRPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ PLLE 
Sbjct  554   DKQEDDLGGRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLGLYYMMDTPIENAPLLES  613

Query  1244  FVNGDDAFRNSRFKLIPYISK  1306
             FV GDDA+RNS FKLIPYISK
Sbjct  614   FVKGDDAYRNSSFKLIPYISK  634


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G WIVKQSVGKKAC++GQALE+NYF+GKNYL
Sbjct  634   KGPWIVKQSVGKKACIVGQALEINYFEGKNYL  665



>ref|XP_011041016.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Populus euphratica]
Length=609

 Score =   494 bits (1273),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 268/451 (59%), Positives = 330/451 (73%), Gaps = 20/451 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D T EA+FRTLMSLG SRSEWDFCF RGSV+EHLDGHTDI+H +LY++W
Sbjct  73    DHPAIMAVGVVDGTPEAIFRTLMSLGASRSEWDFCFYRGSVVEHLDGHTDILHKKLYSNW  132

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRRE+DGTYVILYHSV+ +KCPPQK Y+RACLKSGG+VITP+  G
Sbjct  133   LPWGMRRRDLLLRRYWRREEDGTYVILYHSVIQKKCPPQKGYVRACLKSGGYVITPVNQG  192

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-------SSN  520
             + S+VKHMLA+DWK WK +L+  S+RSITIRML  +AALRE+FRAK GNH        S+
Sbjct  193   RESLVKHMLAIDWKFWKVYLRPPSARSITIRMLERIAALRELFRAKSGNHPSDFSSSDSS  252

Query  521   LSFSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVL  700
             +   L +  ++      + +++ E   D    E+  E+  S   SL+ L  A DEF+D  
Sbjct  253   VKTMLPKAGMEDIESEDKGQQKFEQNADLK--ENEAEKKNSGRRSLMSLNDASDEFFDFP  310

Query  701   EPSdddd--eegegWSSATSPE-----FCVDANQQKISSATTLMKKFHDLAVQKKGYVDL  859
             + ++D D      GW    S E      C+     ++SSA   + K HDLAVQKKGY+D 
Sbjct  311   DSNEDMDFDLLENGWYPEKSQEQPASHICL----HRLSSAAVFVNKLHDLAVQKKGYIDF  366

Query  860   QEVDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQM  1039
             QE+  + +    YG TLQ+DS YS PCSWA  +PS+FLIRG+ Y KD +KIKAK +LMQM
Sbjct  367   QELPKDANVATSYGNTLQKDSTYSLPCSWATAEPSTFLIRGENYLKDSQKIKAKGSLMQM  426

Query  1040  VAADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPL  1219
             V ADWL+SD R+DDL  RP  I+QK+AA  RPEFF ++NIQVPG+T Y+LALYYMLK PL
Sbjct  427   VGADWLRSDHREDDLGSRPESIIQKYAAQGRPEFFFVINIQVPGATQYTLALYYMLKTPL  486

Query  1220  EDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             E+TPLL  FV+GDDAFRNSRFKLIPYISK S
Sbjct  487   EETPLLHSFVHGDDAFRNSRFKLIPYISKGS  517


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE++YF+GKNYL
Sbjct  515   KGSWIVKQSVGKKACLVGQALEMHYFRGKNYL  546



>ref|XP_004982841.1| PREDICTED: uncharacterized protein LOC101786041 [Setaria italica]
Length=763

 Score =   497 bits (1280),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 273/447 (61%), Positives = 320/447 (72%), Gaps = 13/447 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D  SEAVF+TLMSLG SRSEWDFC   G V+EHLDGHTDIIH +L   W
Sbjct  225   DHPAIMAVGVVDANSEAVFQTLMSLGQSRSEWDFCLQEGKVVEHLDGHTDIIHKKLRGDW  284

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHSV H KC P++ YIRACLKSGG+VI+PI  G
Sbjct  285   LPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYKCRPERGYIRACLKSGGYVISPINQG  344

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + SVVKHMLA+DWK WKS+L  +S++ ITIRMLG VAALRE FRAK GN  + L FS  E
Sbjct  345   RQSVVKHMLAIDWKFWKSYLFTSSAKYITIRMLGRVAALREFFRAKNGN-CACLEFSSGE  403

Query  542   MTIDi---eapigeeerreegaVDPTRCED-------GMEELLSEPSSLVGLESACDEFY  691
             +T D+   +              +  R E        G    LS   S V L  A DEF+
Sbjct  404   LTRDMGLPQGENERINLEMRQENESRRLEGPTEGSLGGSNRHLSSTGSFVQLNDAADEFF  463

Query  692   DVLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             DV + S+ D  E    S  ++    VD    K+S+A   +K+ HDLAVQK+GYVDLQ   
Sbjct  464   DVPDESEYDQREIVFPSDEST--HAVDQRHAKLSTAAVFVKRLHDLAVQKRGYVDLQGAA  521

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
               ++ PCCYG TL +DS+Y+ P +WA  DP++FLIRG+ Y  D  KIKA +TLMQMV AD
Sbjct  522   DADNGPCCYGYTLPKDSSYTVPSTWAMTDPTTFLIRGETYLHDRLKIKANSTLMQMVGAD  581

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             W+KSD+R+DDLAGRPGG+VQK AA    +FF IVNIQVPGSTTYSLALYYM+  PLE  P
Sbjct  582   WIKSDKREDDLAGRPGGLVQKCAAQGGTKFFFIVNIQVPGSTTYSLALYYMMDTPLEKVP  641

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLERFVNGDDAFRNSRFKLIPYISK S
Sbjct  642   LLERFVNGDDAFRNSRFKLIPYISKGS  668


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  666   KGSWIVKQSVGKKACLVGQALEINYFRGSNYL  697



>ref|XP_004496270.1| PREDICTED: uncharacterized protein LOC101513040 [Cicer arietinum]
Length=721

 Score =   495 bits (1275),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 263/440 (60%), Positives = 331/440 (75%), Gaps = 5/440 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F TLMSL PSRSEWDFC +RGSV++HLDGHTDIIHLQLY+ W
Sbjct  190   DHPAIMAVGVVDGTSEAIFHTLMSLDPSRSEWDFCINRGSVVDHLDGHTDIIHLQLYSDW  249

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWG+  RDLLLRRYWRREDDGTYV+LYHSV H KCPP+K YIRACLKSGG V++P+  G
Sbjct  250   LPWGIKPRDLLLRRYWRREDDGTYVLLYHSVYHSKCPPKKGYIRACLKSGGFVVSPVNKG  309

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSN-LSFSL-  535
               S+V+HMLA+DWK WK +L+  S++SITIRML  VAALRE++R K GN+SS  ++ +  
Sbjct  310   TQSIVRHMLAIDWKLWKLYLQPTSAKSITIRMLERVAALRELYRTKAGNYSSEPITMTKD  369

Query  536   AEMTIDieapigeeerreegaVDP-TRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
              E+ + I   +  E   E  +++     +D + + +S  +SL+GL  + DEF+DV E +D
Sbjct  370   IELPLSINEDVNIEVPEENSSIEKLVVVKDEVNQEVSGLNSLMGLNDS-DEFFDVPESTD  428

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
              D  +   W S  S E  +   Q +ISSA  L+KKF  LAVQKKGY+DLQEV  EES PC
Sbjct  429   YDHFDNNQWHSDLSSE-QLGVPQPRISSAAGLVKKFQGLAVQKKGYMDLQEVTREESAPC  487

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
              YG TLQ D  Y+ PC+WA  DPS FL+RG+ Y +DH+K+KAK+TLMQ+V  DWL  D R
Sbjct  488   SYGSTLQNDPTYTLPCTWAASDPSLFLVRGESYLQDHQKVKAKDTLMQLVGTDWLCCDTR  547

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL+ RPG IVQ++AA   PEFF ++NIQ+PGS  Y++ALYYM+K PLED PLL++FV 
Sbjct  548   EDDLSSRPGSIVQQYAAKGGPEFFFVINIQMPGSPMYNIALYYMMKTPLEDNPLLQKFVE  607

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDD +RNSRFKLIPYISK S
Sbjct  608   GDDTYRNSRFKLIPYISKGS  627


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV Y +GKNYL
Sbjct  625   KGSWIVKQSVGKKACLVGQALEVRYIRGKNYL  656



>ref|XP_009589980.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Nicotiana 
tomentosiformis]
Length=730

 Score =   495 bits (1275),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 277/442 (63%), Positives = 327/442 (74%), Gaps = 10/442 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLGPSRSEWDFC+ +GSVIEHLDGHTDI+H  L   W
Sbjct  196   DHPAIMAVGVVDGTSEAIFQTLMSLGPSRSEWDFCYYKGSVIEHLDGHTDIVHKLLRRDW  255

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPW M RRDLLLRRYWRREDDGTYVILYHSV HQKCP QK Y+RACLKSGG+VI+P+   
Sbjct  256   LPWSMKRRDLLLRRYWRREDDGTYVILYHSVFHQKCPRQKGYVRACLKSGGYVISPVNQR  315

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DW+ WKS+L+ +S+R ITI ML  +AALRE+FRAK G+ SS  S+ L E
Sbjct  316   KQSVVKHMLAIDWRFWKSYLRTSSARYITIHMLERLAALRELFRAKLGDCSS--SYFLEE  373

Query  542   MTIDieapigeeerreegaVDPTR---CEDGMEELLSEPS---SLVGLESACDEFYDVLE  703
                +      EE + E      +R    +   EE+++ PS   SL+GL  A DEF+DV E
Sbjct  374   QVRNKRLHQIEEVKVEVQNRLESRKNVADMEEEEMVNSPSEHASLMGLNDASDEFFDVSE  433

Query  704   PSddddeegegWSSATSPE-FCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEE  880
             P  D DE   GW S   PE +  D    ++SSA   +KK HDLAVQK+GYVDL E   E 
Sbjct  434   P-LDYDESENGWPSDFGPETYSQDMRHARLSSAAVFVKKLHDLAVQKRGYVDLHEKVKEG  492

Query  881   SEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLK  1060
             +  C YG TL +D   + PCSW   DPS+FLIRG+ Y +D +KIKAK TLM+MVAADWLK
Sbjct  493   TLLCYYGSTLTKDPTCNLPCSWTQTDPSTFLIRGETYLEDRKKIKAKGTLMKMVAADWLK  552

Query  1061  SDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLE  1240
             SD+R+DDL GRPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ PLLE
Sbjct  553   SDKREDDLGGRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLGLYYMMDTPIENAPLLE  612

Query  1241  RFVNGDDAFRNSRFKLIPYISK  1306
              FV GDDA+RNS FKLIPYISK
Sbjct  613   SFVKGDDAYRNSSFKLIPYISK  634


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G WIVKQSVGKKAC++GQALE+NYF+GKNYL
Sbjct  634   KGPWIVKQSVGKKACIVGQALEINYFRGKNYL  665



>ref|XP_011041015.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Populus euphratica]
Length=734

 Score =   495 bits (1275),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 268/451 (59%), Positives = 330/451 (73%), Gaps = 20/451 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D T EA+FRTLMSLG SRSEWDFCF RGSV+EHLDGHTDI+H +LY++W
Sbjct  198   DHPAIMAVGVVDGTPEAIFRTLMSLGASRSEWDFCFYRGSVVEHLDGHTDILHKKLYSNW  257

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRRE+DGTYVILYHSV+ +KCPPQK Y+RACLKSGG+VITP+  G
Sbjct  258   LPWGMRRRDLLLRRYWRREEDGTYVILYHSVIQKKCPPQKGYVRACLKSGGYVITPVNQG  317

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-------SSN  520
             + S+VKHMLA+DWK WK +L+  S+RSITIRML  +AALRE+FRAK GNH        S+
Sbjct  318   RESLVKHMLAIDWKFWKVYLRPPSARSITIRMLERIAALRELFRAKSGNHPSDFSSSDSS  377

Query  521   LSFSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVL  700
             +   L +  ++      + +++ E   D    E+  E+  S   SL+ L  A DEF+D  
Sbjct  378   VKTMLPKAGMEDIESEDKGQQKFEQNADLK--ENEAEKKNSGRRSLMSLNDASDEFFDFP  435

Query  701   EPSdddd--eegegWSSATSPE-----FCVDANQQKISSATTLMKKFHDLAVQKKGYVDL  859
             + ++D D      GW    S E      C+     ++SSA   + K HDLAVQKKGY+D 
Sbjct  436   DSNEDMDFDLLENGWYPEKSQEQPASHICL----HRLSSAAVFVNKLHDLAVQKKGYIDF  491

Query  860   QEVDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQM  1039
             QE+  + +    YG TLQ+DS YS PCSWA  +PS+FLIRG+ Y KD +KIKAK +LMQM
Sbjct  492   QELPKDANVATSYGNTLQKDSTYSLPCSWATAEPSTFLIRGENYLKDSQKIKAKGSLMQM  551

Query  1040  VAADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPL  1219
             V ADWL+SD R+DDL  RP  I+QK+AA  RPEFF ++NIQVPG+T Y+LALYYMLK PL
Sbjct  552   VGADWLRSDHREDDLGSRPESIIQKYAAQGRPEFFFVINIQVPGATQYTLALYYMLKTPL  611

Query  1220  EDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             E+TPLL  FV+GDDAFRNSRFKLIPYISK S
Sbjct  612   EETPLLHSFVHGDDAFRNSRFKLIPYISKGS  642


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE++YF+GKNYL
Sbjct  640   KGSWIVKQSVGKKACLVGQALEMHYFRGKNYL  671



>dbj|BAK01993.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=758

 Score =   496 bits (1276),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 273/447 (61%), Positives = 324/447 (72%), Gaps = 13/447 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D  SE +F+TLMSLG SRSEWDFC   G V+EHLDGH+DIIH +L   W
Sbjct  220   DHPAIMAVGVVDANSEDIFQTLMSLGQSRSEWDFCLREGRVVEHLDGHSDIIHKKLRGDW  279

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHSV H +C P+K YI ACLKSGG+VI+P+  G
Sbjct  280   LPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHNRCSPEKGYIHACLKSGGYVISPVSQG  339

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + SVVKHMLA+DWK WKS+L  +S++ ITIRMLG VAALRE+FRAK GN  + + FS  E
Sbjct  340   RQSVVKHMLAIDWKFWKSYLLTSSAKYITIRMLGRVAALRELFRAKNGN-CACMEFSSGE  398

Query  542   MTIDieapigeeerreegaVDPTRC----------EDGMEELLSEPSSLVGLESACDEFY  691
             +T D   P G  ERR+        C          + G    LS   SLV L  A DEF+
Sbjct  399   LTRDTGLPQGGNERRKIEMQSANECGRLEGPVEGLQGGSNRQLSSTGSLVQLNDATDEFF  458

Query  692   DVLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             DV + S+ D  E   WSS  S    VD    K+SSA   ++K HDLAVQK+GYVDLQ   
Sbjct  459   DVPDESEYDQREAM-WSSDESTH-AVDQRHAKLSSAAVFVRKLHDLAVQKRGYVDLQGAA  516

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
               ++ PC YG TL +DS+ + P SW+  DP++FLIRG+ Y  D +K+KA+NTLMQMV AD
Sbjct  517   DADNAPCYYGHTLPKDSSCTIPSSWSMTDPTTFLIRGESYLIDRQKVKAENTLMQMVGAD  576

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             W+KSD+R+DDLAGRPGG+VQK+AA    +FF IVNIQVPGSTTYSLALYYM+  PLE  P
Sbjct  577   WIKSDKREDDLAGRPGGLVQKYAAQGGSKFFFIVNIQVPGSTTYSLALYYMMDTPLEKVP  636

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLERFVNGDD FRNSRFKLIPYISK S
Sbjct  637   LLERFVNGDDTFRNSRFKLIPYISKGS  663


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  661   KGSWIVKQSVGKKACLVGQALEINYFRGSNYL  692



>ref|XP_007009855.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
[Theobroma cacao]
 gb|EOY18665.1| Pleckstrin (PH) and lipid-binding START domains-containing protein 
[Theobroma cacao]
Length=735

 Score =   493 bits (1270),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 265/447 (59%), Positives = 325/447 (73%), Gaps = 10/447 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +FR +MSLGP+RSEWDFC  RGSV+EHLDGHTDIIH QLY+ W
Sbjct  195   DHPAIMAVGVVDGTSETIFRAVMSLGPARSEWDFCLYRGSVVEHLDGHTDIIHKQLYSDW  254

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLL+RYWRREDDGTYVILYHSV H+KC PQ  Y+RA LKSGG+VITP+  G
Sbjct  255   LPWGMKRRDLLLQRYWRREDDGTYVILYHSVFHKKCLPQSGYVRARLKSGGYVITPVNQG  314

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL------  523
             K S+VKHMLA+DW+ WK +L+ +++RS+TIRML  VAALRE+ +AK+GN+SS        
Sbjct  315   KQSLVKHMLAIDWRFWKLYLRPSAARSLTIRMLERVAALRELLKAKQGNYSSECLAGERR  374

Query  524   -SFSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVL  700
                 L ++  +      +  +      +    E+ +E+  S   SL+ L  A DEF+DV 
Sbjct  375   RDIDLHQIEREDFKMEIQSPKEIIKIEEDVLIENEVEKQASGRISLMSLNEAPDEFFDVP  434

Query  701   EPSdddde--egegWSSATSPEFCVDANQQ-KISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             E S+  D       W    S E      QQ K++SA  L++K HDLA+QKKGY+DLQEV 
Sbjct  435   EASEFTDYDPLESEWPPEPSSELRPPNIQQPKLTSAAGLVRKLHDLAIQKKGYMDLQEVA  494

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
              E+S  C YG +LQ+D   + PCSW+ GDPS+FLIRGK Y KDH+KIKAK TLMQMV AD
Sbjct  495   REDSIMCSYGTSLQKDPTCTLPCSWSAGDPSAFLIRGKNYLKDHQKIKAKGTLMQMVGAD  554

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             WL SD+R+DDL  R GGIVQK+AA   PEFF IVN+Q+PG+  Y+LA+YYM+K PLED P
Sbjct  555   WLISDKREDDLGSRLGGIVQKYAARGGPEFFFIVNMQIPGAPMYTLAMYYMIKTPLEDHP  614

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LL  FVNGDDA+RNSRFKLIPYISK S
Sbjct  615   LLYNFVNGDDAYRNSRFKLIPYISKGS  641


 Score = 62.4 bits (150),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIG +LE++YF+G+NYL
Sbjct  639   KGSWIVKQSVGKKACLIGHSLEIHYFRGQNYL  670



>ref|XP_006436438.1| hypothetical protein CICLE_v10030795mg [Citrus clementina]
 ref|XP_006485700.1| PREDICTED: uncharacterized protein LOC102625473 [Citrus sinensis]
 gb|ESR49678.1| hypothetical protein CICLE_v10030795mg [Citrus clementina]
Length=744

 Score =   493 bits (1269),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 271/453 (60%), Positives = 328/453 (72%), Gaps = 18/453 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F+TLMSLG SRSEWDFCF RG V+EHLDGH+D++H  LY+ W
Sbjct  200   DHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCVVEHLDGHSDVVHKLLYSDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLL+RRYWRREDDGTYVILYHSV H+KCP QK Y+RACLKSGG VITP   G
Sbjct  260   LPWGMQRRDLLVRRYWRREDDGTYVILYHSVNHKKCPKQKGYVRACLKSGGFVITPSNQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL------  523
             K S+VKHMLAVDWK WK +L+ +S+RSITIRML  VAALRE+F+AK GN SS        
Sbjct  320   KQSIVKHMLAVDWKYWKLYLRPSSARSITIRMLERVAALRELFQAKAGNTSSEFLSRGST  379

Query  524   ----SFSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSE-PSS----LVGLESA  676
                 +   +E+  DI+    E+   E   ++  R  +       E PSS    L+G+  A
Sbjct  380   REIKAAQDSELPEDIQLKNEEDTEIEIQKIEEIRKTEKDAPFTEEKPSSGRASLMGINDA  439

Query  677   CDEFYDVLEPSddddeegegWSSATSPEFC-VDANQQKISSATTLMKKFHDLAVQKKGYV  853
              DEF+DV  P    D     WS   SPE   + A Q K++SA   +KK HDLAV KKG  
Sbjct  440   SDEFFDV--PEAYSDHMENDWSLEVSPELQPLSAPQSKLASAAGFVKKLHDLAVHKKGCT  497

Query  854   DLQEVDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLM  1033
             DLQEV +E+ +   YG TLQ DS++++PCSWA  DPS+FLIRG+ Y KDH KIKA  TLM
Sbjct  498   DLQEVPNEDEKSWSYGATLQTDSSFTSPCSWAAADPSTFLIRGENYLKDHRKIKADGTLM  557

Query  1034  QMVAADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKA  1213
             QM+ ADWL+S++R+D+LA RP  +VQK+AA   PEFF +VNIQ PG+T Y+LALYY++K 
Sbjct  558   QMIGADWLRSNKREDNLAARPCSLVQKYAAGGGPEFFFVVNIQFPGTTKYTLALYYVIKT  617

Query  1214  PLEDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             PLED PLL +FVNGDDAFRNSRFKLIPYISK S
Sbjct  618   PLEDNPLLHKFVNGDDAFRNSRFKLIPYISKGS  650


 Score = 61.6 bits (148),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGK ACL+G+ALEVNY++G+NYL
Sbjct  648   KGSWIVKQSVGKTACLLGRALEVNYYRGRNYL  679



>ref|XP_010234829.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Brachypodium distachyon]
Length=760

 Score =   493 bits (1269),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 271/447 (61%), Positives = 324/447 (72%), Gaps = 13/447 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D  SE +F+TLMSLG SRSEWDFC   G VIEHLDGH+DIIH +L   W
Sbjct  222   DHPAIMAVGVVDANSEDIFQTLMSLGQSRSEWDFCLREGRVIEHLDGHSDIIHKKLRGDW  281

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHSV H KC P++ YIRACLKSGG+VI+P+  G
Sbjct  282   LPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHNKCRPEQGYIRACLKSGGYVISPVSQG  341

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + SVVKHMLA+DWK WKS+L  +S++ ITIRMLG VAALRE FRAK GN  + L FS  E
Sbjct  342   RQSVVKHMLAIDWKFWKSYLFTSSAKYITIRMLGRVAALREFFRAKNGN-CACLEFSSGE  400

Query  542   MTIDie--apigeeerreegaVDPTR--------CEDGMEELLSEPSSLVGLESACDEFY  691
             +  D+       E+ + E  + + +R         + G    LS   S V L  A DEF+
Sbjct  401   LMRDMGLPQGENEQIKIEMHSANESRRLEGSTEGSQGGSNRHLSSAGSFVQLNDATDEFF  460

Query  692   DVLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             DV + S+ D  E   WSS  S    VD    K+SSA   +++ HDLAVQK+GY+DLQ   
Sbjct  461   DVPDESEYDQREAM-WSSDESTH-AVDQRHAKLSSAAVFVRRLHDLAVQKRGYIDLQGAT  518

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
               ++ PCCYG TL +DS+ + P SWA  DP++FLIRG+ Y  D +KIKA NTLMQMV AD
Sbjct  519   DADNGPCCYGHTLPKDSSCTMPSSWAMTDPTTFLIRGESYLLDRQKIKANNTLMQMVGAD  578

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             W+KSD+R+DDLAGRPGG+VQK+AA+   +FF IVNIQVPGSTTYSLALYY +  PLE  P
Sbjct  579   WIKSDKREDDLAGRPGGLVQKYAAEGGNKFFFIVNIQVPGSTTYSLALYYAMDTPLEKVP  638

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLERFVNGDD FRNSRFKLIPYISK S
Sbjct  639   LLERFVNGDDTFRNSRFKLIPYISKGS  665


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  663   KGSWIVKQSVGKKACLVGQALEINYFRGTNYL  694



>ref|XP_004149918.1| PREDICTED: uncharacterized protein LOC101207368 [Cucumis sativus]
 gb|KGN47831.1| hypothetical protein Csa_6G405930 [Cucumis sativus]
Length=733

 Score =   492 bits (1266),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 264/445 (59%), Positives = 325/445 (73%), Gaps = 13/445 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVG++  TSE +FRTLMSLGPSRSEWDFCF RGS++EHLDGHTDIIH+QLY  W
Sbjct  200   DHPAIMAVGMVCGTSEEIFRTLMSLGPSRSEWDFCFLRGSLVEHLDGHTDIIHMQLYRDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RD LLRRYWRREDDGTYV+LYHSV H K PPQK Y+RACLKSGG+V+TP+  G
Sbjct  260   LPWGMKKRDFLLRRYWRREDDGTYVLLYHSVFHMKFPPQKGYVRACLKSGGYVVTPVNQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLS-----  526
             K S+VKHMLAVDWK WK +L+ +S+R+ITIRM+  +AALRE+FRAK G+ SS  S     
Sbjct  320   KHSLVKHMLAVDWKFWKLYLRPSSARAITIRMVERLAALRELFRAKVGDSSSEFSSSSRD  379

Query  527   ---FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDV  697
                F L +  +D      +         +    E+  E      +SL+GL  A DEF+DV
Sbjct  380   LRHFELPQSEMDEIKTEIQSPETMRKIKEAFSKENEAE---MPRASLIGLNDAVDEFFDV  436

Query  698   LEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              EPS + D     W+S  + +  ++ +Q K+S+A   +KK HDLAVQKKGY +L E+  E
Sbjct  437   PEPS-ELDLYENEWTSDLTLQ-QLNMSQNKLSTAAVFVKKLHDLAVQKKGYAELPELPRE  494

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             ES    YG TL +D N+STPCS A  DPS FLIRG+ Y KD +KIKA  TLMQ+V ADWL
Sbjct  495   ESMAYSYGSTLPKDLNFSTPCSVASADPSLFLIRGENYLKDSQKIKANGTLMQLVGADWL  554

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SDRR+D+L GRPG IVQK+A    PEFF +VNIQVPG+T Y+LA+YYM++ PLE +PLL
Sbjct  555   RSDRREDNLGGRPGSIVQKYAERGGPEFFFVVNIQVPGTTMYTLAMYYMMRTPLESSPLL  614

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
             + FV GDDAFRNSRFKLIPYIS+ S
Sbjct  615   KNFVEGDDAFRNSRFKLIPYISQGS  639


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             QGSWIVKQSVGKKACL+G ALEV+YF+GKNYL
Sbjct  637   QGSWIVKQSVGKKACLVGHALEVHYFRGKNYL  668



>ref|XP_009396972.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=743

 Score =   492 bits (1266),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 273/448 (61%), Positives = 327/448 (73%), Gaps = 13/448 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH ++MAVGVID TSEAVFR +MSLGPSRSEWDFC   G+V+EHLDGHTDIIH +L + W
Sbjct  203   DHPALMAVGVIDATSEAVFRRVMSLGPSRSEWDFCLLEGNVVEHLDGHTDIIHKKLRSDW  262

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHS  HQKC P++ Y+RACLKSGG+VI+P+  G
Sbjct  263   LPWGMKKRDLLLRRYWRREDDGTYVILYHSFSHQKCQPERGYVRACLKSGGYVISPVNQG  322

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK WKS+L  +S+  ITIRMLG VAALRE FRAK G+ + +  FS  E
Sbjct  323   KQSVVKHMLAIDWKFWKSYLFTSSAEYITIRMLGRVAALREFFRAKVGSCACS-DFSSGE  381

Query  542   MT--IDieapigeeerreegaVDPTRCEDGMEELLSEPS-------SLVGLESACDEFYD  694
              T  I +     E  + E+ A + ++ ED  +E    P+       S + L  A DEF+D
Sbjct  382   STREIGLPQNEREHMKLEQPAEEISKSEDSADETQRSPAKNAKAGGSFLQLNDAADEFFD  441

Query  695   VLEPSddddeegegWSS--ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEV  868
             V+  S+ ++ E   W S      +   D    K+S+A   ++K HD+AVQK+GYVDLQE 
Sbjct  442   VINESEYNEVEAL-WPSDDGLQTQLVQDQRHSKLSTAAVFVRKLHDIAVQKRGYVDLQEA  500

Query  869   DSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
              + ES PC YG TL +D   S P SWA  DPS+FLIRG+ Y  DH KIKA  TLMQMVAA
Sbjct  501   STGESVPCSYGATLPKDPCCSLPSSWAMADPSTFLIRGESYLHDHLKIKANGTLMQMVAA  560

Query  1049  DWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             DWLKSD+R+DDL GRPGGIVQK++A    EFF IV+IQVPGSTTYSLALYYM+ +PLE  
Sbjct  561   DWLKSDKREDDLGGRPGGIVQKYSAHGGSEFFFIVHIQVPGSTTYSLALYYMMDSPLESF  620

Query  1229  PLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             PLLERFV GDDA+RNSRFKLIPYISK S
Sbjct  621   PLLERFVKGDDAYRNSRFKLIPYISKGS  648


 Score = 62.0 bits (149),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQAL++NYF G NY+
Sbjct  646   KGSWIVKQSVGKKACLVGQALDINYFCGSNYI  677



>ref|XP_006846792.1| hypothetical protein AMTR_s00148p00054510 [Amborella trichopoda]
 gb|ERN08373.1| hypothetical protein AMTR_s00148p00054510 [Amborella trichopoda]
Length=774

 Score =   493 bits (1268),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 274/448 (61%), Positives = 325/448 (73%), Gaps = 15/448 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D +SE VF+T+MSLGPSR+EWDFCF RGSVIEHLDGHTDIIH QL++ W
Sbjct  205   DHPAIMAVGVVDASSELVFQTVMSLGPSRTEWDFCFSRGSVIEHLDGHTDIIHKQLHSDW  264

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H+KC PQ+  I+ACLKSGG+VI+P+  G
Sbjct  265   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHRKCLPQRRSIQACLKSGGYVISPVNHG  324

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK WKS+L  AS+R+ITI+MLG VAALREMF+AK G +  +  FS  E
Sbjct  325   KQSVVKHMLAIDWKFWKSYLSAASARNITIKMLGRVAALREMFKAKLGTYQCS-DFSSGE  383

Query  542   MTID----ieapigeeerreegaVDPTRCEDGMEELLSEPS----SLVGLESACDEFYDV  697
             +  D           +           + +   EE L +P+    S + L    DEF+DV
Sbjct  384   LARDILLPQGVREDIKVEVGVQVGSGKKSKSSEEEDLLKPTTGSGSFLQLNEVADEFFDV  443

Query  698   LEPSddddeegegWSSATSPEF-CVDANQQKISSATTLMKKFHDLA--VQKKGYVDLQEV  868
              E S   + +  GWS     E    D  Q K+SSA   +K+ H LA  VQ++ Y+DL+EV
Sbjct  444   PELS---ECDQNGWSPDDGSEMPSQDLIQPKLSSAAVFVKRLHVLAGGVQRRPYIDLREV  500

Query  869   DSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
               EE   CCYG TL +D+  S PCSW   DPS+FLIRGK Y KDHEKIKAK+TLMQMV A
Sbjct  501   SEEEETSCCYGATLPKDATCSMPCSWTTADPSTFLIRGKNYLKDHEKIKAKSTLMQMVGA  560

Query  1049  DWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             DWLKSD+R+DDLAGRPG  VQK+AA    EFF+IVNIQVPGSTTYSLALYYM+  P+E  
Sbjct  561   DWLKSDKREDDLAGRPGSFVQKYAAQGGNEFFVIVNIQVPGSTTYSLALYYMMDTPVEKV  620

Query  1229  PLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             PLLERF+  DDA+RNSRFKLIPYISK S
Sbjct  621   PLLERFIKEDDAYRNSRFKLIPYISKGS  648


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+GKNYL
Sbjct  646   KGSWIVKQSVGKKACLVGQALEINYFQGKNYL  677



>ref|XP_004308785.1| PREDICTED: uncharacterized protein LOC101295576 [Fragaria vesca 
subsp. vesca]
Length=734

 Score =   491 bits (1264),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 268/448 (60%), Positives = 331/448 (74%), Gaps = 17/448 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRTL+SLGPSRSEWDFCF RG+V+E+LDGHTDI+H QLY+ W
Sbjct  199   DHPAIMAVGVVDGTSEAIFRTLLSLGPSRSEWDFCFYRGTVVENLDGHTDIVHQQLYSDW  258

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRRE+DGTYVILYHSV H+KCPP++ Y+RACLKSGG+VITP   G
Sbjct  259   LPWGMKRRDLLLRRYWRREEDGTYVILYHSVSHKKCPPKRGYMRACLKSGGYVITPANHG  318

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K S+V+HMLA+DWK WK +L+ +S+RSITIRML  +AALRE++ AK GN S    F+  E
Sbjct  319   KQSLVRHMLAIDWKFWKLYLRPSSARSITIRMLERIAALRELYGAKAGNCSR--EFTSGE  376

Query  542   MTIDieapigeeerree---gaVDPTRCE--DGMEELLSEP--SSLVGLESACDEFYDVL  700
              + DI       E  +       +  R E  + ME  + +P  +SL G+  + DEF+DV 
Sbjct  377   FSRDIGLAHSGNEITKTEFHSMEEIKRVEEINPMEVEVEKPGRASLKGMHDSADEFFDVP  436

Query  701   EPS-ddddeegegWSSATSPEFCVDA---NQQKISSATTLMKKFHDLAVQKKGYVDLQEV  868
             EP   D D+    W S    EF +D    +Q ++S+++  +KKFH+L VQKKGYVDLQEV
Sbjct  437   EPEPTDYDQFENEWPS----EFTLDVQNTHQPRMSNSSRFVKKFHELRVQKKGYVDLQEV  492

Query  869   DSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
               E++  C YG TLQ+D N + PCSW   DPSSFLIRG  Y +DHEKIKAK TLMQ+V  
Sbjct  493   AKEDNMSCSYGSTLQKDPNCAFPCSWGAADPSSFLIRGPNYLRDHEKIKAKGTLMQLVCV  552

Query  1049  DWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             DWL+ D R D+L+ R GGIVQK+A  D PEFF +VN+QVPG+T Y+LA YY+L  PLE+ 
Sbjct  553   DWLRCDERIDNLSSRFGGIVQKYAELDGPEFFFVVNMQVPGTTMYTLAFYYILNTPLEEN  612

Query  1229  PLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             PLL  FVNGDDA+RNSRFKLIPYISK S
Sbjct  613   PLLHSFVNGDDAYRNSRFKLIPYISKGS  640


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV YF+GKNYL
Sbjct  638   KGSWIVKQSVGKKACLVGQALEVQYFRGKNYL  669



>ref|XP_010234828.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Brachypodium distachyon]
Length=785

 Score =   493 bits (1268),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 271/447 (61%), Positives = 324/447 (72%), Gaps = 13/447 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D  SE +F+TLMSLG SRSEWDFC   G VIEHLDGH+DIIH +L   W
Sbjct  247   DHPAIMAVGVVDANSEDIFQTLMSLGQSRSEWDFCLREGRVIEHLDGHSDIIHKKLRGDW  306

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHSV H KC P++ YIRACLKSGG+VI+P+  G
Sbjct  307   LPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHNKCRPEQGYIRACLKSGGYVISPVSQG  366

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + SVVKHMLA+DWK WKS+L  +S++ ITIRMLG VAALRE FRAK GN  + L FS  E
Sbjct  367   RQSVVKHMLAIDWKFWKSYLFTSSAKYITIRMLGRVAALREFFRAKNGN-CACLEFSSGE  425

Query  542   MTIDie--apigeeerreegaVDPTR--------CEDGMEELLSEPSSLVGLESACDEFY  691
             +  D+       E+ + E  + + +R         + G    LS   S V L  A DEF+
Sbjct  426   LMRDMGLPQGENEQIKIEMHSANESRRLEGSTEGSQGGSNRHLSSAGSFVQLNDATDEFF  485

Query  692   DVLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             DV + S+ D  E   WSS  S    VD    K+SSA   +++ HDLAVQK+GY+DLQ   
Sbjct  486   DVPDESEYDQREAM-WSSDESTH-AVDQRHAKLSSAAVFVRRLHDLAVQKRGYIDLQGAT  543

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
               ++ PCCYG TL +DS+ + P SWA  DP++FLIRG+ Y  D +KIKA NTLMQMV AD
Sbjct  544   DADNGPCCYGHTLPKDSSCTMPSSWAMTDPTTFLIRGESYLLDRQKIKANNTLMQMVGAD  603

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             W+KSD+R+DDLAGRPGG+VQK+AA+   +FF IVNIQVPGSTTYSLALYY +  PLE  P
Sbjct  604   WIKSDKREDDLAGRPGGLVQKYAAEGGNKFFFIVNIQVPGSTTYSLALYYAMDTPLEKVP  663

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLERFVNGDD FRNSRFKLIPYISK S
Sbjct  664   LLERFVNGDDTFRNSRFKLIPYISKGS  690


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  688   KGSWIVKQSVGKKACLVGQALEINYFRGTNYL  719



>ref|XP_008678703.1| PREDICTED: uncharacterized protein LOC100192558 isoform X1 [Zea 
mays]
 tpg|DAA49599.1| TPA: hypothetical protein ZEAMMB73_435086 [Zea mays]
Length=766

 Score =   491 bits (1265),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 269/447 (60%), Positives = 317/447 (71%), Gaps = 13/447 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D  SEAVF+TLMSLG SRSEWDFC   G VIEHLDGHTDII  +L + W
Sbjct  228   DHPAIMAVGVVDANSEAVFQTLMSLGQSRSEWDFCLREGKVIEHLDGHTDIIQKKLRSDW  287

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHSV H KC P+K YIRACLKSGG+VI+P+  G
Sbjct  288   LPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYKCRPEKGYIRACLKSGGYVISPVNQG  347

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + SVVKHMLA+DWK WKS+L  +S++ ITIRMLG VAALRE FRAK GN  S + FS  E
Sbjct  348   RQSVVKHMLAIDWKFWKSYLFTSSAKYITIRMLGRVAALREFFRAKNGN-CSCMEFSSGE  406

Query  542   MTIDi---eapigeeerreegaVDPTRCED-------GMEELLSEPSSLVGLESACDEFY  691
             +T D    +          +   +  R E        G    LS   S V L  A DEF+
Sbjct  407   LTRDTGLPQGENQRINLEMQQENENGRLEGPTEGSLGGSNRHLSSTGSFVQLNDAADEFF  466

Query  692   DVLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             DV  P + + ++ E    +       D    K+S+A   +K+ HDLAVQK+GY+DLQ   
Sbjct  467   DV--PDESEYDQREVMFPSDESLHAADQRHAKLSTAAVFVKRLHDLAVQKRGYIDLQGAA  524

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
               ++ PCCYG TL +DS+Y+ P +WA  DP++FLIRG+ Y  D  KIKA +TLMQMV AD
Sbjct  525   DADNGPCCYGYTLPKDSSYTVPSTWAMTDPTTFLIRGETYLHDRIKIKANSTLMQMVGAD  584

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             W+KSD+R+DDLAGRPGG+VQK AA     FF IVNIQVPGSTTYSLALYYM+  PLE  P
Sbjct  585   WIKSDKREDDLAGRPGGLVQKCAAQGGTRFFFIVNIQVPGSTTYSLALYYMMDTPLEKVP  644

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLERFVNGDDAFRNSRFKLIPYISK S
Sbjct  645   LLERFVNGDDAFRNSRFKLIPYISKGS  671


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G+NYL
Sbjct  669   KGSWIVKQSVGKKACLVGQALEINYFRGRNYL  700



>ref|XP_008678750.1| PREDICTED: uncharacterized protein LOC100192558 isoform X2 [Zea 
mays]
Length=767

 Score =   491 bits (1265),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 269/447 (60%), Positives = 317/447 (71%), Gaps = 13/447 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D  SEAVF+TLMSLG SRSEWDFC   G VIEHLDGHTDII  +L + W
Sbjct  229   DHPAIMAVGVVDANSEAVFQTLMSLGQSRSEWDFCLREGKVIEHLDGHTDIIQKKLRSDW  288

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHSV H KC P+K YIRACLKSGG+VI+P+  G
Sbjct  289   LPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYKCRPEKGYIRACLKSGGYVISPVNQG  348

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + SVVKHMLA+DWK WKS+L  +S++ ITIRMLG VAALRE FRAK GN  S + FS  E
Sbjct  349   RQSVVKHMLAIDWKFWKSYLFTSSAKYITIRMLGRVAALREFFRAKNGN-CSCMEFSSGE  407

Query  542   MTIDi---eapigeeerreegaVDPTRCED-------GMEELLSEPSSLVGLESACDEFY  691
             +T D    +          +   +  R E        G    LS   S V L  A DEF+
Sbjct  408   LTRDTGLPQGENQRINLEMQQENENGRLEGPTEGSLGGSNRHLSSTGSFVQLNDAADEFF  467

Query  692   DVLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             DV  P + + ++ E    +       D    K+S+A   +K+ HDLAVQK+GY+DLQ   
Sbjct  468   DV--PDESEYDQREVMFPSDESLHAADQRHAKLSTAAVFVKRLHDLAVQKRGYIDLQGAA  525

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
               ++ PCCYG TL +DS+Y+ P +WA  DP++FLIRG+ Y  D  KIKA +TLMQMV AD
Sbjct  526   DADNGPCCYGYTLPKDSSYTVPSTWAMTDPTTFLIRGETYLHDRIKIKANSTLMQMVGAD  585

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             W+KSD+R+DDLAGRPGG+VQK AA     FF IVNIQVPGSTTYSLALYYM+  PLE  P
Sbjct  586   WIKSDKREDDLAGRPGGLVQKCAAQGGTRFFFIVNIQVPGSTTYSLALYYMMDTPLEKVP  645

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLERFVNGDDAFRNSRFKLIPYISK S
Sbjct  646   LLERFVNGDDAFRNSRFKLIPYISKGS  672


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G+NYL
Sbjct  670   KGSWIVKQSVGKKACLVGQALEINYFRGRNYL  701



>ref|XP_010555822.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Tarenaya 
hassleriana]
Length=735

 Score =   489 bits (1260),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 265/444 (60%), Positives = 316/444 (71%), Gaps = 13/444 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH++IMAVGVID TSE +F TLMSLGP RSEWDFCF RGSV+EHLDGHTDII+ QLY+ W
Sbjct  205   DHAAIMAVGVIDGTSEEIFNTLMSLGPLRSEWDFCFYRGSVVEHLDGHTDIIYQQLYSDW  264

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM  RDLLLRRYWRREDDGTYVIL HSV H+KCPP K Y+RAC+KSGG+V+TP+  G
Sbjct  265   LPWGMKPRDLLLRRYWRREDDGTYVILCHSVYHKKCPPGKGYVRACVKSGGYVVTPMNNG  324

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               S+VKHM+A+DW+ W  +++ +S+RSITIRM+  VAALREMFRAK G   SNLS     
Sbjct  325   TQSMVKHMIAIDWRSWNLYMRPSSARSITIRMVERVAALREMFRAKHGQFFSNLSSGDFM  384

Query  542   MTIDieapigeeerreegaVDPT-------RCEDGMEELLSEPSSLVGLESACDEFYDVL  700
              T  +          E   +D            +  E+  S   S + L    DEF+DVL
Sbjct  385   TTKTLSKNKTRAVSFEGNKLDEVVKSEVTIMAGEEAEKTSSPRPSFMELNDMSDEFFDVL  444

Query  701   EPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEE  880
             EP +    +   +   TSP+      Q K+ SA  L+KK  DLAVQKKGYVDLQEV  EE
Sbjct  445   EPHESSGFDS--FIRDTSPQ----GPQLKLPSAAGLVKKLQDLAVQKKGYVDLQEVAMEE  498

Query  881   SEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLK  1060
             +    YG TLQ+D ++S PCSWA  DPS+FLIRG  Y KDH+K KAK T+MQM+ ADW+ 
Sbjct  499   NVTYLYGATLQKDPSFSAPCSWATADPSTFLIRGSNYLKDHQKEKAKGTMMQMMGADWIS  558

Query  1061  SDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLE  1240
             SD+R+DDL GR GGIVQ  AA+ RPEFF IVNIQVPGS  Y+LA+YYML  PLE+ PLL 
Sbjct  559   SDKREDDLGGRLGGIVQDFAAEGRPEFFFIVNIQVPGSAMYTLAMYYMLNTPLEENPLLH  618

Query  1241  RFVNGDDAFRNSRFKLIPYISKVS  1312
              FVNGDDA+RNSRFKLIP+ISK S
Sbjct  619   GFVNGDDAYRNSRFKLIPHISKGS  642


 Score = 61.6 bits (148),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE  Y +GKNYL
Sbjct  640   KGSWIVKQSVGKKACLLGQALETRYVRGKNYL  671



>gb|AAK21344.1|AC024594_8 unknown protein [Oryza sativa Japonica Group]
Length=773

 Score =   491 bits (1264),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 273/447 (61%), Positives = 325/447 (73%), Gaps = 13/447 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D  SEAVF+T+MSLG SRSEWDFC   G V+EH+DGHTDIIH +L + W
Sbjct  235   DHPAIMAVGVVDANSEAVFQTVMSLGQSRSEWDFCLQEGRVVEHIDGHTDIIHKKLRDGW  294

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHSV H +C  ++ Y+RACLKSGG+VI+P+  G
Sbjct  295   LPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYRCRSERGYVRACLKSGGYVISPVNQG  354

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK WKS+L  AS++ ITIRMLG VAALRE FRAK GN  + + FS  E
Sbjct  355   KQSVVKHMLAIDWKFWKSYLFTASAKHITIRMLGRVAALREFFRAKNGN-CACIEFSSGE  413

Query  542   MTIDieapigeeerreegaV---DPTRCED-------GMEELLSEPSSLVGLESACDEFY  691
             +T D+    GE ER +   +   +  R ED       G    LS   S + L  A DEF+
Sbjct  414   LTRDMRLQQGENERIKIEMLSASENNRLEDPTEGSLGGSNRHLSSAGSFIQLNDAADEFF  473

Query  692   DVLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             DV + S+ D  E   W S  S    VD    K+S+A   +KK HDLAVQK+GYVDLQ   
Sbjct  474   DVPDDSEYDQREAM-WPSDESTH-SVDQRHAKLSTAAVFVKKLHDLAVQKRGYVDLQGAA  531

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
               ++ P CYG TL +DSN + P +WA  DP++FLIRG+ Y +D  KIKA NTLMQMV AD
Sbjct  532   DFDNGPFCYGYTLPKDSNCTMPSTWAMTDPTTFLIRGESYLQDRLKIKANNTLMQMVGAD  591

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             W+KSD+R+DDL+GRPGG+VQK AA    +FF IVNIQVPGS+TYSLALYYM+  PLE  P
Sbjct  592   WIKSDKREDDLSGRPGGLVQKCAAQGGNKFFFIVNIQVPGSSTYSLALYYMMDTPLEKVP  651

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLERFVNGDDAFRNSRFKLIPYISK S
Sbjct  652   LLERFVNGDDAFRNSRFKLIPYISKGS  678


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  676   KGSWIVKQSVGKKACLVGQALEINYFRGSNYL  707



>ref|XP_009344767.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Pyrus x bretschneideri]
Length=735

 Score =   489 bits (1260),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 269/445 (60%), Positives = 330/445 (74%), Gaps = 11/445 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRTL+SLGPSRSEWDFC+ RGSV+E LDGHTDIIH QLY+ W
Sbjct  200   DHPAIMAVGVVDGTSEAIFRTLLSLGPSRSEWDFCYYRGSVVERLDGHTDIIHQQLYSDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLL+RRYWRREDDGTYVILYHSV H+KC P++ Y+RACLKSGG VITP   G
Sbjct  260   LPWGMQRRDLLIRRYWRREDDGTYVILYHSVSHKKCRPKRGYVRACLKSGGFVITPANQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K S+V+HMLA+DWK WK +L+ +S+R ITIRML  VAALRE+FRAK G  +S+  FS  +
Sbjct  320   KQSLVRHMLAIDWKFWKLYLRPSSARCITIRMLERVAALRELFRAKAG--TSSPEFSSGD  377

Query  542   MTIDieapigeeerreegaVDP---TRCEDG--MEELLSEP---SSLVGLESACDEFYDV  697
             M+ +I+     ++  +     P    + E+G  ME+ + +P   +SL GL  A DEF+DV
Sbjct  378   MSSEIKFSQSGQQNIKTEVQHPGEVKKMEEGVLMEDEVEKPEGRASLKGLHDAADEFFDV  437

Query  698   LEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              EP++ D  E E  S  +  +        K+SSA  L+KK H+L VQKKGY+DLQEV  E
Sbjct  438   PEPTEYDQFENEWPSDVSMEQNPTSIQHPKLSSAAVLVKKLHELRVQKKGYMDLQEVSKE  497

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             +S  C YG TLQ+D + + PCSW   DPSSFLIRG  Y +D +KIKAK+TLMQ+V  DWL
Sbjct  498   DS-VCPYGATLQKDPSCALPCSWGSADPSSFLIRGPNYLRDRQKIKAKSTLMQLVGVDWL  556

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SD+R+DDL  R G IVQK A     EFF IVNIQVPG+T Y+LA YYM+K PLE+TPLL
Sbjct  557   RSDKREDDLGSRYGSIVQKSAERGGSEFFFIVNIQVPGTTMYTLAFYYMIKTPLEETPLL  616

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
               FVNGDD++RNSRFKLIPYISK S
Sbjct  617   HDFVNGDDSYRNSRFKLIPYISKGS  641


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQ VG+KACL+GQALEV+YF+GKNYL
Sbjct  639   KGSWIVKQRVGEKACLVGQALEVHYFRGKNYL  670



>ref|XP_009400818.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=748

 Score =   489 bits (1260),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 271/450 (60%), Positives = 326/450 (72%), Gaps = 15/450 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH ++MAVGVID +SEA+F+ +MSLG SRSEWDFC   G+V+EH+DGHTDIIH +L   W
Sbjct  200   DHPALMAVGVIDASSEAIFKRVMSLGSSRSEWDFCLLEGNVVEHVDGHTDIIHKKLCGDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPW M RRDLLLRRYWRREDDGTYVILYHSV HQKCP ++ Y+RACLKSGG+VI+P+  G
Sbjct  260   LPWRMKRRDLLLRRYWRREDDGTYVILYHSVFHQKCPSKRGYVRACLKSGGYVISPVSQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHS-SNLSFSLA  538
             K SVVKHMLAVDWK WKS+   +S++ ITIRMLG VAALRE FRAK G+ + S+LS S +
Sbjct  320   KQSVVKHMLAVDWKFWKSYFFTSSAKYITIRMLGRVAALREFFRAKLGSRACSDLSSSES  379

Query  539   EMTIDieapigeeerreegaVDPT-RCEDGMEELLSEPS-------SLVGLESACDEFYD  694
                I+++    E+ + E  + D     ED  +E    P+       S + +  A DEF+D
Sbjct  380   TREIELQQSEKEQMKLEVHSADENDNIEDSADETQRSPTKIAKASGSFLQMNDAADEFFD  439

Query  695   VL-EPSddddeegegWSS---ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQ  862
             V+ EP  D+ E    W S      P+   D +  K+S+A   +KK HD+AVQKKGY+DLQ
Sbjct  440   VINEPEYDETEAL--WPSEEGMMQPQLVQDQHHSKLSTAAVFVKKLHDIAVQKKGYIDLQ  497

Query  863   EVDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMV  1042
             E    ES PC YG TL +D N S P SWA  DPS+FLIRGK Y  DH+KIKA  TLMQMV
Sbjct  498   EASLGESVPCSYGLTLPKDLNCSLPSSWAMADPSTFLIRGKSYLHDHQKIKANGTLMQMV  557

Query  1043  AADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLE  1222
             AADWL SD+R+DDL GRPGGIVQK++A    EFF I++IQVPGSTTYSLA YYM+  PLE
Sbjct  558   AADWLNSDKREDDLGGRPGGIVQKYSAQGGSEFFFIIHIQVPGSTTYSLAFYYMMDCPLE  617

Query  1223  DTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
               PLLERFV GDDA+RNSRFKLIPYISK S
Sbjct  618   SVPLLERFVKGDDAYRNSRFKLIPYISKGS  647


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQAL +NYF G NY+
Sbjct  645   KGSWIVKQSVGKKACLVGQALHINYFCGCNYI  676



>ref|XP_009396971.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=837

 Score =   492 bits (1267),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 273/448 (61%), Positives = 327/448 (73%), Gaps = 13/448 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH ++MAVGVID TSEAVFR +MSLGPSRSEWDFC   G+V+EHLDGHTDIIH +L + W
Sbjct  298   DHPALMAVGVIDATSEAVFRRVMSLGPSRSEWDFCLLEGNVVEHLDGHTDIIHKKLRSDW  357

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHS  HQKC P++ Y+RACLKSGG+VI+P+  G
Sbjct  358   LPWGMKKRDLLLRRYWRREDDGTYVILYHSFSHQKCQPERGYVRACLKSGGYVISPVNQG  417

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK WKS+L  +S+  ITIRMLG VAALRE FRAK G+ + +  FS  E
Sbjct  418   KQSVVKHMLAIDWKFWKSYLFTSSAEYITIRMLGRVAALREFFRAKVGSCACS-DFSSGE  476

Query  542   MT--IDieapigeeerreegaVDPTRCEDGMEELLSEPS-------SLVGLESACDEFYD  694
              T  I +     E  + E+ A + ++ ED  +E    P+       S + L  A DEF+D
Sbjct  477   STREIGLPQNEREHMKLEQPAEEISKSEDSADETQRSPAKNAKAGGSFLQLNDAADEFFD  536

Query  695   VLEPSddddeegegWSS--ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEV  868
             V+  S+ ++ E   W S      +   D    K+S+A   ++K HD+AVQK+GYVDLQE 
Sbjct  537   VINESEYNEVEAL-WPSDDGLQTQLVQDQRHSKLSTAAVFVRKLHDIAVQKRGYVDLQEA  595

Query  869   DSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
              + ES PC YG TL +D   S P SWA  DPS+FLIRG+ Y  DH KIKA  TLMQMVAA
Sbjct  596   STGESVPCSYGATLPKDPCCSLPSSWAMADPSTFLIRGESYLHDHLKIKANGTLMQMVAA  655

Query  1049  DWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             DWLKSD+R+DDL GRPGGIVQK++A    EFF IV+IQVPGSTTYSLALYYM+ +PLE  
Sbjct  656   DWLKSDKREDDLGGRPGGIVQKYSAHGGSEFFFIVHIQVPGSTTYSLALYYMMDSPLESF  715

Query  1229  PLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             PLLERFV GDDA+RNSRFKLIPYISK S
Sbjct  716   PLLERFVKGDDAYRNSRFKLIPYISKGS  743


 Score = 62.0 bits (149),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQAL++NYF G NY+
Sbjct  741   KGSWIVKQSVGKKACLVGQALDINYFCGSNYI  772



>ref|XP_008791555.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008791556.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Phoenix dactylifera]
Length=741

 Score =   489 bits (1258),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 264/449 (59%), Positives = 325/449 (72%), Gaps = 14/449 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRT+MSLGPSRSEWDF    G V+EHLDGHTDIIH +L+  W
Sbjct  200   DHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRVVEHLDGHTDIIHKKLHGDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMN+RDLLLRRYWRREDDGTYVILYHSV HQ C P++ YIRACLKSGG+VI+P+  G
Sbjct  260   LPWGMNKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPVNQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S++  +S++ +TIRMLG VAALRE FRAK GN + +  +S  E
Sbjct  320   KQSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAALREFFRAKLGNCTCS-DYSSGE  378

Query  542   MTIDi---eapigeeerreegaVDPTRCEDGMEELLSEPSS-------LVGLESACDEFY  691
             +T +I    +     +   +   + ++  D  E     PSS        + L  A DEF+
Sbjct  379   LTREIGLPYSEKEHIKVEVQTTGENSKSADSAEAPQQSPSSHANTSGSFLQLNDAADEFF  438

Query  692   DVLEPSddddeegegWSS--ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQE  865
             DV++ SD+D  E   W S      +   +  Q K+S+A   +KK HD AVQKKGY+DLQE
Sbjct  439   DVIDESDNDQTEAL-WPSDEGMHSQLVQEQRQHKLSTAAVFVKKLHDFAVQKKGYIDLQE  497

Query  866   VDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVA  1045
                 +  PC YG TL +D + +  CSWA  DP+SFLIRG+ Y +D +KIKA +TLMQMVA
Sbjct  498   ASMGDMAPCSYGTTLPKDPSCTMTCSWAMADPTSFLIRGESYLRDQQKIKANSTLMQMVA  557

Query  1046  ADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLED  1225
             ADWL SD+R+DDL GRPGG+VQK+AA    EFF IVNIQ+PGS+TYSLALYYM+  PLE+
Sbjct  558   ADWLNSDKREDDLGGRPGGVVQKYAAQGGSEFFFIVNIQIPGSSTYSLALYYMMDTPLEN  617

Query  1226  TPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
              PLLE FV GDDA+RNSRFKLIPYISK S
Sbjct  618   VPLLESFVKGDDAYRNSRFKLIPYISKGS  646


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQAL  +YF+G NYL
Sbjct  644   KGSWIVKQSVGKKACLVGQALASHYFRGSNYL  675



>ref|XP_010920451.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X6 [Elaeis guineensis]
Length=698

 Score =   486 bits (1252),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 264/449 (59%), Positives = 322/449 (72%), Gaps = 14/449 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRT+MSLGPSRSEWDF    G V+EHLDGHTDIIH +L   W
Sbjct  157   DHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRVVEHLDGHTDIIHKKLRGDW  216

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHSV HQ C P++ YIRACLKSGG+VI+P+  G
Sbjct  217   LPWGMKKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPVNQG  276

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S++  +S++ +TIRMLG VA LRE FRAK GN + +  +S  E
Sbjct  277   KRSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAGLREFFRAKLGNCTCS-DYSSGE  335

Query  542   MTIDiea---pigeeerreegaVDPTRCEDGMEELLSEPS-------SLVGLESACDEFY  691
             +T +I          +   +   +  +  D  E     PS       S + L  A DEF+
Sbjct  336   LTREIGLPYGEKEHIKVEVQTTGENNKSVDSAEAPQQSPSRHADTNGSFLQLNDAADEFF  395

Query  692   DVLEPSddddeegegWSS--ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQE  865
             DV++ SD+D  E   W S      +   +  Q ++S+A   +KK HD AVQKKGY+DLQE
Sbjct  396   DVIDESDNDQTESL-WPSDEGMHSQLLQEQRQPRLSTAAVFVKKLHDFAVQKKGYIDLQE  454

Query  866   VDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVA  1045
                 +  PC YG TL +D++ + PCSWA  D +SFLIRG+ Y +DH+KIKA +TLMQMVA
Sbjct  455   ASMGDMAPCSYGATLPKDTSCTMPCSWAMADSTSFLIRGESYLRDHQKIKANSTLMQMVA  514

Query  1046  ADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLED  1225
             ADWL SD+R+DDL GRPGGIVQK+AA    EFF IVNIQVPGSTTYSLALYYM+  PLE+
Sbjct  515   ADWLNSDKREDDLGGRPGGIVQKYAAQGGSEFFFIVNIQVPGSTTYSLALYYMMDTPLEN  574

Query  1226  TPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
              PLLE FV GD+A+RNSRFKLIPYISK S
Sbjct  575   VPLLESFVKGDNAYRNSRFKLIPYISKGS  603


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE++YF+G NYL
Sbjct  601   KGSWIVKQSVGKKACLVGQALEIHYFRGSNYL  632



>ref|XP_008791557.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X2 [Phoenix 
dactylifera]
Length=738

 Score =   487 bits (1253),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 264/447 (59%), Positives = 324/447 (72%), Gaps = 13/447 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRT+MSLGPSRSEWDF    G V+EHLDGHTDIIH +L+  W
Sbjct  200   DHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRVVEHLDGHTDIIHKKLHGDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMN+RDLLLRRYWRREDDGTYVILYHSV HQ C P++ YIRACLKSGG+VI+P+  G
Sbjct  260   LPWGMNKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPVNQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S++  +S++ +TIRMLG VAALRE FRAK GN + +  +S  E
Sbjct  320   KQSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAALREFFRAKLGNCTCS-DYSSGE  378

Query  542   MTIDi---eapigeeerreegaVDPTRCEDGMEELLSEPSS-------LVGLESACDEFY  691
             +T +I    +     +   +   + ++  D  E     PSS        + L  A DEF+
Sbjct  379   LTREIGLPYSEKEHIKVEVQTTGENSKSADSAEAPQQSPSSHANTSGSFLQLNDAADEFF  438

Query  692   DVLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             DV++ SD+D  E   W S        +  Q K+S+A   +KK HD AVQKKGY+DLQE  
Sbjct  439   DVIDESDNDQTEAL-WPSDEGMH-SQEQRQHKLSTAAVFVKKLHDFAVQKKGYIDLQEAS  496

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
               +  PC YG TL +D + +  CSWA  DP+SFLIRG+ Y +D +KIKA +TLMQMVAAD
Sbjct  497   MGDMAPCSYGTTLPKDPSCTMTCSWAMADPTSFLIRGESYLRDQQKIKANSTLMQMVAAD  556

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             WL SD+R+DDL GRPGG+VQK+AA    EFF IVNIQ+PGS+TYSLALYYM+  PLE+ P
Sbjct  557   WLNSDKREDDLGGRPGGVVQKYAAQGGSEFFFIVNIQIPGSSTYSLALYYMMDTPLENVP  616

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLE FV GDDA+RNSRFKLIPYISK S
Sbjct  617   LLESFVKGDDAYRNSRFKLIPYISKGS  643


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQAL  +YF+G NYL
Sbjct  641   KGSWIVKQSVGKKACLVGQALASHYFRGSNYL  672



>ref|XP_010920450.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X5 [Elaeis 
guineensis]
Length=723

 Score =   486 bits (1250),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 264/449 (59%), Positives = 322/449 (72%), Gaps = 14/449 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRT+MSLGPSRSEWDF    G V+EHLDGHTDIIH +L   W
Sbjct  182   DHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRVVEHLDGHTDIIHKKLRGDW  241

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHSV HQ C P++ YIRACLKSGG+VI+P+  G
Sbjct  242   LPWGMKKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPVNQG  301

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S++  +S++ +TIRMLG VA LRE FRAK GN + +  +S  E
Sbjct  302   KRSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAGLREFFRAKLGNCTCS-DYSSGE  360

Query  542   MTIDiea---pigeeerreegaVDPTRCEDGMEELLSEPS-------SLVGLESACDEFY  691
             +T +I          +   +   +  +  D  E     PS       S + L  A DEF+
Sbjct  361   LTREIGLPYGEKEHIKVEVQTTGENNKSVDSAEAPQQSPSRHADTNGSFLQLNDAADEFF  420

Query  692   DVLEPSddddeegegWSS--ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQE  865
             DV++ SD+D  E   W S      +   +  Q ++S+A   +KK HD AVQKKGY+DLQE
Sbjct  421   DVIDESDNDQTESL-WPSDEGMHSQLLQEQRQPRLSTAAVFVKKLHDFAVQKKGYIDLQE  479

Query  866   VDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVA  1045
                 +  PC YG TL +D++ + PCSWA  D +SFLIRG+ Y +DH+KIKA +TLMQMVA
Sbjct  480   ASMGDMAPCSYGATLPKDTSCTMPCSWAMADSTSFLIRGESYLRDHQKIKANSTLMQMVA  539

Query  1046  ADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLED  1225
             ADWL SD+R+DDL GRPGGIVQK+AA    EFF IVNIQVPGSTTYSLALYYM+  PLE+
Sbjct  540   ADWLNSDKREDDLGGRPGGIVQKYAAQGGSEFFFIVNIQVPGSTTYSLALYYMMDTPLEN  599

Query  1226  TPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
              PLLE FV GD+A+RNSRFKLIPYISK S
Sbjct  600   VPLLESFVKGDNAYRNSRFKLIPYISKGS  628


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE++YF+G NYL
Sbjct  626   KGSWIVKQSVGKKACLVGQALEIHYFRGSNYL  657



>ref|XP_010920447.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X2 [Elaeis 
guineensis]
Length=740

 Score =   486 bits (1251),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 264/449 (59%), Positives = 322/449 (72%), Gaps = 14/449 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRT+MSLGPSRSEWDF    G V+EHLDGHTDIIH +L   W
Sbjct  200   DHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRVVEHLDGHTDIIHKKLRGDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHSV HQ C P++ YIRACLKSGG+VI+P+  G
Sbjct  260   LPWGMKKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPVNQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S++  +S++ +TIRMLG VA LRE FRAK GN + +  +S  E
Sbjct  320   KRSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAGLREFFRAKLGNCTCS-DYSSGE  378

Query  542   MTIDiea---pigeeerreegaVDPTRCEDGMEELLSEPS-------SLVGLESACDEFY  691
             +T +I          +   +   +  +  D  E     PS       S + L  A DEF+
Sbjct  379   LTREIGLPYGEKEHIKVEVQTTGENNKSVDSAEAPQQSPSRHADTNGSFLQLNDAADEFF  438

Query  692   DVLEPSddddeegegWSS--ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQE  865
             DV++ SD+D  E   W S      +   +  Q ++S+A   +KK HD AVQKKGY+DLQE
Sbjct  439   DVIDESDNDQTESL-WPSDEGMHSQLLQEQRQPRLSTAAVFVKKLHDFAVQKKGYIDLQE  497

Query  866   VDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVA  1045
                 +  PC YG TL +D++ + PCSWA  D +SFLIRG+ Y +DH+KIKA +TLMQMVA
Sbjct  498   ASMGDMAPCSYGATLPKDTSCTMPCSWAMADSTSFLIRGESYLRDHQKIKANSTLMQMVA  557

Query  1046  ADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLED  1225
             ADWL SD+R+DDL GRPGGIVQK+AA    EFF IVNIQVPGSTTYSLALYYM+  PLE+
Sbjct  558   ADWLNSDKREDDLGGRPGGIVQKYAAQGGSEFFFIVNIQVPGSTTYSLALYYMMDTPLEN  617

Query  1226  TPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
              PLLE FV GD+A+RNSRFKLIPYISK S
Sbjct  618   VPLLESFVKGDNAYRNSRFKLIPYISKGS  646


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE++YF+G NYL
Sbjct  644   KGSWIVKQSVGKKACLVGQALEIHYFRGSNYL  675



>ref|XP_010920444.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X1 [Elaeis 
guineensis]
 ref|XP_010920446.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X1 [Elaeis 
guineensis]
Length=741

 Score =   486 bits (1251),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 264/449 (59%), Positives = 322/449 (72%), Gaps = 14/449 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRT+MSLGPSRSEWDF    G V+EHLDGHTDIIH +L   W
Sbjct  200   DHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRVVEHLDGHTDIIHKKLRGDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHSV HQ C P++ YIRACLKSGG+VI+P+  G
Sbjct  260   LPWGMKKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPVNQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S++  +S++ +TIRMLG VA LRE FRAK GN + +  +S  E
Sbjct  320   KRSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAGLREFFRAKLGNCTCS-DYSSGE  378

Query  542   MTIDiea---pigeeerreegaVDPTRCEDGMEELLSEPS-------SLVGLESACDEFY  691
             +T +I          +   +   +  +  D  E     PS       S + L  A DEF+
Sbjct  379   LTREIGLPYGEKEHIKVEVQTTGENNKSVDSAEAPQQSPSRHADTNGSFLQLNDAADEFF  438

Query  692   DVLEPSddddeegegWSS--ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQE  865
             DV++ SD+D  E   W S      +   +  Q ++S+A   +KK HD AVQKKGY+DLQE
Sbjct  439   DVIDESDNDQTESL-WPSDEGMHSQLLQEQRQPRLSTAAVFVKKLHDFAVQKKGYIDLQE  497

Query  866   VDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVA  1045
                 +  PC YG TL +D++ + PCSWA  D +SFLIRG+ Y +DH+KIKA +TLMQMVA
Sbjct  498   ASMGDMAPCSYGATLPKDTSCTMPCSWAMADSTSFLIRGESYLRDHQKIKANSTLMQMVA  557

Query  1046  ADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLED  1225
             ADWL SD+R+DDL GRPGGIVQK+AA    EFF IVNIQVPGSTTYSLALYYM+  PLE+
Sbjct  558   ADWLNSDKREDDLGGRPGGIVQKYAAQGGSEFFFIVNIQVPGSTTYSLALYYMMDTPLEN  617

Query  1226  TPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
              PLLE FV GD+A+RNSRFKLIPYISK S
Sbjct  618   VPLLESFVKGDNAYRNSRFKLIPYISKGS  646


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE++YF+G NYL
Sbjct  644   KGSWIVKQSVGKKACLVGQALEIHYFRGSNYL  675



>ref|XP_010920449.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X4 [Elaeis 
guineensis]
Length=738

 Score =   486 bits (1250),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 264/449 (59%), Positives = 322/449 (72%), Gaps = 14/449 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRT+MSLGPSRSEWDF    G V+EHLDGHTDIIH +L   W
Sbjct  197   DHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRVVEHLDGHTDIIHKKLRGDW  256

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHSV HQ C P++ YIRACLKSGG+VI+P+  G
Sbjct  257   LPWGMKKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPVNQG  316

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S++  +S++ +TIRMLG VA LRE FRAK GN + +  +S  E
Sbjct  317   KRSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAGLREFFRAKLGNCTCS-DYSSGE  375

Query  542   MTIDiea---pigeeerreegaVDPTRCEDGMEELLSEPS-------SLVGLESACDEFY  691
             +T +I          +   +   +  +  D  E     PS       S + L  A DEF+
Sbjct  376   LTREIGLPYGEKEHIKVEVQTTGENNKSVDSAEAPQQSPSRHADTNGSFLQLNDAADEFF  435

Query  692   DVLEPSddddeegegWSS--ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQE  865
             DV++ SD+D  E   W S      +   +  Q ++S+A   +KK HD AVQKKGY+DLQE
Sbjct  436   DVIDESDNDQTESL-WPSDEGMHSQLLQEQRQPRLSTAAVFVKKLHDFAVQKKGYIDLQE  494

Query  866   VDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVA  1045
                 +  PC YG TL +D++ + PCSWA  D +SFLIRG+ Y +DH+KIKA +TLMQMVA
Sbjct  495   ASMGDMAPCSYGATLPKDTSCTMPCSWAMADSTSFLIRGESYLRDHQKIKANSTLMQMVA  554

Query  1046  ADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLED  1225
             ADWL SD+R+DDL GRPGGIVQK+AA    EFF IVNIQVPGSTTYSLALYYM+  PLE+
Sbjct  555   ADWLNSDKREDDLGGRPGGIVQKYAAQGGSEFFFIVNIQVPGSTTYSLALYYMMDTPLEN  614

Query  1226  TPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
              PLLE FV GD+A+RNSRFKLIPYISK S
Sbjct  615   VPLLESFVKGDNAYRNSRFKLIPYISKGS  643


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE++YF+G NYL
Sbjct  641   KGSWIVKQSVGKKACLVGQALEIHYFRGSNYL  672



>ref|XP_002876269.1| hypothetical protein ARALYDRAFT_485890 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52528.1| hypothetical protein ARALYDRAFT_485890 [Arabidopsis lyrata subsp. 
lyrata]
Length=732

 Score =   485 bits (1248),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 257/440 (58%), Positives = 325/440 (74%), Gaps = 9/440 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGVID TSE +F TLMSLGP RSEWDFCF +GSV+EHLDGHTDII+LQLY+ W
Sbjct  206   DHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEWDFCFYKGSVVEHLDGHTDIINLQLYSDW  265

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMNRRDLLLRRYWRRE+DGTYVIL HSV H+ CPP+K Y+RAC+KSGG+V+TP   G
Sbjct  266   LPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKNCPPKKGYVRACVKSGGYVVTPANNG  325

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL---SFS  532
             K S+VKHM+A+DW+ W  +++ +S+RSITIR++  VAALREMF+AK+GN  ++     F 
Sbjct  326   KQSLVKHMVAIDWRSWNLYMRPSSARSITIRVVERVAALREMFKAKQGNGFTDFVSGEFL  385

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
               +  +        +   +E  ++  + E+ M++  S  +SL+ L  A DEF+DV EP++
Sbjct  386   DTKPCLSKINTRPLKTEAKEVDLETVKAEE-MDKPTSARNSLMDLNDASDEFFDVPEPNE  444

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
               + +    +S  S       +Q KI +   ++KK  DLA+ KKGY+DLQEV  EE+   
Sbjct  445   STEFDSFIDTSPYS-----QGHQLKIPTPAGIVKKLQDLAINKKGYMDLQEVGLEENNTF  499

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
              YG TLQ+D + + PCSW+  DPS+FLIRG  Y KD +K+KAK TLMQMV ADW+ SD+R
Sbjct  500   FYGATLQKDPSLTLPCSWSTADPSTFLIRGNNYLKDQQKVKAKGTLMQMVGADWISSDKR  559

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL GR GG+VQ+ AA   PEFF IVNIQVPGS  YSLALYYMLK PLE+ PLLE FVN
Sbjct  560   EDDLGGRVGGLVQEFAAKGGPEFFFIVNIQVPGSAMYSLALYYMLKTPLEEHPLLESFVN  619

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDDA+RNSRFKLIP+ISK S
Sbjct  620   GDDAYRNSRFKLIPHISKGS  639


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV Y +GKNYL
Sbjct  637   KGSWIVKQSVGKKACLVGQALEVRYTRGKNYL  668



>ref|XP_010920448.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X3 [Elaeis 
guineensis]
Length=738

 Score =   484 bits (1246),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 264/447 (59%), Positives = 321/447 (72%), Gaps = 13/447 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRT+MSLGPSRSEWDF    G V+EHLDGHTDIIH +L   W
Sbjct  200   DHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRVVEHLDGHTDIIHKKLRGDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHSV HQ C P++ YIRACLKSGG+VI+P+  G
Sbjct  260   LPWGMKKRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPVNQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S++  +S++ +TIRMLG VA LRE FRAK GN + +  +S  E
Sbjct  320   KRSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAGLREFFRAKLGNCTCS-DYSSGE  378

Query  542   MTIDiea---pigeeerreegaVDPTRCEDGMEELLSEPS-------SLVGLESACDEFY  691
             +T +I          +   +   +  +  D  E     PS       S + L  A DEF+
Sbjct  379   LTREIGLPYGEKEHIKVEVQTTGENNKSVDSAEAPQQSPSRHADTNGSFLQLNDAADEFF  438

Query  692   DVLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             DV++ SD+D  E   W S        +  Q ++S+A   +KK HD AVQKKGY+DLQE  
Sbjct  439   DVIDESDNDQTESL-WPSDEGMH-SQEQRQPRLSTAAVFVKKLHDFAVQKKGYIDLQEAS  496

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
               +  PC YG TL +D++ + PCSWA  D +SFLIRG+ Y +DH+KIKA +TLMQMVAAD
Sbjct  497   MGDMAPCSYGATLPKDTSCTMPCSWAMADSTSFLIRGESYLRDHQKIKANSTLMQMVAAD  556

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             WL SD+R+DDL GRPGGIVQK+AA    EFF IVNIQVPGSTTYSLALYYM+  PLE+ P
Sbjct  557   WLNSDKREDDLGGRPGGIVQKYAAQGGSEFFFIVNIQVPGSTTYSLALYYMMDTPLENVP  616

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLE FV GD+A+RNSRFKLIPYISK S
Sbjct  617   LLESFVKGDNAYRNSRFKLIPYISKGS  643


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE++YF+G NYL
Sbjct  641   KGSWIVKQSVGKKACLVGQALEIHYFRGSNYL  672



>ref|XP_008367183.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Malus domestica]
Length=735

 Score =   484 bits (1245),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 266/445 (60%), Positives = 329/445 (74%), Gaps = 11/445 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRTL+SLGPSRSEWDFC+ +GSV+E LDGHTDIIH QLY+ W
Sbjct  200   DHPAIMAVGVVDGTSEAIFRTLLSLGPSRSEWDFCYYQGSVVERLDGHTDIIHQQLYSDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLL+RRYWRREDDGTYVILYHSV H+KCPP++ Y+RACLKSGG VITP   G
Sbjct  260   LPWGMQRRDLLIRRYWRREDDGTYVILYHSVSHKKCPPKRGYVRACLKSGGFVITPANQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K S+V+HMLA+DWK WK +L+ +S+R ITIRML  VAALRE+F AK G  +S+  F   +
Sbjct  320   KQSLVRHMLAIDWKFWKLYLRPSSARCITIRMLERVAALRELFGAKAG--TSSPEFXSGD  377

Query  542   MTIDieapigeeerreegaVDP---TRCEDG--MEELLSEP---SSLVGLESACDEFYDV  697
             M+ +I+     ++  +     P    + E+G  +E+ + +P   +SL GL  A DEF+DV
Sbjct  378   MSSEIKFSQSGQQNIKTEVQHPGEVKKMEEGVLVEDEVEKPEGRASLKGLHDAADEFFDV  437

Query  698   LEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              EP++ D  E E  S  +  +        K+SSA  L+KK H+L VQKKGY+DLQEV  E
Sbjct  438   PEPTEYDQFENEWPSDVSMEQNPTSIQHHKLSSAAVLVKKLHELRVQKKGYMDLQEVCKE  497

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             +S  C YG TLQ+D + + PCSW   DPSSFLIRG  Y +D +KIKAK+TLMQ+V  DWL
Sbjct  498   DS-VCPYGATLQKDPSCALPCSWGSADPSSFLIRGPNYLRDRQKIKAKSTLMQLVGVDWL  556

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SD+R+DDL  R G IVQK A     EFF IVNIQVPG+T Y+LA YYM+K PLE+TPLL
Sbjct  557   RSDKREDDLGSRYGNIVQKSAERGGSEFFFIVNIQVPGTTMYTLAFYYMIKTPLEETPLL  616

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
               FVNGDD++RNSRFKLIPYISK S
Sbjct  617   HAFVNGDDSYRNSRFKLIPYISKGS  641


 Score = 65.9 bits (159),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV+YF+GKNYL
Sbjct  639   KGSWIVKQSVGKKACLVGQALEVHYFRGKNYL  670



>ref|XP_007143713.1| hypothetical protein PHAVU_007G095400g [Phaseolus vulgaris]
 gb|ESW15707.1| hypothetical protein PHAVU_007G095400g [Phaseolus vulgaris]
Length=719

 Score =   483 bits (1244),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 257/441 (58%), Positives = 322/441 (73%), Gaps = 9/441 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+F TLM+L P+RSEWDFC  RGSV++HLDGHTDI+H+++YN W
Sbjct  190   DHPAIMAVGVVDGTSEAIFNTLMTLDPTRSEWDFCVYRGSVVDHLDGHTDIVHIEMYNDW  249

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM  RDLLLRRYWRREDDG+YV+LYHSV H KCPP+K Y+RACLKSGG V+TP+  G
Sbjct  250   LPWGMKPRDLLLRRYWRREDDGSYVLLYHSVYHSKCPPKKGYVRACLKSGGFVVTPVNKG  309

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               SVV+HMLA+DWK WK +L+ +S+RSITIRML  +AALRE+FR K GN SS       E
Sbjct  310   TQSVVRHMLAIDWKFWKLYLRPSSARSITIRMLERIAALRELFRTKGGNSSSETLTMTKE  369

Query  542   MTIDieapigeeerreegaV---DP-TRCEDGMEELLSEPSSLVGLESACDEFYDVLEPS  709
             + +        +    E      +P    EDG+E   S  ++L+G   + DEF+DV EP+
Sbjct  370   IGLPPGVKEDVKSDVSEEKTKFEEPLIVLEDGVEP--SGRTNLMGFNDS-DEFFDVPEPT  426

Query  710   ddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEP  889
             + D  + E      S +  +     ++S+A  L+KK HDLAVQKKGY+DL E   EES  
Sbjct  427   EYDHFDNEWHPDLASEQMGMSI--PRMSTAVGLVKKLHDLAVQKKGYMDLHETVREESAS  484

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
             C YG TLQ DS+ S PC+WA  DPS FL+RG+ Y +DH+K+KA  TL QMV ADWL+SD 
Sbjct  485   CSYGATLQNDSSCSLPCTWAASDPSLFLVRGENYLQDHQKVKAHGTLTQMVGADWLRSDT  544

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFV  1249
             R+DDL+ RPG IVQ++AA   PEFF ++NIQ+PG+  YSLALYYMLK PLED PL++ FV
Sbjct  545   REDDLSSRPGSIVQQYAAKGGPEFFFVINIQMPGTPMYSLALYYMLKTPLEDNPLMQSFV  604

Query  1250  NGDDAFRNSRFKLIPYISKVS  1312
             +GDDA+RNSRFKLIPYISK S
Sbjct  605   DGDDAYRNSRFKLIPYISKGS  625


 Score = 62.8 bits (151),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV Y +GKNYL
Sbjct  623   KGSWIVKQSVGKKACLVGQALEVLYIRGKNYL  654



>ref|XP_008367239.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Malus domestica]
Length=730

 Score =   484 bits (1245),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 266/445 (60%), Positives = 329/445 (74%), Gaps = 11/445 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRTL+SLGPSRSEWDFC+ +GSV+E LDGHTDIIH QLY+ W
Sbjct  195   DHPAIMAVGVVDGTSEAIFRTLLSLGPSRSEWDFCYYQGSVVERLDGHTDIIHQQLYSDW  254

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLL+RRYWRREDDGTYVILYHSV H+KCPP++ Y+RACLKSGG VITP   G
Sbjct  255   LPWGMQRRDLLIRRYWRREDDGTYVILYHSVSHKKCPPKRGYVRACLKSGGFVITPANQG  314

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K S+V+HMLA+DWK WK +L+ +S+R ITIRML  VAALRE+F AK G  +S+  F   +
Sbjct  315   KQSLVRHMLAIDWKFWKLYLRPSSARCITIRMLERVAALRELFGAKAG--TSSPEFXSGD  372

Query  542   MTIDieapigeeerreegaVDP---TRCEDG--MEELLSEP---SSLVGLESACDEFYDV  697
             M+ +I+     ++  +     P    + E+G  +E+ + +P   +SL GL  A DEF+DV
Sbjct  373   MSSEIKFSQSGQQNIKTEVQHPGEVKKMEEGVLVEDEVEKPEGRASLKGLHDAADEFFDV  432

Query  698   LEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              EP++ D  E E  S  +  +        K+SSA  L+KK H+L VQKKGY+DLQEV  E
Sbjct  433   PEPTEYDQFENEWPSDVSMEQNPTSIQHHKLSSAAVLVKKLHELRVQKKGYMDLQEVCKE  492

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             +S  C YG TLQ+D + + PCSW   DPSSFLIRG  Y +D +KIKAK+TLMQ+V  DWL
Sbjct  493   DS-VCPYGATLQKDPSCALPCSWGSADPSSFLIRGPNYLRDRQKIKAKSTLMQLVGVDWL  551

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SD+R+DDL  R G IVQK A     EFF IVNIQVPG+T Y+LA YYM+K PLE+TPLL
Sbjct  552   RSDKREDDLGSRYGNIVQKSAERGGSEFFFIVNIQVPGTTMYTLAFYYMIKTPLEETPLL  611

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
               FVNGDD++RNSRFKLIPYISK S
Sbjct  612   HAFVNGDDSYRNSRFKLIPYISKGS  636


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV+YF+GKNYL
Sbjct  634   KGSWIVKQSVGKKACLVGQALEVHYFRGKNYL  665



>ref|XP_006292259.1| hypothetical protein CARUB_v10018468mg [Capsella rubella]
 gb|EOA25157.1| hypothetical protein CARUB_v10018468mg [Capsella rubella]
Length=731

 Score =   483 bits (1243),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 250/440 (57%), Positives = 328/440 (75%), Gaps = 9/440 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH++IMAVGVI+ TSE +F TLMSLGP RSEWDFCF +GSV+EHLDGHTDII++QLY+ W
Sbjct  205   DHAAIMAVGVIEGTSEDIFNTLMSLGPLRSEWDFCFYKGSVVEHLDGHTDIINMQLYSDW  264

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMNRRDLLLRRYWRRE+DGTYVIL HSV H+KCPP++ Y+RAC+KSGG+V+TP+  G
Sbjct  265   LPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKKCPPKRGYVRACVKSGGYVVTPVNKG  324

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL---SFS  532
             K S+VKHM+A+DW+ W  +++ +S+RSITIR++  VAALREMF+AK+G+  +      F+
Sbjct  325   KHSLVKHMVAIDWRSWNLYMRPSSARSITIRVVERVAALREMFKAKQGHGFTEFVSGEFA  384

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
             + +  +        +   +E   +  + E+ M++  S  +SL+ L  A DEF+DV EP++
Sbjct  385   VTKPCLSKVNTKPLKTEAKEVNQETVKAEE-MDKPSSARNSLMDLNDASDEFFDVPEPNE  443

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
               + +    +S  S       +Q KI     ++KK  DLA+ KKGY+DLQE+  EE+   
Sbjct  444   STEFDSFIDNSPFS-----QGHQLKIPKPAGIVKKLQDLAINKKGYMDLQEMGLEENNTF  498

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
              YG TLQ+D N + PCSW+  DPS+FLIRG  Y +DH+K+KAK TLMQM+ ADW+ SD+R
Sbjct  499   FYGATLQKDPNLTLPCSWSTADPSTFLIRGNNYLEDHQKVKAKGTLMQMIGADWISSDKR  558

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL GR GG+VQ+ AA   PEFF +VNIQVPGS  YSLALYYMLK PLE+ PLL+ FVN
Sbjct  559   EDDLGGRVGGLVQEFAAKGGPEFFFVVNIQVPGSAMYSLALYYMLKTPLEEHPLLQSFVN  618

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDDA+RNSRFKL+P+ISK S
Sbjct  619   GDDAYRNSRFKLVPHISKGS  638


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV Y +GKNYL
Sbjct  636   KGSWIVKQSVGKKACLVGQALEVRYTRGKNYL  667



>ref|XP_008456489.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Cucumis melo]
Length=733

 Score =   483 bits (1243),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 261/445 (59%), Positives = 323/445 (73%), Gaps = 13/445 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVG++  TSE +FRTLMSLG SRSEWDFCF RGS++EH+DGHTDIIH+QLY  W
Sbjct  200   DHPAIMAVGMVCGTSEEIFRTLMSLGSSRSEWDFCFFRGSLVEHIDGHTDIIHMQLYRDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RD LLRRYWRREDDGTYV+LYHSV H K PPQK Y+RACLKSGG+V+TP+  G
Sbjct  260   LPWGMKKRDFLLRRYWRREDDGTYVLLYHSVFHVKFPPQKGYVRACLKSGGYVVTPVNQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLS-----  526
             K S+VKHMLAVDWK WK +L+ +S+R+ITIRM+  +AALRE+FRAK G+ SS  S     
Sbjct  320   KHSLVKHMLAVDWKFWKLYLRPSSARAITIRMVERLAALRELFRAKVGDSSSEFSSSSRD  379

Query  527   ---FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDV  697
                F L +  ID      +         +    E+  E      +SL+GL  A DEF+DV
Sbjct  380   LRHFELPQSDIDEIKTEIQSPETMRKIKEAFLKENEAE---MPRASLIGLNDAVDEFFDV  436

Query  698   LEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              EP+ + D     W+S  + +  ++ +Q K+S+A   +KK HDLAVQKKGY +L E+  E
Sbjct  437   PEPA-ELDHYENEWTSDLTLQ-QLNMSQNKLSTAAVFVKKLHDLAVQKKGYTELPELPRE  494

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             ES    YG TL +D N+STPCS A  DPS FLIRG+ Y KD +KIKA  TLMQ+V ADWL
Sbjct  495   ESMAYSYGSTLPKDFNFSTPCSVASADPSLFLIRGENYLKDSQKIKANGTLMQLVGADWL  554

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SDRR+D+L GRPG IVQK+A     EFF +VNIQVPG+T Y+LA+YYM++ PLE +PLL
Sbjct  555   RSDRREDNLGGRPGSIVQKYAERGGTEFFFVVNIQVPGTTMYTLAMYYMMRTPLESSPLL  614

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
             + FV GDDAFRNSRFKLIPYIS+ S
Sbjct  615   KNFVEGDDAFRNSRFKLIPYISQGS  639


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             QGSWIVKQSVGKKACL+G ALEV+YF+GKNYL
Sbjct  637   QGSWIVKQSVGKKACLVGHALEVHYFRGKNYL  668



>ref|NP_191040.2| Pleckstrin homology (PH) and lipid-binding START domain-containing 
protein [Arabidopsis thaliana]
 ref|NP_001030862.1| Pleckstrin homology (PH) and lipid-binding START domain-containing 
protein [Arabidopsis thaliana]
 dbj|BAH19994.1| AT3G54800 [Arabidopsis thaliana]
 gb|AEE79289.1| Pleckstrin homology (PH) and lipid-binding START domain-containing 
protein [Arabidopsis thaliana]
 gb|AEE79290.1| Pleckstrin homology (PH) and lipid-binding START domain-containing 
protein [Arabidopsis thaliana]
Length=733

 Score =   481 bits (1238),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 256/440 (58%), Positives = 325/440 (74%), Gaps = 9/440 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGVID TSE +F TLMSLGP RSEWDFCF +G+V+EHLDGHTDIIHLQLY+ W
Sbjct  207   DHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEWDFCFYKGNVVEHLDGHTDIIHLQLYSDW  266

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMNRRDLLLRRYWRREDDGTYVIL HSV H+ CPP+K Y+RAC+KSGG+V+TP   G
Sbjct  267   LPWGMNRRDLLLRRYWRREDDGTYVILCHSVYHKNCPPKKGYVRACVKSGGYVVTPANNG  326

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL---SFS  532
             K S+VKHM+A+DW+ W  +++ +S+RSITIR++  VAALREMF+AK+G+  +      F 
Sbjct  327   KQSLVKHMVAIDWRSWNLYMRPSSARSITIRVVERVAALREMFKAKQGHGFTEFVSGEFL  386

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
               +  +     +  +   +E  ++    E+ M++  S  +SL+ L  A DEF+DV EP++
Sbjct  387   DTKPCLSKINTMPLKTEAKEVDLETMHAEE-MDKPTSARNSLMDLNDASDEFFDVPEPNE  445

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
               + +    SS  S       +Q KI +   ++KK  DLA+ KKGY+DLQEV  EE+   
Sbjct  446   STEFDSFIDSSPYS-----QGHQLKIPTPAGIVKKLQDLAINKKGYMDLQEVGLEENNTF  500

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
              YG TLQ+D + + PCSW+  DPS+FLIRG  Y K+ +K+KAK TLMQM+ ADW+ SD+R
Sbjct  501   FYGATLQKDPSLTLPCSWSTADPSTFLIRGNNYLKNQQKVKAKGTLMQMIGADWISSDKR  560

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL GR GG+VQ++AA   PEFF IVNIQVPGS  YSLALYYMLK PLE+ PLLE FVN
Sbjct  561   EDDLGGRIGGLVQEYAAKGSPEFFFIVNIQVPGSAMYSLALYYMLKTPLEEHPLLESFVN  620

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDDA+RNSRFKLIP+ISK S
Sbjct  621   GDDAYRNSRFKLIPHISKGS  640


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQ LEV Y +GKNYL
Sbjct  638   KGSWIVKQSVGKKACLVGQVLEVCYTRGKNYL  669



>ref|XP_006662447.1| PREDICTED: uncharacterized protein LOC102718305 [Oryza brachyantha]
Length=715

 Score =   481 bits (1237),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 264/438 (60%), Positives = 310/438 (71%), Gaps = 18/438 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D  SEAVF+T+MSLG SRSEWDFC   G V+EH+DGHTDIIH +L   W
Sbjct  200   DHPAIMAVGVVDANSEAVFQTIMSLGQSRSEWDFCLQEGRVVEHIDGHTDIIHKKLKGDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLLRRYWRREDDGTYVILYHSV H +C  ++ Y+RACLKSGG+VI+P+  G
Sbjct  260   LPWGMRKRDLLLRRYWRREDDGTYVILYHSVFHYRCRSERGYVRACLKSGGYVISPVNQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               SVVKHMLA+DWK WKS+L  +S++SITIRMLG VAALRE FRAK GN  + L FS  E
Sbjct  320   NQSVVKHMLAIDWKFWKSYLFTSSAKSITIRMLGRVAALREFFRAKNGN-CACLEFSSGE  378

Query  542   MTIDieapigeeerreegaVDPTRCE-DGMEELLSEPSSLVGLESACDEFYDVLEPSddd  718
                                 DPT     G    LS   S + L  A DEF+DV + S+ D
Sbjct  379   ---------------NNRLEDPTEGSLGGSNRHLSSAGSFIQLNDAADEFFDVPDESEYD  423

Query  719   deegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCY  898
               E   W S  S     D    K+S+A   ++K HDLAVQKKGYVDLQ     ++   CY
Sbjct  424   QREAM-WPSDESTHSVQDQRHAKLSTAAVFVRKLHDLAVQKKGYVDLQGAADFDNGSFCY  482

Query  899   GGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQD  1078
             G TL +DS+ + P +WA  DP++FLIRG+ Y  D  KIKA +TLMQMV ADW+KSD+R+D
Sbjct  483   GCTLPKDSSCTMPSTWAMADPTTFLIRGESYLLDRHKIKAHSTLMQMVGADWIKSDKRED  542

Query  1079  DLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGD  1258
             DLAGRPGG+VQK AA    +FF IVNIQVPGS+TYSLALYYM+  PLE  PLLERFVNGD
Sbjct  543   DLAGRPGGLVQKCAAQGGNKFFFIVNIQVPGSSTYSLALYYMMDTPLEKVPLLERFVNGD  602

Query  1259  DAFRNSRFKLIPYISKVS  1312
             DAFRNSRFKLIPYISK S
Sbjct  603   DAFRNSRFKLIPYISKGS  620


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  618   KGSWIVKQSVGKKACLVGQALEINYFRGSNYL  649



>ref|XP_008385406.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like, partial 
[Malus domestica]
Length=564

 Score =   475 bits (1222),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 268/446 (60%), Positives = 320/446 (72%), Gaps = 28/446 (6%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D  SE +F+TLMSLGPSRS+              DGHTDIIH QLY+ W
Sbjct  44    DHPAIMAVGVVDGISEGIFQTLMSLGPSRSD-------------JDGHTDIIHKQLYSDW  90

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV H++CPPQK Y+RACLKSGG+VITP+   
Sbjct  91    LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKRCPPQKGYVRACLKSGGYVITPVNQX  150

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK WKS+L+ +S+R +TI+MLG VAALRE FR  +GN+SS+  FSL E
Sbjct  151   KQSVVKHMLAIDWKFWKSYLQSSSARXMTIKMLGRVAALREFFRT-QGNYSSS-EFSLGE  208

Query  542   MTIDieapigeeerreegaVDPTRCEDG---------MEELLSEPSSLVGLESACDEFYD  694
             +  +      E +   +    PT   DG         +E+  SE +SLV L  A DEF+D
Sbjct  209   LRRNFSLQQNEGDGEADA---PTVTGDGRTKEKLAEEVEKAPSEHASLVSLNDASDEFFD  265

Query  695   VLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDS  874
             V EP   D  E E      S     + +  K+S+A   +K+ HDLAVQK+GYVDLQE+D 
Sbjct  266   VPEPPSSDQSETEWIPDFGSEMHSQNIHHPKLSTAAGFVKRLHDLAVQKRGYVDLQEMDR  325

Query  875   EESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADW  1054
             E+   C YG TL +DS  +   SW   DPS+FLIRGK Y +DH+K+KAK TLMQMVAADW
Sbjct  326   EDIT-CHYGSTLPKDSACNLASSWTSADPSTFLIRGKSYLEDHKKVKAKGTLMQMVAADW  384

Query  1055  LKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPL  1234
             LKSD+R+DDL GRPG IVQK+A   R EFF IVNIQVPGSTTYSLALYYM+ +P+EDTPL
Sbjct  385   LKSDKREDDLGGRPGSIVQKYATQGRGEFFFIVNIQVPGSTTYSLALYYMMNSPVEDTPL  444

Query  1235  LERFVNGDDAFRNSRFKLIPYISKVS  1312
             LE F+ GDDA+RNSRFKLIPYISK S
Sbjct  445   LESFIKGDDAYRNSRFKLIPYISKGS  470


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF GKNY+
Sbjct  468   KGSWIVKQSVGKKACLIGQALEINYFHGKNYV  499



>ref|XP_006403534.1| hypothetical protein EUTSA_v10010151mg [Eutrema salsugineum]
 gb|ESQ44987.1| hypothetical protein EUTSA_v10010151mg [Eutrema salsugineum]
Length=731

 Score =   479 bits (1232),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 252/440 (57%), Positives = 322/440 (73%), Gaps = 8/440 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGVID TSE +F TLMSLGP RSEWDFCF +G+V+EHLDGHTDII++QLY+ W
Sbjct  204   DHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEWDFCFYKGTVVEHLDGHTDIINIQLYSDW  263

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMNRRDLLLRRYWRRE+DGTYVIL HSV H+KCPP++ Y+RAC+KSGG+V+TP+  G
Sbjct  264   LPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKKCPPKRGYVRACVKSGGYVVTPVNKG  323

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL---SFS  532
             K S+VKHM+A+DW+ W  +++ +S+RSITIR++  +AALREMF+AK+G+  +      F 
Sbjct  324   KQSLVKHMVAIDWRSWNLYMRSSSARSITIRVVERLAALREMFKAKQGHGFTEFVSGEFM  383

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
              A   +        +   +   +D  + E+ ME+  S  +SL+ L  A DEF+DV EP++
Sbjct  384   EANSCLSKINTRPLKPEAKRIDLDLVKAEE-MEKPSSARNSLMDLNDASDEFFDVPEPNE  442

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
               + +     S+    F    +Q KI S    +KK  DLA+ KKGY+DLQEV  +E    
Sbjct  443   STEFDNLIDKSS----FSQGPSQLKIPSPAGFVKKLQDLAINKKGYMDLQEVAIDEKTTF  498

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
              YG TLQ+D N + PCSWA  DPS+FLIRG  Y KD +K+KAK TLMQM+ ADW+ S++R
Sbjct  499   FYGATLQKDPNLTLPCSWAIADPSTFLIRGDNYLKDQQKVKAKGTLMQMIGADWISSNKR  558

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL GR GG+VQ+ A    PEFF IVNIQVPGS  YSLALYYMLK PLE+ PLL+ FV+
Sbjct  559   EDDLGGRLGGLVQEFAEKGGPEFFFIVNIQVPGSAMYSLALYYMLKTPLEEHPLLQSFVD  618

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDDA+RNSRFKLIP+ISK S
Sbjct  619   GDDAYRNSRFKLIPHISKGS  638


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV Y +GKNYL
Sbjct  636   KGSWIVKQSVGKKACLVGQALEVRYTRGKNYL  667



>gb|KHN17142.1| hypothetical protein glysoja_011616 [Glycine soja]
Length=705

 Score =   478 bits (1229),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 261/444 (59%), Positives = 332/444 (75%), Gaps = 14/444 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             ++ +IMAVGV+D  SEA+F TLM+L PSRSEWDFC  RG+V++H+DGHTDIIHLQLYN W
Sbjct  175   ENPAIMAVGVVDGASEAIFHTLMTLDPSRSEWDFCIYRGNVVDHIDGHTDIIHLQLYNDW  234

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM  RDLLLRRYWRREDDG+YV+L+HSV H KCPP+K Y+RAC+KSGG V+TP+  G
Sbjct  235   LPWGMKPRDLLLRRYWRREDDGSYVLLFHSVYHSKCPPKKGYVRACVKSGGFVVTPVNKG  294

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               SVV+HMLAVDWK WK +L+ AS+RSITIRML  +AALRE+FR K GN+SS     LA 
Sbjct  295   TQSVVRHMLAVDWKFWKLYLRPASARSITIRMLERIAALRELFRTKGGNYSSE---PLAM  351

Query  542   MTIDieapigeeerreegaVDPTRCEDG----MEELLSEPS---SLVGLESACDEFYDVL  700
                       +E+ + E + +  + E+     ME+ + EPS   SL+GL  + DEF+DV 
Sbjct  352   TKDIGLPLGVKEDIKTEVSQEKNKFEEPPLVVMEDEV-EPSGRRSLMGLNDS-DEFFDVP  409

Query  701   EPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEE  880
             EP++ D  + E W +  S E  +  +  +++SA   +KK H LAVQKKGY+DLQE   EE
Sbjct  410   EPTEYDHFQNE-WHADLSSE-QMSMSIPRMTSAAGFVKKLHGLAVQKKGYMDLQEAAMEE  467

Query  881   SEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLK  1060
             S  C YG TLQ+DS+ ++PC+WA  DPS FL+RG+ Y +DH+K+KA  TL QMV ADWL+
Sbjct  468   STSCSYGATLQKDSSCASPCTWAASDPSLFLVRGENYLQDHQKVKANGTLTQMVGADWLR  527

Query  1061  SDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLE  1240
             SD R+D+L+ RPG IVQ++AA   PEFF ++N+Q+PGS  YSLALYYMLK PLED PLL+
Sbjct  528   SDTREDNLSSRPGSIVQQYAAKGGPEFFFVINMQMPGSPMYSLALYYMLKTPLEDNPLLQ  587

Query  1241  RFVNGDDAFRNSRFKLIPYISKVS  1312
              FV+GDDA+RNSRFKLIPYISK S
Sbjct  588   SFVDGDDAYRNSRFKLIPYISKGS  611


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+ Y +GKNYL
Sbjct  609   KGSWIVKQSVGKKACLVGQALEMLYIRGKNYL  640



>ref|XP_006589424.1| PREDICTED: uncharacterized protein LOC100802528 isoform X2 [Glycine 
max]
Length=721

 Score =   478 bits (1229),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 265/445 (60%), Positives = 336/445 (76%), Gaps = 16/445 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             ++ +IMAVGV+D  SEA+F TLM+L PSRSEWDFC  RG+V++H+DGHTDIIHLQLYN W
Sbjct  191   ENPAIMAVGVVDGASEAIFHTLMTLDPSRSEWDFCIYRGNVVDHIDGHTDIIHLQLYNDW  250

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM  RDLLLRRYWRREDDG+YV+L+HSV H KCPP+K Y+RAC+KSGG V+TP+  G
Sbjct  251   LPWGMKPRDLLLRRYWRREDDGSYVLLFHSVYHSKCPPKKGYVRACVKSGGFVVTPVNKG  310

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               SVV+HMLAVDWK WK +L+ AS+RSITIRML  +AALRE+FR K GN+SS     LA 
Sbjct  311   TQSVVRHMLAVDWKFWKLYLRPASARSITIRMLERIAALRELFRTKGGNYSSE---PLA-  366

Query  542   MTIDiea-pigeeerreegaVDPTRCEDG----MEELLSEPS---SLVGLESACDEFYDV  697
             MT DI      +E+ + E + +  + E+     ME+ + EPS   SL+GL  + DEF+DV
Sbjct  367   MTKDIGLPLGVKEDIKTEVSQEKNKFEEPPLVVMEDEV-EPSGRRSLMGLNDS-DEFFDV  424

Query  698   LEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              EP++ D  + E W +  S E  +  +  +++SA   +KK H LAVQKKGY+DLQE   E
Sbjct  425   PEPTEYDHFQNE-WHADLSSE-QMSMSIPRMTSAAGFVKKLHGLAVQKKGYMDLQEAAME  482

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             ES  C YG TLQ+DS+ ++PC+WA  DPS FL+RG+ Y +DH+K+KA  TL QMV ADWL
Sbjct  483   ESTSCSYGATLQKDSSCASPCTWAASDPSLFLVRGENYLQDHQKVKANGTLTQMVGADWL  542

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SD R+D+L+ RPG IVQ++AA   PEFF ++N+Q+PGS  YSLALYYMLK PLED PLL
Sbjct  543   RSDTREDNLSSRPGSIVQQYAAKGGPEFFFVINMQMPGSPMYSLALYYMLKTPLEDNPLL  602

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
             + FV+GDDA+RNSRFKLIPYISK S
Sbjct  603   QSFVDGDDAYRNSRFKLIPYISKGS  627


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+ Y +GKNYL
Sbjct  625   KGSWIVKQSVGKKACLVGQALEMLYIRGKNYL  656



>ref|XP_006589423.1| PREDICTED: uncharacterized protein LOC100802528 isoform X1 [Glycine 
max]
Length=730

 Score =   478 bits (1230),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 265/445 (60%), Positives = 336/445 (76%), Gaps = 16/445 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             ++ +IMAVGV+D  SEA+F TLM+L PSRSEWDFC  RG+V++H+DGHTDIIHLQLYN W
Sbjct  200   ENPAIMAVGVVDGASEAIFHTLMTLDPSRSEWDFCIYRGNVVDHIDGHTDIIHLQLYNDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM  RDLLLRRYWRREDDG+YV+L+HSV H KCPP+K Y+RAC+KSGG V+TP+  G
Sbjct  260   LPWGMKPRDLLLRRYWRREDDGSYVLLFHSVYHSKCPPKKGYVRACVKSGGFVVTPVNKG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               SVV+HMLAVDWK WK +L+ AS+RSITIRML  +AALRE+FR K GN+SS     LA 
Sbjct  320   TQSVVRHMLAVDWKFWKLYLRPASARSITIRMLERIAALRELFRTKGGNYSSE---PLA-  375

Query  542   MTIDiea-pigeeerreegaVDPTRCEDG----MEELLSEPS---SLVGLESACDEFYDV  697
             MT DI      +E+ + E + +  + E+     ME+ + EPS   SL+GL  + DEF+DV
Sbjct  376   MTKDIGLPLGVKEDIKTEVSQEKNKFEEPPLVVMEDEV-EPSGRRSLMGLNDS-DEFFDV  433

Query  698   LEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              EP++ D  + E W +  S E  +  +  +++SA   +KK H LAVQKKGY+DLQE   E
Sbjct  434   PEPTEYDHFQNE-WHADLSSE-QMSMSIPRMTSAAGFVKKLHGLAVQKKGYMDLQEAAME  491

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             ES  C YG TLQ+DS+ ++PC+WA  DPS FL+RG+ Y +DH+K+KA  TL QMV ADWL
Sbjct  492   ESTSCSYGATLQKDSSCASPCTWAASDPSLFLVRGENYLQDHQKVKANGTLTQMVGADWL  551

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SD R+D+L+ RPG IVQ++AA   PEFF ++N+Q+PGS  YSLALYYMLK PLED PLL
Sbjct  552   RSDTREDNLSSRPGSIVQQYAAKGGPEFFFVINMQMPGSPMYSLALYYMLKTPLEDNPLL  611

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
             + FV+GDDA+RNSRFKLIPYISK S
Sbjct  612   QSFVDGDDAYRNSRFKLIPYISKGS  636


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+ Y +GKNYL
Sbjct  634   KGSWIVKQSVGKKACLVGQALEMLYIRGKNYL  665



>dbj|BAC42639.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64831.1| At3g54800 [Arabidopsis thaliana]
Length=733

 Score =   478 bits (1230),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 255/440 (58%), Positives = 324/440 (74%), Gaps = 9/440 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGVID TSE +F TLMSLGP RSEWDFCF +G+V+EHLDGHTDIIHLQLY+ W
Sbjct  207   DHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEWDFCFYKGNVVEHLDGHTDIIHLQLYSDW  266

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMNRRDLLLRRYWRREDDGTYVIL HSV H+ CPP+K Y+RAC+KSGG+V+TP   G
Sbjct  267   LPWGMNRRDLLLRRYWRREDDGTYVILCHSVYHKNCPPKKGYVRACVKSGGYVVTPANNG  326

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL---SFS  532
             K S+VKHM+A+DW+ W  +++ +S+RSITIR++  VAALREMF+AK+G+  +      F 
Sbjct  327   KQSLVKHMVAIDWRSWNLYMRPSSARSITIRVVERVAALREMFKAKQGHGFTEFVSGEFL  386

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
               +  +     +  +   +E  ++    E+ M++  S  +SL+ L  A DEF+DV EP++
Sbjct  387   DTKPCLSKINTMPLKTEAKEVDLETMHAEE-MDKPTSARNSLMDLNDASDEFFDVPEPNE  445

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
               + +    SS  S       +Q KI +   ++KK  DLA+ KKGY+DLQEV  EE+   
Sbjct  446   STEFDSFIDSSPYS-----QGHQLKIPTPAGIVKKLQDLAINKKGYMDLQEVGLEENNTF  500

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
              YG TLQ+  + + PCSW+  DPS+FLIRG  Y K+ +K+KAK TLMQM+ ADW+ SD+R
Sbjct  501   FYGATLQKGPSLTLPCSWSTADPSTFLIRGNNYLKNQQKVKAKGTLMQMIGADWISSDKR  560

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL GR GG+VQ++AA   PEFF IVNIQVPGS  YSLALYYMLK PLE+ PLLE FVN
Sbjct  561   EDDLGGRIGGLVQEYAAKGSPEFFFIVNIQVPGSAMYSLALYYMLKTPLEEHPLLESFVN  620

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDDA+RNSRFKLIP+ISK S
Sbjct  621   GDDAYRNSRFKLIPHISKGS  640


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQ LEV Y +GKNYL
Sbjct  638   KGSWIVKQSVGKKACLVGQVLEVCYTRGKNYL  669



>emb|CDX67608.1| BnaA07g16480D [Brassica napus]
Length=722

 Score =   478 bits (1229),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 256/439 (58%), Positives = 321/439 (73%), Gaps = 9/439 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH ++MAVGVID TSE +F TLMSL P RSEWDFCF +GSV+EHLDGHTDII++QLY+ W
Sbjct  198   DHPAVMAVGVIDGTSEDIFNTLMSLDPLRSEWDFCFYKGSVVEHLDGHTDIINVQLYSDW  257

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMNRRDLLLRRYWRRE+DGTYVIL HSV H+KCPP++ Y+RAC+KSGG+V+TP+  G
Sbjct  258   LPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKKCPPRRGYVRACVKSGGYVVTPVSKG  317

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGN-HSSNLSFSLA  538
             K S+VKHM+A+DW+ W  +++ +SSRSITIR++  +AALREMF+AK+G   +  +S    
Sbjct  318   KQSLVKHMVAIDWRSWNLYMRPSSSRSITIRVVERLAALREMFKAKQGQGFAEFVSGEFL  377

Query  539   EMTIDieapigeeerreegaVDPTRCE-DGMEELLSEPSSLVGLESACDEFYDVLEPSdd  715
             E    +          E   VD    + D ME+  S   SL+ L    DEF+DV EPS+ 
Sbjct  378   ETKPCLSKVNIRPLITEAKRVDLELVKADEMEKPSSARHSLMDLNDVSDEFFDVPEPSEF  437

Query  716   ddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCC  895
             D       S   +  F    +Q KI S   ++KK  DLA  KKGY+DLQEV  ++     
Sbjct  438   D-------SLIDNSPFSQGHSQLKIPSPAGIVKKLQDLANNKKGYMDLQEVGMDDKSTFF  490

Query  896   YGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQ  1075
             YG TLQ+D N++ PCSWA  DPS+FLIRG+ Y KD +K+KA +TLMQM+ ADW+ SD+R+
Sbjct  491   YGATLQKDPNFTMPCSWATADPSTFLIRGENYLKDRQKVKANDTLMQMIGADWISSDKRE  550

Query  1076  DDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNG  1255
             D+L GR GG+VQ++AA D PEFF IVN+QVPGS  YSLALYYMLK PLE+ PLLE FVNG
Sbjct  551   DNLGGRIGGLVQEYAAKDGPEFFFIVNMQVPGSAMYSLALYYMLKTPLEEHPLLESFVNG  610

Query  1256  DDAFRNSRFKLIPYISKVS  1312
             DDA+RNSRFKLIP+ISK S
Sbjct  611   DDAYRNSRFKLIPHISKGS  629


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV Y +GKNYL
Sbjct  627   KGSWIVKQSVGKKACLVGQALEVRYTRGKNYL  658



>ref|XP_009103932.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Brassica 
rapa]
Length=722

 Score =   478 bits (1229),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 256/439 (58%), Positives = 321/439 (73%), Gaps = 9/439 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH ++MAVGVID TSE +F TLMSL P RSEWDFCF +GSV+EHLDGHTDII++QLY+ W
Sbjct  198   DHPAVMAVGVIDGTSEDIFNTLMSLDPLRSEWDFCFYKGSVVEHLDGHTDIINVQLYSDW  257

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMNRRDLLLRRYWRRE+DGTYVIL HSV H+KCPP++ Y+RAC+KSGG+V+TP+  G
Sbjct  258   LPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKKCPPRRGYVRACVKSGGYVVTPVSKG  317

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGN-HSSNLSFSLA  538
             K S+VKHM+A+DW+ W  +++ +SSRSITIR++  +AALREMF+AK+G   +  +S    
Sbjct  318   KQSLVKHMVAIDWRSWNLYMRPSSSRSITIRVVERLAALREMFKAKQGQGFAEFVSGEFL  377

Query  539   EMTIDieapigeeerreegaVDPTRCE-DGMEELLSEPSSLVGLESACDEFYDVLEPSdd  715
             E    +          E   VD    + D ME+  S   SL+ L    DEF+DV EPS+ 
Sbjct  378   ETKPCLSKVNIRPLITEAKRVDLELVKADEMEKPSSARHSLMDLNDVSDEFFDVPEPSEF  437

Query  716   ddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCC  895
             D       S   +  F    +Q KI S   ++KK  DLA  KKGY+DLQEV  ++     
Sbjct  438   D-------SLIDNSPFSQGHSQLKIPSPAGIVKKLQDLANNKKGYMDLQEVGMDDKSTFF  490

Query  896   YGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQ  1075
             YG TLQ+D N++ PCSWA  DPS+FLIRG+ Y KD +K+KA +TLMQM+ ADW+ SD+R+
Sbjct  491   YGATLQKDPNFTMPCSWATADPSTFLIRGENYLKDRQKVKANDTLMQMIGADWISSDKRE  550

Query  1076  DDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNG  1255
             D+L GR GG+VQ++AA D PEFF IVN+QVPGS  YSLALYYMLK PLE+ PLLE FVNG
Sbjct  551   DNLGGRIGGLVQEYAAKDGPEFFFIVNMQVPGSAMYSLALYYMLKTPLEEHPLLESFVNG  610

Query  1256  DDAFRNSRFKLIPYISKVS  1312
             DDA+RNSRFKLIP+ISK S
Sbjct  611   DDAYRNSRFKLIPHISKGS  629


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV Y +GKNYL
Sbjct  627   KGSWIVKQSVGKKACLVGQALEVRYTRGKNYL  658



>ref|XP_010516021.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
 ref|XP_010516022.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
Length=731

 Score =   476 bits (1225),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 248/440 (56%), Positives = 327/440 (74%), Gaps = 9/440 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH++IMAVGVI+ TSE +F TLMSLGP RSEWDFCF +GSV+EHLDGHTDII++QLY+ W
Sbjct  205   DHAAIMAVGVIEGTSEDIFNTLMSLGPLRSEWDFCFYKGSVVEHLDGHTDIINMQLYSDW  264

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMNRRDLLLRRYWRRE+DGTYVIL HSV H+KCPP++ Y+RAC+KSGG+V+TP+  G
Sbjct  265   LPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKKCPPKRGYVRACVKSGGYVVTPVNKG  324

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL---SFS  532
             K S+VKHM+A+DW+ W  +++ +S+RSITIR++  VAALREMF+A++G+  S      F 
Sbjct  325   KHSLVKHMVAIDWRSWNLYMRPSSARSITIRVVERVAALREMFKARQGHSFSEFVSGEFM  384

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
             + +  +        +   ++   +  + +D M++  S  +SL+ L  A DEF+DV EP++
Sbjct  385   VTKPCLSKLNTKPLKTEAKDVYQESMKADD-MDKPSSARNSLMDLNDASDEFFDVPEPNE  443

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
               + +    +S  S       +Q KI + + ++KK  DLA+ KKGY+DLQEV  EES   
Sbjct  444   STEFDSFIDTSPYS-----QGHQLKIPTPSGIVKKLQDLAINKKGYMDLQEVGLEESNTF  498

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
              YG TL +DS+ + PCSW+  D S+FLIRG  Y +D +K+KA  TLMQM+ ADW+ SD+R
Sbjct  499   FYGATLHKDSSLTLPCSWSTADASTFLIRGDSYLEDRQKVKANGTLMQMIGADWISSDKR  558

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL GR GG+VQ++AA   PEFF +VNIQVPGS  YSLALYYMLK PLE+ PLL+ FVN
Sbjct  559   EDDLGGRLGGLVQEYAAKGSPEFFFVVNIQVPGSAMYSLALYYMLKTPLEEHPLLQSFVN  618

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDDA+RNSRFKLIP+ISK S
Sbjct  619   GDDAYRNSRFKLIPHISKGS  638


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV Y +GKNYL
Sbjct  636   KGSWIVKQSVGKKACLVGQALEVRYTRGKNYL  667



>ref|XP_008377573.1| PREDICTED: LOW QUALITY PROTEIN: protein ENHANCED DISEASE RESISTANCE 
2-like [Malus domestica]
Length=735

 Score =   474 bits (1221),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 261/446 (59%), Positives = 330/446 (74%), Gaps = 13/446 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRTL+SLGPSRSEWDFC+ RGSV+E LDGHTDIIH QLY+ W
Sbjct  200   DHPAIMAVGVVDGTSEAIFRTLLSLGPSRSEWDFCYYRGSVVESLDGHTDIIHQQLYSDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LP GM RRDLL+RRYWRREDDGTYVILYHS  H+KCPP++ Y+RACLKSGG+VITP+  G
Sbjct  260   LPRGMKRRDLLMRRYWRREDDGTYVILYHSASHKKCPPKRGYVRACLKSGGYVITPVNKG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K S+V+HMLA+DWK WK +L+ +S+R ITIRML +VAALRE+FRAK G  +S+  FS  +
Sbjct  320   KQSLVRHMLAIDWKFWKLYLRPSSARGITIRMLEIVAALRELFRAKXG--TSSPEFSSGD  377

Query  542   MTIDieapigeeerreegaVDP---TRCEDG--MEELLSEP---SSLVGLESACDEFYDV  697
             M+ +I      ++        P    + E+G  +E+ + +P   +SL GL  A DEF+DV
Sbjct  378   MSREIRLSQSGQQNIRTQVQHPGEVKKMEEGVLVEDEVEKPEGRTSLKGLHDAADEFFDV  437

Query  698   LEPSddddeegegWSSATSPEFCVDANQQ-KISSATTLMKKFHDLAVQKKGYVDLQEVDS  874
              E S + D+    W S  S E    + Q  K+SSA  L+K+ H+L VQKKG  DLQEV S
Sbjct  438   PE-STEYDQFENEWPSDISMEQNPTSIQHPKLSSAAVLVKRLHELGVQKKGCPDLQEV-S  495

Query  875   EESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADW  1054
             +E+    YG TLQ+D + + PCSW   DPSSFLIRG  Y +D +KIKAK+TLMQ+V  DW
Sbjct  496   KENNVFPYGATLQKDPSCALPCSWGSADPSSFLIRGPNYLQDRQKIKAKSTLMQLVGVDW  555

Query  1055  LKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPL  1234
             L+SD+R+DD++ R G IVQK A  D  EFF IVN+Q+PG+T ++LA YYM+K PLE+TPL
Sbjct  556   LRSDKREDDISSRYGSIVQKSAERDGSEFFFIVNMQIPGTTKHTLAFYYMMKTPLEETPL  615

Query  1235  LERFVNGDDAFRNSRFKLIPYISKVS  1312
             L  FVNGDD++RNSRFKLIPY+ K S
Sbjct  616   LHNFVNGDDSYRNSRFKLIPYVVKGS  641


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSV KK CL+GQ LEV+YF+GKNYL
Sbjct  639   KGSWIVKQSVAKKPCLVGQLLEVHYFRGKNYL  670



>ref|XP_010427199.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
 ref|XP_010427200.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
Length=736

 Score =   474 bits (1221),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 252/441 (57%), Positives = 326/441 (74%), Gaps = 11/441 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH++IMAVGVI+ TSE +F TLMSLGP RSEWDFCF +GSV+EHLDGHTDII+LQLY+ W
Sbjct  210   DHAAIMAVGVIEGTSEDIFNTLMSLGPLRSEWDFCFYKGSVVEHLDGHTDIINLQLYSDW  269

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWG+NRRDLLLRRYWRRE+DGTYVIL HSV H+KCPP+K Y+RAC+KSGG+V+TP+  G
Sbjct  270   LPWGLNRRDLLLRRYWRREEDGTYVILCHSVYHKKCPPKKGYVRACVKSGGYVVTPVNKG  329

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K S+VKHM+A+DW+ W  +++ +S+RSITIR++  VAALREMF+A++G+  S   F   E
Sbjct  330   KHSLVKHMVAIDWRSWNLYMRPSSARSITIRVVERVAALREMFKARQGHSFS--EFVSGE  387

Query  542   MTIDi----eapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPS  709
               +      +      +   +     T   D M++  S  +SL+ L  A DEF+DV EP+
Sbjct  388   FMVTKPCLPKINTYPLKTEAKDVYQETMKADEMDKPSSARNSLMDLNDASDEFFDVPEPN  447

Query  710   ddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEP  889
             +  + +       TSP      +Q KI + + ++KK  DLA+ KKGY+DLQEV  EE+  
Sbjct  448   ESTEFDSFI---DTSP--YTQGHQLKIPTPSGIVKKLQDLAINKKGYMDLQEVGLEENNT  502

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
               YG TLQ+DS+ + PC+W+  DPS+FLIRG  Y +D +K+KA  TLMQM+ ADW+ SD+
Sbjct  503   FFYGATLQKDSSLTLPCTWSTADPSTFLIRGDSYLEDRQKVKANGTLMQMIGADWISSDK  562

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFV  1249
             R+DDL GR GG+VQ++AA   PEFF IVN+QVPGS  YSLALYYMLK PLE+ PLL+ FV
Sbjct  563   REDDLGGRLGGLVQEYAAKGSPEFFFIVNMQVPGSAMYSLALYYMLKTPLEEHPLLQSFV  622

Query  1250  NGDDAFRNSRFKLIPYISKVS  1312
             NGDDA+RNSRFKLIP+ISK S
Sbjct  623   NGDDAYRNSRFKLIPHISKGS  643


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV Y +GKNYL
Sbjct  641   KGSWIVKQSVGKKACLVGQALEVRYTRGKNYL  672



>emb|CDX73448.1| BnaC08g25550D [Brassica napus]
Length=722

 Score =   473 bits (1217),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 252/440 (57%), Positives = 317/440 (72%), Gaps = 11/440 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGVID TSE +F TLMS GP RSEWDF F +GSV+EHLDGHTDII++QLY+ W
Sbjct  198   DHPAIMAVGVIDGTSEDIFNTLMSFGPLRSEWDFSFYKGSVVEHLDGHTDIINVQLYSDW  257

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMNRRDLLLRRYWRRE+DGTYVIL HSV H++CPP+K Y+RAC+KSGG+V+TP+   
Sbjct  258   LPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKECPPKKGYVRACVKSGGYVVTPVNKA  317

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL---SFS  532
             K S+VKHM+A+DW+ W  +   +SSRSITIR++  +AALREMF+AK+G+  +      F 
Sbjct  318   KQSLVKHMVAIDWRSWNLYTGASSSRSITIRVVERLAALREMFKAKQGHGFTEFVSGEFM  377

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
               +  +        +   +   ++  + ED ME+  S  +SL+ L  A DEF+DV EPS+
Sbjct  378   DTKSCVSNINTRPLKIAAKRVDLELVKAED-MEKPSSARNSLMDLNDASDEFFDVPEPSE  436

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
              D       S   +  F    +Q KI S   ++KK  DLA+ KKGY+DLQEV  +E    
Sbjct  437   FD-------SFIDNSLFSQGHSQLKIPSPAGIVKKLQDLAINKKGYMDLQEVGMDEKTTF  489

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
              YG TLQ+D N + PCSWA  DPS+FLIRG  Y +D +K+KAK+T+MQM+ ADW+ SD+R
Sbjct  490   FYGATLQKDPNLTLPCSWATADPSTFLIRGDNYLQDQQKVKAKDTMMQMIGADWISSDKR  549

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL GR GG+VQ+ AA   PEFF IVN+Q PGS  YSLALYYMLK PLED PLL  FVN
Sbjct  550   EDDLGGRLGGVVQEFAAKGGPEFFFIVNMQAPGSAMYSLALYYMLKTPLEDHPLLHSFVN  609

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDDA+RNSRFKLIP+ISK S
Sbjct  610   GDDAYRNSRFKLIPHISKGS  629


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQAL V Y +GKNYL
Sbjct  627   KGSWIVKQSVGKKACLVGQALVVRYTRGKNYL  658



>ref|XP_009116156.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Brassica 
rapa]
 ref|XP_009116157.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Brassica 
rapa]
Length=722

 Score =   472 bits (1214),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 251/440 (57%), Positives = 316/440 (72%), Gaps = 11/440 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGVID TSE +F TLMS GP RSEWDF F +GSV+EHLDGHTDII++QLY+ W
Sbjct  198   DHPAIMAVGVIDGTSENIFNTLMSFGPLRSEWDFSFYKGSVVEHLDGHTDIINVQLYSDW  257

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMNRRDLLLRRYWRRE+DGTYVIL HSV H+ CPP+K Y+RAC+KSGG+V+TP+   
Sbjct  258   LPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKDCPPKKGYVRACVKSGGYVVTPVNKA  317

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL---SFS  532
             K S+VKHM+A+DW+ W  +   +SSRSITIR++  +AALREMF+AK+G+  +      F 
Sbjct  318   KQSLVKHMVAIDWRSWNLYTGASSSRSITIRVVERLAALREMFKAKQGHGFTEFVSGEFM  377

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
               +  +        +   +   ++  + ED ME+  S  +SL+ L  A DEF+DV EPS+
Sbjct  378   DTKSCVSNINTGPLKIAAKRVDLELVKAED-MEKPSSARNSLMDLNDASDEFFDVPEPSE  436

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
              D       S   +       +Q KI S   ++KK  DLA+ KKGY+DLQEV  +E    
Sbjct  437   FD-------SFIDNSPISQGHSQLKIPSPAGIVKKLQDLAINKKGYMDLQEVGMDEKTTF  489

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
              YG TLQ+D N + PCSWA  DPS+FLIRG+ Y +D +K+KAK+T+MQM+ ADW+ SD+R
Sbjct  490   FYGATLQKDPNLTLPCSWATADPSTFLIRGENYLQDQQKVKAKDTMMQMIGADWISSDKR  549

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL GR GG+VQ+ AA   PEFF IVN+Q PGS  YSLALYYMLK PLED PLL  FVN
Sbjct  550   EDDLGGRLGGVVQEFAAKGGPEFFFIVNMQAPGSAMYSLALYYMLKTPLEDHPLLHSFVN  609

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDDA+RNSRFKLIP+ISK S
Sbjct  610   GDDAYRNSRFKLIPHISKGS  629


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQAL V Y +GKNYL
Sbjct  627   KGSWIVKQSVGKKACLVGQALVVRYTRGKNYL  658



>emb|CDY07523.1| BnaC06g15410D [Brassica napus]
Length=722

 Score =   471 bits (1211),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 253/439 (58%), Positives = 319/439 (73%), Gaps = 9/439 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH ++MAVGVID TSE +F TLMSL P RSEWDFCF +GSV+EHLDGHTDII++QLY+ W
Sbjct  198   DHPAVMAVGVIDGTSEDIFNTLMSLDPLRSEWDFCFYKGSVVEHLDGHTDIINVQLYSDW  257

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMNRRDLLLRRYWRRE+DGTYVIL HSV H+KCPP++ Y+RAC+KSGG+V+ P+  G
Sbjct  258   LPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKKCPPRRGYVRACVKSGGYVVAPVSKG  317

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGN-HSSNLSFSLA  538
             K S+VKHM+A+DW+ W  +++ +SSRSITIR++  +AALREMF+AK+G+  +  +S    
Sbjct  318   KQSLVKHMVAIDWRSWNLYMRPSSSRSITIRVVERLAALREMFKAKQGHGFAEFVSGEFL  377

Query  539   EMTIDieapigeeerreegaVDPTRCE-DGMEELLSEPSSLVGLESACDEFYDVLEPSdd  715
             E    +          E   VD    + D ME+  S   SL+ L +  DEF+DV EPS+ 
Sbjct  378   ETKSCLSKVNIRPLITEAKRVDLELVKADEMEKPSSARHSLMDLNNVSDEFFDVPEPSEF  437

Query  716   ddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCC  895
             D       S   +  F    +Q KI S   ++KK  DLA  KKGY+DLQEV  ++     
Sbjct  438   D-------SLIDNSPFSQGHSQLKIPSPAGIVKKLQDLANNKKGYMDLQEVGMDDKSTFF  490

Query  896   YGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQ  1075
             YG TLQ+D N + PCSWA  DPS+FLIRG+ Y KD +K+KA  TLMQM+ ADW+ S++R+
Sbjct  491   YGATLQKDPNLTMPCSWATADPSTFLIRGENYLKDRQKVKANETLMQMIGADWISSNKRE  550

Query  1076  DDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNG  1255
             DDL GR GG+VQ++AA   PEFF IVN+QVPGS  YSLALYYMLK PLE+ PL+E FVNG
Sbjct  551   DDLGGRLGGLVQEYAAKGGPEFFFIVNMQVPGSAMYSLALYYMLKTPLEEHPLIESFVNG  610

Query  1256  DDAFRNSRFKLIPYISKVS  1312
             DDA+RNSRFKLIP+ISK S
Sbjct  611   DDAYRNSRFKLIPHISKGS  629


 Score = 61.6 bits (148),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV Y +GKNY 
Sbjct  627   KGSWIVKQSVGKKACLVGQALEVRYTRGKNYF  658



>emb|CDX78263.1| BnaA09g34580D [Brassica napus]
Length=722

 Score =   470 bits (1209),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 250/440 (57%), Positives = 315/440 (72%), Gaps = 11/440 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGVID TSE +F TLMS GP RSEWDF F +GSV+EHLDGHTDII++QLY+ W
Sbjct  198   DHPAIMAVGVIDGTSENIFNTLMSFGPLRSEWDFSFYKGSVVEHLDGHTDIINVQLYSDW  257

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMNRRDLLLRRYWRRE+DGTYVIL HSV H+ CPP+K Y+RAC+KSGG+V+TP+   
Sbjct  258   LPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKDCPPKKGYVRACVKSGGYVVTPVNKA  317

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL---SFS  532
             K S+VKHM+A+DW+ W  +   +SSRSITIR++  +AALREMF+AK+G+  +      F 
Sbjct  318   KQSLVKHMVAIDWRSWNLYTGASSSRSITIRVVERLAALREMFKAKQGHGFTEFVSGEFM  377

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
               +  +        +   +   ++  + ED ME+  S  +SL+ L  A DEF+DV EPS+
Sbjct  378   DTKSCVSNINTGPLKIAAKRVDLELVKAED-MEKPSSARNSLMDLNDASDEFFDVPEPSE  436

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
              D       S   +       +Q KI S   ++KK  DLA+ KKGY+DLQEV  +E    
Sbjct  437   FD-------SFIDNSPISQGHSQLKIPSPAGIVKKLQDLAINKKGYMDLQEVGMDEKTTF  489

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
              YG TLQ+D N + PCSWA  DPS+FLIRG  Y +D +K+KAK+T+MQM+ ADW+ SD+R
Sbjct  490   FYGATLQKDPNLTLPCSWATADPSTFLIRGDNYLQDQQKVKAKDTMMQMIGADWISSDKR  549

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL GR GG+VQ+ AA   PEFF IVN+Q PGS  YSLALYYMLK P+ED PLL  FVN
Sbjct  550   EDDLGGRLGGVVQEFAAKGGPEFFFIVNMQAPGSAMYSLALYYMLKTPIEDHPLLHSFVN  609

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDDA+RNSRFKLIP+ISK S
Sbjct  610   GDDAYRNSRFKLIPHISKGS  629


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQAL V Y +GKNYL
Sbjct  627   KGSWIVKQSVGKKACLVGQALVVRYTRGKNYL  658



>ref|XP_003591887.1| hypothetical protein MTR_1g094890 [Medicago truncatula]
 gb|AES62138.1| pleckstrin-like (PH) and lipid-binding START domain protein [Medicago 
truncatula]
Length=717

 Score =   467 bits (1202),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 256/448 (57%), Positives = 315/448 (70%), Gaps = 25/448 (6%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             + S+IMAVGVID TSEA+F TLMSL PSRSEWDFC  RG V++H+DGHTDIIHLQLYN W
Sbjct  190   EQSAIMAVGVIDGTSEAIFHTLMSLDPSRSEWDFCIHRGIVVDHIDGHTDIIHLQLYNDW  249

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM  RDLLL+RYWRREDDGTYV+LYHSV H KCPP+K Y+RACLKSGG V+TP+  G
Sbjct  250   LPWGMKPRDLLLQRYWRREDDGTYVLLYHSVYHSKCPPKKGYVRACLKSGGFVVTPVNKG  309

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               SVV+HML +DWK WK +L  +S+RSITIRML  +AALRE++R K GN+S  ++     
Sbjct  310   TQSVVRHMLTIDWKLWKLYLGASSTRSITIRMLERIAALRELYRTKVGNYSEPIT-----  364

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPS-----------SLVGLESACDEF  688
             MT DI  P+    +++         +  +EEL+               SL+GL  + DEF
Sbjct  365   MTKDIVLPVTVTVKKDVKIEVANENKSKIEELVEVKDQVDDKEIPGRISLMGLTDS-DEF  423

Query  689   YDVLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEV  868
             +DV E S + D     W S    E        K S A + +KK  +LAV KKGY+DLQEV
Sbjct  424   FDVPE-STEYDHYDNQWHSDFPSE-------PKPSPAGSFVKKLQELAVHKKGYMDLQEV  475

Query  869   DSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
               EES  C YG TLQ+D N + PCSWA  DPS FL+RG+ Y +DH+K+KA +TLMQ+V A
Sbjct  476   AKEESASCSYGNTLQKDPNCTLPCSWAPSDPSLFLVRGETYLQDHQKVKANDTLMQLVGA  535

Query  1049  DWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             DWL+ + R+DDL+ RP  IVQK+AA   PEFF +++IQ+PGS  YS+ALYYM+K PLED 
Sbjct  536   DWLRCNTREDDLSSRPSSIVQKYAAKGGPEFFFVIHIQMPGSPMYSIALYYMMKTPLEDN  595

Query  1229  PLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             PLL  FV GDD +RNSRFKLIPYISK S
Sbjct  596   PLLHSFVEGDDTYRNSRFKLIPYISKGS  623


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+ Y +GKNYL
Sbjct  621   KGSWIVKQSVGKKACLVGQALEIRYIRGKNYL  652



>ref|XP_010504305.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
 ref|XP_010504306.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Camelina 
sativa]
Length=734

 Score =   468 bits (1203),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 245/440 (56%), Positives = 325/440 (74%), Gaps = 11/440 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH++IMAVGVI+ TSE +F TLMSLGP RSEWDFCF +GSV+EHLDGHT II++QLY+ W
Sbjct  210   DHAAIMAVGVIEGTSEDIFNTLMSLGPLRSEWDFCFYKGSVVEHLDGHTYIINMQLYSDW  269

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMNRRDLLLRRYWRRE+DGTYVIL HSV H+KCPP++ Y+RAC+KSGG+V+TP+  G
Sbjct  270   LPWGMNRRDLLLRRYWRREEDGTYVILCHSVYHKKCPPKRGYVRACVKSGGYVVTPVNKG  329

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL---SFS  532
             K S+VKHM+A+DW+ W  +++ +S+RSITIR++  VAALREMF+A++G+  S      F 
Sbjct  330   KHSLVKHMVAIDWRSWNLYMRPSSARSITIRVVERVAALREMFKARQGHSFSEFVSGEFM  389

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
             + + ++        +   ++   +  +  D M++  S  +SL+ L  A DEF+DV EP++
Sbjct  390   VTKPSLSKINIKPLKTEAKDVYQETMKA-DEMDKPSSARNSLMDLNDASDEFFDVPEPNE  448

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
               + +       TSP     +   +I + + ++KK  DLA+ KKGY+DLQEV  EE+   
Sbjct  449   STEFDSFI---DTSPY----SQGHQIPTPSGIVKKLQDLAINKKGYMDLQEVGLEENNTF  501

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
              YG TL +DS+ + PCSW+  D S+FLIRG  Y +D +K+KA  TLMQM+ ADW+ SD+R
Sbjct  502   FYGATLHKDSSLTLPCSWSTADASTFLIRGDSYLEDRQKVKANGTLMQMIGADWISSDKR  561

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL GR GG+VQ++AA   PEFF +VNIQVPGS  YSLALYYMLK PLE+ PLL+ FVN
Sbjct  562   EDDLGGRLGGLVQEYAAKGSPEFFFVVNIQVPGSAMYSLALYYMLKTPLEEHPLLQSFVN  621

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDDA+RNSRFKLIP+ISK S
Sbjct  622   GDDAYRNSRFKLIPHISKGS  641


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEV Y + KNYL
Sbjct  639   KGSWIVKQSVGKKACLVGQALEVRYTRCKNYL  670



>emb|CDY02892.1| BnaC04g25940D [Brassica napus]
Length=725

 Score =   466 bits (1198),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 246/440 (56%), Positives = 319/440 (73%), Gaps = 8/440 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGVID TSE +F TLMSLGP RSEWDFCF +GSV+EHLDGHTDI+++QLY+ W
Sbjct  198   DHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEWDFCFYKGSVVEHLDGHTDIVNIQLYSDW  257

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPW MNRRD+LLRRYWRRE+DGTYVIL HSV H+KCPP K Y+RACLKSGG+V+TP+  G
Sbjct  258   LPWLMNRRDVLLRRYWRREEDGTYVILCHSVYHKKCPPTKGYVRACLKSGGYVVTPVNKG  317

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL---SFS  532
             K S+VKHM+A+DW+ W  +++ +S RSITIR++  +AALREMF+AK+G+  +      F 
Sbjct  318   KQSLVKHMVAIDWRSWNLYMRPSSERSITIRVVERLAALREMFKAKQGHGFAEFVSGEFM  377

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
               + ++     +  ++  +   ++  + E+ ME+  S  +SL+ L  A DEF+DV EP++
Sbjct  378   QTKSSLSKINTLPFKKEAKRIDLELVKVEE-MEKPSSARNSLMDLNDASDEFFDVPEPNE  436

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
               + +    S   +  F    +Q K+ S + ++KK  DLA  KKGY+DLQEV  + +   
Sbjct  437   SYEFD----SLIENSPFSQGHSQLKLPSPSGIVKKLQDLANNKKGYMDLQEVGMDVNSTF  492

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
              YG TLQQD N + PCSW+  DPS+FLIRG  Y  D +K+KA  T+MQMV ADW+ SD+R
Sbjct  493   IYGATLQQDPNLTMPCSWSIADPSTFLIRGDNYLNDQQKVKANGTMMQMVGADWISSDKR  552

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL GR GG+VQ+  A   PEFF IVN+QVPGS   SLALYYMLK PLE+ PLL  FVN
Sbjct  553   EDDLGGRLGGLVQEFGAKGGPEFFFIVNMQVPGSAMISLALYYMLKTPLEEHPLLHSFVN  612

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDDA+RNSRFKLIP+ISK S
Sbjct  613   GDDAYRNSRFKLIPHISKGS  632


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+G ALEV Y +GKNYL
Sbjct  630   KGSWIVKQSVGKKACLVGHALEVRYTRGKNYL  661



>ref|XP_009139208.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Brassica 
rapa]
Length=725

 Score =   464 bits (1195),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 245/440 (56%), Positives = 320/440 (73%), Gaps = 8/440 (2%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGVID TSE +F TLMSLGP RSEWDFCF +G+V+EHLDGHTDI+++QLY+ W
Sbjct  198   DHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEWDFCFYKGTVVEHLDGHTDIVNIQLYSDW  257

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPW MNRRD+LLRRYWRRE+DGTYVIL HSV H+KCPP K Y+RAC+KSGG+V+TP+  G
Sbjct  258   LPWLMNRRDVLLRRYWRREEDGTYVILCHSVYHKKCPPTKGYVRACVKSGGYVVTPVSKG  317

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL---SFS  532
             K S+VKHM+A+DW+ W  +++ +S RSITIR++  +AALREMF+AK+G+  +      F 
Sbjct  318   KQSLVKHMVAIDWRSWNLYMRPSSERSITIRVVERLAALREMFKAKQGHGFAEFVSGEFM  377

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
               + ++     +  ++  +   ++  + E+ ME+  S  +SL+ L  A DEF+DV EP++
Sbjct  378   QTKSSLSKINTLPFKKEAKRIDLELVKVEE-MEKPSSARNSLMDLNDASDEFFDVPEPNE  436

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
               + +    S   +  F    +Q K+ S + ++KK  DLA  KKGY+DLQEV  + +   
Sbjct  437   SYEFD----SLIDNSPFSQGHSQLKLPSPSGIVKKLQDLANNKKGYMDLQEVGMDVNSTF  492

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
              YG TLQQD N + PCSW+  DPS+FLIRG  Y  D +K+KA  T+MQMV ADW+ SD+R
Sbjct  493   IYGATLQQDPNLTMPCSWSIADPSTFLIRGDNYLNDQQKVKANGTMMQMVGADWISSDKR  552

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL GR GG+VQ+ AA   PEFF IVN+QVPGS   SLALYYMLK PLE+ PLL  FVN
Sbjct  553   EDDLGGRLGGLVQEFAAKGGPEFFFIVNMQVPGSAMISLALYYMLKTPLEEHPLLHSFVN  612

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDDA+RNSRFKLIP+ISK S
Sbjct  613   GDDAYRNSRFKLIPHISKGS  632


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+G ALEV Y +GKNYL
Sbjct  630   KGSWIVKQSVGKKACLVGHALEVRYTRGKNYL  661



>ref|XP_006599998.1| PREDICTED: uncharacterized protein LOC100794533 [Glycine max]
Length=697

 Score =   459 bits (1180),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 252/435 (58%), Positives = 313/435 (72%), Gaps = 10/435 (2%)
 Frame = +2

Query  5     HSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWL  184
             H  +MAVGV+D TSE +F TLMSLG SRSEWDFC  +GSV++H+D HTDIIH++LYN WL
Sbjct  176   HPVMMAVGVVDGTSEEIFHTLMSLGSSRSEWDFCTYQGSVVDHIDDHTDIIHVKLYNDWL  235

Query  185   PWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGK  364
             PWGM  RD LLRRYWRRED+GTYV+L+HSV H+ CPPQ+ Y+RA LKSGG ++TPI  GK
Sbjct  236   PWGMKPRDFLLRRYWRREDNGTYVLLFHSVYHKICPPQRGYVRASLKSGGFLVTPINKGK  295

Query  365   ASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAEM  544
              S+VKHMLA+DWK WK +L  +S+R  TIRML  VAALRE F+AK GN SS       E+
Sbjct  296   QSLVKHMLAIDWKLWKLYLSSSSARFSTIRMLERVAALREFFKAKAGNCSS----EPIEI  351

Query  545   TIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddde  724
              +D +  + EE  +    V     E  ++   S  +SL+GL+ + DEF+DV EP + D+ 
Sbjct  352   AVDTKNEVTEENSKAVEGV----LEGEVDGETSRRTSLMGLDDS-DEFFDVSEPKNYDEF  406

Query  725   egegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEE-SEPCCYG  901
             E E  S+  S +        K+SSA  L KK  DL+VQKKGY+DLQE  S + SEPC YG
Sbjct  407   ENEWHSAPLSEQHSQTDYHPKMSSADGLAKKLQDLSVQKKGYMDLQETSSRDNSEPCPYG  466

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
              TLQ+DS+ + PCSW   D S F IRGK Y KD +K+KA+ TLMQMV ADW++S+ RQDD
Sbjct  467   ATLQKDSSCNLPCSWDESDASLFYIRGKTYLKDKKKVKAERTLMQMVGADWIQSNSRQDD  526

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             L  RPG IVQ++  + RPEFF +VN QVPGS+ YS+ LYYM+K PLED PLL  FV+GDD
Sbjct  527   LCSRPGSIVQQYEKNGRPEFFFVVNFQVPGSSLYSIGLYYMMKTPLEDNPLLHSFVHGDD  586

Query  1262  AFRNSRFKLIPYISK  1306
             A+RNSRFKLIPYI K
Sbjct  587   AYRNSRFKLIPYIFK  601



>gb|KHN32782.1| hypothetical protein glysoja_024141 [Glycine soja]
Length=646

 Score =   452 bits (1163),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 250/435 (57%), Positives = 313/435 (72%), Gaps = 10/435 (2%)
 Frame = +2

Query  5     HSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWL  184
             H  +MAVGV+D TSE +F TLMSLG SRSEWDFC  +GSV++H+D HTDIIH++LYN WL
Sbjct  145   HPVMMAVGVVDGTSEEIFHTLMSLGSSRSEWDFCTYQGSVVDHIDDHTDIIHVKLYNDWL  204

Query  185   PWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGK  364
             PWGM  RD LLRRYWRRED+GTYV+L+HSV H+ CPP++ Y+RA LKSGG ++TPI  GK
Sbjct  205   PWGMKPRDFLLRRYWRREDNGTYVLLFHSVYHKICPPERGYVRASLKSGGFLVTPINKGK  264

Query  365   ASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAEM  544
              S+VKHMLA+DWK WK +L  +S+R  TIRML  VAALRE F+AK GN SS       E+
Sbjct  265   QSLVKHMLAIDWKLWKLYLSSSSARFSTIRMLERVAALREFFKAKAGNCSS----EPIEI  320

Query  545   TIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddde  724
              +DI+  + EE  +    V     E  ++   S  ++L+GL+ + DEF+DV EP + D+ 
Sbjct  321   AVDIKNEVTEENSKAVEGV----LEGEVDGETSRRTNLMGLDDS-DEFFDVSEPKNYDEF  375

Query  725   egegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEE-SEPCCYG  901
             E E  S+  S +        K+SSA  L KK  DL+VQKKGY+DLQE  S + SEPC YG
Sbjct  376   ENEWHSAPLSEQHSQTDYHPKMSSADGLAKKLQDLSVQKKGYMDLQETSSRDNSEPCPYG  435

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
              TLQ+DS+ + PCSW   D S F IRGK Y KD +K+KA+ TLMQMV ADW++S+ RQDD
Sbjct  436   ATLQKDSSCNLPCSWDESDASLFYIRGKTYLKDKKKVKAERTLMQMVGADWIQSNSRQDD  495

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             L  RPG IVQ++  +  PEFF +VN QVPGS+ YS+ LYYM+K PLED PLL  FV+GDD
Sbjct  496   LCSRPGSIVQQYEKNGGPEFFFVVNFQVPGSSLYSIGLYYMMKTPLEDNPLLHSFVHGDD  555

Query  1262  AFRNSRFKLIPYISK  1306
             A+RNSRFKLIPYI K
Sbjct  556   AYRNSRFKLIPYIFK  570



>ref|XP_010689527.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=699

 Score =   448 bits (1153),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 255/436 (58%), Positives = 306/436 (70%), Gaps = 5/436 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +FR +MSLGPSRS+WD+ F RGSV+E+LDGHTDIIH QL  +W
Sbjct  172   DHPAIMAVGVVDGTSENIFRAVMSLGPSRSQWDYSFYRGSVVENLDGHTDIIHKQLCAYW  231

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWG+ +RDLLLRRYWRR+DDGTYVILYHSV H+KC PQK YIRACLKSGG+VITP+  G
Sbjct  232   LPWGVQQRDLLLRRYWRRDDDGTYVILYHSVYHKKCLPQKGYIRACLKSGGYVITPLNHG  291

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W ++L  + +RS TIRMLG +AALRE+F+AK G+  S+ SF   +
Sbjct  292   KQSVVKHMLAIDWKLWAAYLLPSLARSTTIRMLGKIAALRELFKAKAGDCFSSNSF--GD  349

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEP-SSLVGLESACDEFYDVLEPSddd  718
                   +    +      AVD     +  E        SL  L    DEF+D  E S D 
Sbjct  350   QPFGHASQNENKPEIYPHAVDGKENLEEKELEKLSEHGSLAELNDVSDEFFDAPEGS-DF  408

Query  719   deegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCY  898
             D    GW S   PE  +   + K S+A   +KK H LAV KKGYVDL E+ ++E   CCY
Sbjct  409   DPPDYGWPSDCGPETNLQDARSKRSTAAVFVKKLHGLAVHKKGYVDLVEIAAKEGISCCY  468

Query  899   GGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQD  1078
             G TL +D   +   SW   DPS+FLIRGK Y  D +KIKA +TLM+MVAADW+ SDRR+D
Sbjct  469   GTTLAKDPTCTIASSWTTTDPSTFLIRGKTYLMDSQKIKANHTLMKMVAADWITSDRRED  528

Query  1079  DLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGD  1258
             DL GRPG IVQ +AA    EFF IVNIQVPGS TY+LALYYM  + LED PLL+ FV+ D
Sbjct  529   DLGGRPGSIVQNYAAKGGSEFFFIVNIQVPGSKTYNLALYYM-TSNLEDAPLLQNFVDRD  587

Query  1259  DAFRNSRFKLIPYISK  1306
             DA+RNSRFKLIPYISK
Sbjct  588   DAYRNSRFKLIPYISK  603


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G WIVKQSVGKKACL GQALE+NYF GKNY+
Sbjct  603   KGPWIVKQSVGKKACLAGQALEINYFCGKNYI  634



>ref|XP_010689526.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=716

 Score =   449 bits (1154),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 255/436 (58%), Positives = 306/436 (70%), Gaps = 5/436 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +FR +MSLGPSRS+WD+ F RGSV+E+LDGHTDIIH QL  +W
Sbjct  189   DHPAIMAVGVVDGTSENIFRAVMSLGPSRSQWDYSFYRGSVVENLDGHTDIIHKQLCAYW  248

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWG+ +RDLLLRRYWRR+DDGTYVILYHSV H+KC PQK YIRACLKSGG+VITP+  G
Sbjct  249   LPWGVQQRDLLLRRYWRRDDDGTYVILYHSVYHKKCLPQKGYIRACLKSGGYVITPLNHG  308

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W ++L  + +RS TIRMLG +AALRE+F+AK G+  S+ SF   +
Sbjct  309   KQSVVKHMLAIDWKLWAAYLLPSLARSTTIRMLGKIAALRELFKAKAGDCFSSNSF--GD  366

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEP-SSLVGLESACDEFYDVLEPSddd  718
                   +    +      AVD     +  E        SL  L    DEF+D  E S D 
Sbjct  367   QPFGHASQNENKPEIYPHAVDGKENLEEKELEKLSEHGSLAELNDVSDEFFDAPEGS-DF  425

Query  719   deegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCY  898
             D    GW S   PE  +   + K S+A   +KK H LAV KKGYVDL E+ ++E   CCY
Sbjct  426   DPPDYGWPSDCGPETNLQDARSKRSTAAVFVKKLHGLAVHKKGYVDLVEIAAKEGISCCY  485

Query  899   GGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQD  1078
             G TL +D   +   SW   DPS+FLIRGK Y  D +KIKA +TLM+MVAADW+ SDRR+D
Sbjct  486   GTTLAKDPTCTIASSWTTTDPSTFLIRGKTYLMDSQKIKANHTLMKMVAADWITSDRRED  545

Query  1079  DLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGD  1258
             DL GRPG IVQ +AA    EFF IVNIQVPGS TY+LALYYM  + LED PLL+ FV+ D
Sbjct  546   DLGGRPGSIVQNYAAKGGSEFFFIVNIQVPGSKTYNLALYYM-TSNLEDAPLLQNFVDRD  604

Query  1259  DAFRNSRFKLIPYISK  1306
             DA+RNSRFKLIPYISK
Sbjct  605   DAYRNSRFKLIPYISK  620


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G WIVKQSVGKKACL GQALE+NYF GKNY+
Sbjct  620   KGPWIVKQSVGKKACLAGQALEINYFCGKNYI  651



>ref|XP_010689525.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=727

 Score =   449 bits (1154),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 255/436 (58%), Positives = 306/436 (70%), Gaps = 5/436 (1%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +FR +MSLGPSRS+WD+ F RGSV+E+LDGHTDIIH QL  +W
Sbjct  200   DHPAIMAVGVVDGTSENIFRAVMSLGPSRSQWDYSFYRGSVVENLDGHTDIIHKQLCAYW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWG+ +RDLLLRRYWRR+DDGTYVILYHSV H+KC PQK YIRACLKSGG+VITP+  G
Sbjct  260   LPWGVQQRDLLLRRYWRRDDDGTYVILYHSVYHKKCLPQKGYIRACLKSGGYVITPLNHG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W ++L  + +RS TIRMLG +AALRE+F+AK G+  S+ SF   +
Sbjct  320   KQSVVKHMLAIDWKLWAAYLLPSLARSTTIRMLGKIAALRELFKAKAGDCFSSNSF--GD  377

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEP-SSLVGLESACDEFYDVLEPSddd  718
                   +    +      AVD     +  E        SL  L    DEF+D  E S D 
Sbjct  378   QPFGHASQNENKPEIYPHAVDGKENLEEKELEKLSEHGSLAELNDVSDEFFDAPEGS-DF  436

Query  719   deegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCY  898
             D    GW S   PE  +   + K S+A   +KK H LAV KKGYVDL E+ ++E   CCY
Sbjct  437   DPPDYGWPSDCGPETNLQDARSKRSTAAVFVKKLHGLAVHKKGYVDLVEIAAKEGISCCY  496

Query  899   GGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQD  1078
             G TL +D   +   SW   DPS+FLIRGK Y  D +KIKA +TLM+MVAADW+ SDRR+D
Sbjct  497   GTTLAKDPTCTIASSWTTTDPSTFLIRGKTYLMDSQKIKANHTLMKMVAADWITSDRRED  556

Query  1079  DLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGD  1258
             DL GRPG IVQ +AA    EFF IVNIQVPGS TY+LALYYM  + LED PLL+ FV+ D
Sbjct  557   DLGGRPGSIVQNYAAKGGSEFFFIVNIQVPGSKTYNLALYYM-TSNLEDAPLLQNFVDRD  615

Query  1259  DAFRNSRFKLIPYISK  1306
             DA+RNSRFKLIPYISK
Sbjct  616   DAYRNSRFKLIPYISK  631


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G WIVKQSVGKKACL GQALE+NYF GKNY+
Sbjct  631   KGPWIVKQSVGKKACLAGQALEINYFCGKNYI  662



>ref|XP_002534384.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27998.1| conserved hypothetical protein [Ricinus communis]
Length=640

 Score =   443 bits (1139),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 242/412 (59%), Positives = 300/412 (73%), Gaps = 15/412 (4%)
 Frame = +2

Query  92    EWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPWGMNrrdlllrrywrreddGTYVILYHS  271
             +WD+CF RGS++EHLDGHTDIIH QLYN W P G+ RRDLLLRRYWRR+DDGTYVILY S
Sbjct  191   KWDYCFYRGSMVEHLDGHTDIIHKQLYNDWFPRGLKRRDLLLRRYWRRDDDGTYVILYQS  250

Query  272   VVHQKCPPQKDYIRACLKSGGHVITPIKLGKASVVKHMLAVDWKCWKSHLKQASSRSITI  451
             V+H+KCPPQK Y+RACLKSGG+VITP+  G  S+VKHMLAVDWK WK +++ +S RSITI
Sbjct  251   VIHKKCPPQKGYVRACLKSGGYVITPLNQGTRSLVKHMLAVDWKSWKLYMRPSSERSITI  310

Query  452   RMLGVVAALREMFRAKEGNHSSNLSFSLAEMT----IDieapigeeerreegaVDPTRCE  619
             RM+  VAALRE+FRAK GN+S   S  ++       I+      E+E  E+   D    E
Sbjct  311   RMIERVAALRELFRAKAGNYSDFRSGEISRQIMLPQIEKVDMNVEDETLEKIEQDHNSIE  370

Query  620   DGMEELLSEPSSLVGLESACDEFYDVLEPSdddd-eegegWSSATSPEFCVDANQQKISS  796
             +G  +L     SL GL +A DEF+DV   ++  D +    W S ++          ++SS
Sbjct  371   EGTGKL---SRSLTGLNNASDEFFDVPNANEMMDCDSDNEWPSESTVPL-------RLSS  420

Query  797   ATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLI  976
             A  L+KK HDLAV KK YVDLQ +  ++S  C YG TLQ+D + + PCSWA  DPS+FLI
Sbjct  421   AAGLVKKLHDLAVHKKNYVDLQGLTGKDSTVCFYGATLQKDPSCTLPCSWAAADPSTFLI  480

Query  977   RGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVN  1156
             RG+ Y +DH+K+K+K TLMQMV ADWL+S  R+DDL  RP  IVQK+A   RPEFF IVN
Sbjct  481   RGENYLRDHKKVKSKGTLMQMVGADWLRSSHREDDLGSRPDSIVQKYATQGRPEFFFIVN  540

Query  1157  IQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             IQ+PGS+ ++LA+YYMLK PLEDTPLL++FVNGDDAFRNSRFKLIPYISK S
Sbjct  541   IQIPGSSMHTLAMYYMLKTPLEDTPLLQKFVNGDDAFRNSRFKLIPYISKGS  592


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALEVNYF+GK YL
Sbjct  590   KGSWIVKQSVGKKACLVGQALEVNYFRGKTYL  621



>gb|KHG25367.1| Homeobox-leucine zipper ATHB-14 -like protein [Gossypium arboreum]
Length=758

 Score =   440 bits (1132),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 240/449 (53%), Positives = 314/449 (70%), Gaps = 17/449 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             D  +IMAVGV+D TSEA+F  LMSLGPSRSEWD+C   GS++E LDGHTDIIH +LY+ W
Sbjct  221   DDPAIMAVGVVDGTSEAIFLALMSLGPSRSEWDYCVYHGSLVECLDGHTDIIHKKLYSDW  280

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLL+RYWRREDDGTYVILYHSV H+KCPPQ  Y+RA LKSGG+V+TP+  G
Sbjct  281   LPWGMKRRDLLLQRYWRREDDGTYVILYHSVAHKKCPPQSGYVRAHLKSGGYVVTPVNQG  340

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSS--------  517
             + S VKHMLA+DWK WKS+ + +++RS+TI ML  VAALRE+F+AK+ N SS        
Sbjct  341   QQSTVKHMLAIDWKLWKSYPRLSAARSLTILMLMRVAALRELFKAKQRNSSSICLSREWL  400

Query  518   -NLSFSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYD  694
              ++     E   D      ++        D     + +E+  S   SL GL    DEF+D
Sbjct  401   RHIHLPQTEKPDDKTDTESDKSIE-----DNNLINNEVEQPASLHVSLSGLNEEPDEFFD  455

Query  695   VLEPSddddeegegWSSATSPEF---CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQE  865
             V E S+  D +         P      ++ +Q K++SA + ++K HDLA QKKGY++LQE
Sbjct  456   VPEESEFSDYDHLESERPGEPSSELPPLNLHQPKLTSAASFVRKLHDLATQKKGYMNLQE  515

Query  866   VDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVA  1045
             V +E+++  CYG +L++D   + P SW+ G+PS FLIRG+ Y +D +KIKA   LMQMV 
Sbjct  516   VATEDTKLYCYGNSLRKDLTATLPSSWSPGNPSLFLIRGRNYLQDKQKIKANGALMQMVG  575

Query  1046  ADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLED  1225
             ADWL S++R+D+L  R GGIVQ HAA   PEFF IVN Q+PG+  Y+LA+Y+M+K+PLED
Sbjct  576   ADWLISEKREDNLGSRLGGIVQNHAAQGGPEFFFIVNFQIPGTPRYTLAMYFMMKSPLED  635

Query  1226  TPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
              P L +FVNGDDA+RNSRFKLIP++S+ S
Sbjct  636   HPSLYKFVNGDDAYRNSRFKLIPHVSEGS  664


 Score = 52.8 bits (125),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGK+  L+ Q LE  YF+GKNY+
Sbjct  662   EGSWIVKQSVGKRGSLLCQTLEAQYFRGKNYM  693



>ref|XP_010264665.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Nelumbo nucifera]
Length=604

 Score =   432 bits (1111),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 238/397 (60%), Positives = 288/397 (73%), Gaps = 12/397 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRTLMSLGPSRSEWDFC  RGSV+EHLDGHTDIIH QL ++W
Sbjct  200   DHPAIMAVGVVDGTSEAIFRTLMSLGPSRSEWDFCIYRGSVVEHLDGHTDIIHKQLNDNW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RDLLL+RYWRREDDGTYVILYHSV  +KC PQK Y+RACLKSGG+VI+P+  G
Sbjct  260   LPWGMRKRDLLLKRYWRREDDGTYVILYHSVFQKKCQPQKGYVRACLKSGGYVISPVNQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DW+ WK +++ +S+RSITIRMLG +AALRE F+AK GN+ S   FS  E
Sbjct  320   KQSVVKHMLAIDWRFWKCYIRTSSARSITIRMLGRIAALREFFKAKVGNYPS-FEFSSGE  378

Query  542   MT---------IDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYD  694
             +T         I+      +         +    ++ +E+  S+ +SL+ L    DEF+D
Sbjct  379   LTQCIGLPQNEIEDLKVEVQTPSENIMTKEVDLMKEEVEKQSSKSASLLVLNDVADEFFD  438

Query  695   VLEPSddddeegegWSSATSPEF-CVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             V EPS D D    GWSS  SPE    D    K+S+AT  +KK HDLAVQK+GY+DLQE+ 
Sbjct  439   VPEPS-DFDPSENGWSSNMSPEIHPQDLRHPKLSTATGFVKKLHDLAVQKRGYMDLQEMA  497

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
              E+S  CCYG TL +DS  +  CSW   DPS+FLIRG  Y  DH+K+KAK TLMQMV AD
Sbjct  498   REDSISCCYGATLPKDSCCNLACSWTTADPSTFLIRGDNYLIDHQKMKAKGTLMQMVGAD  557

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQ  1162
             WLKSD+R+DDL GRPGGIVQ+ A    PEFF IVNIQ
Sbjct  558   WLKSDKREDDLGGRPGGIVQQSATKGGPEFFFIVNIQ  594



>ref|XP_009344768.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Pyrus x bretschneideri]
Length=711

 Score =   435 bits (1119),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 251/445 (56%), Positives = 308/445 (69%), Gaps = 35/445 (8%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRTL+SLGPSRSEWDFC+ RGSV+E LDGHTDIIH QLY+ W
Sbjct  200   DHPAIMAVGVVDGTSEAIFRTLLSLGPSRSEWDFCYYRGSVVERLDGHTDIIHQQLYSDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLL+RRYWRREDDGTY                         GG VITP   G
Sbjct  260   LPWGMQRRDLLIRRYWRREDDGTY------------------------GGGFVITPANQG  295

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K S+V+HMLA+DWK WK +L+ +S+R ITIRML  VAALRE+FRAK G  +S+  FS  +
Sbjct  296   KQSLVRHMLAIDWKFWKLYLRPSSARCITIRMLERVAALRELFRAKAG--TSSPEFSSGD  353

Query  542   MTIDieapigeeerreegaVDP---TRCEDG--MEELLSEP---SSLVGLESACDEFYDV  697
             M+ +I+     ++  +     P    + E+G  ME+ + +P   +SL GL  A DEF+DV
Sbjct  354   MSSEIKFSQSGQQNIKTEVQHPGEVKKMEEGVLMEDEVEKPEGRASLKGLHDAADEFFDV  413

Query  698   LEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              EP++ D  E E  S  +  +        K+SSA  L+KK H+L VQKKGY+DLQEV  E
Sbjct  414   PEPTEYDQFENEWPSDVSMEQNPTSIQHPKLSSAAVLVKKLHELRVQKKGYMDLQEVSKE  473

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             +S  C YG TLQ+D + + PCSW   DPSSFLIRG  Y +D +KIKAK+TLMQ+V  DWL
Sbjct  474   DS-VCPYGATLQKDPSCALPCSWGSADPSSFLIRGPNYLRDRQKIKAKSTLMQLVGVDWL  532

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SD+R+DDL  R G IVQK A     EFF IVNIQVPG+T Y+LA YYM+K PLE+TPLL
Sbjct  533   RSDKREDDLGSRYGSIVQKSAERGGSEFFFIVNIQVPGTTMYTLAFYYMIKTPLEETPLL  592

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
               FVNGDD++RNSRFKLIPYISK S
Sbjct  593   HDFVNGDDSYRNSRFKLIPYISKGS  617


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQ VG+KACL+GQALEV+YF+GKNYL
Sbjct  615   KGSWIVKQRVGEKACLVGQALEVHYFRGKNYL  646



>ref|XP_008791558.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X3 [Phoenix dactylifera]
Length=717

 Score =   433 bits (1114),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 245/449 (55%), Positives = 304/449 (68%), Gaps = 38/449 (8%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSEA+FRT+MSLGPSRSEWDF    G V+EHLDGHTDIIH +L+  W
Sbjct  200   DHPAIMAVGVVDATSEAIFRTVMSLGPSRSEWDFSLLEGRVVEHLDGHTDIIHKKLHGDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMN+RDLLLRRYWRREDDGTY                         GG+VI+P+  G
Sbjct  260   LPWGMNKRDLLLRRYWRREDDGTY------------------------GGGYVISPVNQG  295

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK W+S++  +S++ +TIRMLG VAALRE FRAK GN + +  +S  E
Sbjct  296   KQSVVKHMLAIDWKFWRSYMFTSSAKYVTIRMLGRVAALREFFRAKLGNCTCS-DYSSGE  354

Query  542   MTIDi---eapigeeerreegaVDPTRCEDGMEELLSEPSS-------LVGLESACDEFY  691
             +T +I    +     +   +   + ++  D  E     PSS        + L  A DEF+
Sbjct  355   LTREIGLPYSEKEHIKVEVQTTGENSKSADSAEAPQQSPSSHANTSGSFLQLNDAADEFF  414

Query  692   DVLEPSddddeegegWSS--ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQE  865
             DV++ SD+D  E   W S      +   +  Q K+S+A   +KK HD AVQKKGY+DLQE
Sbjct  415   DVIDESDNDQTEAL-WPSDEGMHSQLVQEQRQHKLSTAAVFVKKLHDFAVQKKGYIDLQE  473

Query  866   VDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVA  1045
                 +  PC YG TL +D + +  CSWA  DP+SFLIRG+ Y +D +KIKA +TLMQMVA
Sbjct  474   ASMGDMAPCSYGTTLPKDPSCTMTCSWAMADPTSFLIRGESYLRDQQKIKANSTLMQMVA  533

Query  1046  ADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLED  1225
             ADWL SD+R+DDL GRPGG+VQK+AA    EFF IVNIQ+PGS+TYSLALYYM+  PLE+
Sbjct  534   ADWLNSDKREDDLGGRPGGVVQKYAAQGGSEFFFIVNIQIPGSSTYSLALYYMMDTPLEN  593

Query  1226  TPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
              PLLE FV GDDA+RNSRFKLIPYISK S
Sbjct  594   VPLLESFVKGDDAYRNSRFKLIPYISKGS  622


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQAL  +YF+G NYL
Sbjct  620   KGSWIVKQSVGKKACLVGQALASHYFRGSNYL  651



>emb|CAB77600.1| putative protein [Arabidopsis thaliana]
Length=709

 Score =   429 bits (1102),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 304/440 (69%), Gaps = 33/440 (8%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGVID TSE +F TLMSLGP RSEWDFCF +G+V+EHLDGHTDIIHLQLY+ W
Sbjct  207   DHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEWDFCFYKGNVVEHLDGHTDIIHLQLYSDW  266

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGMNRRDLLLRRYWRREDDGTY                         GG+V+TP   G
Sbjct  267   LPWGMNRRDLLLRRYWRREDDGTY------------------------GGGYVVTPANNG  302

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL---SFS  532
             K S+VKHM+A+DW+ W  +++ +S+RSITIR++  VAALREMF+AK+G+  +      F 
Sbjct  303   KQSLVKHMVAIDWRSWNLYMRPSSARSITIRVVERVAALREMFKAKQGHGFTEFVSGEFL  362

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
               +  +     +  +   +E  ++    E+ M++  S  +SL+ L  A DEF+DV EP++
Sbjct  363   DTKPCLSKINTMPLKTEAKEVDLETMHAEE-MDKPTSARNSLMDLNDASDEFFDVPEPNE  421

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
               + +    SS  S       +Q KI +   ++KK  DLA+ KKGY+DLQEV  EE+   
Sbjct  422   STEFDSFIDSSPYS-----QGHQLKIPTPAGIVKKLQDLAINKKGYMDLQEVGLEENNTF  476

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
              YG TLQ+D + + PCSW+  DPS+FLIRG  Y K+ +K+KAK TLMQM+ ADW+ SD+R
Sbjct  477   FYGATLQKDPSLTLPCSWSTADPSTFLIRGNNYLKNQQKVKAKGTLMQMIGADWISSDKR  536

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL GR GG+VQ++AA   PEFF IVNIQVPGS  YSLALYYMLK PLE+ PLLE FVN
Sbjct  537   EDDLGGRIGGLVQEYAAKGSPEFFFIVNIQVPGSAMYSLALYYMLKTPLEEHPLLESFVN  596

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDDA+RNSRFKLIP+ISK S
Sbjct  597   GDDAYRNSRFKLIPHISKGS  616


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQ LEV Y +GKNYL
Sbjct  614   KGSWIVKQSVGKKACLVGQVLEVCYTRGKNYL  645



>ref|XP_010906507.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Elaeis guineensis]
Length=698

 Score =   427 bits (1099),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 250/443 (56%), Positives = 300/443 (68%), Gaps = 51/443 (12%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D T EA+FRT+MSLGPSRSE                             
Sbjct  206   DHPAIMAVGVVDATPEAIFRTVMSLGPSRSE-----------------------------  236

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
                GM RRDLLLRRYWRREDDGTYVILYHSV HQ C P++ YIRACLKSGG+VI+P   G
Sbjct  237   ---GMKRRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPANQG  293

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               SVVKHMLA+DWK WKS+L  +S+  ITIRMLG VAALRE+FR K GN+S +  FS  +
Sbjct  294   NVSVVKHMLAIDWKFWKSYLFASSAIYITIRMLGRVAALRELFRVKLGNYS-HTDFSSGD  352

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPS----SLVGLESACDEFYDVLEPS  709
             M  +++ P    +  E          +G E   ++P+    S + L  A DEF+DVL+ S
Sbjct  353   MEPEVQLPGENSKSEEFI--------EGSENSSAKPAKTGGSFLQLNDAADEFFDVLDES  404

Query  710   ddddeegegWSS--ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
             + +  E   W S     P+   D  Q K+S+A   +++ HDLAVQKKGYVDLQE   E+S
Sbjct  405   EYEQTEAM-WPSDAGMQPQ---DQRQPKLSTAAVFVRRLHDLAVQKKGYVDLQEASMEDS  460

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
              PCCYG TLQ+DS+++  CSWA  DPS+FLIR K Y +D +KIKA  TLMQMVAADWLKS
Sbjct  461   MPCCYGATLQKDSSFTIACSWASADPSTFLIRSKTYLQDRQKIKANGTLMQMVAADWLKS  520

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
              +R+DDL GR GGIVQK+AA    EFF IVNIQVPGSTTYSLALYYM+  P+ED PLLE 
Sbjct  521   SKREDDLGGRAGGIVQKYAAQGGREFFFIVNIQVPGSTTYSLALYYMMDTPVEDVPLLES  580

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             F+  DDA+RNSRFKLIPYISK S
Sbjct  581   FIREDDAYRNSRFKLIPYISKGS  603


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF G NYL
Sbjct  601   KGSWIVKQSVGKKACLVGQALEINYFHGGNYL  632



>ref|XP_010906510.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X4 [Elaeis guineensis]
Length=650

 Score =   423 bits (1088),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 244/427 (57%), Positives = 300/427 (70%), Gaps = 27/427 (6%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D T EA+FRT+MSLGPSRSEWDFCF  GSVIEHLDGHTDIIH +L++ W
Sbjct  206   DHPAIMAVGVVDATPEAIFRTVMSLGPSRSEWDFCFAHGSVIEHLDGHTDIIHKKLHSDW  265

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSV HQ C P++ YIRACLKSGG+VI+P   G
Sbjct  266   LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHQNCRPERGYIRACLKSGGYVISPANQG  325

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               SVVKHMLA+DWK WKS+L  +S+  ITIRMLG VAALRE+FR K GN+ S+  FS  +
Sbjct  326   NVSVVKHMLAIDWKFWKSYLFASSAIYITIRMLGRVAALRELFRVKLGNY-SHTDFSSGD  384

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPS----SLVGLESACDEFYDVLEPS  709
             M  +++ P    +  E          +G E   ++P+    S + L  A DEF+DVL+ S
Sbjct  385   MEPEVQLPGENSKSEEFI--------EGSENSSAKPAKTGGSFLQLNDAADEFFDVLDES  436

Query  710   ddddeegegWSS--ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
              + ++    W S     P+   D  Q K+S+A   +++ HDLAVQKKGYVDLQE   E+S
Sbjct  437   -EYEQTEAMWPSDAGMQPQ---DQRQPKLSTAAVFVRRLHDLAVQKKGYVDLQEASMEDS  492

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
              PCCYG TLQ+DS+++  CSWA  DPS+FLIR K Y +D +KIKA  TLMQMVAADWLKS
Sbjct  493   MPCCYGATLQKDSSFTIACSWASADPSTFLIRSKTYLQDRQKIKANGTLMQMVAADWLKS  552

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVP---GSTT-----YSLALYYMLKAPL  1219
              +R+DDL GR GGIVQK+AA    EFF IVNIQ+    GS+T      SL L Y+    +
Sbjct  553   SKREDDLGGRAGGIVQKYAAQGGREFFFIVNIQLGIDIGSSTVARGVVSLVLGYLNNLVI  612

Query  1220  EDTPLLE  1240
             E   L++
Sbjct  613   EMAFLIQ  619



>ref|XP_008456490.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Cucumis melo]
Length=695

 Score =   415 bits (1067),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 239/445 (54%), Positives = 293/445 (66%), Gaps = 51/445 (11%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVG++  TSE +FRTLMSLG SRSEWDFCF RGS++EH+DGHTDIIH+QLY  W
Sbjct  200   DHPAIMAVGMVCGTSEEIFRTLMSLGSSRSEWDFCFFRGSLVEHIDGHTDIIHMQLYRDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RD LLRRYWRREDDGTYV+LYHSV H K PPQK Y+RACLKSGG+V+TP+   
Sbjct  260   LPWGMKKRDFLLRRYWRREDDGTYVLLYHSVFHVKFPPQKGYVRACLKSGGYVVTPVN--  317

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLS-----  526
                                                  ALRE+FRAK G+ SS  S     
Sbjct  318   ------------------------------------QALRELFRAKVGDSSSEFSSSSRD  341

Query  527   ---FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDV  697
                F L +  ID      +         +    E+  E      +SL+GL  A DEF+DV
Sbjct  342   LRHFELPQSDIDEIKTEIQSPETMRKIKEAFLKENEAE---MPRASLIGLNDAVDEFFDV  398

Query  698   LEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              EP++ D  E E W+S  + +  ++ +Q K+S+A   +KK HDLAVQKKGY +L E+  E
Sbjct  399   PEPAELDHYENE-WTSDLTLQ-QLNMSQNKLSTAAVFVKKLHDLAVQKKGYTELPELPRE  456

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
             ES    YG TL +D N+STPCS A  DPS FLIRG+ Y KD +KIKA  TLMQ+V ADWL
Sbjct  457   ESMAYSYGSTLPKDFNFSTPCSVASADPSLFLIRGENYLKDSQKIKANGTLMQLVGADWL  516

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             +SDRR+D+L GRPG IVQK+A     EFF +VNIQVPG+T Y+LA+YYM++ PLE +PLL
Sbjct  517   RSDRREDNLGGRPGSIVQKYAERGGTEFFFVVNIQVPGTTMYTLAMYYMMRTPLESSPLL  576

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
             + FV GDDAFRNSRFKLIPYIS+ S
Sbjct  577   KNFVEGDDAFRNSRFKLIPYISQGS  601


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             QGSWIVKQSVGKKACL+G ALEV+YF+GKNYL
Sbjct  599   QGSWIVKQSVGKKACLVGHALEVHYFRGKNYL  630



>ref|XP_009421353.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   416 bits (1069),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 236/448 (53%), Positives = 302/448 (67%), Gaps = 13/448 (3%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH  +MAVGVID +SEA+F+T+MSLG SRSEWDFC   G+V+E LD HTDIIH +L   W
Sbjct  191   DHPGMMAVGVIDASSEAIFQTVMSLGQSRSEWDFCLLEGNVVESLDEHTDIIHKKLRGDW  250

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDL+L+R WR+EDDGTYVILYHSV+H KC P++ Y+RACLKSGG+ I+P+  G
Sbjct  251   LPWGMKRRDLILKRSWRKEDDGTYVILYHSVIHYKCQPERGYVRACLKSGGYEISPVNQG  310

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLA+DWK WKS++   S  SIT++MLG VAALRE FRAK GN + +  F+L  
Sbjct  311   KQSVVKHMLAIDWKFWKSNMF-TSYASITMKMLGRVAALREFFRAKLGNCAFS-DFTLDG  368

Query  542   MT--IDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVG------LESACDEFYDV  697
             +T  I +     + +   +   + ++ E+ +EE    P    G      L  A DEF+DV
Sbjct  369   LTREIILPQIEEQIKLDMQTVDENSKIENFVEESQMSPPRHPGNGSSNQLNDAADEFFDV  428

Query  698   LEPSddddeegegWS-SATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGY--VDLQEV  868
             L  S+ D  E    S      +   D  Q K+ +    +KK HD+      Y   +L++ 
Sbjct  429   LTESEYDQTENYCPSDEGMQSQLIQDQCQDKLPTTAVFIKKLHDITGSTLCYFCAELEDE  488

Query  869   DSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
                +S PC YG TL +D +    CSWA  DPS+F IRG+ Y  DH+K+KA  TLMQMVAA
Sbjct  489   SIGDSMPCSYGTTLPKDPSCRMACSWAMADPSTFAIRGESYLHDHQKVKANTTLMQMVAA  548

Query  1049  DWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             DWLKSD+R+D++  R GGIVQK+AA    EFF +V++QVPG TTYSLALYYM+  PLE+ 
Sbjct  549   DWLKSDKREDNVGNRTGGIVQKYAAQGGSEFFFVVHMQVPGLTTYSLALYYMMDTPLENV  608

Query  1229  PLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             P L+ FV GDD++RNSRFKLIP ISK S
Sbjct  609   PFLKNFVRGDDSYRNSRFKLIPCISKGS  636


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSW+VKQSVGKKACLIGQALE+NYF G NY+
Sbjct  634   KGSWLVKQSVGKKACLIGQALEINYFHGSNYI  665



>ref|XP_009400820.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=642

 Score =   404 bits (1038),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 230/400 (58%), Positives = 282/400 (71%), Gaps = 15/400 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH ++MAVGVID +SEA+F+ +MSLG SRSEWDFC   G+V+EH+DGHTDIIH +L   W
Sbjct  222   DHPALMAVGVIDASSEAIFKRVMSLGSSRSEWDFCLLEGNVVEHVDGHTDIIHKKLCGDW  281

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPW M RRDLLLRRYWRREDDGTYVILYHSV HQKCP ++ Y+RACLKSGG+VI+P+  G
Sbjct  282   LPWRMKRRDLLLRRYWRREDDGTYVILYHSVFHQKCPSKRGYVRACLKSGGYVISPVSQG  341

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHS-SNLSFSLA  538
             K SVVKHMLAVDWK WKS+   +S++ ITIRMLG VAALRE FRAK G+ + S+LS S +
Sbjct  342   KQSVVKHMLAVDWKFWKSYFFTSSAKYITIRMLGRVAALREFFRAKLGSRACSDLSSSES  401

Query  539   EMTIDieapigeeerreegaVDPT-RCEDGMEELLSEPS-------SLVGLESACDEFYD  694
                I+++    E+ + E  + D     ED  +E    P+       S + +  A DEF+D
Sbjct  402   TREIELQQSEKEQMKLEVHSADENDNIEDSADETQRSPTKIAKASGSFLQMNDAADEFFD  461

Query  695   VL-EPSddddeegegWSS---ATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQ  862
             V+ EP    DE    W S      P+   D +  K+S+A   +KK HD+AVQKKGY+DLQ
Sbjct  462   VINEPE--YDETEALWPSEEGMMQPQLVQDQHHSKLSTAAVFVKKLHDIAVQKKGYIDLQ  519

Query  863   EVDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMV  1042
             E    ES PC YG TL +D N S P SWA  DPS+FLIRGK Y  DH+KIKA  TLMQMV
Sbjct  520   EASLGESVPCSYGLTLPKDLNCSLPSSWAMADPSTFLIRGKSYLHDHQKIKANGTLMQMV  579

Query  1043  AADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQ  1162
             AADWL SD+R+DDL GRPGGIVQK++A    EFF I++IQ
Sbjct  580   AADWLNSDKREDDLGGRPGGIVQKYSAQGGSEFFFIIHIQ  619



>gb|EMS46709.1| hypothetical protein TRIUR3_29071 [Triticum urartu]
Length=738

 Score =   400 bits (1029),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 242/452 (54%), Positives = 292/452 (65%), Gaps = 57/452 (13%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D  SE +F+TLMSLG SRSE                             
Sbjct  234   DHPAIMAVGVVDANSEDIFQTLMSLGQSRSE-----------------------------  264

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
                GM +RDLLLRRYWRRE+DGTYVILYHSV H +C P+K YIRACLKSGG+VI+P+  G
Sbjct  265   ---GMRKRDLLLRRYWRREEDGTYVILYHSVFHNRCSPEKGYIRACLKSGGYVISPVSQG  321

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + SVVKHMLA+DWK WKS+L  +S++ ITI        LRE+FRAK GN  + + FS  E
Sbjct  322   RQSVVKHMLAIDWKFWKSYLLTSSAKYITI-------PLRELFRAKNGN-CACMEFSSGE  373

Query  542   MTIDieapigeeerreegaVDPTRCE----------DGMEELLSEPSSLVGLESACDEFY  691
             +  D+  P G  E  +        CE           G +  LS   SLV L  A DEF+
Sbjct  374   LMRDMGLPQGGNEPTKIETQSANECERLEGPVEGPQGGSKRHLSSTGSLVQLNDATDEFF  433

Query  692   DVLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             DV + S+ D  E   WSS  S     D    K+SSA   ++K HDLAVQK+GY+DLQ   
Sbjct  434   DVPDESEYDQREAM-WSSDESTH-AADQRHAKLSSAAVFVRKLHDLAVQKRGYIDLQGAA  491

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEK-----IKAKNTLMQ  1036
               ++ PC YG TL +DS+ + P SW+  DP++FLIRG+ Y  D +K     IKA+NTLMQ
Sbjct  492   DADNGPCYYGHTLPKDSSCTMPSSWSMTDPTTFLIRGESYLLDRQKEIRDPIKAENTLMQ  551

Query  1037  MVAADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAP  1216
             MV ADW+KSD+R+DDLAGRPGG+VQK+AA    +FF IVNIQVPGSTTYSLALYYM+  P
Sbjct  552   MVGADWIKSDKREDDLAGRPGGLVQKYAAQGGSKFFFIVNIQVPGSTTYSLALYYMMDTP  611

Query  1217  LEDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LE  PLLERFVNGDD FRNSRFKLIPYISK S
Sbjct  612   LEKVPLLERFVNGDDTFRNSRFKLIPYISKGS  643


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  641   KGSWIVKQSVGKKACLVGQALEINYFRGSNYL  672



>gb|EPS61698.1| hypothetical protein M569_13096, partial [Genlisea aurea]
Length=438

 Score =   381 bits (979),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 207/370 (56%), Positives = 250/370 (68%), Gaps = 30/370 (8%)
 Frame = +2

Query  245   GTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKASVVKHMLAVDWKCWKSHLK  424
             GTYVILYHSV HQ CPP++ YIRACLKSGG+VI+PI  G+ SVVKHMLA+DWK W+S+L+
Sbjct  19    GTYVILYHSVFHQNCPPKRGYIRACLKSGGYVISPINQGRHSVVKHMLAMDWKFWRSYLQ  78

Query  425   QASSRSITIRMLGVVAALREMFRAK-----EGNHSSNLSFSLAEMTIDieapigeeerre  589
              + +RSITI MLG +AA+RE+F AK      G  S  L  S  E  +             
Sbjct  79    LSLARSITISMLGRLAAMRELFSAKVDCLPSGFLSGELRRSKREPDV-------------  125

Query  590   egaVDPTRCEDGMEELL-----SEPSSLVGLESACDEFYDVLEPSddddeegegWSSATS  754
                V P   E+ +EE       SE SSL+G   A DEFYDV EP D +  E  GW S  S
Sbjct  126   -VEVQPQPREEDVEEETTKTGGSERSSLIGFNDAADEFYDVSEPLDYEPYETIGWHSDFS  184

Query  755   PEFCV-DANQQKISSATTLMKKFHDLAVQKKGYVDLQEV---DSEESEPCCYGGTLQQDS  922
              E  V D  + K+S+AT  +K+ HDLA+QKKGYVDL E+   D   S  C Y  TL +D 
Sbjct  185   SETHVQDVGKHKLSTATGFVKRLHDLAIQKKGYVDLHEMARGDLSSSSRCGY--TLPKDP  242

Query  923   NYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDDLAGRPGG  1102
              ++  CSWA  D SSFLIRG  Y  D +KIKAK+TLM++V ADWLKSD+R+DDL  RPGG
Sbjct  243   AFNVLCSWAAADTSSFLIRGTTYLNDRKKIKAKSTLMELVGADWLKSDKREDDLGSRPGG  302

Query  1103  IVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDDAFRNSRF  1282
             +VQ +     PEFF IVNIQ+PGSTTYSLA YYM++ PLE+TPLL+ FVNGDDA+RNSRF
Sbjct  303   MVQTYGLKGGPEFFFIVNIQIPGSTTYSLAAYYMMRTPLEETPLLQSFVNGDDAYRNSRF  362

Query  1283  KLIPYISKVS  1312
             KLIPYISK S
Sbjct  363   KLIPYISKGS  372


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+ Y  GKNYL
Sbjct  370   KGSWIVKQSVGKKACLIGQALELKYVGGKNYL  401



>ref|XP_002467069.1| hypothetical protein SORBIDRAFT_01g019140 [Sorghum bicolor]
 gb|EER94067.1| hypothetical protein SORBIDRAFT_01g019140 [Sorghum bicolor]
Length=725

 Score =   363 bits (932),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 219/447 (49%), Positives = 268/447 (60%), Gaps = 69/447 (15%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D  SEAVF+TLMSLG S         R   +   D       L L  +W
Sbjct  243   DHPAIMAVGVVDANSEAVFQTLMSLGQS---------RSEGMRKRD-------LLLRRYW  286

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
                             RREDDGTY                         GG+VI+P+  G
Sbjct  287   ----------------RREDDGTY------------------------GGGYVISPVNQG  306

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + SVVKHMLA+DWK WKS+L  +S++ ITIRMLG VAALRE FRAK GN +  + FS  E
Sbjct  307   RQSVVKHMLAIDWKFWKSYLFTSSAKYITIRMLGRVAALREFFRAKNGNCAC-MEFSSGE  365

Query  542   MTIDi---eapigeeerreegaVDPTRCED-------GMEELLSEPSSLVGLESACDEFY  691
             +T D+   +          +   +  R E        G    L+  SS V L  A DEF+
Sbjct  366   LTRDMGLPQGENQRINLEIQQENENRRLEGPTEGSVGGSNRHLNSTSSFVQLNDATDEFF  425

Query  692   DVLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             DV + S+ D  E    S  ++     D    K+S+A   +K+ HDLAVQK+GYVDLQ   
Sbjct  426   DVPDESEYDQREVMFPSDEST--HASDQRHAKLSTAAVFVKRLHDLAVQKRGYVDLQGAA  483

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
               ++ PCCYG TL +DS+Y+ P +WA  DP++FLIRG+ Y  D  KIKA +TLMQMV AD
Sbjct  484   DADNGPCCYGYTLPKDSSYAVPSTWAMTDPTTFLIRGETYLHDRLKIKANSTLMQMVGAD  543

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             W+KSD+R+DDLAGRPGG+VQK AA    +FF +VNIQVPGSTTYSLALYYM+  PLE  P
Sbjct  544   WIKSDKREDDLAGRPGGLVQKCAAQGGTKFFFVVNIQVPGSTTYSLALYYMMDTPLEKVP  603

Query  1232  LLERFVNGDDAFRNSRFKLIPYISKVS  1312
             LLERFVNGDDAFRNSRFKLIPYISK S
Sbjct  604   LLERFVNGDDAFRNSRFKLIPYISKGS  630


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  628   KGSWIVKQSVGKKACLVGQALEINYFRGNNYL  659



>ref|XP_010092610.1| hypothetical protein L484_002656 [Morus notabilis]
 gb|EXB51751.1| hypothetical protein L484_002656 [Morus notabilis]
Length=661

 Score =   353 bits (907),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 198/347 (57%), Positives = 248/347 (71%), Gaps = 14/347 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVG+ID TSEA+FRTL+SLG SRSEWDFCF RGSV+EHLDGHTDIIH QLY+ W
Sbjct  200   DHPAIMAVGIIDGTSEAIFRTLLSLGSSRSEWDFCFYRGSVVEHLDGHTDIIHKQLYSDW  259

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRDLLLRRYWRREDDGTYVILYHSVVH+KCPPQK Y+RA LKSGG VITP+  G
Sbjct  260   LPWGMQRRDLLLRRYWRREDDGTYVILYHSVVHKKCPPQKGYVRAWLKSGGFVITPVNQG  319

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K S+VKHML++DWK W+ +L+ +S+RSITIRML  ++ALRE+FRAK G+HS  L  S A+
Sbjct  320   KQSIVKHMLSIDWKYWRLYLRPSSARSITIRMLERLSALRELFRAKSGSHSPEL--SAAQ  377

Query  542   MTIDie---------apigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYD  694
             +T DI              +     +   + +  ED M+ L+S   SL+ L  A DEF+D
Sbjct  378   LTRDIVLPQSEKEDIKTKVQYTEEVQNMEEVSLMEDEMDRLVSGRKSLMELNDAEDEFFD  437

Query  695   VLEPSddddeegegW--SSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEV  868
             V EP+ D       W  S  ++ +   + +  K+SSA   +KK +DL VQKKGY+DLQ+ 
Sbjct  438   VPEPT-DSRLLENEWPNSELSTGQKTPNISHTKLSSAAVFVKKLNDLRVQKKGYMDLQDA  496

Query  869   DSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEK  1009
             D E++  C YG TLQ+D + + PC+W  GDPSSFL+RG  Y +DH K
Sbjct  497   DREDTMSCFYGATLQKDPSCALPCTWTAGDPSSFLVRGSTYLQDHHK  543



>gb|AAD20693.1| unknown protein [Arabidopsis thaliana]
Length=446

 Score =   340 bits (873),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 214/437 (49%), Positives = 262/437 (60%), Gaps = 91/437 (21%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D TSE +F+TL+SLGPSRSEWDFCF +GSV+EHLDGHTDIIH QLY+ W
Sbjct  7     DHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGSVVEHLDGHTDIIHKQLYSDW  66

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM RRD  LRRYWRREDDGTY                         GG+VI+PI  G
Sbjct  67    LPWGMKRRDFSLRRYWRREDDGTY------------------------GGGYVISPIDNG  102

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             K SVVKHMLAVDWK W+S++K + +RSIT++MLG ++   E+ R+     + +  F  + 
Sbjct  103   KQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISG--ELSRSARLTQNEDGVFGDSS  160

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             +  +                      +  ++  SE SSLV L    DEF+DV EPSD+D+
Sbjct  161   LRENEMFKDT--------------ANEERDKFPSERSSLVDL----DEFFDVPEPSDNDN  202

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
              +   W+S    +F +D   Q    AT                          + PCCYG
Sbjct  203   LDDS-WTS----DFDLDTCCQSSPHATC-------------------------NPPCCYG  232

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
              TL  D +   PCSW   DPS+FLIRGK Y  D +K+KAK TLM+MVAADWLKSD+R+DD
Sbjct  233   TTLPTDPSCDLPCSWTTTDPSTFLIRGKTYLDDQKKVKAKGTLMEMVAADWLKSDKREDD  292

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             L  RPGGIV                 QVPGSTTYSL LYYM+  P+E+ PLL  FVNGDD
Sbjct  293   LGSRPGGIV-----------------QVPGSTTYSLVLYYMMSTPIEEHPLLVSFVNGDD  335

Query  1262  AFRNSRFKLIPYISKVS  1312
             A+RNSRFKLIPYISK S
Sbjct  336   AYRNSRFKLIPYISKGS  352


 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  350   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  381



>ref|XP_004173884.1| PREDICTED: uncharacterized LOC101207368, partial [Cucumis sativus]
Length=360

 Score =   337 bits (863),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 193/344 (56%), Positives = 240/344 (70%), Gaps = 13/344 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVG++  TSE +FRTLMSLGPSRSEWDFCF RGS++EHLDGHTDIIH+QLY  W
Sbjct  22    DHPAIMAVGMVCGTSEEIFRTLMSLGPSRSEWDFCFLRGSLVEHLDGHTDIIHMQLYRDW  81

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPWGM +RD LLRRYWRREDDGTYV+LYHSV H K PPQK Y+RACLKSGG+V+TP+  G
Sbjct  82    LPWGMKKRDFLLRRYWRREDDGTYVLLYHSVFHMKFPPQKGYVRACLKSGGYVVTPVNQG  141

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLS-----  526
             K S+VKHMLAVDWK WK +L+ +S+R+ITIRM+  +AALRE+FRAK G+ SS  S     
Sbjct  142   KHSLVKHMLAVDWKFWKLYLRPSSARAITIRMVERLAALRELFRAKVGDSSSEFSSSSRD  201

Query  527   ---FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDV  697
                F L +  +D      +         +    E+  E      +SL+GL  A DEF+DV
Sbjct  202   LRHFELPQSEMDEIKTEIQSPETMRKIKEAFSKENEAE---MPRASLIGLNDAVDEFFDV  258

Query  698   LEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              EPS + D     W+S  + +  ++ +Q K+S+A   +KK HDLAVQKKGY +L E+  E
Sbjct  259   PEPS-ELDLYENEWTSDLTLQ-QLNMSQNKLSTAAVFVKKLHDLAVQKKGYAELPELPRE  316

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEK  1009
             ES    YG TL +D N+STPCS A  DPS FLIRG+ Y KD +K
Sbjct  317   ESMAYSYGSTLPKDLNFSTPCSVASADPSLFLIRGENYLKDSQK  360



>gb|AAP54296.2| pleckstriny domain-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=412

 Score =   325 bits (833),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 182/320 (57%), Positives = 218/320 (68%), Gaps = 13/320 (4%)
 Frame = +2

Query  383   MLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAEMTIDiea  562
             MLA+DWK WKS+L  AS++ ITIRMLG VAALRE FRAK GN +  + FS  E+T D+  
Sbjct  1     MLAIDWKFWKSYLFTASAKHITIRMLGRVAALREFFRAKNGNCAC-IEFSSGELTRDMRL  59

Query  563   pigeeerreegaV---DPTRCED-------GMEELLSEPSSLVGLESACDEFYDVLEPSd  712
               GE ER +   +   +  R ED       G    LS   S + L  A DEF+DV + S+
Sbjct  60    QQGENERIKIEMLSASENNRLEDPTEGSLGGSNRHLSSAGSFIQLNDAADEFFDVPDDSE  119

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
              D  E   W S  S    VD    K+S+A   +KK HDLAVQK+GYVDLQ     ++ P 
Sbjct  120   YDQREAM-WPSDESTH-SVDQRHAKLSTAAVFVKKLHDLAVQKRGYVDLQGAADFDNGPF  177

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
             CYG TL +DSN + P +WA  DP++FLIRG+ Y +D  KIKA NTLMQMV ADW+KSD+R
Sbjct  178   CYGYTLPKDSNCTMPSTWAMTDPTTFLIRGESYLQDRLKIKANNTLMQMVGADWIKSDKR  237

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
             +DDL+GRPGG+VQK AA    +FF IVNIQVPGS+TYSLALYYM+  PLE  PLLERFVN
Sbjct  238   EDDLSGRPGGLVQKCAAQGGNKFFFIVNIQVPGSSTYSLALYYMMDTPLEKVPLLERFVN  297

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDDAFRNSRFKLIPYISK S
Sbjct  298   GDDAFRNSRFKLIPYISKGS  317


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  315   KGSWIVKQSVGKKACLVGQALEINYFRGSNYL  346



>dbj|BAE98675.1| hypothetical protein [Arabidopsis thaliana]
Length=410

 Score =   325 bits (832),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 222/321 (69%), Gaps = 16/321 (5%)
 Frame = +2

Query  383   MLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFS----LAEMTI  550
             MLAVDWK W+S++K + +RSIT++MLG ++ALRE+FRAK G+   NLS       A +T 
Sbjct  1     MLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAKHGSFPPNLSSGELSRSARLTQ  60

Query  551   DieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSddddeeg  730
             + +   G+   RE      T  E+  ++  SE SSLV L    DEF+DV EPSD+D+ + 
Sbjct  61    NEDGVFGDSSLRENEMFKDTANEE-RDKFPSERSSLVDL----DEFFDVPEPSDNDNLDD  115

Query  731   egWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEP-------  889
                S       C ++ Q K++SAT+L+KK HDLAVQK+GYVDL E   EES P       
Sbjct  116   SWTSDFDLDTCCQESRQPKLNSATSLVKKLHDLAVQKRGYVDLHERAKEESSPHATCNPP  175

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
             CCYG TL  D +   PCSW   DPS+FLIRGK Y  D +K+KAK TLM+MVAADWLKSD+
Sbjct  176   CCYGTTLPTDPSCDLPCSWTTTDPSTFLIRGKTYLDDQKKVKAKGTLMEMVAADWLKSDK  235

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFV  1249
             R+DDL  RPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ PLL  FV
Sbjct  236   REDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEHPLLVSFV  295

Query  1250  NGDDAFRNSRFKLIPYISKVS  1312
             NGDDA+RNSRFKLIPYISK S
Sbjct  296   NGDDAYRNSRFKLIPYISKGS  316


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  314   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  345



>ref|XP_001759959.1| predicted protein [Physcomitrella patens]
 gb|EDQ75084.1| predicted protein [Physcomitrella patens]
Length=730

 Score =   320 bits (820),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 201/458 (44%), Positives = 280/458 (61%), Gaps = 31/458 (7%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             D  ++M VGV+  T E+VF+T+M+LG SRSEWDFC+ +G VIEH+DGH+DI+H Q + HW
Sbjct  184   DPPALMGVGVVFATCESVFQTVMTLGSSRSEWDFCYAKGRVIEHIDGHSDIVHKQFHTHW  243

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIK--  355
             LPW M  RDL++ RYWRREDDG+YVILY SV H+KC P++ ++RA LKSGG+VI+P+   
Sbjct  244   LPWRMKPRDLVVHRYWRREDDGSYVILYKSVKHEKCRPRRKFVRAWLKSGGYVISPLPPQ  303

Query  356   --LGKASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLS  526
                     VKH+L VDWK +K+    +  R IT+++L  VAALRE ++ K  ++  +++S
Sbjct  304   GGFQHRCAVKHILTVDWKHFKTPWSSSKDRVITLKVLERVAALREFYKVKPADYMPTSIS  363

Query  527   FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVG----LESACDEFYD  694
               L  + +    P   ++        P     G E   S   ++ G     + A +EF+D
Sbjct  364   PDLRRLDVAGCKPPLLQKENI-----PEVHLCGAEVARSPEDNIAGQSMFRQLAEEEFFD  418

Query  695   VLEPSddddeegegWSS---ATSPEFCVDANQ----QKISSATTLMKKFHDLAVQKKGYV  853
             V E S  D E          +T P+   D +Q     K+S+A T++K+F  +A QK+ + 
Sbjct  419   VPEDSAWDTELEPDLDGRRESTDPDETSDEDQNGGVHKLSAAATIVKRFQGMAAQKRTH-  477

Query  854   DLQEVDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLM  1033
               Q+ D +  E     GTL + S   T   +   + S FLIRGK Y +D +K+ AK+ +M
Sbjct  478   --QDDDEDGIELLAREGTLPKSSGCCTTSCYESAEASIFLIRGKHYLQDRKKVVAKDPVM  535

Query  1034  QMVAADWLKSDRRQDDLAGRPGGIVQKHAADDRP-------EFFLIVNIQVPGSTTYSLA  1192
             Q VAADWLKS++R+D LA RP   VQ+  A+ R         FF I+NIQVPGSTTYSLA
Sbjct  536   QFVAADWLKSNKREDHLASRPSNPVQQFLANQRKIEGRVQDPFFFIINIQVPGSTTYSLA  595

Query  1193  LYYMLKAPLEDTPLLERFVNGDDAFRNSRFKLIPYISK  1306
             LYYM+  PL D  +LE FV GDD  RN+ FKLIP+I+K
Sbjct  596   LYYMITQPLSDFLILENFVRGDDRHRNASFKLIPHIAK  633


 Score = 53.1 bits (126),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G WIVKQSVGK ACLIG+ALE+ Y   KNY+
Sbjct  633   KGPWIVKQSVGKTACLIGEALEITYHTDKNYI  664



>ref|XP_002961222.1| hypothetical protein SELMODRAFT_74418 [Selaginella moellendorffii]
 gb|EFJ38761.1| hypothetical protein SELMODRAFT_74418 [Selaginella moellendorffii]
Length=711

 Score =   312 bits (800),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 192/442 (43%), Positives = 262/442 (59%), Gaps = 19/442 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+    E+VF T+M+LG SRSEWDFC+  G ++E +DGHTDI+H QL   W
Sbjct  188   DHPAIMAVGVVKAPCESVFDTVMALGDSRSEWDFCYSTGRIVERIDGHTDIVHKQLRRKW  247

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPI---  352
             LP  M  RDLL  RYWRRE DG+YVILY SV  + CP +   +RA LKSGG+VI+P+   
Sbjct  248   LPGHMRGRDLLFHRYWRREYDGSYVILYRSVSRKDCPTRSGTVRANLKSGGYVISPLTGE  307

Query  353   -KLGKASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHS-SNLS  526
              +    S+V+HML +DW  WKSH K +  + IT+RML  +A LRE+++AK    +  + S
Sbjct  308   GEQPARSLVRHMLEIDWNTWKSHFKPSRVQKITLRMLERIAGLRELYKAKVIEPTWVDAS  367

Query  527   FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEP  706
                 +     E    EE        +P          + E  S + +    DEF+D  + 
Sbjct  368   GEFDDQAAKEEKEENEERAIVVSDQEPKSAH------IDEQESFLRVND-TDEFFDAPDD  420

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESE  886
             SD +D   +   S +  E   +  + +  S  + +K+ H LA   +      E  S ++E
Sbjct  421   SDQEDLPDDMLRSVSETE-GTEEFEPETKSTASFVKRIHALAAAAQPQT---EFSSRDAE  476

Query  887   PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSD  1066
                  GTL + S Y   CSW+  DPS+FLIRGK Y +D++K+KAK TLMQ+VA DW  S+
Sbjct  477   LLDREGTLPKSSFY---CSWSAADPSTFLIRGKNYLRDNKKVKAKETLMQLVAVDWFTSN  533

Query  1067  RRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERF  1246
             +R+D +A R    +Q         FF IVN+QVPGSTTYSL  YYMLK  L+  PLLE+F
Sbjct  534   QREDHIASRENTFMQPKVRKLARSFFFIVNLQVPGSTTYSLVFYYMLKQSLDQIPLLEKF  593

Query  1247  VNGDDAFRNSRFKLIPYISKVS  1312
             VNG D FR+S FKLIP++++ S
Sbjct  594   VNGGDRFRSSTFKLIPHVAEGS  615


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGK ACLIG+AL+++YF GKNYL
Sbjct  613   EGSWIVKQSVGKTACLIGEALDLHYFHGKNYL  644



>gb|EMT33197.1| hypothetical protein F775_21642 [Aegilops tauschii]
Length=683

 Score =   308 bits (788),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 259/448 (58%), Gaps = 91/448 (20%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+D  SE +F+TLMSLG SRSE                             
Sbjct  221   DHPAIMAVGVVDANSEDIFQTLMSLGQSRSE-----------------------------  251

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
                GM +RDLLLRRYWRREDDGTYVILYHSV H +C P+K YIRACLKSGG+VI+P+  G
Sbjct  252   ---GMRKRDLLLRRYWRREDDGTYVILYHSVFHNRCSPEKGYIRACLKSGGYVISPVSQG  308

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             + SVVKHMLA+DWK WKS+L  +S++ ITI        LRE+FRAK GN +  + FS  E
Sbjct  309   RQSVVKHMLAIDWKFWKSYLLTSSAKYITI-------PLRELFRAKNGNCAC-MEFSSGE  360

Query  542   MTIDieapigeeerreegaVDPTRCE----------DGMEELLSEPSSLVGLESACDEFY  691
             +  D+  P G  ER +        CE           G    LS   SLV L  A DEF+
Sbjct  361   LMRDMGLPQGGNERTKIEMQSANECERLEGPVEGPQGGSNRHLSSTGSLVQLNDATDEFF  420

Query  692   DVLEPSddddeegegWSSATSPEFCVD-ANQQKISSATTLMKKFHDLAVQKKGYVDLQEV  868
             DV + S+ D  E   WSS  S        +  K++S  T  +K +D+             
Sbjct  421   DVPDESEYDQREAM-WSSDESTHAARRRQDDTKLTSGNT-SQKTNDML------------  466

Query  869   DSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
                               NY    S  G    S +I     ++  + IKA+NTLMQMV A
Sbjct  467   ------------------NYPVLLSLYG----SCMI----LQEIRDPIKAENTLMQMVGA  500

Query  1049  DWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             DW+KSD+R+DDLAGRPGG+VQK+AA    +FF IVNIQVPGSTTYSLALYYM+  PLE  
Sbjct  501   DWIKSDKREDDLAGRPGGLVQKYAAQGGSKFFFIVNIQVPGSTTYSLALYYMMDTPLEKV  560

Query  1229  PLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             PLLERFVNGDD FRNSRFKLIPYISK S
Sbjct  561   PLLERFVNGDDTFRNSRFKLIPYISKGS  588


 Score = 63.9 bits (154),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  586   KGSWIVKQSVGKKACLVGQALEINYFRGSNYL  617



>ref|XP_002969204.1| hypothetical protein SELMODRAFT_146206 [Selaginella moellendorffii]
 gb|EFJ29292.1| hypothetical protein SELMODRAFT_146206 [Selaginella moellendorffii]
Length=722

 Score =   302 bits (774),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 190/443 (43%), Positives = 260/443 (59%), Gaps = 16/443 (4%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             DH +IMAVGV+    E+VF T+M+LG SR+EWDFC+  G ++E +DGHTDI+H QL   W
Sbjct  194   DHPAIMAVGVVKAPCESVFDTVMALGDSRAEWDFCYSTGRIVERIDGHTDIVHKQLRRKW  253

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPI---  352
             LP  M  RDLL  RYWRRE DG+YVILY SV  + CP +   +RA LKSGG+VI+P+   
Sbjct  254   LPGHMRGRDLLFHRYWRREYDGSYVILYRSVSRKDCPTRSGTVRAKLKSGGYVISPLTGE  313

Query  353   -KLGKASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHS-SNLS  526
              +    S+V+HML +DW  WKSH K +  + IT+RML  +A LRE+++AK    +  + S
Sbjct  314   GEQPARSLVRHMLEIDWNTWKSHFKPSRVQKITLRMLERIAGLRELYKAKVIEPTWVDAS  373

Query  527   FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEP  706
                 +     E    EE        +P          + E  S + +    DEF+D  + 
Sbjct  374   REFDDQAAKEEKEENEERAIVVSDQEPKSAH------IDEQESFLRVND-TDEFFDAPDD  426

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQ-EVDSEES  883
             SD +D   +   S +  E   +   +  S+A+ + +     A   K     Q E  S ++
Sbjct  427   SDQEDLPDDMLRSVSETEGTEEFEPETKSTASFVKRIHALAAAAHKKGAQPQTEFSSRDA  486

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
             E     GTL + S Y   CSW+  DPS+FLIRGK Y +D++K+KAK TLMQ+VA DW  S
Sbjct  487   ELLDREGTLPKSSFY---CSWSAADPSTFLIRGKNYLRDNKKVKAKETLMQLVAVDWFTS  543

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
             ++R+D +A R    +Q         FF IVN+QVPGS TYSL  YYMLK  L+  PLLE+
Sbjct  544   NQREDHIASRENTFMQPKVRKLGRSFFFIVNLQVPGSPTYSLVFYYMLKQSLDQIPLLEK  603

Query  1244  FVNGDDAFRNSRFKLIPYISKVS  1312
             FVNG D FR+S FKLIP++++ S
Sbjct  604   FVNGGDRFRSSTFKLIPHVAEGS  626


 Score = 60.5 bits (145),  Expect(2) = 1e-90, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGK ACLIG+AL+++YF GKNYL
Sbjct  624   EGSWIVKQSVGKTACLIGEALDLHYFHGKNYL  655



>ref|XP_006415101.1| hypothetical protein EUTSA_v10008155mg [Eutrema salsugineum]
 gb|ESQ33454.1| hypothetical protein EUTSA_v10008155mg [Eutrema salsugineum]
Length=333

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 171/232 (74%), Gaps = 1/232 (0%)
 Frame = +2

Query  620   DGMEELLSEPSSLVGLESACDEFYDVLEPSddddeegegWSSATSPEFCVDANQQKISSA  799
             D  ++  SE SSLV L    DEF+DV EPSD+D  +    S   S  +  ++ Q K++SA
Sbjct  8     DERDKFPSERSSLVDLNDGVDEFFDVPEPSDNDPLDESWTSDYDSDTYSQESRQPKLNSA  67

Query  800   TTLMKKFHDLAVQKKGYVDLQEVDSEESE-PCCYGGTLQQDSNYSTPCSWAGGDPSSFLI  976
             T+L+KK HDLAVQK+GYVDL E   EES  PCCYG TL  D   + PCSW   DPS+FLI
Sbjct  68    TSLVKKLHDLAVQKRGYVDLHEKAREESSTPCCYGTTLPTDPTCALPCSWTTTDPSTFLI  127

Query  977   RGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVN  1156
             RGK Y  D +K+KAK TLM+MVAADWLKSD+R+DDL  RPGGIVQK+AA   PEFF IVN
Sbjct  128   RGKTYLSDQKKVKAKGTLMEMVAADWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVN  187

Query  1157  IQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             IQVPGSTTYSL LYYM+  P+E+ PLL  FVNGDDA+RNSRFKLIPYISK S
Sbjct  188   IQVPGSTTYSLVLYYMMSTPIEEHPLLVSFVNGDDAYRNSRFKLIPYISKGS  239


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  237   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  268



>ref|XP_001755631.1| predicted protein [Physcomitrella patens]
 gb|EDQ79691.1| predicted protein [Physcomitrella patens]
Length=731

 Score =   296 bits (759),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 192/453 (42%), Positives = 275/453 (61%), Gaps = 25/453 (6%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             D  ++M+VGV+  T E+VF T+M+LG SR+EWDFC+ +G VIEH+DGH+DI+H   +  W
Sbjct  193   DPPALMSVGVVHATCESVFETVMALGSSRAEWDFCYLKGRVIEHIDGHSDIVHKHFHKFW  252

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             L   M  RDL++ RYWRREDDG+YVILY SV H+KCPP++ ++RA LKSGG+VI+P+   
Sbjct  253   LSSRMKPRDLVVHRYWRREDDGSYVILYTSVNHEKCPPRRKFVRAWLKSGGYVISPLPTQ  312

Query  362   KA----SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNH-SSNLS  526
                    +VKH+L VDWK WKS       + IT+++L  VAAL+E ++ K  ++  S++ 
Sbjct  313   GGYPNRCMVKHILTVDWKNWKSCWSPCRDKDITLKVLERVAALKEFYKIKPSDYMPSSMG  372

Query  527   FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSL---VGLESACDEFYDV  697
              ++ +          +    ++  + P    D     L E  ++   +  + A DEF+DV
Sbjct  373   PNVRQ------PARCKLPVAQKENILPIHLNDDAAAFLLEEKNVGKSMFQQLAEDEFFDV  426

Query  698   LEPSd---dddeegegWSSATSPEFCVDANQQKIS--SATTLMKKFHDLAVQKKGYVDLQ  862
              E S    + D + +G    T  E   D ++ + S      L+      A QK+ Y   Q
Sbjct  427   PEDSAWDLELDRDLDGQQQNTDLEETSDEDKVRQSGFGFDRLIALDMPFAAQKRTY---Q  483

Query  863   EVDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMV  1042
             + D ++ +     GTL + S+  T   +   + S+FLIRGK Y +D +K+ AK+ +MQ V
Sbjct  484   DTDQDDIDLLTREGTLPKISSSGTTSCYQSAEASTFLIRGKHYLQDRKKVVAKDPVMQFV  543

Query  1043  AADWLKSDRRQDDLAGRPGGIVQKHAADD---RPEFFLIVNIQVPGSTTYSLALYYMLKA  1213
             AADWLKS++R+D LA RP   VQ   A+       FF I+NIQVPGSTTYSLALYYM+  
Sbjct  544   AADWLKSNKREDHLANRPSYPVQLFLANQGRVDDAFFFIINIQVPGSTTYSLALYYMITQ  603

Query  1214  PLEDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             PL D PLLE FV+GDD +RN+ FKLIP+I+K S
Sbjct  604   PLSDFPLLENFVHGDDRYRNAGFKLIPHIAKGS  636


 Score = 58.2 bits (139),  Expect(2) = 3e-88, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGK ACLIG+ALE+ Y  GKNY+
Sbjct  634   KGSWIVKQSVGKTACLIGEALEITYHSGKNYI  665



>ref|XP_001764317.1| predicted protein [Physcomitrella patens]
 gb|EDQ70871.1| predicted protein [Physcomitrella patens]
Length=707

 Score =   296 bits (758),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 183/446 (41%), Positives = 263/446 (59%), Gaps = 35/446 (8%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             D  ++MAVGV+  + E+VF ++MSLG SR EWDFC+ +G VIEH+DGH+DI+H QL+ +W
Sbjct  189   DPPALMAVGVVQASCESVFESVMSLGSSRVEWDFCYSKGRVIEHIDGHSDIVHKQLHKYW  248

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIK--  355
             LPW M  RDLL+ RYWRREDDG+YVILY SV H++CPP++ ++RA +KSGG+VI+P+   
Sbjct  249   LPWRMKPRDLLVHRYWRREDDGSYVILYKSVNHERCPPRRKFVRAWIKSGGYVISPLPPQ  308

Query  356   --LGKASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSF  529
                     VKH+L VDWK +        +R IT+R+L  V+AL E ++ K  ++   +  
Sbjct  309   GGFPYRCAVKHILTVDWKHFNMRWSHCRNRDITLRVLERVSALSEFYKVKPADY---MPI  365

Query  530   SLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVG----LESACDEFYDV  697
             S+ +    +     + +  ++  +      D  E   S+ ++  G     + A DEF+DV
Sbjct  366   SIGQDLRRLNLTGCKFQVSQKQNISSVHLTDD-EVSHSQGNNTAGQSMFRQLAEDEFFDV  424

Query  698   LEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSE  877
              E S         W +   P+             +  +++ H            Q+   +
Sbjct  425   PEDS--------AWDTELEPDLDGQRKSADPEETSDEVQRMH------------QDTVED  464

Query  878   ESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
               E     GTL + S   T   +   + S FL+RGK Y  D +K+ A++ +MQ VAADWL
Sbjct  465   GIELMVRAGTLPKSSCSCTTSCYESAEASVFLVRGKHYLHDRKKVVAEDPVMQFVAADWL  524

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDR--PE-FFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             KS++R+D LA RP   +QK  A+    P+ FF IVNIQVPGSTTYSLALYYM+ +PL D 
Sbjct  525   KSNKREDHLASRPSHPIQKFLANQGRVPDPFFFIVNIQVPGSTTYSLALYYMITSPLSDF  584

Query  1229  PLLERFVNGDDAFRNSRFKLIPYISK  1306
             P+LE FV+GDD  RN+ FKLIP+I+K
Sbjct  585   PILENFVSGDDRHRNASFKLIPHIAK  610



>ref|XP_001767644.1| predicted protein [Physcomitrella patens]
 gb|EDQ67603.1| predicted protein [Physcomitrella patens]
Length=712

 Score =   296 bits (757),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 181/449 (40%), Positives = 259/449 (58%), Gaps = 46/449 (10%)
 Frame = +2

Query  2     DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
             D  ++MAVGV+D T  +VF T M+LG SR+EWDFCF +G VIE++ GHTDIIH Q ++ W
Sbjct  198   DIPTLMAVGVVDATPASVFETAMALGRSRAEWDFCFHQGRVIENVHGHTDIIHEQFHSRW  257

Query  182   LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
             LPW M  RDL+ +RYWRR+DDGTYVILY+S+ H+KCPP + + RA L SGG VI+P+K  
Sbjct  258   LPWRMKPRDLVFQRYWRRDDDGTYVILYNSINHEKCPPGRKFTRAWLHSGGFVISPLKGR  317

Query  362   KASV----VKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSF  529
             K  V    VKH++ VDWK W+   +++ +R +++ ML  +AA+RE+++ KE         
Sbjct  318   KDKVKWCMVKHIMKVDWKGWEFLWRKSRNRDMSLIMLERIAAIRELYKVKEK--------  369

Query  530   SLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVG-----LESACDEFYD  694
              +  M  +      +           +  E    + +S   SL       +E A DEF+D
Sbjct  370   PIISMKKEHHQRHEDIFYESAEPKPESEDESSNRDRVSNQPSLKESTSKFIEVADDEFFD  429

Query  695   VLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAV----QKKGYVDLQ  862
               EP+         W     PE      + + SS   + +K H+L V    +     D++
Sbjct  430   AEEPT--------SWERGEDPELKF-YEELEGSSMDEVEQKAHNLPVWSLRKLADEADVE  480

Query  863   EVDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMV  1042
              ++ E S    Y               W   +P +FLIRGK + +DH+K+KA   LMQ+V
Sbjct  481   FMNRESSLGSVY---------------WEPAEPGTFLIRGKHFLRDHKKVKAGTPLMQLV  525

Query  1043  AADWLKSDRRQDDLAGRPGGIVQKHAADDRPE-FFLIVNIQVPGSTTYSLALYYMLKAPL  1219
             AADW KSD+R+D +A   G ++QK  A    + +F+I+N+QVPG+ TYSL LYYM    L
Sbjct  526   AADWFKSDKREDHIAAHDGCVIQKLFAKQVADSYFVIINLQVPGTPTYSLVLYYMTNKRL  585

Query  1220  EDTPLLERFVNGDDAFRNSRFKLIPYISK  1306
             +D PLLE FV GD+ +R  RFKL PY++K
Sbjct  586   QDIPLLENFVRGDNRYRACRFKLCPYVAK  614


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G WIVKQSVGK ACL+G+AL++ YF   NYL
Sbjct  614   KGPWIVKQSVGKSACLVGEALDITYFSSDNYL  645



>gb|EEC67181.1| hypothetical protein OsI_34049 [Oryza sativa Indica Group]
Length=662

 Score =   283 bits (724),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 162/290 (56%), Positives = 193/290 (67%), Gaps = 13/290 (4%)
 Frame = +2

Query  473   ALREMFRAKEGNHSSNLSFSLAEMTIDieapigeeerreegaV---DPTRCED-------  622
             ALRE FRAK GN +  + FS  E+T D+    GE ER +   +   +  R ED       
Sbjct  281   ALREFFRAKNGNCAC-IEFSSGELTRDMRLQQGENERIKIEMLSASENNRLEDPTEGSLG  339

Query  623   GMEELLSEPSSLVGLESACDEFYDVLEPSddddeegegWSSATSPEFCVDANQQKISSAT  802
             G    LS   S + L  A DEF+DV + S+ D  E   W S  S    VD    K+S+A 
Sbjct  340   GSNRHLSSAGSFIQLNDAADEFFDVPDDSEYDQREAM-WPSDESTH-SVDQRHAKLSTAA  397

Query  803   TLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRG  982
               +KK HDLAVQK+GYVDLQ     ++ P CYG TL +DSN + P +WA  DP++FLIRG
Sbjct  398   VFVKKLHDLAVQKRGYVDLQGAADFDNGPFCYGYTLPKDSNCTMPSTWAMTDPTTFLIRG  457

Query  983   KKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQ  1162
             + Y +D  KIKA NTLMQMV ADW+KSD+R+DDLAGRPGG+VQK AA    +FF IVNIQ
Sbjct  458   ESYLQDRLKIKANNTLMQMVGADWIKSDKREDDLAGRPGGLVQKCAAQGGNKFFFIVNIQ  517

Query  1163  VPGSTTYSLALYYMLKAPLEDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             VPGS+TYSLALYYM+  PLE  PLLERFVNGDDAFRNSRFKLIPYISK S
Sbjct  518   VPGSSTYSLALYYMMDTPLEKVPLLERFVNGDDAFRNSRFKLIPYISKGS  567


 Score = 63.9 bits (154),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  565   KGSWIVKQSVGKKACLVGQALEINYFRGSNYL  596



>gb|EEE51149.1| hypothetical protein OsJ_31910 [Oryza sativa Japonica Group]
Length=668

 Score =   282 bits (721),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 161/290 (56%), Positives = 193/290 (67%), Gaps = 13/290 (4%)
 Frame = +2

Query  473   ALREMFRAKEGNHSSNLSFSLAEMTIDieapigeeerreegaV---DPTRCED-------  622
             ALRE FRAK GN +  + FS  E+T D+    GE ER +   +   +  R ED       
Sbjct  287   ALREFFRAKNGNCAC-IEFSSGELTRDMRLQQGENERIKIEMLSASENNRLEDPTEGSLG  345

Query  623   GMEELLSEPSSLVGLESACDEFYDVLEPSddddeegegWSSATSPEFCVDANQQKISSAT  802
             G    LS   S + L  A DEF+DV + S+ D  E   W S  S    VD    K+S+A 
Sbjct  346   GSNRHLSSAGSFIQLNDAADEFFDVPDDSEYDQREAM-WPSDESTH-SVDQRHAKLSTAA  403

Query  803   TLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRG  982
               +KK HDLAVQK+GYVDLQ     ++ P CYG TL +DSN + P +WA  DP++FLIRG
Sbjct  404   VFVKKLHDLAVQKRGYVDLQGAADFDNGPFCYGYTLPKDSNCTMPSTWAMTDPTTFLIRG  463

Query  983   KKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQ  1162
             + Y +D  KIKA NTLMQMV ADW+KSD+R+DDL+GRPGG+VQK AA    +FF IVNIQ
Sbjct  464   ESYLQDRLKIKANNTLMQMVGADWIKSDKREDDLSGRPGGLVQKCAAQGGNKFFFIVNIQ  523

Query  1163  VPGSTTYSLALYYMLKAPLEDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             VPGS+TYSLALYYM+  PLE  PLLERFVNGDDAFRNSRFKLIPYISK S
Sbjct  524   VPGSSTYSLALYYMMDTPLEKVPLLERFVNGDDAFRNSRFKLIPYISKGS  573


 Score = 63.9 bits (154),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G NYL
Sbjct  571   KGSWIVKQSVGKKACLVGQALEINYFRGSNYL  602



>ref|XP_001782866.1| predicted protein [Physcomitrella patens]
 gb|EDQ52321.1| predicted protein [Physcomitrella patens]
Length=729

 Score =   283 bits (723),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 179/456 (39%), Positives = 261/456 (57%), Gaps = 47/456 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++MAVGV+D     VF T+M+LGPSR+EWDFCF +G +I+H+ GH DI+H Q ++ WLPW
Sbjct  204   ALMAVGVVDAIPATVFDTVMALGPSRAEWDFCFHQGQIIDHVHGHMDIVHKQFHSKWLPW  263

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              M  RDL+  RYWRR+DDGTYVILY S+ H KCPP K + RA + SGG+VI+P+    A 
Sbjct  264   RMKPRDLVFERYWRRDDDGTYVILYRSIKHPKCPPSKKFTRAYVLSGGYVISPLTGKNAE  323

Query  368   ---SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLA  538
                S+VKH++ VDW+ +    +++ +R++++ ML  +AA+RE+F+ KE      L     
Sbjct  324   VNRSMVKHIMKVDWRGY--FWRKSRNRNMSLLMLERIAAIRELFKVKE-RPPVPLKTERR  380

Query  539   EMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSddd  718
             E    I      ++       +    +  +EE  S+      L+ A DEF+D  EP    
Sbjct  381   ENEESIFERAQSQQEFANTLSNKLTNQSTLEESESK-----FLQVADDEFFDAEEP----  431

Query  719   deegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYV-DLQEVDSEESEPCC  895
                   W   +  E         +SS         +   + + Y+   Q   S E +   
Sbjct  432   ----LSWKRESQSEL--------MSSDEVEGSSMDEEQYEPRNYIASFQFTCSNEKQYSS  479

Query  896   Y---GGT-----------LQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLM  1033
             +   GGT           ++++S+  T  +W   + S+FLIRGK Y +DH+K+KA   +M
Sbjct  480   FASQGGTRDRTTEGDLEFMKRESSLGT-MTWDTAESSTFLIRGKHYLRDHKKVKAGTPVM  538

Query  1034  QMVAADWLKSDRRQDDLAGRPGGIVQK---HAADDRPEFFLIVNIQVPGSTTYSLALYYM  1204
             Q+VAADW KSDR ++ LA R G ++QK    A      +F+I+N+QVPG+ +YSL LYYM
Sbjct  539   QLVAADWFKSDRSEEHLAARAGCVIQKLFTSAQRVAESYFVIINLQVPGTPSYSLVLYYM  598

Query  1205  LKAPLEDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
                 L+D PLLE FV GDD +RNSRFKL P+++K S
Sbjct  599   ANKLLQDIPLLEGFVRGDDHYRNSRFKLCPHVAKGS  634


 Score = 58.2 bits (139),  Expect(2) = 5e-84, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGK ACL+G+AL++NYF   NYL
Sbjct  632   KGSWIVKQSVGKSACLVGEALDINYFSSDNYL  663



>ref|XP_009345389.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Pyrus 
x bretschneideri]
Length=406

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 202/307 (66%), Gaps = 13/307 (4%)
 Frame = +2

Query  419   LKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAEMTIDieapigeeerreega  598
             L  +S+R ITIR L +VAALRE+FRAK G  +S+  FS  +M+ +I      +       
Sbjct  10    LFHSSARCITIRRLEIVAALRELFRAKAG--TSSPEFSSRDMSGEIRLSQSGQHNIRTEV  67

Query  599   VDPTRCEDGMEELLSEP--------SSLVGLESACDEFYDVLEPSddddeegegWSSATS  754
               P   ++  E +L E         +SL GL  A DEF+DV EP++ D  E E W S  S
Sbjct  68    QHPGEVKEMEEGVLVEDEVEKPEGHTSLKGLHDAADEFFDVPEPTEYDQFENE-WPSDMS  126

Query  755   PEFCVDANQQ-KISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYGGTLQQDSNYS  931
              E    + Q  K+SSA  L+K+ H+L VQK+G  DLQEV S+E+    YG TLQ+D + +
Sbjct  127   MEQNPTSIQHPKLSSAAILVKRLHELRVQKRGCTDLQEV-SKENNVFPYGATLQKDPSCA  185

Query  932   TPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDDLAGRPGGIVQ  1111
              PCSW   DPSSFLIRG  Y +  +KIKAK+TLMQ+V  DWL+SD+R+DD++ R G IVQ
Sbjct  186   LPCSWGSADPSSFLIRGPNYLQHRQKIKAKSTLMQLVGVDWLRSDKREDDISSRYGSIVQ  245

Query  1112  KHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDDAFRNSRFKLI  1291
             K+A     EFF IVN+Q+PG++ ++LA YYM+K PLE+TPLL  FVNGDD++RNSRFKLI
Sbjct  246   KYAERGGSEFFFIVNMQIPGTSMHTLAFYYMMKTPLEETPLLHDFVNGDDSYRNSRFKLI  305

Query  1292  PYISKVS  1312
             PYISK S
Sbjct  306   PYISKES  312


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  1393  SWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             SWIVKQS+GKKACL+GQ LEV+YF+G NYL
Sbjct  312   SWIVKQSLGKKACLVGQRLEVHYFRGMNYL  341



>ref|NP_001131246.1| hypothetical protein [Zea mays]
 gb|ACF79576.1| unknown [Zea mays]
Length=287

 Score =   261 bits (666),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = +2

Query  770   DANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYGGTLQQDSNYSTPCSWA  949
             D    K+S+A   +K+ HDLAVQK+GY+DLQ     ++ PCCYG TL +DS+Y+ P +WA
Sbjct  12    DQRHAKLSTAAVFVKRLHDLAVQKRGYIDLQGAADADNGPCCYGYTLPKDSSYTVPSTWA  71

Query  950   GGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDDLAGRPGGIVQKHAADD  1129
               DP++FLIRG+ Y  D  KIKA +TLMQMV ADW+KSD+R+DDLAGRPGG+VQK AA  
Sbjct  72    MTDPTTFLIRGETYLHDRIKIKANSTLMQMVGADWIKSDKREDDLAGRPGGLVQKCAAQG  131

Query  1130  RPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDDAFRNSRFKLIPYISKV  1309
                FF IVNIQVPGSTTYSLALYYM+  PLE  PLLERFVNGDDAFRNSRFKLIPYISK 
Sbjct  132   GTRFFFIVNIQVPGSTTYSLALYYMMDTPLEKVPLLERFVNGDDAFRNSRFKLIPYISKG  191

Query  1310  S  1312
             S
Sbjct  192   S  192


 Score = 65.1 bits (157),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACL+GQALE+NYF+G+NYL
Sbjct  190   KGSWIVKQSVGKKACLVGQALEINYFRGRNYL  221



>ref|XP_008362690.1| PREDICTED: LOW QUALITY PROTEIN: protein ENHANCED DISEASE RESISTANCE 
2-like, partial [Malus domestica]
Length=480

 Score =   264 bits (674),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 158/283 (56%), Positives = 203/283 (72%), Gaps = 10/283 (4%)
 Frame = +2

Query  2    DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
            DH +IMAVGV+D TSEA+FRTL+SLGPSRSEWDFC+ +GSV+E LDGHTDIIH QLY+ W
Sbjct  200  DHPAIMAVGVVDGTSEAIFRTLLSLGPSRSEWDFCYYQGSVVERLDGHTDIIHQQLYSDW  259

Query  182  LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
            LPWGM RRDLL+RRYWRREDDGTYVILYHSV H+KCPP++ Y+RACLKSGG VITP   G
Sbjct  260  LPWGMQRRDLLIRRYWRREDDGTYVILYHSVSHKKCPPKRGYVRACLKSGGFVITPANQG  319

Query  362  KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
            K S+V+HMLA+DWK WK +L+ +S+R ITIRML  VAALRE+F AK G  +S+  F   +
Sbjct  320  KQSLVRHMLAIDWKFWKLYLRPSSARCITIRMLERVAALRELFGAKAG--TSSPEFXSGD  377

Query  542  MTIDieapigeeerreegaVDP---TRCEDG--MEELLSEP---SSLVGLESACDEFYDV  697
            M+ +I+     ++  +     P    + E+G  +E+ + +P   +SL GL  A DEF+DV
Sbjct  378  MSSEIKFSQSGQQNIKTEVQHPGEVXKMEEGVLVEDEVEKPEGRASLKGLHDAADEFFDV  437

Query  698  LEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHD  826
             EP++ D  E E  S  +  +        K+SSA  L+KK H+
Sbjct  438  PEPTEYDQFENEWPSDVSMEQNPTSIQHHKLSSAAVLVKKLHE  480



>gb|KDO44678.1| hypothetical protein CISIN_1g0045761mg, partial [Citrus sinensis]
Length=275

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +2

Query  773   ANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYGGTLQQDSNYSTPCSWAG  952
             A Q K++SA   +KK HDLAV KKG  DLQEV +E+ +   YG TLQ DS++++PCSWA 
Sbjct  2     APQSKLASAAGFVKKLHDLAVHKKGCTDLQEVPNEDEKSWSYGATLQTDSSFTSPCSWAA  61

Query  953   GDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDDLAGRPGGIVQKHAADDR  1132
              DPS+FLIRG+ Y KDH KIKA  TLMQM+ ADWL+S++R+D+LA RP  +VQK+AA   
Sbjct  62    ADPSTFLIRGENYLKDHRKIKADGTLMQMIGADWLRSNKREDNLAARPCSLVQKYAAGGG  121

Query  1133  PEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             PEFF +VNIQ PG+T Y+LALYY++K PLED PLL +FVNGDDAFRNSRFKLIPYISK S
Sbjct  122   PEFFFVVNIQFPGTTKYTLALYYVIKTPLEDNPLLHKFVNGDDAFRNSRFKLIPYISKGS  181


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGK ACL+G+ALEVNY++G+NYL
Sbjct  179   KGSWIVKQSVGKTACLLGRALEVNYYRGRNYL  210



>emb|CDY64695.1| BnaA04g27680D [Brassica napus]
Length=318

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 159/229 (69%), Gaps = 4/229 (2%)
 Frame = +2

Query  626   MEELLSEPSSLVGLESACDEFYDVLEPSddddeegegWSSATSPEFCVDANQQKISSATT  805
             ME+  S  +SL+ L  A DEF+DV EP++  + +    S   +  F    +Q K+ S + 
Sbjct  1     MEKPSSARNSLMDLNDASDEFFDVPEPNESYEFD----SLIDNSPFSQGHSQLKLPSPSG  56

Query  806   LMKKFHDLAVQKKGYVDLQEVDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGK  985
             ++KK  DLA  KKGY+DLQEV  + +    YG TLQQD N + PCSW+  DPS+FLIRG 
Sbjct  57    IVKKLQDLANNKKGYMDLQEVGMDVNSTFIYGATLQQDPNLTMPCSWSIADPSTFLIRGD  116

Query  986   KYKKDHEKIKAKNTLMQMVAADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQV  1165
              Y  D +K+KA  T+MQMV ADW+ SD+R+DDL GR GG+VQ+ AA   PEFF IVN+QV
Sbjct  117   NYLNDQQKVKANGTMMQMVGADWISSDKREDDLGGRLGGLVQEFAAKGGPEFFFIVNMQV  176

Query  1166  PGSTTYSLALYYMLKAPLEDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             PGS   SLALYYMLK PLE+ PLL  FVNGDDA+RNSRFKLIP+ISK S
Sbjct  177   PGSAMISLALYYMLKTPLEEHPLLHSFVNGDDAYRNSRFKLIPHISKGS  225


 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  1372  VCGFRQGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +    +GSWIVKQSVGKKACL+G ALEV Y +GKNYL
Sbjct  218   IPHISKGSWIVKQSVGKKACLVGHALEVRYTRGKNYL  254



>gb|KDO44676.1| hypothetical protein CISIN_1g0045762mg, partial [Citrus sinensis]
 gb|KDO44677.1| hypothetical protein CISIN_1g0045762mg, partial [Citrus sinensis]
Length=469

 Score =   253 bits (646),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 153/269 (57%), Positives = 180/269 (67%), Gaps = 17/269 (6%)
 Frame = +2

Query  2    DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
            DH +IMAVGV+D TSEA+F+TLMSLG SRSEWDFCF RG V+EHLDGH+D++H  LY+ W
Sbjct  200  DHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCVVEHLDGHSDVVHKLLYSDW  259

Query  182  LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
            LPWGM RRDLL+RRYWRREDDGTYVILYHSV H+KCP QK Y+RACLKSGG VITP   G
Sbjct  260  LPWGMQRRDLLVRRYWRREDDGTYVILYHSVNHKKCPKQKGYVRACLKSGGFVITPSNQG  319

Query  362  KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
            K S+VKHMLAVDWK WK +L+ +S+RSITIRML  VAALRE+F+AK GN SS      + 
Sbjct  320  KQSIVKHMLAVDWKYWKLYLRPSSARSITIRMLERVAALRELFQAKAGNTSSEFLSRGST  379

Query  542  MTIDieapigeeerreegaVDPTRCE-DGMEELL--------------SEPSSLVGLESA  676
              I         E  +    + T  E   MEE+               S  +SL+G+  A
Sbjct  380  REIKASQDSELSEDIQLKNEEDTEIEIQKMEEIRKTEKDAPFTEEKPSSGRASLMGINDA  439

Query  677  CDEFYDVLEPSddddeegegWSSATSPEF  763
             DEF+DV  P    D     WS   SPE 
Sbjct  440  SDEFFDV--PEAYSDHMENDWSLEVSPEL  466



>gb|AAM98241.1| unknown protein [Arabidopsis thaliana]
 gb|AAP13416.1| At2g28320 [Arabidopsis thaliana]
Length=277

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 179/271 (66%), Gaps = 16/271 (6%)
 Frame = +2

Query  383   MLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFS----LAEMTI  550
             MLAVDWK W+S++K + +RSIT++MLG ++ALRE+FRAK G+   NLS       A +T 
Sbjct  1     MLAVDWKSWRSYVKPSLARSITVKMLGRISALRELFRAKHGSFPPNLSSGELSRSARLTQ  60

Query  551   DieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSddddeeg  730
             + +   G+   RE      T  E+  ++  SE SSLV L    DEF+DV EPSD+D+ + 
Sbjct  61    NEDGVFGDSSLRENEMFKDTANEE-RDKFPSERSSLVDL----DEFFDVPEPSDNDNLDD  115

Query  731   egWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEP-------  889
                S       C ++ Q K++SAT+L+KK HDLAVQK+GYVDL E   EES P       
Sbjct  116   SWTSDFDLDTCCQESRQPKLNSATSLVKKLHDLAVQKRGYVDLHERAKEESSPHATCNPP  175

Query  890   CCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDR  1069
             CCYG TL  D +   PCSW   DPS+FLIRGK Y  D +K+KAK TLM+MVAADWLKSD+
Sbjct  176   CCYGTTLPTDPSCDLPCSWTTTDPSTFLIRGKTYLDDQKKVKAKGTLMEMVAADWLKSDK  235

Query  1070  RQDDLAGRPGGIVQKHAADDRPEFFLIVNIQ  1162
             R+DDL  RPGGIVQK+AA   PEFF IVNIQ
Sbjct  236   REDDLGSRPGGIVQKYAAKGGPEFFFIVNIQ  266



>emb|CDY69875.1| BnaAnng31850D, partial [Brassica napus]
Length=462

 Score =   243 bits (621),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 180/239 (75%), Gaps = 4/239 (2%)
 Frame = +2

Query  2    DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
            DH +IMAVGVID TSE +F TLMSLGP RSEWDFCF +G+V+EHLDGHTDI+++QLY+ W
Sbjct  198  DHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEWDFCFYKGTVVEHLDGHTDIVNIQLYSDW  257

Query  182  LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
            LPW MNRRD+LLRRYWRRE+DGTYVIL HSV H+KCPP K Y+RAC+KSGG+V+TP+  G
Sbjct  258  LPWLMNRRDVLLRRYWRREEDGTYVILCHSVYHKKCPPTKGYVRACIKSGGYVVTPVSKG  317

Query  362  KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL---SFS  532
            K S+VKHM+A+DW+ W  +++ +S RSITIR++  +AALREMF+AK+G+  +      F 
Sbjct  318  KQSLVKHMVAIDWRSWNLYMRPSSERSITIRVVERLAALREMFKAKQGHGFAEFVSGEFM  377

Query  533  LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPS  709
              + ++     +  ++  +   ++  + E+ ME+  S  +SL+ L  A DEF+DV EP+
Sbjct  378  QTKSSLSKINTLPFKKEAKRIDLELVKVEE-MEKPSSARNSLMDLNDASDEFFDVPEPN  435



>dbj|BAD94447.1| hypothetical protein [Arabidopsis thaliana]
Length=247

 Score =   221 bits (564),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +2

Query  887   PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSD  1066
             PCCYG TL  D +   PCSW   DPS+FLIRGK Y  D +K+KAK TLM+MVAADWLKSD
Sbjct  12    PCCYGTTLPTDPSCDLPCSWTTTDPSTFLIRGKTYLDDQKKVKAKGTLMEMVAADWLKSD  71

Query  1067  RRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERF  1246
             +R+DDL  RPGGIVQK+AA   PEFF IVNIQVPGSTTYSL LYYM+  P+E+ PLL  F
Sbjct  72    KREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTYSLVLYYMMSTPIEEHPLLVSF  131

Query  1247  VNGDDAFRNSRFKLIPYISKVS  1312
             VNGDDA+RNSRFKLIPYISK S
Sbjct  132   VNGDDAYRNSRFKLIPYISKGS  153


 Score = 65.1 bits (157),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIVKQSVGKKACLIGQALE+NYF+GKNY+
Sbjct  151   KGSWIVKQSVGKKACLIGQALEINYFRGKNYI  182



>ref|XP_008349774.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Malus 
domestica]
Length=505

 Score =   233 bits (593),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
            DH +IMAVGV+D  SE +F+TLMSLGPSRSEWDFCF +G+V+EHLDGHTDIIH QLY+ W
Sbjct  188  DHPAIMAVGVVDGXSEGIFQTLMSLGPSRSEWDFCFYKGNVVEHLDGHTDIIHKQLYSDW  247

Query  182  LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
            LPWGM RRDLLLRRYWRREDDGTYVILYHSV H++CPPQK Y+RACLKSGG+VITP+  G
Sbjct  248  LPWGMKRRDLLLRRYWRREDDGTYVILYHSVFHKRCPPQKGYVRACLKSGGYVITPVNQG  307

Query  362  KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAAL  478
            K SVVKHMLA+DWK WKS+L+ +S+R++TI+MLG VA +
Sbjct  308  KQSVVKHMLAIDWKFWKSYLQSSSARTMTIKMLGRVAGI  346


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  1381  FRQGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             F QGSWIVKQSVGKKACLIGQALE+NYF GKNY+
Sbjct  373   FPQGSWIVKQSVGKKACLIGQALEINYFHGKNYV  406



>ref|XP_007151874.1| hypothetical protein PHAVU_004G082900g [Phaseolus vulgaris]
 gb|ESW23868.1| hypothetical protein PHAVU_004G082900g [Phaseolus vulgaris]
Length=404

 Score =   208 bits (530),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 139/174 (80%), Gaps = 3/174 (2%)
 Frame = +2

Query  2    DHSSIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHW  181
            +H  +M +GVID TSE +F TLMSLG SRSEWDFC  +GSVI+H+D HTDIIHL+LY+  
Sbjct  191  NHPVMMTIGVIDGTSEDIFHTLMSLGSSRSEWDFCTYQGSVIDHIDDHTDIIHLKLYDDR  250

Query  182  LPWGMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLG  361
            LPWGM  RD LL+RYWRRE DGTYV+L+HSV+H+ CPPQ+DY+RA LKSGG +ITP+K G
Sbjct  251  LPWGMKPRDFLLQRYWRREKDGTYVLLFHSVLHKNCPPQRDYVRASLKSGGFLITPVKNG  310

Query  362  KASVVKHMLAVDWKCWK--SHLKQASSRSITIRMLGVVAALREMFRAKEGNHSS  517
            K+S+VKHMLA+DWK WK   HL  + + S+TI +L  + ALRE FRAK GN SS
Sbjct  311  KSSLVKHMLAIDWKFWKLYPHL-SSGAISLTISLLERLGALREFFRAKVGNFSS  363



>ref|XP_009396700.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Musa acuminata 
subsp. malaccensis]
Length=713

 Score =   198 bits (504),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 144/439 (33%), Positives = 231/439 (53%), Gaps = 43/439 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV+D T  A+F  +MS+  +R EWD  F  G ++E +DGHT +++ +L   W   
Sbjct  212   AMKAVGVVDATCAAIFELIMSMDGTRFEWDCSFQHGDLVEEVDGHTAVLYQRLQLEWCSR  271

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIK---LG  361
              +  RDL   RYWR  DDG+YV+L+ S  H  C PQ  ++RA ++SGG  I+P+K    G
Sbjct  272   IVWPRDLCYVRYWRHNDDGSYVVLFQSREHSNCGPQPGFVRAHMESGGFKISPLKPRNRG  331

Query  362   KASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D + W      +  +   + ML  VA +RE+F   +  H++     +  
Sbjct  332   PRTQVQHLMQIDLRGWFVGYFPSFQQHCLLHMLSSVAGIRELFSQTDEVHTAPRIPIMVS  391

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT D  +               +  E   +E+  +P   V L+     F D   P   D+
Sbjct  392   MTSDSVS---------------SEKEQKTQEISIQPG--VSLDQV---FTDNTHPLILDE  431

Query  722   eegegWSSATSPEFCVDANQQ-KISSATTLMKKFHDLAVQKKGYVDLQEVDSEES-EPCC  895
             +     S        +DA ++ ++ S   + +K           ++  +VD+ +S +  C
Sbjct  432   D-----SDDEEDTHILDAEEEMELGSYCHVFQK----------NIEEMDVDTSDSFDTSC  476

Query  896   YGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQ  1075
             + G L+ D + ++   W   D ++F +R + + KD  KI A   +M++VA DWLK+  R 
Sbjct  477   FSGNLRWDDDENSRDCWRLPDGNNFKVRSENFFKDKSKIPAGKYVMELVAVDWLKNATRM  536

Query  1076  DDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNG  1255
             D++A R G   Q   A ++  F  ++N+Q+PGST YSL  YY +K  LE   LL+RFV+G
Sbjct  537   DNVARRSGCAAQ--VASEKGLFSFVINLQIPGSTHYSLVFYY-VKKQLEPGSLLQRFVDG  593

Query  1256  DDAFRNSRFKLIPYISKVS  1312
             DD FRNSRFKLIP ++K S
Sbjct  594   DDEFRNSRFKLIPSVTKGS  612


 Score = 48.1 bits (113),  Expect(2) = 1e-55, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG  ACL+G+A++  Y +G+ YL
Sbjct  610   KGSWIVRQSVGSTACLLGKAVDCTYVRGEKYL  641



>ref|XP_009396597.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Musa acuminata 
subsp. malaccensis]
Length=702

 Score =   196 bits (497),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 147/437 (34%), Positives = 225/437 (51%), Gaps = 41/437 (9%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV+D T EA+F  +M++  +R EWD  F  GS++E +DGHT I++ +L   W   
Sbjct  203   TMKAVGVVDATCEAIFGLVMTMDGTRFEWDCSFQHGSLVEEVDGHTAILYHRLQLEWFSR  262

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ+ ++RA ++SGG  I+P++     
Sbjct  263   FVWPRDLCYVRYWRRNDDGSYVVLFRSRDHPNCGPQRGFVRAHIESGGFKISPLRSRDGR  322

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+ ++ +D K W      +  +   + ML  VA +RE+F   +  H++N    +  
Sbjct  323   PRTQVQQLMQIDLKGWFVGYFPSFQQHCLLHMLNSVAGIRELFSQTDEIHTANRIPIMVS  382

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT D  +               ++ E   EE+  +P   V L+     F D  +P   D+
Sbjct  383   MTSDSVS---------------SKKEQKTEEISFQPG--VSLDQV---FNDNRQPIILDE  422

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
             +  E   +   PE    A ++  S  T    K  D+ V+    +D            C+ 
Sbjct  423   DSDEDEDNQV-PE----AEEEGSSIKTGNNIKQPDIEVETSDILDTS----------CFS  467

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G L+ D    +   W   D + F +R + + KD  KI A   LM++VA DWLK+ +R D 
Sbjct  468   GNLRWDDGEDSRNCWKIPDGNIFKVRSENFFKDKSKIPAGKYLMELVAVDWLKNTKRMDH  527

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G   Q   A ++  F L++N+Q+PGST YS+  YY +K  L    LL+RF +GDD
Sbjct  528   VAQRTGCAAQ--VASEKGLFTLVINLQIPGSTHYSMVFYY-VKKQLVPGSLLQRFADGDD  584

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSR KLIP + K S
Sbjct  585   EFRNSRLKLIPSVPKGS  601


 Score = 47.0 bits (110),  Expect(2) = 1e-54, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ +Y +G+ YL
Sbjct  599   KGSWIVRQSVGSNPCLLGKAVDCSYIRGEKYL  630



>ref|XP_010278841.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Nelumbo nucifera]
Length=733

 Score =   193 bits (490),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 146/440 (33%), Positives = 225/440 (51%), Gaps = 45/440 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E +F+ +MS+   R EWD  F  GS++E +DGHT +I+ +L   W P 
Sbjct  232   AMKAVGVVEATCEEIFQLIMSMDGRRFEWDCSFQYGSLVEEVDGHTAVIYHRLQLDWFPM  291

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIK--LGK  364
              +  RDL   RYWRR DDG+YV+L+ S  H+ C PQ  ++RA ++SGG  I+P+K   G 
Sbjct  292   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCSPQPGFVRAHVESGGFTISPLKPHCGP  351

Query  365   ASVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAA----LREMFRAKEGNHSSNLSFS  532
              + V++++ +D K W     ++  +   + ML  VAA    LRE F   +  H+  +   
Sbjct  352   RAKVQYLMQIDLKGWGVGYFRSFRKHCLLNMLNSVAAVLTGLREWFSQTDERHTIPMIPV  411

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
             +  MT    +   ++                      EPS L  L    D+ + V   S 
Sbjct  412   MVNMTSGPPSEKVQKN--------------------QEPSILRSL----DKLHSVGRNSM  447

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
               DE      S    EF +  ++Q+  S    ++        K+   +  +  +E+ +  
Sbjct  448   MIDEY-----SDDDEEFQIAESEQEAGSTRQEIEP-------KQTETEADKEPAEQIDMS  495

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
             C+ G L+++ N +    W   D + F +R K +  D  KI A   LM++VA DW K  +R
Sbjct  496   CFSGNLRRNDNDNGRDCWRIPDSNLFKVRSKNFCFDKTKIPAGKYLMELVAVDWFKDTKR  555

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
              D +  R G  VQ   A ++  F L +N+QVPGST YS+  Y+++K  L    LL+RFV+
Sbjct  556   MDHVVRRKGCAVQ--VASEKGFFSLAINLQVPGSTHYSMVFYFVIKQ-LVPGSLLQRFVD  612

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDD FRNSR KLIP + K S
Sbjct  613   GDDEFRNSRLKLIPSVPKGS  632


 Score = 48.1 bits (113),  Expect(2) = 3e-54, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  630   KGSWIVRQSVGSSPCLLGKAVDCNYIRGPKYL  661



>ref|XP_011092598.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Sesamum indicum]
 ref|XP_011092599.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Sesamum indicum]
 ref|XP_011092600.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 [Sesamum indicum]
Length=730

 Score =   192 bits (488),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 140/437 (32%), Positives = 217/437 (50%), Gaps = 42/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ + E +F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  229   AMKAVGVVEASCEEIFELVMSMDATRCEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPT  288

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C PQ  Y+RA ++SGG  I+P+K     
Sbjct  289   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGYVRAHIESGGFNISPLKPHNGR  348

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +   ++ML  VA LRE F   +   ++     +  
Sbjct  349   PRTQVQHLMQIDLKGWGVGYISSFQQYCLLQMLNSVAGLREYFSQTDERTAAPRIPVMVN  408

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT    +     + +       T     ++++ +E  + V ++   DE  D         
Sbjct  409   MTSVSGSSKRSHKLQSASVHHRT---PSLDQIHAENRNAVLMDEYSDEDEDFQ-------  458

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                              A+Q+ + SA  +  K      + K  +D             + 
Sbjct  459   ----------------GADQEALPSAIEVEDKRTAYEEENKDQIDFS----------IFS  492

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G L++D++      W   D ++F +R K++  D  KI A   LM +VA DW K  +R D 
Sbjct  493   GNLRRDAHDKARDCWTLSDGNNFRVRSKRFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDH  552

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G   Q   A DR  F ++ N+QVPGST YS+  Y++ K  L    LL+RFV+GDD
Sbjct  553   VARRRGCAAQ--VASDRGHFSIVFNLQVPGSTHYSMVFYFVSKE-LVPGSLLQRFVDGDD  609

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSR KLIP + K S
Sbjct  610   EFRNSRLKLIPSVPKGS  626


 Score = 48.1 bits (113),  Expect(2) = 7e-54, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  624   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  655



>ref|XP_010906232.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X2 [Elaeis 
guineensis]
Length=723

 Score =   192 bits (488),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 145/437 (33%), Positives = 223/437 (51%), Gaps = 43/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E++F  +MS+  +R EWD  F  GS+++ +DGHT I++ +L   W P 
Sbjct  226   AMQAVGVVEATCESIFELIMSMDGTRFEWDCSFQYGSLVQEVDGHTAILYHRLQLDWFPM  285

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ  ++RA ++SGG  I+P+K     
Sbjct  286   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHPNCGPQPGFVRAHIESGGFNISPLKPRNGR  345

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +   ++ML  VA LRE F   + +H       +  
Sbjct  346   PRTQVQHLMQIDLKGWGVGYFPSFQQHCLLQMLNSVAGLREWFCQTDESHMVPRMPMMVN  405

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT+D  +               ++ +  ++E   +PS LV      D+ +     S   D
Sbjct  406   MTLDSVS---------------SKKKQKIQENSVQPSPLV------DQMHSASRHSVMLD  444

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
             E+ +       PE   +A   K+                + G     E  S++ +   + 
Sbjct  445   EDSDEDEDYQIPELEQEAYSVKL----------------ENGIKQADEEPSDQIDLSGFS  488

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G+L++D    +   W   D S+F +R K +  D  KI A   LM++VA DW K  +R D 
Sbjct  489   GSLRRDDRDKSRDCWRISDGSNFRVRSKHFIYDKTKIPAGKHLMELVAVDWYKDVKRMDH  548

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G  VQ   A ++  F L +N+QVPGST YS+  Y++ K  L    LL+RF +GDD
Sbjct  549   VARRKGCAVQ--VASEKGLFSLAINLQVPGSTHYSMVFYFVTKQ-LVPGSLLQRFADGDD  605

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSRFKLIP + K S
Sbjct  606   EFRNSRFKLIPSVPKGS  622


 Score = 45.4 bits (106),  Expect(2) = 4e-53, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G  YL
Sbjct  620   KGSWIVRQSVGSTPCLLGKAVDCTYIRGPKYL  651



>ref|XP_010906231.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X1 [Elaeis 
guineensis]
Length=725

 Score =   192 bits (487),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 145/437 (33%), Positives = 223/437 (51%), Gaps = 43/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E++F  +MS+  +R EWD  F  GS+++ +DGHT I++ +L   W P 
Sbjct  228   AMQAVGVVEATCESIFELIMSMDGTRFEWDCSFQYGSLVQEVDGHTAILYHRLQLDWFPM  287

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ  ++RA ++SGG  I+P+K     
Sbjct  288   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHPNCGPQPGFVRAHIESGGFNISPLKPRNGR  347

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +   ++ML  VA LRE F   + +H       +  
Sbjct  348   PRTQVQHLMQIDLKGWGVGYFPSFQQHCLLQMLNSVAGLREWFCQTDESHMVPRMPMMVN  407

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT+D  +               ++ +  ++E   +PS LV      D+ +     S   D
Sbjct  408   MTLDSVS---------------SKKKQKIQENSVQPSPLV------DQMHSASRHSVMLD  446

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
             E+ +       PE   +A   K+                + G     E  S++ +   + 
Sbjct  447   EDSDEDEDYQIPELEQEAYSVKL----------------ENGIKQADEEPSDQIDLSGFS  490

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G+L++D    +   W   D S+F +R K +  D  KI A   LM++VA DW K  +R D 
Sbjct  491   GSLRRDDRDKSRDCWRISDGSNFRVRSKHFIYDKTKIPAGKHLMELVAVDWYKDVKRMDH  550

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G  VQ   A ++  F L +N+QVPGST YS+  Y++ K  L    LL+RF +GDD
Sbjct  551   VARRKGCAVQ--VASEKGLFSLAINLQVPGSTHYSMVFYFVTKQ-LVPGSLLQRFADGDD  607

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSRFKLIP + K S
Sbjct  608   EFRNSRFKLIPSVPKGS  624


 Score = 45.4 bits (106),  Expect(2) = 5e-53, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G  YL
Sbjct  622   KGSWIVRQSVGSTPCLLGKAVDCTYIRGPKYL  653



>ref|XP_009776802.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Nicotiana sylvestris]
Length=706

 Score =   189 bits (481),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 146/445 (33%), Positives = 218/445 (49%), Gaps = 59/445 (13%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ + E +F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  210   AMKAVGVVEASCEDIFELVMSMDATRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPA  269

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C P   Y+RA ++SGG  I+P+K     
Sbjct  270   LVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPLPGYVRAHIESGGFNISPLKPLNGR  329

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +   ++ML  VA LRE F   +   ++     +  
Sbjct  330   PRTQVQHLMQIDLKGWGVGYISSFQQHCLLQMLNSVAGLREYFSQADERTAAPRIPVMVN  389

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESA------CDEFYDVLE  703
             MT                +V   R +   E L     SL  + +A       DE+ D  E
Sbjct  390   MT--------------SASVSSKRSQKFQETLHHRTRSLDQIRAANRNASMMDEYSDEEE  435

Query  704   PSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
                               +F     +    S    MKK             L+E  S++ 
Sbjct  436   ------------------DFQGADQEVMPPSPEHEMKK-----------TALEEEPSDQI  466

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
             +   + G L++D +      W   D ++F +R K +  D  KI A   LM +VA DW K 
Sbjct  467   DFSIFSGNLRRDDSDKGRNCWRISDGNNFRVRSKNFCYDKSKIAAGKPLMDLVAVDWFKD  526

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP--LL  1237
              +R D +A RPG   Q   A ++  F L++N+QVPGST YS+  Y+++K   E TP  L 
Sbjct  527   TKRMDHVAKRPGCAAQ--VAAEKGLFSLVINVQVPGSTHYSMVFYFVMK---ELTPGSLF  581

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
             +RFV+GDD FRNSR KLIP + K S
Sbjct  582   QRFVDGDDEFRNSRMKLIPSVPKGS  606


 Score = 47.0 bits (110),  Expect(2) = 8e-53, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   C++G+A++ NY +G  YL
Sbjct  604   KGSWIVRQSVGSTPCILGKAVDCNYIRGPKYL  635



>ref|XP_009776801.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Nicotiana sylvestris]
Length=724

 Score =   189 bits (481),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 146/445 (33%), Positives = 218/445 (49%), Gaps = 59/445 (13%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ + E +F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  228   AMKAVGVVEASCEDIFELVMSMDATRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPA  287

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C P   Y+RA ++SGG  I+P+K     
Sbjct  288   LVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPLPGYVRAHIESGGFNISPLKPLNGR  347

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +   ++ML  VA LRE F   +   ++     +  
Sbjct  348   PRTQVQHLMQIDLKGWGVGYISSFQQHCLLQMLNSVAGLREYFSQADERTAAPRIPVMVN  407

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESA------CDEFYDVLE  703
             MT                +V   R +   E L     SL  + +A       DE+ D  E
Sbjct  408   MT--------------SASVSSKRSQKFQETLHHRTRSLDQIRAANRNASMMDEYSDEEE  453

Query  704   PSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
                               +F     +    S    MKK             L+E  S++ 
Sbjct  454   ------------------DFQGADQEVMPPSPEHEMKK-----------TALEEEPSDQI  484

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
             +   + G L++D +      W   D ++F +R K +  D  KI A   LM +VA DW K 
Sbjct  485   DFSIFSGNLRRDDSDKGRNCWRISDGNNFRVRSKNFCYDKSKIAAGKPLMDLVAVDWFKD  544

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP--LL  1237
              +R D +A RPG   Q   A ++  F L++N+QVPGST YS+  Y+++K   E TP  L 
Sbjct  545   TKRMDHVAKRPGCAAQ--VAAEKGLFSLVINVQVPGSTHYSMVFYFVMK---ELTPGSLF  599

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
             +RFV+GDD FRNSR KLIP + K S
Sbjct  600   QRFVDGDDEFRNSRMKLIPSVPKGS  624


 Score = 47.0 bits (110),  Expect(2) = 9e-53, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   C++G+A++ NY +G  YL
Sbjct  622   KGSWIVRQSVGSTPCILGKAVDCNYIRGPKYL  653



>emb|CAN74297.1| hypothetical protein VITISV_018694 [Vitis vinifera]
Length=203

 Score =   170 bits (430),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = +2

Query  989   YKKDHEKIKAKNTLMQMVAADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVP  1168
             YKK +  IKA+ TLMQ+V ADWL+S++R+DDLAGRPG IVQK+A   RPEFF +VN+Q+P
Sbjct  3     YKKKNS-IKAQKTLMQLVGADWLRSNKREDDLAGRPGSIVQKYAEWSRPEFFFVVNLQLP  61

Query  1169  GSTTYSLALYYMLKAPLEDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             G+T Y+LALYYML+ PL+DTPLLE FVNGDDAFRNSRFKLIPYIS+ S
Sbjct  62    GATRYNLALYYMLRTPLKDTPLLESFVNGDDAFRNSRFKLIPYISQGS  109


 Score = 66.2 bits (160),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             QGSWIVKQSVGKKACL+GQALE+NYF+GKNYL
Sbjct  107   QGSWIVKQSVGKKACLVGQALEINYFQGKNYL  138



>ref|XP_008813630.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Phoenix 
dactylifera]
Length=725

 Score =   191 bits (485),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 147/437 (34%), Positives = 221/437 (51%), Gaps = 43/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T EA+F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  228   AMKAVGVVEATCEAIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQPSWFPM  287

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ  ++RA ++SGG  I+P+K     
Sbjct  288   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHPNCGPQPGFVRAHIESGGFNISPLKSRNGR  347

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W         +   ++ML  VA LRE F   + +H+      +  
Sbjct  348   PRTQVQHLMQIDLKGWGVGYFPPFQQHCLLQMLNNVAGLREWFSQTDESHTVPRMSVMVN  407

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT +  +   E++ +E   + P    D M    S  S ++  +S  DE Y + EP     
Sbjct  408   MTSNSASSRKEQKTQENS-IQPNLSLDQMHSN-SRHSVMLDEDSDEDEDYQIPEPEQ---  462

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                             +A   K+ +A                     E  S++ +   + 
Sbjct  463   ----------------EAYAVKLENAIR----------------HADEEPSDQIDLSGFS  490

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G L++D    +   W   D ++F +R   +  D  KI A   LM++VA DW K  +R D 
Sbjct  491   GNLRRDDQEKSRDCWRISDGNNFRVRSNHFIYDKTKIPAGKHLMELVAVDWFKDVKRMDH  550

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G  VQ   A ++  F L +N+QVPGST YS+  Y++ K  L    LL+RFV+GDD
Sbjct  551   VATRKGCAVQ--VASEKGLFSLAINVQVPGSTHYSMVFYFVTKQ-LVPGSLLQRFVDGDD  607

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSRFKLIP + K S
Sbjct  608   EFRNSRFKLIPSVPKGS  624


 Score = 44.7 bits (104),  Expect(2) = 1e-52, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   C++G+A++  Y +G  YL
Sbjct  622   KGSWIVRQSVGSTPCILGKAVDCTYIRGPKYL  653



>ref|XP_010661303.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Vitis vinifera]
Length=741

 Score =   190 bits (482),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 144/440 (33%), Positives = 220/440 (50%), Gaps = 58/440 (13%)
 Frame = +2

Query  20    AVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPWGMN  199
             A+GV++ + E +F  +M++  +R EWD  F  GS++E +DGHT +++ +L  +W P  + 
Sbjct  245   AIGVVEASCEEIFELVMNMDSTRFEWDCSFQYGSLVEEVDGHTAVLYHRLQLYWYPTFIW  304

Query  200   rrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA---S  370
              RDL   RYWRR DDG+YV+L+ S  H+ C PQ  ++RA ++SGG  I+P+K       S
Sbjct  305   PRDLCYVRYWRRNDDGSYVVLFRSREHEHCGPQPGFVRAHIESGGFNISPLKPRHGRPRS  364

Query  371   VVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAEMTI  550
              V+H++ +D K W      +  +   ++ML  VA LRE F   +  H++     +  MT 
Sbjct  365   KVQHLMQIDLKGWGVGYLSSFKQHCLLQMLNGVAGLREWFSQSDERHTAPRIPVMINMT-  423

Query  551   DieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESAC------DEFYDVLEPSd  712
                            +V   + ++  E       SL  L SA       DEF D  E   
Sbjct  424   -------------SASVSSQKNQENQEPAGKGFPSLDELHSASRNSMMLDEFSDEDE---  467

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
                            EF V   +Q+              A  +     L+E  +++ +  
Sbjct  468   ---------------EFQVAEVEQE--------------AYNEVEQTALEEDPTDQIDLS  498

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
             C+ G L+++ N      W   D ++F +R K +  D  KI A    M++VA DWLK  +R
Sbjct  499   CFSGNLRRNDNDDGRDCWTISDGNNFRVRSKHFFSDKSKIPAGKHTMELVAVDWLKDIKR  558

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
              D +A RPG  VQ   A ++  F L +N+QVPGST YS+ ++Y++   L    LL+ FV+
Sbjct  559   IDHVARRPGCAVQ--VASEKGLFSLAINLQVPGSTHYSM-VFYLVTKQLVPGSLLQCFVD  615

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDD FRNSR KLIP + K S
Sbjct  616   GDDEFRNSRLKLIPSVPKGS  635


 Score = 45.4 bits (106),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G  YL
Sbjct  633   KGSWIVRQSVGSTPCLLGKAVDCTYIRGPKYL  664



>ref|XP_010661302.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Vitis vinifera]
Length=759

 Score =   190 bits (482),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 144/440 (33%), Positives = 220/440 (50%), Gaps = 58/440 (13%)
 Frame = +2

Query  20    AVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPWGMN  199
             A+GV++ + E +F  +M++  +R EWD  F  GS++E +DGHT +++ +L  +W P  + 
Sbjct  263   AIGVVEASCEEIFELVMNMDSTRFEWDCSFQYGSLVEEVDGHTAVLYHRLQLYWYPTFIW  322

Query  200   rrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA---S  370
              RDL   RYWRR DDG+YV+L+ S  H+ C PQ  ++RA ++SGG  I+P+K       S
Sbjct  323   PRDLCYVRYWRRNDDGSYVVLFRSREHEHCGPQPGFVRAHIESGGFNISPLKPRHGRPRS  382

Query  371   VVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAEMTI  550
              V+H++ +D K W      +  +   ++ML  VA LRE F   +  H++     +  MT 
Sbjct  383   KVQHLMQIDLKGWGVGYLSSFKQHCLLQMLNGVAGLREWFSQSDERHTAPRIPVMINMT-  441

Query  551   DieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESAC------DEFYDVLEPSd  712
                            +V   + ++  E       SL  L SA       DEF D  E   
Sbjct  442   -------------SASVSSQKNQENQEPAGKGFPSLDELHSASRNSMMLDEFSDEDE---  485

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
                            EF V   +Q+              A  +     L+E  +++ +  
Sbjct  486   ---------------EFQVAEVEQE--------------AYNEVEQTALEEDPTDQIDLS  516

Query  893   CYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRR  1072
             C+ G L+++ N      W   D ++F +R K +  D  KI A    M++VA DWLK  +R
Sbjct  517   CFSGNLRRNDNDDGRDCWTISDGNNFRVRSKHFFSDKSKIPAGKHTMELVAVDWLKDIKR  576

Query  1073  QDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVN  1252
              D +A RPG  VQ   A ++  F L +N+QVPGST YS+ ++Y++   L    LL+ FV+
Sbjct  577   IDHVARRPGCAVQ--VASEKGLFSLAINLQVPGSTHYSM-VFYLVTKQLVPGSLLQCFVD  633

Query  1253  GDDAFRNSRFKLIPYISKVS  1312
             GDD FRNSR KLIP + K S
Sbjct  634   GDDEFRNSRLKLIPSVPKGS  653


 Score = 45.4 bits (106),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G  YL
Sbjct  651   KGSWIVRQSVGSTPCLLGKAVDCTYIRGPKYL  682



>ref|XP_009401233.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Musa acuminata 
subsp. malaccensis]
Length=728

 Score =   189 bits (481),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 149/437 (34%), Positives = 222/437 (51%), Gaps = 41/437 (9%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVG+++ T E++F+ +M +  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  229   AMKAVGIVEATCESIFQLVMRMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPV  288

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS  370
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ  ++RA ++SGG  I+P+K     
Sbjct  289   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHVNCSPQPGFVRAHVESGGFKISPLKPRDGR  348

Query  371   V---VKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             V   V+H++ +D K W      +  +   I+ML  VA LRE F   + NH  +    +  
Sbjct  349   VRTQVQHLMQIDLKGWGVGYLPSFQQHCLIQMLNSVAGLREWFSQTDENHDVSKIPLMVN  408

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT    +   + + +E   V P      M+   S  S ++  +S  DE Y + EP  +  
Sbjct  409   MTAQTISIKKDRKTQENS-VHPNSSLYHMQAA-SRHSVILDEDSDEDEDYQIPEPEQEAY  466

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                                          +K  +DL   KK  +D  E  SE  +   + 
Sbjct  467   P----------------------------VKLENDL---KKAVLD--EEPSESIDLSEFS  493

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G L+ D    +   W   D ++F +R K +  D  KI     LM++VA DW K  +R D 
Sbjct  494   GNLRHDDRDKSRNCWRISDGNNFRVRSKHFIYDKTKIPGGRHLMELVAVDWFKDAKRIDH  553

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G  VQ   A ++  F L++N+QVP ST YS+  Y++ K PL    LL+ FV+GDD
Sbjct  554   VARRKGCAVQ--VASEKGLFSLVINVQVPASTHYSMVFYFVSK-PLVPGSLLQLFVDGDD  610

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSRFKLIP + K S
Sbjct  611   EFRNSRFKLIPAVPKGS  627


 Score = 45.8 bits (107),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G  YL
Sbjct  625   KGSWIVRQSVGSTPCLLGKAVDCTYIRGSEYL  656



>emb|CDP11764.1| unnamed protein product [Coffea canephora]
Length=729

 Score =   184 bits (467),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 140/437 (32%), Positives = 221/437 (51%), Gaps = 42/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E +F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   WL  
Sbjct  228   AMKAVGVVEATCEEIFELVMSMDATRFEWDCTFQYGSLVEEVDGHTAILYHRLQLDWLSM  287

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C PQ  ++RA ++SGG  I+P+K     
Sbjct  288   LVWPRDLCYVRYWRRNDDGSYVVLFQSRQHENCGPQPGFVRAHIESGGFNISPMKPHHGR  347

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H+  +D K W  +   +  +   ++ML  VA LRE F   +   ++     +  
Sbjct  348   PRTQVQHLTQIDLKGWGVNYISSFQQHCLLQMLNSVAGLREYFSQSDERAAAPRIPVMVN  407

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT    A +  ++  +       +    ++++ S   ++  ++   DE  D   P     
Sbjct  408   MT---SASVSSKKSEKLYGSSVHKRSMSLDQITSSNKNVSMMDDYSDEDEDFQVPD----  460

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                        P   +D+  +K +S   L     DL++      +L+  D E++  C   
Sbjct  461   ------QEVLPP--SLDSEVKKSASEEELADNI-DLSIFSG---NLRRDDHEKARHC---  505

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
                           W   D ++F +R + +  D  KI A   LM +VA DW K  +R D 
Sbjct  506   --------------WNISDGNNFRVRSRTFCYDKSKIPAGKHLMDLVAVDWFKDSKRMDH  551

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A RPG   Q   A ++  F L++N+QVPGST YS+  YY+ K  +  + LL+RFV+GDD
Sbjct  552   VARRPGCTAQ--VASEKGLFSLVINVQVPGSTHYSMVFYYVTKKLIPGS-LLQRFVDGDD  608

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSR KLIP + K S
Sbjct  609   EFRNSRLKLIPSVPKGS  625


 Score = 50.4 bits (119),  Expect(2) = 3e-52, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G NYL
Sbjct  623   KGSWIVRQSVGSTPCLLGKAVDCNYVRGNNYL  654



>ref|XP_010918068.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Elaeis guineensis]
Length=634

 Score =   189 bits (480),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 149/437 (34%), Positives = 224/437 (51%), Gaps = 43/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T EA+F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  137   AMRAVGVVEATCEAIFEHVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLGWFPM  196

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ  ++RA ++SGG +I+P+K     
Sbjct  197   LVWPRDLCYVRYWRRNDDGSYVVLFRSREHPNCGPQPGFVRAHIESGGFIISPLKSRNGR  256

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +   ++ML  VA LRE F   + +H       +  
Sbjct  257   PRTQVQHLMQIDLKGWAVGYFPSFQQHCLLQMLNSVAGLREWFSQTDESHMVPRMPVMVN  316

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT +  A   +E + +E ++ P    D M    S  S ++  +S  DE Y + EP     
Sbjct  317   MTSN-SASSRKERKTQENSIQPNPSVDQMHS-ASRHSVMLDEDSDEDEDYQIPEPEQ---  371

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                             +A   K+ +   L  +      +  G +DL            + 
Sbjct  372   ----------------EAYPVKLENDIGLADE------EPSGQIDL----------AGFS  399

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G L++D    +   W   D ++F +R K +  D  KI A   LM++VA DW K  +R D 
Sbjct  400   GILRRDDRDKSRDCWRISDGNNFRVRSKHFTYDKTKIPAGKHLMELVAVDWFKDVKRMDH  459

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G  VQ   A ++  F L +N+QVPGST YS+  Y++ K  L    LL+RFV+GDD
Sbjct  460   VARRKGCAVQ--VASEKGLFSLAINLQVPGSTHYSMVFYFVTKQ-LVPGSLLQRFVDGDD  516

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSR KLIP + K S
Sbjct  517   EFRNSRLKLIPSVPKGS  533


 Score = 45.1 bits (105),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G  YL
Sbjct  531   KGSWIVRQSVGSTPCLLGKAVDCTYIRGPKYL  562



>ref|XP_008802965.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Phoenix dactylifera]
Length=730

 Score =   188 bits (477),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 141/437 (32%), Positives = 223/437 (51%), Gaps = 43/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E++F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  231   AMKAVGVVEATCESIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPM  290

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ  ++RA ++SGG  I+P+K     
Sbjct  291   FVWHRDLCYVRYWRRNDDGSYVVLFRSREHPNCGPQPGFVRAHIESGGFNISPLKPRNGR  350

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +   ++ML  VA LRE F   + +H+      +  
Sbjct  351   PRTQVQHLMQIDLKGWGVGYFPSFQQHCLLQMLNSVAGLREWFSQTDESHTVTRIPMMVN  410

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT++  +               ++ +  ++E   +P+  V      D+ +     S   D
Sbjct  411   MTLNSVS---------------SKNKRKIQENSIQPNPSV------DQMHSASRHSVMLD  449

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
             E+ +       PE   +A   K+ ++                     E  S++ +   + 
Sbjct  450   EDSDEDEDYQIPELEQEAYSVKLENSNK----------------RADEEPSDQIDLSGFS  493

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             GTL++D    +   W   D ++F +R K +  D  KI +   LM++VA DW K  +R D 
Sbjct  494   GTLRRDDRDKSRDCWRISDGNNFRVRSKHFIYDKTKIPSGKHLMELVAVDWFKDVKRMDH  553

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G  VQ   A ++  F L +N+QVPGST YS+  Y++ K  L    LL+RF +GDD
Sbjct  554   VARRKGCAVQ--VASEKGLFSLAINLQVPGSTHYSMVFYFVTKQ-LVPGSLLQRFADGDD  610

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSRFKLIP + K S
Sbjct  611   EFRNSRFKLIPSVPKGS  627


 Score = 45.4 bits (106),  Expect(2) = 6e-52, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G  YL
Sbjct  625   KGSWIVRQSVGSTPCLLGKAVDCTYIRGPKYL  656



>ref|XP_008802967.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X3 [Phoenix dactylifera]
Length=728

 Score =   188 bits (477),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 141/437 (32%), Positives = 223/437 (51%), Gaps = 43/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E++F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  229   AMKAVGVVEATCESIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPM  288

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ  ++RA ++SGG  I+P+K     
Sbjct  289   FVWHRDLCYVRYWRRNDDGSYVVLFRSREHPNCGPQPGFVRAHIESGGFNISPLKPRNGR  348

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +   ++ML  VA LRE F   + +H+      +  
Sbjct  349   PRTQVQHLMQIDLKGWGVGYFPSFQQHCLLQMLNSVAGLREWFSQTDESHTVTRIPMMVN  408

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT++  +               ++ +  ++E   +P+  V      D+ +     S   D
Sbjct  409   MTLNSVS---------------SKNKRKIQENSIQPNPSV------DQMHSASRHSVMLD  447

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
             E+ +       PE   +A   K+ ++                     E  S++ +   + 
Sbjct  448   EDSDEDEDYQIPELEQEAYSVKLENSNK----------------RADEEPSDQIDLSGFS  491

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             GTL++D    +   W   D ++F +R K +  D  KI +   LM++VA DW K  +R D 
Sbjct  492   GTLRRDDRDKSRDCWRISDGNNFRVRSKHFIYDKTKIPSGKHLMELVAVDWFKDVKRMDH  551

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G  VQ   A ++  F L +N+QVPGST YS+  Y++ K  L    LL+RF +GDD
Sbjct  552   VARRKGCAVQ--VASEKGLFSLAINLQVPGSTHYSMVFYFVTKQ-LVPGSLLQRFADGDD  608

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSRFKLIP + K S
Sbjct  609   EFRNSRFKLIPSVPKGS  625


 Score = 45.4 bits (106),  Expect(2) = 6e-52, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G  YL
Sbjct  623   KGSWIVRQSVGSTPCLLGKAVDCTYIRGPKYL  654



>ref|XP_010918070.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X3 [Elaeis guineensis]
Length=497

 Score =   188 bits (478),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 149/434 (34%), Positives = 222/434 (51%), Gaps = 43/434 (10%)
 Frame = +2

Query  20    AVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPWGMN  199
             AVGV++ T EA+F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P  + 
Sbjct  3     AVGVVEATCEAIFEHVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLGWFPMLVW  62

Query  200   rrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA---S  370
              RDL   RYWRR DDG+YV+L+ S  H  C PQ  ++RA ++SGG +I+P+K       +
Sbjct  63    PRDLCYVRYWRRNDDGSYVVLFRSREHPNCGPQPGFVRAHIESGGFIISPLKSRNGRPRT  122

Query  371   VVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAEMTI  550
              V+H++ +D K W      +  +   ++ML  VA LRE F   + +H       +  MT 
Sbjct  123   QVQHLMQIDLKGWAVGYFPSFQQHCLLQMLNSVAGLREWFSQTDESHMVPRMPVMVNMTS  182

Query  551   DieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSddddeeg  730
             +  A   +E + +E ++ P    D M    S  S ++  +S  DE Y + EP        
Sbjct  183   N-SASSRKERKTQENSIQPNPSVDQMHS-ASRHSVMLDEDSDEDEDYQIPEPEQ------  234

Query  731   egWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYGGTL  910
                          +A   K+ +   L  +      +  G +DL            + G L
Sbjct  235   -------------EAYPVKLENDIGLADE------EPSGQIDL----------AGFSGIL  265

Query  911   QQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDDLAG  1090
             ++D    +   W   D ++F +R K +  D  KI A   LM++VA DW K  +R D +A 
Sbjct  266   RRDDRDKSRDCWRISDGNNFRVRSKHFTYDKTKIPAGKHLMELVAVDWFKDVKRMDHVAR  325

Query  1091  RPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDDAFR  1270
             R G  VQ   A ++  F L +N+QVPGST YS+  Y++ K  L    LL+RFV+GDD FR
Sbjct  326   RKGCAVQ--VASEKGLFSLAINLQVPGSTHYSMVFYFVTKQ-LVPGSLLQRFVDGDDEFR  382

Query  1271  NSRFKLIPYISKVS  1312
             NSR KLIP + K S
Sbjct  383   NSRLKLIPSVPKGS  396


 Score = 45.1 bits (105),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G  YL
Sbjct  394   KGSWIVRQSVGSTPCLLGKAVDCTYIRGPKYL  425



>ref|XP_008802966.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Phoenix dactylifera]
Length=728

 Score =   188 bits (477),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 141/437 (32%), Positives = 223/437 (51%), Gaps = 43/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E++F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  231   AMKAVGVVEATCESIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPM  290

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ  ++RA ++SGG  I+P+K     
Sbjct  291   FVWHRDLCYVRYWRRNDDGSYVVLFRSREHPNCGPQPGFVRAHIESGGFNISPLKPRNGR  350

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +   ++ML  VA LRE F   + +H+      +  
Sbjct  351   PRTQVQHLMQIDLKGWGVGYFPSFQQHCLLQMLNSVAGLREWFSQTDESHTVTRIPMMVN  410

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT++  +               ++ +  ++E   +P+  V      D+ +     S   D
Sbjct  411   MTLNSVS---------------SKNKRKIQENSIQPNPSV------DQMHSASRHSVMLD  449

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
             E+ +       PE   +A   K+ ++                     E  S++ +   + 
Sbjct  450   EDSDEDEDYQIPELEQEAYSVKLENSNK----------------RADEEPSDQIDLSGFS  493

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             GTL++D    +   W   D ++F +R K +  D  KI +   LM++VA DW K  +R D 
Sbjct  494   GTLRRDDRDKSRDCWRISDGNNFRVRSKHFIYDKTKIPSGKHLMELVAVDWFKDVKRMDH  553

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G  VQ   A ++  F L +N+QVPGST YS+  Y++ K  L    LL+RF +GDD
Sbjct  554   VARRKGCAVQ--VASEKGLFSLAINLQVPGSTHYSMVFYFVTKQ-LVPGSLLQRFADGDD  610

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSRFKLIP + K S
Sbjct  611   EFRNSRFKLIPSVPKGS  627


 Score = 45.4 bits (106),  Expect(2) = 6e-52, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G  YL
Sbjct  625   KGSWIVRQSVGSTPCLLGKAVDCTYIRGPKYL  656



>ref|XP_009601910.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Nicotiana tomentosiformis]
Length=724

 Score =   185 bits (469),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 145/445 (33%), Positives = 217/445 (49%), Gaps = 59/445 (13%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ + E +F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  228   AMKAVGVVEASCEDIFELVMSMDATRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPA  287

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C P   Y+RA ++SGG  I+P+K     
Sbjct  288   LVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPLPGYVRAHIESGGFNISPLKPLNGR  347

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +   ++ML  VA LRE F   +   ++     +  
Sbjct  348   PRTQVQHLMQIDLKGWGVGYISSFQQHCLLQMLNSVAGLREYFSQADERTAAPRIPVMVN  407

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESA------CDEFYDVLE  703
             MT                +V   R +   E L     SL  + +A       DE+ D  E
Sbjct  408   MT--------------SASVSSKRSQKFQETLHHRTRSLDQIRAANRNASMMDEYSDEEE  453

Query  704   PSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
                               +F     +    S    MKK             L+E   ++ 
Sbjct  454   ------------------DFQGADQEVMPPSPEHEMKK-----------TALEEEPLDQI  484

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
             +   Y G L++D + +    W   D ++F +R K +  D  KI A   LM +VA DW K 
Sbjct  485   DFSVYSGNLRRDDSDNGRNCWRISDGNNFRVRSKNFCYDKSKIAAGKPLMDLVAVDWFKD  544

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP--LL  1237
              +R D +A R G   Q   A ++  F L++N+QVPGST YS+  Y+++K   E TP  L 
Sbjct  545   TKRMDHVAKRLGCAAQ--VAAEKGLFSLVINVQVPGSTHYSMVFYFVMK---ELTPGSLF  599

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
             +RFV+GDD FRNSR KLIP + K S
Sbjct  600   QRFVDGDDEFRNSRMKLIPSVPKGS  624


 Score = 48.1 bits (113),  Expect(2) = 1e-51, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  622   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  653



>ref|XP_009601911.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Nicotiana tomentosiformis]
Length=706

 Score =   185 bits (469),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 145/445 (33%), Positives = 217/445 (49%), Gaps = 59/445 (13%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ + E +F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  210   AMKAVGVVEASCEDIFELVMSMDATRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPA  269

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C P   Y+RA ++SGG  I+P+K     
Sbjct  270   LVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPLPGYVRAHIESGGFNISPLKPLNGR  329

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +   ++ML  VA LRE F   +   ++     +  
Sbjct  330   PRTQVQHLMQIDLKGWGVGYISSFQQHCLLQMLNSVAGLREYFSQADERTAAPRIPVMVN  389

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESA------CDEFYDVLE  703
             MT                +V   R +   E L     SL  + +A       DE+ D  E
Sbjct  390   MT--------------SASVSSKRSQKFQETLHHRTRSLDQIRAANRNASMMDEYSDEEE  435

Query  704   PSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
                               +F     +    S    MKK             L+E   ++ 
Sbjct  436   ------------------DFQGADQEVMPPSPEHEMKK-----------TALEEEPLDQI  466

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
             +   Y G L++D + +    W   D ++F +R K +  D  KI A   LM +VA DW K 
Sbjct  467   DFSVYSGNLRRDDSDNGRNCWRISDGNNFRVRSKNFCYDKSKIAAGKPLMDLVAVDWFKD  526

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP--LL  1237
              +R D +A R G   Q   A ++  F L++N+QVPGST YS+  Y+++K   E TP  L 
Sbjct  527   TKRMDHVAKRLGCAAQ--VAAEKGLFSLVINVQVPGSTHYSMVFYFVMK---ELTPGSLF  581

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
             +RFV+GDD FRNSR KLIP + K S
Sbjct  582   QRFVDGDDEFRNSRMKLIPSVPKGS  606


 Score = 48.1 bits (113),  Expect(2) = 1e-51, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  604   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  635



>ref|XP_002519855.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF42459.1| lipid binding protein, putative [Ricinus communis]
Length=727

 Score =   184 bits (466),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 143/437 (33%), Positives = 216/437 (49%), Gaps = 39/437 (9%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E +F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  228   AMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPA  287

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C PQ   +RA ++SGG  I P+K     
Sbjct  288   FIWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGR  347

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +   ++ML  VA LRE F   +   +      +  
Sbjct  348   PRTQVQHLMQIDLKGWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVMVN  407

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             M     A   +  + +E +V P    D +    S  S+++   S  DE Y + E      
Sbjct  408   MA-SASASTKKNFKLQESSVHPAPSLDQINAA-SRNSTIMDEYSDEDEEYQIAEEEQ---  462

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                             +A Q K  +   + +              L+E   E  +  C+ 
Sbjct  463   ----------------EAYQTKKENENDMRR------------TALEEEPVEPIDLSCFS  494

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G L++D        W   D ++F +R K +  D  KI A   LM +VA DW K  +R D 
Sbjct  495   GNLRRDDRDKARDCWRISDGNNFRVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDH  554

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G   Q   A ++  F ++ N+QVPGST YS+  Y++ K  +  + LL+RFV+GDD
Sbjct  555   VARRQGCAAQ--VASEKGLFSVVFNLQVPGSTHYSMVFYFVTKELIPGS-LLQRFVDGDD  611

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSRFKLIP + K S
Sbjct  612   EFRNSRFKLIPSVPKGS  628


 Score = 48.1 bits (113),  Expect(2) = 2e-51, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  626   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  657



>ref|XP_009601912.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X3 [Nicotiana tomentosiformis]
Length=682

 Score =   185 bits (469),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 145/445 (33%), Positives = 217/445 (49%), Gaps = 59/445 (13%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ + E +F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  228   AMKAVGVVEASCEDIFELVMSMDATRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPA  287

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C P   Y+RA ++SGG  I+P+K     
Sbjct  288   LVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPLPGYVRAHIESGGFNISPLKPLNGR  347

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +   ++ML  VA LRE F   +   ++     +  
Sbjct  348   PRTQVQHLMQIDLKGWGVGYISSFQQHCLLQMLNSVAGLREYFSQADERTAAPRIPVMVN  407

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESA------CDEFYDVLE  703
             MT                +V   R +   E L     SL  + +A       DE+ D  E
Sbjct  408   MT--------------SASVSSKRSQKFQETLHHRTRSLDQIRAANRNASMMDEYSDEEE  453

Query  704   PSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
                               +F     +    S    MKK             L+E   ++ 
Sbjct  454   ------------------DFQGADQEVMPPSPEHEMKK-----------TALEEEPLDQI  484

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
             +   Y G L++D + +    W   D ++F +R K +  D  KI A   LM +VA DW K 
Sbjct  485   DFSVYSGNLRRDDSDNGRNCWRISDGNNFRVRSKNFCYDKSKIAAGKPLMDLVAVDWFKD  544

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP--LL  1237
              +R D +A R G   Q   A ++  F L++N+QVPGST YS+  Y+++K   E TP  L 
Sbjct  545   TKRMDHVAKRLGCAAQ--VAAEKGLFSLVINVQVPGSTHYSMVFYFVMK---ELTPGSLF  599

Query  1238  ERFVNGDDAFRNSRFKLIPYISKVS  1312
             +RFV+GDD FRNSR KLIP + K S
Sbjct  600   QRFVDGDDEFRNSRMKLIPSVPKGS  624


 Score = 47.0 bits (110),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  622   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  653



>ref|XP_009384748.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=709

 Score =   181 bits (460),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 142/439 (32%), Positives = 224/439 (51%), Gaps = 45/439 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVG+++ T E++F+ +M +   R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  210   AMKAVGIMEATCESIFQLVMRMDGMRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPV  269

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS  370
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ  ++RA ++SGG  I+P+K     
Sbjct  270   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHVNCSPQPGFVRAHVESGGFKISPLKTCNGR  329

Query  371   V---VKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             +   V++++ +D K W      +  +   I+ML  VA LRE F   + N+  +    +  
Sbjct  330   LRTQVQYLMQIDLKGWGVGYFPSFQQHCLIQMLNSVAGLREWFSQTDENYDVSKMPLMVN  389

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT +      + + +E   V P   +  M    S    ++  +S  DE Y + EP     
Sbjct  390   MTAETAPIKKDRKTQENS-VQPNSSQYQMHGA-SRHHVMLDEDSDDDEDYQIPEP-----  442

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKK--GYVDLQEVDSEESEPCC  895
                                +Q++     L  +F+   + ++    +DL E          
Sbjct  443   -------------------EQEVY-PIKLENEFNKAGLDEEPSASIDLSE----------  472

Query  896   YGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQ  1075
             + G L++D    +   W   D ++F +R K++  D  KI A   LM++VA DW K  +R 
Sbjct  473   FSGNLRRDDLDKSRNCWRISDGNNFRVRSKQFIYDKTKIPAGKHLMELVAVDWFKDVKRI  532

Query  1076  DDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNG  1255
             D +A R G  VQ   A ++  F L++N+QVP ST YS+  Y++ K PL    LL+ FV+G
Sbjct  533   DHVARRKGCAVQ--VASEKGLFSLVINVQVPASTHYSMVFYFVSK-PLVPGSLLQLFVDG  589

Query  1256  DDAFRNSRFKLIPYISKVS  1312
             DD +RNSRFKLIP + K S
Sbjct  590   DDEYRNSRFKLIPAVPKGS  608


 Score = 46.2 bits (108),  Expect(2) = 4e-50, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G +YL
Sbjct  606   KGSWIVRQSVGSTPCLLGKAVDCTYIRGPDYL  637



>ref|XP_003517072.1| PREDICTED: uncharacterized protein LOC100806401 isoform X1 [Glycine 
max]
Length=725

 Score =   179 bits (454),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 137/437 (31%), Positives = 221/437 (51%), Gaps = 42/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E +F+ +MS+  +R EWD  F  GS++E +DGHT +++ +L   W P 
Sbjct  229   AMKAVGVVEATCEEIFKLVMSMDGTRFEWDCSFLHGSLVEEVDGHTAVLYHRLQLDWFPM  288

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C PQ   +RA ++SGG  I+P+K     
Sbjct  289   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHIESGGFNISPLKPRNGR  348

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +    +ML  VA LRE F   +  ++      +  
Sbjct  349   PRTQVQHLMQIDLKGWGVGYLSSFQQYCVRQMLNSVAGLREWFAQSDERNAHPRIPVMVN  408

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             M+        + ++  + +V+PT   D M    S  S+L+   S  +E + + EP  +  
Sbjct  409   MS-STAVSSKKNQKPNDFSVNPTSL-DQMNAT-SRSSALIDEYSDDEEDFQIAEPEQEAY  465

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                         +  ++ + +K +                     L+E  + E +   + 
Sbjct  466   ------------QIGLENDVRKTA---------------------LEEEPAHEIDFSSFS  492

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G L++D   +    W   D ++F +R K Y  D  K+ A   ++ +VA DW K  +R D 
Sbjct  493   GNLRRDDRDNARDCWKISDGNNFRVRSKHYCYDKTKVPAGKHMLDLVAVDWFKDSKRMDH  552

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G   Q   A ++  F +++N+QVP ST YS+  Y++ K  L    LL RFV+GDD
Sbjct  553   VARRHGCAAQ--VASEKGFFSIVINLQVPASTHYSMVFYFVTKE-LVSGSLLHRFVDGDD  609

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSRFKLIP + K S
Sbjct  610   EFRNSRFKLIPSVPKGS  626


 Score = 48.1 bits (113),  Expect(2) = 5e-50, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  624   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  655



>gb|EPS70366.1| hypothetical protein M569_04394, partial [Genlisea aurea]
Length=647

 Score =   181 bits (458),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 142/437 (32%), Positives = 209/437 (48%), Gaps = 42/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E  F  +MS+   R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  156   AMKAVGVVEATCEETFELVMSMDTKRYEWDCSFLDGSLVEEVDGHTAILYHRLQLDWFPM  215

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+++ S  H  C PQ  ++RA ++SGG  I+P+K     
Sbjct  216   LVWPRDLCYVRYWRRNDDGSYVVVFRSREHPDCGPQPGFVRAHIESGGFTISPLKSHNGV  275

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W              RML  VA LRE     +   ++     +  
Sbjct  276   HRTQVQHLMQIDLKGWGVGHISWFQHHCVFRMLNSVAGLREYLSQTDVRSATTRIPVMVN  335

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             M             R   ++  T+        +S  +S        DEF D  E      
Sbjct  336   MA---------SGSRSTKSILRTQSSSLHRRNVSIDTSTDKNNVLADEFSDEDE------  380

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                         +F   A+Q+   S++T          + K  V L+E   +  +   + 
Sbjct  381   ------------DFQGAADQEVPLSSST--------EAEDKKNVSLEET-QDALDVSAFA  419

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G +++D +      W   D S+F +R K Y  D  K  A   LM +VA DW K  +R D 
Sbjct  420   GNIRRDDDEKARNCWTLSDGSNFRVRSKNYCHDRSKTPAGKHLMDLVAVDWFKDTKRMDH  479

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R  G   K  A DR  F ++VN+QVPG+T YS+  Y++ K  +  + LL RFVNGDD
Sbjct  480   VA-RISGCAAK-VASDRGNFCVVVNMQVPGTTHYSMVFYFVTKKLIPGS-LLHRFVNGDD  536

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSR K+IP + K S
Sbjct  537   EFRNSRLKIIPSVPKGS  553


 Score = 46.2 bits (108),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +  +YL
Sbjct  551   KGSWIVRQSVGSSPCLLGKAVDCNYIRSSDYL  582



>ref|XP_006587626.1| PREDICTED: uncharacterized protein LOC100808706 isoform X2 [Glycine 
max]
Length=725

 Score =   179 bits (454),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 137/437 (31%), Positives = 219/437 (50%), Gaps = 42/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E +F  +MS+  +R EWD  F  GS++E +DGHT +++ +L   W P 
Sbjct  229   AMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFLHGSLVEEVDGHTAVLYHRLQLDWFPM  288

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C PQ   +RA ++SGG  I+P+K     
Sbjct  289   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHIESGGFNISPLKPRNGR  348

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +    +ML  VA LRE F   +  H+      +  
Sbjct  349   PRTQVQHLMQIDLKGWGVGYLSSFQQYCVRQMLNSVAGLREWFAQSDERHAHPRIPVMVN  408

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             M+        + ++  + +V+PT   D M    S  S+L+   S  +E + + EP  +  
Sbjct  409   MS-STAVSSKKNQKPNDFSVNPTSL-DQMNAA-SRSSALIDEYSDDEEDFQIAEPEQEAY  465

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                         +  ++ + +K +                     L+E  + E +   + 
Sbjct  466   ------------QIGLENDVRKTA---------------------LEEEPAHEIDFSSFS  492

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G L++D   +    W   D ++F +R K Y  D  K+ A   ++ +VA DW K  +R D 
Sbjct  493   GNLRRDDRDNARDCWKISDGNNFRVRSKHYCYDKTKVPAGKHMLDLVAVDWFKDSKRMDH  552

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +  R G   Q   A ++  F +++N+QVP ST YS+  Y++ K  L    LL RFV+GDD
Sbjct  553   VVRRHGCAAQ--VASEKGFFSIVINLQVPASTHYSMVFYFVTKE-LVSGSLLHRFVDGDD  609

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSRFKLIP + K S
Sbjct  610   EFRNSRFKLIPSVPKGS  626


 Score = 48.1 bits (113),  Expect(2) = 6e-50, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  624   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  655



>ref|XP_004173695.1| PREDICTED: uncharacterized protein LOC101227255, partial [Cucumis 
sativus]
Length=192

 Score =   162 bits (409),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +2

Query  1010  IKAKNTLMQMVAADWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSL  1189
             IKA  TLMQ+V ADWL+SDRR+D+L GRPG IVQK+A    PEFF +VNIQVPG+T Y+L
Sbjct  1     IKANGTLMQLVGADWLRSDRREDNLGGRPGSIVQKYAERGGPEFFFVVNIQVPGTTMYTL  60

Query  1190  ALYYMLKAPLEDTPLLERFVNGDDAFRNSRFKLIPYISKVS  1312
             A+YYM++ PLE +PLL+ FV GDDAFRNSRFKLIPYIS+ S
Sbjct  61    AMYYMMRTPLESSPLLKNFVEGDDAFRNSRFKLIPYISQGS  101


 Score = 64.3 bits (155),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             QGSWIVKQSVGKKACL+G ALEV+YF+GKNYL
Sbjct  99    QGSWIVKQSVGKKACLVGHALEVHYFRGKNYL  130



>gb|AES95593.2| pleckstrin-like (PH) and lipid-binding START domain protein [Medicago 
truncatula]
Length=724

 Score =   177 bits (449),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 135/437 (31%), Positives = 214/437 (49%), Gaps = 44/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ + E +F  +MS+  +R EWD  F  G ++E +DGHT +++ +L   W P 
Sbjct  230   AMKAVGVVEASCEEIFELVMSMDGTRFEWDCSFQEGRLVEEVDGHTAVLYHRLQLDWFPM  289

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ   +RA ++SGG+ I+P+K     
Sbjct  290   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHDNCGPQPGCVRAHIESGGYNISPLKPRNGR  349

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +    +ML  VA LRE F A+    ++     +  
Sbjct  350   PRTQVQHLMQIDLKGWGVSYIPSFQQHCLRQMLNSVAGLREWF-AQSDERNAPPRIPVMV  408

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
                       + ++  + +V+ T  +   +   +  S L+   S  DE + + EP     
Sbjct  409   NMFSTSVTSKKSQKTNDISVNSTSLD---QNAANRNSVLMDEYSDDDEDFQIAEP-----  460

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                               +Q       + ++K             L E   +E +   + 
Sbjct  461   ------------------DQDAFQIGQSDVRK-----------TALDEEPDDEIDLSSFS  491

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G L++D   +    W   D S+F +R K +  D  K  A   LM +VA DW K  +R D 
Sbjct  492   GNLRRDDRDNARDCWKISDGSNFRVRSKHFCYDKSKAPAGKHLMDLVAVDWFKDSKRMDH  551

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A RPG   Q   A ++  F +I+N+QVP S+ YS+  Y++ K  +  T LL+RFV+GDD
Sbjct  552   VAKRPGCAAQ--VASEKGYFSIIINVQVPASSHYSMVFYFVTKELVPGT-LLQRFVDGDD  608

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSR KLIP + K S
Sbjct  609   EFRNSRLKLIPSVPKGS  625


 Score = 48.1 bits (113),  Expect(2) = 2e-49, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  623   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  654



>ref|XP_003612635.1| Kinase-START [Medicago truncatula]
 gb|KEH27681.1| pleckstrin-like (PH) and lipid-binding START domain protein [Medicago 
truncatula]
Length=725

 Score =   177 bits (449),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 135/437 (31%), Positives = 214/437 (49%), Gaps = 44/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ + E +F  +MS+  +R EWD  F  G ++E +DGHT +++ +L   W P 
Sbjct  231   AMKAVGVVEASCEEIFELVMSMDGTRFEWDCSFQEGRLVEEVDGHTAVLYHRLQLDWFPM  290

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ   +RA ++SGG+ I+P+K     
Sbjct  291   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHDNCGPQPGCVRAHIESGGYNISPLKPRNGR  350

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +    +ML  VA LRE F A+    ++     +  
Sbjct  351   PRTQVQHLMQIDLKGWGVSYIPSFQQHCLRQMLNSVAGLREWF-AQSDERNAPPRIPVMV  409

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
                       + ++  + +V+ T  +   +   +  S L+   S  DE + + EP     
Sbjct  410   NMFSTSVTSKKSQKTNDISVNSTSLD---QNAANRNSVLMDEYSDDDEDFQIAEP-----  461

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                               +Q       + ++K             L E   +E +   + 
Sbjct  462   ------------------DQDAFQIGQSDVRK-----------TALDEEPDDEIDLSSFS  492

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G L++D   +    W   D S+F +R K +  D  K  A   LM +VA DW K  +R D 
Sbjct  493   GNLRRDDRDNARDCWKISDGSNFRVRSKHFCYDKSKAPAGKHLMDLVAVDWFKDSKRMDH  552

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A RPG   Q   A ++  F +I+N+QVP S+ YS+  Y++ K  +  T LL+RFV+GDD
Sbjct  553   VAKRPGCAAQ--VASEKGYFSIIINVQVPASSHYSMVFYFVTKELVPGT-LLQRFVDGDD  609

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSR KLIP + K S
Sbjct  610   EFRNSRLKLIPSVPKGS  626


 Score = 48.1 bits (113),  Expect(2) = 2e-49, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  624   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  655



>ref|XP_007158193.1| hypothetical protein PHAVU_002G132000g [Phaseolus vulgaris]
 gb|ESW30187.1| hypothetical protein PHAVU_002G132000g [Phaseolus vulgaris]
Length=724

 Score =   177 bits (448),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 135/437 (31%), Positives = 214/437 (49%), Gaps = 43/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E +F  +MS+  +R EWD  F  GS++E +DGHT +++ +L   W P 
Sbjct  229   AMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFLHGSLVEEVDGHTAVLYHRLQLDWFPM  288

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C PQ  ++RA ++SGG  I+P+K     
Sbjct  289   FVWPRDLCYVRYWRRNDDGSYVVLFCSREHENCSPQPGWVRAHIESGGFNISPLKPRNGR  348

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +    +ML  VA LRE F   +  ++      +  
Sbjct  349   PRTQVQHLMQIDLKGWGVGYLSSFQQYCVRQMLNSVAGLREWFAQSDERNAHPRIPVMVN  408

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             M+    +               ++      +    PSSL  + +A               
Sbjct  409   MSSTSVS---------------SKKNQKPNDFSVNPSSLDQMNAASR-------------  440

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                   +SA   E+  D + Q   S     +   +  V++     L+E    E +   + 
Sbjct  441   ------NSALIDEYSDDEDFQIAESEQEAYQIGLENDVRRTA---LEEEPGNEIDLSSFS  491

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G L++D   +    W   D ++F +R K +  D  K+ A   ++ +VA DW K  +R D 
Sbjct  492   GNLRRDDRDNARDCWKISDGNNFRVRSKHFCYDKSKVPAGKHMLDLVAVDWFKDSKRMDH  551

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G   Q   A ++  F +++N+QVP ST YS+  Y++ K  L    LL RFV+GDD
Sbjct  552   VARRHGCAAQ--VASEKGFFSIVINVQVPASTHYSMVFYFVTKE-LVSGSLLHRFVDGDD  608

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSRFKLIP + K S
Sbjct  609   EFRNSRFKLIPSVPKGS  625


 Score = 48.1 bits (113),  Expect(2) = 3e-49, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  623   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  654



>ref|XP_010661304.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X3 [Vitis vinifera]
Length=683

 Score =   190 bits (482),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 143/441 (32%), Positives = 221/441 (50%), Gaps = 58/441 (13%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ A+GV++ + E +F  +M++  +R EWD  F  GS++E +DGHT +++ +L  +W P 
Sbjct  260   AMGAIGVVEASCEEIFELVMNMDSTRFEWDCSFQYGSLVEEVDGHTAVLYHRLQLYWYPT  319

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C PQ  ++RA ++SGG  I+P+K     
Sbjct  320   FIWPRDLCYVRYWRRNDDGSYVVLFRSREHEHCGPQPGFVRAHIESGGFNISPLKPRHGR  379

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               S V+H++ +D K W      +  +   ++ML  VA LRE F   +  H++     +  
Sbjct  380   PRSKVQHLMQIDLKGWGVGYLSSFKQHCLLQMLNGVAGLREWFSQSDERHTAPRIPVMIN  439

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESAC------DEFYDVLE  703
             MT                +V   + ++  E       SL  L SA       DEF D  E
Sbjct  440   MT--------------SASVSSQKNQENQEPAGKGFPSLDELHSASRNSMMLDEFSDEDE  485

Query  704   PSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES  883
                               EF V   +Q+              A  +     L+E  +++ 
Sbjct  486   ------------------EFQVAEVEQE--------------AYNEVEQTALEEDPTDQI  513

Query  884   EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKS  1063
             +  C+ G L+++ N      W   D ++F +R K +  D  KI A    M++VA DWLK 
Sbjct  514   DLSCFSGNLRRNDNDDGRDCWTISDGNNFRVRSKHFFSDKSKIPAGKHTMELVAVDWLKD  573

Query  1064  DRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLER  1243
              +R D +A RPG  VQ   A ++  F L +N+QVPGST YS+ ++Y++   L    LL+ 
Sbjct  574   IKRIDHVARRPGCAVQ--VASEKGLFSLAINLQVPGSTHYSM-VFYLVTKQLVPGSLLQC  630

Query  1244  FVNGDDAFRNSRFKLIPYISK  1306
             FV+GDD FRNSR KLIP + K
Sbjct  631   FVDGDDEFRNSRLKLIPSVPK  651



>ref|XP_009384749.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=708

 Score =   178 bits (451),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 147/437 (34%), Positives = 227/437 (52%), Gaps = 41/437 (9%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVG+++ T E++F+ +M +   R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  209   AMKAVGIMEATCESIFQLVMRMDGMRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPV  268

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS  370
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ  ++RA ++SGG  I+P+K     
Sbjct  269   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHVNCSPQPGFVRAHVESGGFKISPLKTCNGR  328

Query  371   V---VKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             +   V++++ +D K W      +  +   I+ML  VA LRE F   + N+  +    +  
Sbjct  329   LRTQVQYLMQIDLKGWGVGYFPSFQQHCLIQMLNSVAGLREWFSQTDENYDVSKMPLMVN  388

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT +  API ++ + +E +V P   +  M    S    ++  +S  DE Y + EP     
Sbjct  389   MTAE-TAPIKKDRKTQENSVQPNSSQYQMHG-ASRHHVMLDEDSDDDEDYQIPEPE----  442

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                E +      EF   A   +  SA+  + +F           +L+  D ++S  C   
Sbjct  443   --QEVYPIKLENEFN-KAGLDEEPSASIDLSEFSG---------NLRRDDLDKSRNC---  487

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
                           W   D ++F +R K++  D  KI A   LM++VA DW K  +R D 
Sbjct  488   --------------WRISDGNNFRVRSKQFIYDKTKIPAGKHLMELVAVDWFKDVKRIDH  533

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G  VQ   A ++  F L++N+QVP ST YS+  Y++ K PL    LL+ FV+GDD
Sbjct  534   VARRKGCAVQ--VASEKGLFSLVINVQVPASTHYSMVFYFVSK-PLVPGSLLQLFVDGDD  590

Query  1262  AFRNSRFKLIPYISKVS  1312
              +RNSRFKLIP + K S
Sbjct  591   EYRNSRFKLIPAVPKGS  607


 Score = 46.2 bits (108),  Expect(2) = 4e-49, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G +YL
Sbjct  605   KGSWIVRQSVGSTPCLLGKAVDCTYIRGPDYL  636



>ref|XP_009384747.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=726

 Score =   177 bits (450),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 147/437 (34%), Positives = 227/437 (52%), Gaps = 41/437 (9%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVG+++ T E++F+ +M +   R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  227   AMKAVGIMEATCESIFQLVMRMDGMRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPV  286

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS  370
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ  ++RA ++SGG  I+P+K     
Sbjct  287   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHVNCSPQPGFVRAHVESGGFKISPLKTCNGR  346

Query  371   V---VKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
             +   V++++ +D K W      +  +   I+ML  VA LRE F   + N+  +    +  
Sbjct  347   LRTQVQYLMQIDLKGWGVGYFPSFQQHCLIQMLNSVAGLREWFSQTDENYDVSKMPLMVN  406

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT +  API ++ + +E +V P   +  M    S    ++  +S  DE Y + EP     
Sbjct  407   MTAE-TAPIKKDRKTQENSVQPNSSQYQMHG-ASRHHVMLDEDSDDDEDYQIPEPE----  460

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                E +      EF   A   +  SA+  + +F           +L+  D ++S  C   
Sbjct  461   --QEVYPIKLENEFN-KAGLDEEPSASIDLSEFSG---------NLRRDDLDKSRNC---  505

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
                           W   D ++F +R K++  D  KI A   LM++VA DW K  +R D 
Sbjct  506   --------------WRISDGNNFRVRSKQFIYDKTKIPAGKHLMELVAVDWFKDVKRIDH  551

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G  VQ   A ++  F L++N+QVP ST YS+  Y++ K PL    LL+ FV+GDD
Sbjct  552   VARRKGCAVQ--VASEKGLFSLVINVQVPASTHYSMVFYFVSK-PLVPGSLLQLFVDGDD  608

Query  1262  AFRNSRFKLIPYISKVS  1312
              +RNSRFKLIP + K S
Sbjct  609   EYRNSRFKLIPAVPKGS  625


 Score = 46.2 bits (108),  Expect(2) = 5e-49, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G +YL
Sbjct  623   KGSWIVRQSVGSTPCLLGKAVDCTYIRGPDYL  654



>ref|XP_006587627.1| PREDICTED: uncharacterized protein LOC100808706 isoform X3 [Glycine 
max]
Length=708

 Score =   175 bits (444),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 137/438 (31%), Positives = 220/438 (50%), Gaps = 43/438 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E +F  +MS+  +R EWD  F  GS++E +DGHT +++ +L   W P 
Sbjct  211   AMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFLHGSLVEEVDGHTAVLYHRLQLDWFPM  270

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C PQ   +RA ++SGG  I+P+K     
Sbjct  271   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHIESGGFNISPLKPRNGR  330

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +    +ML  VA LRE F   +  H+      +  
Sbjct  331   PRTQVQHLMQIDLKGWGVGYLSSFQQYCVRQMLNSVAGLREWFAQSDERHAHPRIPVMVN  390

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             M+        + ++  + +V+PT   D M    S  S+L+   S  +E + + EP  +  
Sbjct  391   MS-STAVSSKKNQKPNDFSVNPTSL-DQMNAA-SRSSALIDEYSDDEEDFQIAEPEQEAY  447

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                         +  ++ + +K +                     L+E  + E +   + 
Sbjct  448   ------------QIGLENDVRKTA---------------------LEEEPAHEIDFSSFS  474

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDH-EKIKAKNTLMQMVAADWLKSDRRQD  1078
             G L++D   +    W   D ++F +R K Y  D  +K+ A   ++ +VA DW K  +R D
Sbjct  475   GNLRRDDRDNARDCWKISDGNNFRVRSKHYCYDKTKKVPAGKHMLDLVAVDWFKDSKRMD  534

Query  1079  DLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGD  1258
              +  R G   Q   A ++  F +++N+QVP ST YS+  Y++ K  L    LL RFV+GD
Sbjct  535   HVVRRHGCAAQ--VASEKGFFSIVINLQVPASTHYSMVFYFVTKE-LVSGSLLHRFVDGD  591

Query  1259  DAFRNSRFKLIPYISKVS  1312
             D FRNSRFKLIP + K S
Sbjct  592   DEFRNSRFKLIPSVPKGS  609


 Score = 48.1 bits (113),  Expect(2) = 7e-49, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  607   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  638



>ref|XP_006573467.1| PREDICTED: uncharacterized protein LOC100806401 isoform X2 [Glycine 
max]
Length=726

 Score =   175 bits (444),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 137/438 (31%), Positives = 222/438 (51%), Gaps = 43/438 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E +F+ +MS+  +R EWD  F  GS++E +DGHT +++ +L   W P 
Sbjct  229   AMKAVGVVEATCEEIFKLVMSMDGTRFEWDCSFLHGSLVEEVDGHTAVLYHRLQLDWFPM  288

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C PQ   +RA ++SGG  I+P+K     
Sbjct  289   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHIESGGFNISPLKPRNGR  348

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +    +ML  VA LRE F   +  ++      +  
Sbjct  349   PRTQVQHLMQIDLKGWGVGYLSSFQQYCVRQMLNSVAGLREWFAQSDERNAHPRIPVMVN  408

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             M+        + ++  + +V+PT   D M    S  S+L+   S  +E + + EP  +  
Sbjct  409   MS-STAVSSKKNQKPNDFSVNPTSL-DQMNAT-SRSSALIDEYSDDEEDFQIAEPEQEAY  465

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                         +  ++ + +K +                     L+E  + E +   + 
Sbjct  466   ------------QIGLENDVRKTA---------------------LEEEPAHEIDFSSFS  492

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDH-EKIKAKNTLMQMVAADWLKSDRRQD  1078
             G L++D   +    W   D ++F +R K Y  D  +K+ A   ++ +VA DW K  +R D
Sbjct  493   GNLRRDDRDNARDCWKISDGNNFRVRSKHYCYDKTKKVPAGKHMLDLVAVDWFKDSKRMD  552

Query  1079  DLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGD  1258
              +A R G   Q   A ++  F +++N+QVP ST YS+  Y++ K  L    LL RFV+GD
Sbjct  553   HVARRHGCAAQ--VASEKGFFSIVINLQVPASTHYSMVFYFVTKE-LVSGSLLHRFVDGD  609

Query  1259  DAFRNSRFKLIPYISKVS  1312
             D FRNSRFKLIP + K S
Sbjct  610   DEFRNSRFKLIPSVPKGS  627


 Score = 48.1 bits (113),  Expect(2) = 8e-49, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  625   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  656



>ref|XP_006587625.1| PREDICTED: uncharacterized protein LOC100808706 isoform X1 [Glycine 
max]
Length=726

 Score =   175 bits (443),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 137/438 (31%), Positives = 220/438 (50%), Gaps = 43/438 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T E +F  +MS+  +R EWD  F  GS++E +DGHT +++ +L   W P 
Sbjct  229   AMKAVGVVEATCEEIFELVMSMDGTRFEWDCSFLHGSLVEEVDGHTAVLYHRLQLDWFPM  288

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H+ C PQ   +RA ++SGG  I+P+K     
Sbjct  289   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHIESGGFNISPLKPRNGR  348

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +    +ML  VA LRE F   +  H+      +  
Sbjct  349   PRTQVQHLMQIDLKGWGVGYLSSFQQYCVRQMLNSVAGLREWFAQSDERHAHPRIPVMVN  408

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             M+        + ++  + +V+PT   D M    S  S+L+   S  +E + + EP  +  
Sbjct  409   MS-STAVSSKKNQKPNDFSVNPTSL-DQMNAA-SRSSALIDEYSDDEEDFQIAEPEQEAY  465

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                         +  ++ + +K +                     L+E  + E +   + 
Sbjct  466   ------------QIGLENDVRKTA---------------------LEEEPAHEIDFSSFS  492

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDH-EKIKAKNTLMQMVAADWLKSDRRQD  1078
             G L++D   +    W   D ++F +R K Y  D  +K+ A   ++ +VA DW K  +R D
Sbjct  493   GNLRRDDRDNARDCWKISDGNNFRVRSKHYCYDKTKKVPAGKHMLDLVAVDWFKDSKRMD  552

Query  1079  DLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGD  1258
              +  R G   Q   A ++  F +++N+QVP ST YS+  Y++ K  L    LL RFV+GD
Sbjct  553   HVVRRHGCAAQ--VASEKGFFSIVINLQVPASTHYSMVFYFVTKE-LVSGSLLHRFVDGD  609

Query  1259  DAFRNSRFKLIPYISKVS  1312
             D FRNSRFKLIP + K S
Sbjct  610   DEFRNSRFKLIPSVPKGS  627


 Score = 48.1 bits (113),  Expect(2) = 9e-49, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  625   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  656



>ref|XP_010054083.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Eucalyptus grandis]
Length=723

 Score =   175 bits (443),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 138/437 (32%), Positives = 217/437 (50%), Gaps = 45/437 (10%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ + E +F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W   
Sbjct  230   AMKAVGVVEASCEEIFGLVMSMDSTRFEWDSTFHTGSLVEEVDGHTAILYHRLQLDWFST  289

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPI--KLGK  364
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ   +RA ++SGG  I+P+  + G+
Sbjct  290   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHVNCGPQPGCVRAHVESGGFNISPLQPRHGR  349

Query  365   ASV-VKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
                 V+H++ +D K W      +  +   ++ML  VA LRE F   +          +  
Sbjct  350   PRTQVQHLMQIDLKGWLVGYFPSFQQHCLLQMLNSVAGLREWFAQTDERIPPPRIPVMVN  409

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT    +    + +       P+     +E L S  +S++      DE+ D  E      
Sbjct  410   MTSTSVSSKARKLQGSSAHSGPS-----LESLNSGRNSVM-----MDEYSDDDEEQ----  455

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                              A+ ++  S+T +        V+++G         ++ +  C+ 
Sbjct  456   ----------------GADTEQEGSSTGIENDIKKNVVEEQG---------DQIDLSCFT  490

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             GTL++D        W+  D ++F +R K +  D  KI A   LM +VA DW K  +R D 
Sbjct  491   GTLRRDDRDKARDCWSISDGNNFKVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDKKRMDH  550

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             +A R G   Q   A ++  F +++N+QVPGS  YS+  Y++ K  L    LL+RFV+GDD
Sbjct  551   VARRKGCAAQ--VASEKGLFSVVINLQVPGSMHYSMVFYFVTKE-LVSGSLLQRFVDGDD  607

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSR KLIP + K S
Sbjct  608   EFRNSRLKLIPSVPKGS  624


 Score = 47.8 bits (112),  Expect(2) = 1e-48, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  622   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  653



>ref|XP_010054081.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010054082.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Eucalyptus grandis]
Length=649

 Score =   175 bits (444),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 140/438 (32%), Positives = 217/438 (50%), Gaps = 47/438 (11%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ + E +F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W   
Sbjct  156   AMKAVGVVEASCEEIFGLVMSMDSTRFEWDSTFHTGSLVEEVDGHTAILYHRLQLDWFST  215

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPI--KLGK  364
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ   +RA ++SGG  I+P+  + G+
Sbjct  216   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHVNCGPQPGCVRAHVESGGFNISPLQPRHGR  275

Query  365   ASV-VKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
                 V+H++ +D K W      +  +   ++ML  VA LRE F   +          +  
Sbjct  276   PRTQVQHLMQIDLKGWLVGYFPSFQQHCLLQMLNSVAGLREWFAQTDERIPPPRIPVMVN  335

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT    +    + +       P+     +E L S  +S++      DE+ D  E      
Sbjct  336   MTSTSVSSKARKLQGSSAHSGPS-----LESLNSGRNSVM-----MDEYSDDDEEQ----  381

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKG-YVDLQEVDSEESEPCCY  898
                              A+ ++  S+T +        V+++G  +DL           C+
Sbjct  382   ----------------GADTEQEGSSTGIENDIKKNVVEEQGDQIDLS----------CF  415

Query  899   GGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQD  1078
              GTL++D        W+  D ++F +R K +  D  KI A   LM +VA DW K  +R D
Sbjct  416   TGTLRRDDRDKARDCWSISDGNNFKVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDKKRMD  475

Query  1079  DLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGD  1258
              +A R G   Q   A ++  F +++N+QVPGS  YS+  Y++ K  L    LL+RFV+GD
Sbjct  476   HVARRKGCAAQ--VASEKGLFSVVINLQVPGSMHYSMVFYFVTKE-LVSGSLLQRFVDGD  532

Query  1259  DAFRNSRFKLIPYISKVS  1312
             D FRNSR KLIP + K S
Sbjct  533   DEFRNSRLKLIPSVPKGS  550


 Score = 47.0 bits (110),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  548   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  579



>gb|KCW78456.1| hypothetical protein EUGRSUZ_D026091, partial [Eucalyptus grandis]
Length=633

 Score =   175 bits (444),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 140/438 (32%), Positives = 217/438 (50%), Gaps = 47/438 (11%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ + E +F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W   
Sbjct  140   AMKAVGVVEASCEEIFGLVMSMDSTRFEWDSTFHTGSLVEEVDGHTAILYHRLQLDWFST  199

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPI--KLGK  364
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ   +RA ++SGG  I+P+  + G+
Sbjct  200   FVWPRDLCYVRYWRRNDDGSYVVLFRSREHVNCGPQPGCVRAHVESGGFNISPLQPRHGR  259

Query  365   ASV-VKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
                 V+H++ +D K W      +  +   ++ML  VA LRE F   +          +  
Sbjct  260   PRTQVQHLMQIDLKGWLVGYFPSFQQHCLLQMLNSVAGLREWFAQTDERIPPPRIPVMVN  319

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT    +    + +       P+     +E L S  +S++      DE+ D  E      
Sbjct  320   MTSTSVSSKARKLQGSSAHSGPS-----LESLNSGRNSVM-----MDEYSDDDEEQG---  366

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKG-YVDLQEVDSEESEPCCY  898
                              A+ ++  S+T +        V+++G  +DL           C+
Sbjct  367   -----------------ADTEQEGSSTGIENDIKKNVVEEQGDQIDLS----------CF  399

Query  899   GGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQD  1078
              GTL++D        W+  D ++F +R K +  D  KI A   LM +VA DW K  +R D
Sbjct  400   TGTLRRDDRDKARDCWSISDGNNFKVRSKHFCYDKSKIPAGKHLMDLVAVDWFKDKKRMD  459

Query  1079  DLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGD  1258
              +A R G   Q   A ++  F +++N+QVPGS  YS+  Y++ K  L    LL+RFV+GD
Sbjct  460   HVARRKGCAAQ--VASEKGLFSVVINLQVPGSMHYSMVFYFVTKE-LVSGSLLQRFVDGD  516

Query  1259  DAFRNSRFKLIPYISKVS  1312
             D FRNSR KLIP + K S
Sbjct  517   DEFRNSRLKLIPSVPKGS  534


 Score = 47.0 bits (110),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G  YL
Sbjct  532   KGSWIVRQSVGSTPCLLGKAVDCNYIRGPKYL  563



>gb|EYU29082.1| hypothetical protein MIMGU_mgv1a002092mg [Erythranthe guttata]
Length=716

 Score =   171 bits (434),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 137/438 (31%), Positives = 211/438 (48%), Gaps = 59/438 (13%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVG+++ T E VF  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  230   AMKAVGIVEATCEEVFELVMSMDATRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPT  289

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S VH+ C PQ  ++RA ++SGG  I+P+K     
Sbjct  290   CVWPRDLCYVRYWRRNDDGSYVVLFRSRVHENCGPQPGFVRAHIESGGFSISPLKPHNGR  349

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +      ++ML  VA LRE F   +   ++     +  
Sbjct  350   PRTQVQHLIQIDLKGWGVGYISSFQHHCLLQMLNCVAGLREYFSQTDERTAAPRIPVMVN  409

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT                  +  R +     +     SL  + +A      + E SD+D+
Sbjct  410   MT---------------SVSNSKRSKKLHSSVYHNGQSLDQIHAANRNAVLMDEYSDEDE  454

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
             +       A+SP    +   +KI+S                     +E   ++ +   + 
Sbjct  455   DFQYADQEASSPS-ATEVEDKKIAS---------------------EEESQDQVDLSIFS  492

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G L++D +     SW   D ++F +R K +  D  KI     LM +VA DW K  +R D 
Sbjct  493   GNLRRDGHDKARDSWMLSDGNNFRVRSKNFFCDKSKIPGSKHLMDLVAVDWFKDTKRMDH  552

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTT-YSLALYYMLKAPLEDTPLLERFVNGD  1258
             +A R G                    QVP STT YS+  Y++ KA ++ + LL+RFV+GD
Sbjct  553   VARRSGCAA-----------------QVPASTTHYSMVFYFVTKALVQGS-LLQRFVDGD  594

Query  1259  DAFRNSRFKLIPYISKVS  1312
             D FRNSR KLIP + K S
Sbjct  595   DDFRNSRLKLIPSVPKGS  612


 Score = 50.4 bits (119),  Expect(2) = 2e-48, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++ NY +G NYL
Sbjct  610   KGSWIVRQSVGSTPCLLGKAVDCNYIRGHNYL  641



>gb|KDO44679.1| hypothetical protein CISIN_1g0045761mg, partial [Citrus sinensis]
Length=168

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = +2

Query  773   ANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYGGTLQQDSNYSTPCSWAG  952
             A Q K++SA   +KK HDLAV KKG  DLQEV +E+ +   YG TLQ DS++++PCSWA 
Sbjct  2     APQSKLASAAGFVKKLHDLAVHKKGCTDLQEVPNEDEKSWSYGATLQTDSSFTSPCSWAA  61

Query  953   GDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDDLAGRPGGIVQKHAADDR  1132
              DPS+FLIRG+ Y KDH KIKA  TLMQM+ ADWL+S++R+D+LA RP  +VQK+AA   
Sbjct  62    ADPSTFLIRGENYLKDHRKIKADGTLMQMIGADWLRSNKREDNLAARPCSLVQKYAAGGG  121

Query  1133  PEFFLIVNIQVPG  1171
             PEFF +VNIQ PG
Sbjct  122   PEFFFVVNIQFPG  134



>ref|XP_002463332.1| hypothetical protein SORBIDRAFT_02g041955 [Sorghum bicolor]
 gb|EER99853.1| hypothetical protein SORBIDRAFT_02g041955 [Sorghum bicolor]
Length=805

 Score =   178 bits (452),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 139/437 (32%), Positives = 216/437 (49%), Gaps = 49/437 (11%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T EA+F  +MS+  +R EWD  F +GS++E +DGHT +++ +L  HW   
Sbjct  294   AMRAVGVVEATCEAIFGLMMSMDATRYEWDCSFRQGSLVEEVDGHTAVLYHRLQLHWCSR  353

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H  C  Q+ ++RA ++SGG  I P+K     
Sbjct  354   LIWPRDLCYVRYWRRNDDGSYVVLFRSTEHPNCNRQRGFVRAFIESGGFKICPLKSRNGR  413

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W  +   +      +++L  VA LRE F   +  H +    ++  
Sbjct  414   PRTQVQHLMQIDLKGWFLNYSTSFQYHSLLQILNCVAGLREYFSQTDDIHITPRIPAMES  473

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             M     A   E+    +    PT      E L ++    +  ES  DE Y V        
Sbjct  474   MADVNTAQKDEKLTEIDSNTKPT----DQEHLENKNMGTIDEESDDDEEYQV--------  521

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                        PE  ++  Q          + F ++  +    +DL           C+ 
Sbjct  522   -----------PEADIEVQQ----------RYFFNMTDEPPEKIDLS----------CFS  550

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G L  D +  +   W   D   F +R K +  D  +I A + LM++ A DW K  +R D+
Sbjct  551   GILHHDPDEKSRNCWTVPDSKLFKVRSKNFPNDKSEIPAASYLMELAAIDWYKDTKRMDN  610

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDD  1261
             + GR    V + AA+     F IVN+Q+PGST YS+ +Y+ + + L+   LL+RF +GDD
Sbjct  611   V-GRQKNCVAQIAAEKGMHTF-IVNLQIPGSTHYSMVMYF-VTSSLKKGSLLQRFFDGDD  667

Query  1262  AFRNSRFKLIPYISKVS  1312
              FRNSR KLIP + K S
Sbjct  668   DFRNSRLKLIPSVPKGS  684


 Score = 41.2 bits (95),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+AL+ +Y +  + L
Sbjct  682   KGSWIVRQSVGSSPCLLGKALDCSYVRTPSVL  713



>ref|XP_010918069.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Elaeis guineensis]
Length=619

 Score =   166 bits (421),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 143/438 (33%), Positives = 215/438 (49%), Gaps = 62/438 (14%)
 Frame = +2

Query  11    SIMAVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             ++ AVGV++ T EA+F  +MS+  +R EWD  F  GS++E +DGHT I++ +L   W P 
Sbjct  139   AMRAVGVVEATCEAIFEHVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLGWFPM  198

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA-  367
              +  RDL   RYWRR DDG+YV+L+ S  H  C PQ  ++RA ++SGG +I+P+K     
Sbjct  199   LVWPRDLCYVRYWRRNDDGSYVVLFRSREHPNCGPQPGFVRAHIESGGFIISPLKSRNGR  258

Query  368   --SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAE  541
               + V+H++ +D K W      +  +   ++ML  VA LRE F   + +H       +  
Sbjct  259   PRTQVQHLMQIDLKGWAVGYFPSFQQHCLLQMLNSVAGLREWFSQTDESHMVPRMPVMVN  318

Query  542   MTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSdddd  721
             MT +  A   +E + +E ++ P    D M    S  S ++  +S  DE Y + EP     
Sbjct  319   MTSN-SASSRKERKTQENSIQPNPSVDQMHS-ASRHSVMLDEDSDEDEDYQIPEPEQ---  373

Query  722   eegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYG  901
                             +A   K+ +   L  +      +  G +DL            + 
Sbjct  374   ----------------EAYPVKLENDIGLADE------EPSGQIDL----------AGFS  401

Query  902   GTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDD  1081
             G L++D    +   W   D ++F +R K +  D  KI A   LM++VA DW K  +R D 
Sbjct  402   GILRRDDRDKSRDCWRISDGNNFRVRSKHFTYDKTKIPAGKHLMELVAVDWFKDVKRMDH  461

Query  1082  LAGRPGGIVQKHAADDRPEFFLIVNIQ-VPGSTTYSLALYYMLKAPLEDTPLLERFVNGD  1258
             +A R G  VQ   A ++  F L +N+Q VPGS                   LL+RFV+GD
Sbjct  462   VARRKGCAVQ--VASEKGLFSLAINLQLVPGS-------------------LLQRFVDGD  500

Query  1259  DAFRNSRFKLIPYISKVS  1312
             D FRNSR KLIP + K S
Sbjct  501   DEFRNSRLKLIPSVPKGS  518


 Score = 44.7 bits (104),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G  YL
Sbjct  516   KGSWIVRQSVGSTPCLLGKAVDCTYIRGPKYL  547



>gb|KDP32754.1| hypothetical protein JCGZ_12046 [Jatropha curcas]
Length=294

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 136/218 (62%), Gaps = 8/218 (4%)
 Frame = +2

Query  473   ALREMFRAKEGNHSSNLSFSLAEMTI--DieapigeeerreegaVDPTRCEDGMEELLSE  646
             ALRE+F +++ N++  LS    E  +   IE    + E +    ++    ++ +E+    
Sbjct  3     ALRELFNSRDENYADFLSGDSTEQVVLPQIEKLDFKLEVKGSENIESNLTQNEVEKT---  59

Query  647   PSSLVGLESACDEFYDVLEPSddd--deegegWSSATSPEFCVDA-NQQKISSATTLMKK  817
              +SL  L S+ DEF+DV + +D    +  G  WSS  SPE    + +  ++SSA  ++KK
Sbjct  60    STSLTCLNSSPDEFFDVPDANDMMDFEHMGNDWSSKISPEIQTPSIHPPRLSSAAGIVKK  119

Query  818   FHDLAVQKKGYVDLQEVDSEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKK  997
              HDLAVQKKGY DL E   E+S  C +G TLQ+D   S PC+WA  +PSSFLIRG+ Y K
Sbjct  120   LHDLAVQKKGYTDLHEAAKEDSISCSFGSTLQKDPTCSLPCTWAAAEPSSFLIRGQNYLK  179

Query  998   DHEKIKAKNTLMQMVAADWLKSDRRQDDLAGRPGGIVQ  1111
             D EK+KAK TLMQMV ADWL+SD+R+DDL GRP  IVQ
Sbjct  180   DREKVKAKGTLMQMVGADWLRSDQREDDLGGRPESIVQ  217



>ref|XP_010687748.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=745

 Score =   164 bits (414),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 129/442 (29%), Positives = 201/442 (45%), Gaps = 46/442 (10%)
 Frame = +2

Query  14    IMAVGVIDETSEAVFRTLMSLGPSRS-EWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             + +VG+ID  +E VF  LMSL PSR  EWD       ++E +D H D+++      +  W
Sbjct  245   VKSVGIIDVRAETVFDILMSLEPSRRYEWDMLTSDLELVESIDAHYDVVYGTYDPKYFTW  304

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS  370
               ++RD +  R W R  DGTY IL    VH+KCP +  Y R  +      I  +    ++
Sbjct  305   WSSKRDFVFSRQWVRGQDGTYTILQFPAVHKKCPAKSGYQRTKINPSTWEIKDLDASDST  364

Query  371   ------VVKHMLAVD---WKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL  523
                   +V HML +    W  WK        +SI   +L  V+ L+E   A     +++ 
Sbjct  365   TESPRCLVTHMLEIQSDSWGTWKKSRSSKFEKSIPYALLCQVSGLKEYIGANPVLKNNSA  424

Query  524   SFSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLE  703
             +  L   + +      +             C+D                ++ DEFYD + 
Sbjct  425   TAVLTSKSSNNSVSSSD-------------CDD----------------ASADEFYDAIA  455

Query  704   PSddddeegegWSSATSPEFCVDANQQ-KISSATTLMKKFHDLAVQKKGYVDLQEVDSEE  880
                 +DE+ +        +     N    ++S +  M   HD +           V  E 
Sbjct  456   AGSSEDEDSDDDIEVEKKDHVTLENDSLDVASLSMKMASAHDASSILDSAT--SPVPIEL  513

Query  881   SEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLK  1060
             S+ C   G+L Q  +      W     + F+IRG  Y KD+ K++A + L++++A DWLK
Sbjct  514   SQFC---GSLHQGKDDDDINCWTNPGGAGFMIRGNTYLKDYAKVRAGDPLLKLIAVDWLK  570

Query  1061  SDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLE  1240
             +D+  D +A RP  +VQ  A    P F LI N+Q+P    Y+L  YY    P++ + LL 
Sbjct  571   ADQSIDKVALRPSCVVQSEAGRKLP-FILIFNLQIPSKPNYNLVFYYAADRPVKKSSLLG  629

Query  1241  RFVNGDDAFRNSRFKLIPYISK  1306
             +F++G D FR+SRFKLIP I K
Sbjct  630   KFIDGTDTFRDSRFKLIPSIVK  651


 Score = 41.2 bits (95),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G W+VK++VG KACL+G+A+   Y +  N+L
Sbjct  651   KGYWMVKRAVGSKACLLGKAVTCRYLRQDNFL  682



>ref|XP_010687749.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=741

 Score =   164 bits (414),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 129/442 (29%), Positives = 201/442 (45%), Gaps = 46/442 (10%)
 Frame = +2

Query  14    IMAVGVIDETSEAVFRTLMSLGPSRS-EWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             + +VG+ID  +E VF  LMSL PSR  EWD       ++E +D H D+++      +  W
Sbjct  241   VKSVGIIDVRAETVFDILMSLEPSRRYEWDMLTSDLELVESIDAHYDVVYGTYDPKYFTW  300

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS  370
               ++RD +  R W R  DGTY IL    VH+KCP +  Y R  +      I  +    ++
Sbjct  301   WSSKRDFVFSRQWVRGQDGTYTILQFPAVHKKCPAKSGYQRTKINPSTWEIKDLDASDST  360

Query  371   ------VVKHMLAVD---WKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNL  523
                   +V HML +    W  WK        +SI   +L  V+ L+E   A     +++ 
Sbjct  361   TESPRCLVTHMLEIQSDSWGTWKKSRSSKFEKSIPYALLCQVSGLKEYIGANPVLKNNSA  420

Query  524   SFSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLE  703
             +  L   + +      +             C+D                ++ DEFYD + 
Sbjct  421   TAVLTSKSSNNSVSSSD-------------CDD----------------ASADEFYDAIA  451

Query  704   PSddddeegegWSSATSPEFCVDANQQ-KISSATTLMKKFHDLAVQKKGYVDLQEVDSEE  880
                 +DE+ +        +     N    ++S +  M   HD +           V  E 
Sbjct  452   AGSSEDEDSDDDIEVEKKDHVTLENDSLDVASLSMKMASAHDASSILDSAT--SPVPIEL  509

Query  881   SEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLK  1060
             S+ C   G+L Q  +      W     + F+IRG  Y KD+ K++A + L++++A DWLK
Sbjct  510   SQFC---GSLHQGKDDDDINCWTNPGGAGFMIRGNTYLKDYAKVRAGDPLLKLIAVDWLK  566

Query  1061  SDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLE  1240
             +D+  D +A RP  +VQ  A    P F LI N+Q+P    Y+L  YY    P++ + LL 
Sbjct  567   ADQSIDKVALRPSCVVQSEAGRKLP-FILIFNLQIPSKPNYNLVFYYAADRPVKKSSLLG  625

Query  1241  RFVNGDDAFRNSRFKLIPYISK  1306
             +F++G D FR+SRFKLIP I K
Sbjct  626   KFIDGTDTFRDSRFKLIPSIVK  647


 Score = 41.2 bits (95),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G W+VK++VG KACL+G+A+   Y +  N+L
Sbjct  647   KGYWMVKRAVGSKACLLGKAVTCRYLRQDNFL  678



>ref|XP_001780427.1| predicted protein [Physcomitrella patens]
 gb|EDQ54717.1| predicted protein [Physcomitrella patens]
Length=743

 Score =   157 bits (398),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 136/441 (31%), Positives = 202/441 (46%), Gaps = 37/441 (8%)
 Frame = +2

Query  20    AVGVIDETSEAVFRTLMSLGPS-RSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPWGM  196
             +VGVID  +E +F  +MS     R +WD       ++E +DGHTDI++      +     
Sbjct  230   SVGVIDAAAETIFEHIMSFNTKMRYQWDMYMGNLELVEEIDGHTDIVYGSFDPKFFKRFQ  289

Query  197   NrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPI--KLGKAS  370
              + D L  R WRR+ DG+Y I      H+KCPP++ + R  +  G   I P+  K G  S
Sbjct  290   KKTDFLFSRVWRRDQDGSYSITQIFTTHKKCPPKRGFNRINISPGIWEIMPLPPKPGFGS  349

Query  371   ---VVKHMLAVD---WKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFS  532
                +V  M+ V    W  WK         +I   +L   A LRE+  A   N        
Sbjct  350   PRCLVTQMIEVKSTGWGRWKHSSFSKFLTTIPYILLCRTAGLRELVAANPDNTHLETQVK  409

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
               E+                 +VD  +   G+  LL+ P   +  E   +EFYD L    
Sbjct  410   TKEVK---------------KSVD-EQGLSGLNSLLTRPPDSLHAEPQ-EEFYDALMVEY  452

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPC  892
              D++E +   S  S +       + IS    +      L+  KK      E + + + P 
Sbjct  453   PDEDEDDAARSMLSKQRTASQKFKGISWGVVV-----GLSKSKKAPATRAEKELDWNFPA  507

Query  893   CY--GGTLQ---QDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
              +   G  Q   +  +  +   W+      F++R   Y  D  K    + L++++A DWL
Sbjct  508   VHFEDGVFQSGLRRCDGRSDHGWSDPGGKGFMVRSVTYNNDGLKTTGGDPLLKLLAVDWL  567

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             KSD+R D++A RP   VQ  A    P F LI+N+QVP S  YSL +Y++ + P+    LL
Sbjct  568   KSDKRIDNVAKRPSCCVQSDAGKKAP-FILIINLQVPASPNYSLVMYFVSERPIRQGSLL  626

Query  1238  ERFVNGDDAFRNSRFKLIPYI  1300
             +RF NGD+AFRNSRFKLIP I
Sbjct  627   DRFANGDNAFRNSRFKLIPSI  647


 Score = 46.6 bits (109),  Expect(2) = 4e-43, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G W+VK++VG KACL+G+A+  NYF+  N+L
Sbjct  649   EGYWVVKRAVGTKACLLGKAVTCNYFREDNFL  680



>ref|XP_003549700.1| PREDICTED: uncharacterized protein LOC100780025 isoform 1 [Glycine 
max]
Length=743

 Score =   160 bits (404),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 133/444 (30%), Positives = 197/444 (44%), Gaps = 58/444 (13%)
 Frame = +2

Query  20    AVGVIDETSEAVFRTLMSLGPS-RSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPWGM  196
             +VGVID T++ VF  ++S     R EWD       +I+  DGH D+++    + +L    
Sbjct  243   SVGVIDATADTVFEVILSTKQQKRYEWDTLMCDLELIDSYDGHYDVVYGTYDSKYLSRWH  302

Query  197   NrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS--  370
             +++D +  R W R  DGTY IL    +H+K P +  Y RA +      I  +    AS  
Sbjct  303   SKQDFVFSRQWFRGQDGTYTILQFPAIHKKKPQRSGYRRAKVNPSSWEIRNLNTSMASNS  362

Query  371   ---VVKHMLAV---DWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFS  532
                +V H L +    W  WK +      RSI   +L  V+ L+E   A    H  N +  
Sbjct  363   PRCLVTHTLEIHSTSWCRWKKNKSSKFERSIPYALLCQVSGLKEYIAANPALHHENATTI  422

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
             +     D              ++     ED M+                DEFYD +    
Sbjct  423   VHSKLSD-------------ASISSAEYEDEMQ----------------DEFYDAITA--  451

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFH----DLAVQKKGYVDL-QEVDSE  877
                       S+TS E   D  +  +  A   +K        LA+ +    DL +E+D  
Sbjct  452   ---------DSSTSDEESDDDQKLVLQEARVKLKNISWAITTLALMRTAAPDLTEELDPH  502

Query  878   ESE---PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
              +    P    G+L++ ++ +    WA      F+IRGK Y KD  K+   + L+++VA 
Sbjct  503   VTHITIPSDLHGSLRKGNDDNDTNCWASPSGKGFMIRGKNYLKDSSKVVGGDPLLKLVAV  562

Query  1049  DWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             DW   D+  D +A  P  +VQ  A    P F L++N+QVP    YSL LYY    P+   
Sbjct  563   DWFTVDKSADRIALHPKCLVQSEAGKTLP-FILVINLQVPAKPNYSLVLYYAADRPINKN  621

Query  1229  PLLERFVNGDDAFRNSRFKLIPYI  1300
              LL +FV+G DAFR+SRFKLIP I
Sbjct  622   SLLAKFVDGSDAFRDSRFKLIPSI  645


 Score = 43.5 bits (101),  Expect(2) = 6e-43, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G W+VK++VG KACL+G+A+   YF+  N+L
Sbjct  647   EGYWMVKRAVGTKACLLGKAVTCKYFRQDNFL  678



>gb|KHN18589.1| hypothetical protein glysoja_007002 [Glycine soja]
Length=743

 Score =   159 bits (402),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 133/444 (30%), Positives = 196/444 (44%), Gaps = 58/444 (13%)
 Frame = +2

Query  20    AVGVIDETSEAVFRTLMSL-GPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPWGM  196
             +VGVID T++ VF  ++S     R EWD       +I+  DGH D+++    + +L    
Sbjct  243   SVGVIDATADTVFEVILSTEQQKRYEWDTLMCDLELIDSYDGHYDVVYGTYDSKYLSRWH  302

Query  197   NrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS--  370
             +++D +  R W R  DGTY IL    +H+K P +  Y RA +      I  +    AS  
Sbjct  303   SKQDFVFSRQWFRGQDGTYTILQFPAIHKKKPQRSGYRRAKVNPSSWEIRNLNTSMASNS  362

Query  371   ---VVKHMLAV---DWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFS  532
                +V H L +    W  WK +      RSI   +L  V+ L+E   A    H  N +  
Sbjct  363   PRCLVTHTLEIHSTSWCRWKKNKSSKFERSIPYALLCQVSGLKEYIAANPALHHENGTTI  422

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
             +     D               +     ED M+                DEFYD +    
Sbjct  423   VHSKLSDAS-------------ISSAEYEDEMQ----------------DEFYDAITAD-  452

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFH----DLAVQKKGYVDL-QEVDSE  877
                       S+TS E   D  +  +  A   +K        LA+ +    DL +E+D  
Sbjct  453   ----------SSTSDEESDDDQKLVLQEARVKLKNISWAITTLALMRTAAPDLTEELDPH  502

Query  878   ESE---PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
              +    P    G+L++ ++ +    WA      F+IRGK Y KD  K+   + L+++VA 
Sbjct  503   VTHITIPSDLHGSLRKGNDDNDTNCWASPSGKGFMIRGKNYLKDSSKVVGGDPLLKLVAV  562

Query  1049  DWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             DW   D+  D +A  P  +VQ  A    P F L++N+QVP    YSL LYY    P+   
Sbjct  563   DWFTVDKSADRIALHPKCLVQSEAGKTLP-FILVINLQVPAKPNYSLVLYYAADRPINKN  621

Query  1229  PLLERFVNGDDAFRNSRFKLIPYI  1300
              LL +FV+G DAFR+SRFKLIP I
Sbjct  622   SLLAKFVDGSDAFRDSRFKLIPSI  645


 Score = 43.5 bits (101),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G W+VK++VG KACL+G+A+   YF+  N+L
Sbjct  647   EGYWMVKRAVGTKACLLGKAVTCKYFRQDNFL  678



>ref|XP_003542620.1| PREDICTED: uncharacterized protein LOC100801191 isoform 1 [Glycine 
max]
Length=747

 Score =   155 bits (391),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 130/444 (29%), Positives = 195/444 (44%), Gaps = 58/444 (13%)
 Frame = +2

Query  20    AVGVIDETSEAVFRTLMSL-GPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPWGM  196
             +VGVID T++ VF  ++S     R EWD       +I+  DGH D+++    + +L    
Sbjct  247   SVGVIDATADTVFEVILSTEQQKRYEWDTLMCDLELIDSYDGHYDVVYGTYDSKYLSRWH  306

Query  197   NrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS--  370
             +++D +  R W R  DGTY IL    +H+K P +  Y RA +      I  +    AS  
Sbjct  307   SKQDFVFSRQWFRGQDGTYTILQFPAIHKKKPQRSGYRRAKVNPSSWEIRNLNTSMASKS  366

Query  371   ---VVKHMLAV---DWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFS  532
                +V H L +    W  WK++      RSI   +L  V+ L+E   A    H  N +  
Sbjct  367   PRCLVTHTLEIHSSSWCQWKNNKSSKFERSIPYALLCQVSGLKEYIAANPALHHENGTTI  426

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
             +     D               +     ED M+                DEFYD +    
Sbjct  427   VHSKLSDAS-------------ISSAEYEDEMQ----------------DEFYDAITAD-  456

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFH----DLAVQKKGYVDL-QEVDSE  877
                       S+TS E   D  +  +      +K        LA+++    DL +E+D  
Sbjct  457   ----------SSTSDEESDDDQKLVLQEPRVKLKNISWAITTLALKRTAAPDLTEELDPH  506

Query  878   ESE---PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
              +    P    G+L +  + +    WA      F+IRGK Y KD  K+   + L++++A 
Sbjct  507   VTHITIPSDLHGSLCKGKDDNDTNCWASPSGKGFMIRGKNYLKDSSKVVGGDPLLKLIAV  566

Query  1049  DWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             DW   D+  D ++  P  +VQ  A    P F L++N+QVP    YSL LYY    P+   
Sbjct  567   DWFTVDKSADRISLHPKCLVQSEAGKKLP-FILVINLQVPAKPNYSLVLYYAADRPINKN  625

Query  1229  PLLERFVNGDDAFRNSRFKLIPYI  1300
              LL +FV+G DAFR+SRFKLIP I
Sbjct  626   SLLAKFVDGSDAFRDSRFKLIPSI  649


 Score = 43.5 bits (101),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G W+VK++VG KACL+G+A+   YF+  N+L
Sbjct  651   EGYWMVKRAVGTKACLLGKAVTCKYFRQDNFL  682



>ref|XP_004242555.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2 isoform X1 [Solanum 
lycopersicum]
Length=753

 Score =   155 bits (392),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 131/443 (30%), Positives = 195/443 (44%), Gaps = 51/443 (12%)
 Frame = +2

Query  14    IMAVGVIDETSEAVFRTLMSLGPSRS-EWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             + AVGV++ +++ VF  L+SL   R  EWD       +IE LDGH D+++  L    L W
Sbjct  250   VKAVGVVEASADTVFDVLLSLDRHRRYEWDMLTGDVELIESLDGHCDVVYGTLDLRKLSW  309

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIR----ACLKSGGHVITPIKL  358
               ++RD +  R W    DGTY IL+    ++K PP+  Y R    AC     ++ T   L
Sbjct  310   WQSKRDFVFSRRWFHGQDGTYTILHFPTEYKKRPPKSGYRRIKMIACSWEISNIGTSSSL  369

Query  359   GKA----SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLS  526
               A    +++  + +  W  WK++      R++   ML  VA L+E   A        L+
Sbjct  370   KPARCLVTLILEIRSKAWFKWKNNEFCKFERTLPFGMLSQVAGLKEYIGANPA-----LT  424

Query  527   FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEP  706
             F  + + +  +             +     ED M                 DEFYD +  
Sbjct  425   FESSTVVVQSKTSGVS--------ISSNELEDAM---------------GSDEFYDAIGT  461

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQE-----VD  871
                        SS       V + Q K      +      LA++K    D  +     V 
Sbjct  462   DSS--------SSDEDSGDEVSSKQDKKVKLKNVSWAIASLALKKTSAPDTSKELNPNVP  513

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
             S   +P  + GT++          W+    S F+IRGK Y KD  K+   + L++++A D
Sbjct  514   SLTLDPSQFHGTMRHAKGEGDSDCWSSPSGSGFMIRGKTYLKDSTKVTGGDPLLKLIAVD  573

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             W K D    ++A  P  IVQ  A    P F LI+N+QVP    YSL LYY    P+    
Sbjct  574   WFKVDECITNIALHPKCIVQSEAGKKIP-FVLIINLQVPAKPNYSLVLYYAADRPVNKDS  632

Query  1232  LLERFVNGDDAFRNSRFKLIPYI  1300
             LL +F++G D+FR+SRFKLIP I
Sbjct  633   LLGKFIDGTDSFRDSRFKLIPSI  655


 Score = 42.7 bits (99),  Expect(2) = 3e-41, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  1384  RQGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             R+G W+VK++VG KACL+G+A+   Y +  N+L
Sbjct  656   REGYWMVKRAVGTKACLLGKAVTCKYLRQDNFL  688



>gb|KHN22102.1| hypothetical protein glysoja_033416 [Glycine soja]
Length=747

 Score =   154 bits (389),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 130/444 (29%), Positives = 194/444 (44%), Gaps = 58/444 (13%)
 Frame = +2

Query  20    AVGVIDETSEAVFRTLMSL-GPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPWGM  196
             +VGVID T++ VF  ++S     R EWD       +I+  DGH D+++    + +L    
Sbjct  247   SVGVIDATADTVFEVILSTEQQKRYEWDTLMCDLELIDSYDGHYDVVYGTYDSKYLSRWH  306

Query  197   NrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS--  370
             +++D +  R W R  DGTY IL    +H+K P +  Y RA +      I  +    AS  
Sbjct  307   SKQDFVFSRQWFRGQDGTYTILQFPAIHKKKPQRSGYRRAKVNPSSWEIRNLNTSMASKS  366

Query  371   ---VVKHMLAV---DWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFS  532
                +V H L +    W  WK +      RSI   +L  V+ L+E   A    H  N +  
Sbjct  367   PRCLVTHTLEIHSSSWCQWKKNKSSKFERSIPYALLCQVSGLKEYIAANPALHHENGTTI  426

Query  533   LAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPSd  712
             +     D               +     ED M+                DEFYD +    
Sbjct  427   VHSKLSDAS-------------ISSAEYEDEMQ----------------DEFYDAITAD-  456

Query  713   dddeegegWSSATSPEFCVDANQQKISSATTLMKKFH----DLAVQKKGYVDL-QEVDSE  877
                       S+TS E   D  +  +      +K        LA+++    DL +E+D  
Sbjct  457   ----------SSTSDEESDDDQKLVLQEPRVKLKNISWAITTLALKRTAAPDLTEELDPH  506

Query  878   ESE---PCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAA  1048
              +    P    G+L +  + +    WA      F+IRGK Y KD  K+   + L++++A 
Sbjct  507   VTHITIPSDLHGSLCKGKDDNDTNCWASPSGKGFMIRGKNYLKDSSKVVGGDPLLKLIAV  566

Query  1049  DWLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDT  1228
             DW   D+  D ++  P  +VQ  A    P F L++N+QVP    YSL LYY    P+   
Sbjct  567   DWFTVDKSADRISLHPKCLVQSEAGKKLP-FILVINLQVPAKPNYSLVLYYAADRPINKN  625

Query  1229  PLLERFVNGDDAFRNSRFKLIPYI  1300
              LL +FV+G DAFR+SRFKLIP I
Sbjct  626   SLLAKFVDGSDAFRDSRFKLIPSI  649


 Score = 43.5 bits (101),  Expect(2) = 3e-41, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G W+VK++VG KACL+G+A+   YF+  N+L
Sbjct  651   EGYWMVKRAVGTKACLLGKAVTCKYFRQDNFL  682



>ref|XP_006343695.1| PREDICTED: uncharacterized protein LOC102603249 [Solanum tuberosum]
Length=744

 Score =   152 bits (384),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 129/443 (29%), Positives = 194/443 (44%), Gaps = 51/443 (12%)
 Frame = +2

Query  14    IMAVGVIDETSEAVFRTLMSLGP-SRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             + AV V++ +++ VF  L+SL    R EWD       +IE LDGH D+++  L    L W
Sbjct  241   VKAVAVVEASADTVFDVLLSLDRHQRYEWDTLTGDVELIESLDGHCDVVYGTLDLRKLSW  300

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIR----ACLKSGGHVITPIKL  358
               ++RD +  R W    DGTY IL+    ++K PP+  Y R    AC     ++ T   L
Sbjct  301   WQSKRDFVFSRRWFHGQDGTYTILHFPTEYKKRPPKSGYRRIKMIACSWEISNIGTSSSL  360

Query  359   GKA----SVVKHMLAVDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLS  526
               A    +++  + +  W  WK++      R++   ML  VA L+E   A        L+
Sbjct  361   KPARCLVTLILEIRSKAWFKWKNNEFCKFERTLPFGMLSQVAGLKEYIGANPA-----LT  415

Query  527   FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEP  706
             F  + + +  +             +     ED M                 DEFYD +  
Sbjct  416   FESSTVVVQSKTSGVS--------ISSNELEDAM---------------GSDEFYDAIGT  452

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQ-----EVD  871
                        SS       V + Q K      +      LA++K    D       +V 
Sbjct  453   DSS--------SSDEDSGDEVSSKQDKKVKLKNVSWAIASLALKKTSAPDTSKELNPDVP  504

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
             S   +P  + GT++          W+    S F+IRGK Y KD  K+   + L++++A D
Sbjct  505   SLTLDPSQFHGTMRHAKGEGDSDCWSSPSGSGFMIRGKTYLKDSTKVTGGDPLLKLIAVD  564

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             W K D    ++A  P  +VQ  A    P F LI+N+QVP    YSL LYY    P+    
Sbjct  565   WFKVDECITNIALHPKCLVQSEAGKKTP-FVLIINLQVPAKPNYSLVLYYAADRPVNKDS  623

Query  1232  LLERFVNGDDAFRNSRFKLIPYI  1300
             LL +F++G D+FR+SRFKLIP I
Sbjct  624   LLGKFIDGTDSFRDSRFKLIPSI  646


 Score = 42.7 bits (99),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  1384  RQGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             R+G W+VK++VG KACL+G+A+   Y +  N+L
Sbjct  647   REGYWMVKRAVGTKACLLGKAVTCKYLRQDNFL  679



>ref|XP_001768121.1| predicted protein [Physcomitrella patens]
 gb|EDQ66994.1| predicted protein [Physcomitrella patens]
Length=837

 Score =   152 bits (384),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 124/443 (28%), Positives = 206/443 (47%), Gaps = 61/443 (14%)
 Frame = +2

Query  20    AVGVIDETSEAVFRTLMSLGPSRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPWGMN  199
             AVGV+  +++ +F  +M  GP R +WD  F+  SVIE +DGH+D+++++L   W   G +
Sbjct  313   AVGVVKASADQIFNLVMEYGPERQQWDHTFESASVIEIVDGHSDVLYIRLRQDW---GFS  369

Query  200   rrdlllrryw-rreddGTYV------ILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKL  358
             R   L    + +RE+ G Y       + Y S    K P Q  Y+RA + SGG++ITP+K 
Sbjct  370   RARDLCLARYWKREETGAYCEWSNTPVFYRSF--HKYPLQAGYVRAYIHSGGYIITPLKT  427

Query  359   GKA------SVVKHMLAVDWKCWKSHL-KQASSRSITIR--MLGVVAALREMFRAKEGNH  511
                      S+V+ +L +D   W S L  + S     +R  +L VVA +RE   A    H
Sbjct  428   TDGGSEKPCSLVEAVLEMDTAGWSSLLGARISGYPAYLRDSLLSVVAGIREHIDA----H  483

Query  512   SSNLSFSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFY  691
             S N   ++ +  I  +                T   D  E ++S  +  +      +E++
Sbjct  484   SINFRATIIKRHIVEQDTEDYAH---------TANHDLSETVVSN-APFLSTSDDIEEYF  533

Query  692   DVLEPSddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVD  871
             D                         + +Q   SS +   +    +   K   + +Q  +
Sbjct  534   DA------------------------NMDQFSESSESVYEQALSAVEPPKLPRIKVQS-E  568

Query  872   SEESEPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
              E  +   + G +++        S+A  D S+FL++G  +     +  A   + +++  D
Sbjct  569   LETFDLSKFSGNVERGPLKGGKHSFAEPDSSAFLLKGINFLSTGSRAPAGEPICKLLGVD  628

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             WLK   R D +AG P   VQ+ A  +   FF I+N+Q P ++ YSL  Y++ +  + +  
Sbjct  629   WLKCKDRMDHVAGMPRSFVQR-ACSNEGLFFFIINLQFPHTSNYSLVFYFVTEEDITEGS  687

Query  1232  LLERFVNGDDAFRNSRFKLIPYI  1300
             +L RF++GDDAFRNSRF LIP I
Sbjct  688   VLHRFISGDDAFRNSRFSLIPAI  710


 Score = 40.8 bits (94),  Expect(2) = 8e-40, Method: Composition-based stats.
 Identities = 17/31 (55%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +1

Query  1390  GSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             GSWIV+Q+VG KA  +GQ +E  Y  G NY+
Sbjct  741   GSWIVRQAVGTKAVPLGQIVETKYHVGFNYM  771



>emb|CBI38216.3| unnamed protein product [Vitis vinifera]
Length=640

 Score =   147 bits (372),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/365 (31%), Positives = 171/365 (47%), Gaps = 58/365 (16%)
 Frame = +2

Query  245   GTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKA---SVVKHMLAVDWKCWKS  415
             G+YV+L+ S  H+ C PQ  ++RA ++SGG  I+P+K       S V+H++ +D K W  
Sbjct  214   GSYVVLFRSREHEHCGPQPGFVRAHIESGGFNISPLKPRHGRPRSKVQHLMQIDLKGWGV  273

Query  416   HLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSFSLAEMTIDieapigeeerreeg  595
                 +  +   ++ML  VA LRE F   +  H++     +  MT                
Sbjct  274   GYLSSFKQHCLLQMLNGVAGLREWFSQSDERHTAPRIPVMINMT--------------SA  319

Query  596   aVDPTRCEDGMEELLSEPSSLVGLESA------CDEFYDVLEPSddddeegegWSSATSP  757
             +V   + ++  E       SL  L SA       DEF D  E                  
Sbjct  320   SVSSQKNQENQEPAGKGFPSLDELHSASRNSMMLDEFSDEDE------------------  361

Query  758   EFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEESEPCCYGGTLQQDSNYSTP  937
             EF V   +Q+              A  +     L+E  +++ +  C+ G L+++ N    
Sbjct  362   EFQVAEVEQE--------------AYNEVEQTALEEDPTDQIDLSCFSGNLRRNDNDDGR  407

Query  938   CSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWLKSDRRQDDLAGRPGGIVQKH  1117
               W   D ++F +R K +  D  KI A    M++VA DWLK  +R D +A RPG  VQ  
Sbjct  408   DCWTISDGNNFRVRSKHFFSDKSKIPAGKHTMELVAVDWLKDIKRIDHVARRPGCAVQ--  465

Query  1118  AADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLLERFVNGDDAFRNSRFKLIPY  1297
              A ++  F L +N+QVPGST YS+ ++Y++   L    LL+ FV+GDD FRNSR KLIP 
Sbjct  466   VASEKGLFSLAINLQVPGSTHYSM-VFYLVTKQLVPGSLLQCFVDGDDEFRNSRLKLIPS  524

Query  1298  ISKVS  1312
             + K S
Sbjct  525   VPKGS  529


 Score = 44.7 bits (104),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +GSWIV+QSVG   CL+G+A++  Y +G  YL
Sbjct  527   KGSWIVRQSVGSTPCLLGKAVDCTYIRGPKYL  558



>ref|XP_010049876.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X2 [Eucalyptus grandis]
Length=740

 Score =   148 bits (374),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 123/443 (28%), Positives = 202/443 (46%), Gaps = 52/443 (12%)
 Frame = +2

Query  14    IMAVGVIDETSEAVFRTLMSLGPSRS-EWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             + +VGV+D +++ VF  L++L   R  EWD       ++E  DGH D+++      +L  
Sbjct  238   VKSVGVVDASADTVFEVLLNLERQRRYEWDPFTSDLELVESYDGHYDVVYGTYDPKYLAR  297

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS  370
               ++RD +  R W    DGTY IL   V H+K P +  Y R  L      I+ I     +
Sbjct  298   WQSKRDFVFSRQWFHAQDGTYTILQLPVAHKKRPTKSGYRRTTLNPSTWEISSINTPMGT  357

Query  371   VVKHMLA--------VDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLS  526
              +   L         + W  WK+       ++I   ++  V+ L+E     E N S  + 
Sbjct  358   NIAKCLVTQTLEIHEIGWMRWKNSHCSKFEKTIPYALMCQVSGLKEYI---EANPSLKVQ  414

Query  527   FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEP  706
              S+A                    V  ++  +     +S PSS    +   DEFYD +  
Sbjct  415   SSMA--------------------VVQSKVSN-----ISIPSSEYEEQDLRDEFYDAIST  449

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDL-QEVDSEES  883
                 +         +  E      + ++ +    ++ F   +++K   +D  +E+D   +
Sbjct  450   DSSSE------EDESDDEETDHKAKVRLKNVAWAIRSF---SLKKSSVIDANKELDPRVA  500

Query  884   ----EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
                 +P  + G+L +  + S    WA    + F+IRGK Y KD+ K+   + L++++A D
Sbjct  501   PATIDPSNFHGSLHKGKDDSDTNCWASPSGAGFMIRGKNYLKDNNKVIGGDPLLKLLAVD  560

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             WLK D + D +A  P  +VQ  A    P F L++N+Q+P    YSL +YY    P+    
Sbjct  561   WLKVDEKMDRIALHPKCLVQSEAGKKLP-FILVINLQIPARPNYSLVIYYASDRPVNKDS  619

Query  1232  LLERFVNGDDAFRNSRFKLIPYI  1300
             LL +FV+G DAFR+SRFKLIP I
Sbjct  620   LLGKFVDGSDAFRDSRFKLIPSI  642


 Score = 43.5 bits (101),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G W+VK++VG KACL+G+A+  NY +  N+L
Sbjct  644   EGYWMVKRAVGTKACLLGKAVTCNYLRQDNFL  675



>ref|XP_010049875.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like isoform 
X1 [Eucalyptus grandis]
Length=754

 Score =   148 bits (373),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 123/443 (28%), Positives = 202/443 (46%), Gaps = 52/443 (12%)
 Frame = +2

Query  14    IMAVGVIDETSEAVFRTLMSLGPSRS-EWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             + +VGV+D +++ VF  L++L   R  EWD       ++E  DGH D+++      +L  
Sbjct  252   VKSVGVVDASADTVFEVLLNLERQRRYEWDPFTSDLELVESYDGHYDVVYGTYDPKYLAR  311

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS  370
               ++RD +  R W    DGTY IL   V H+K P +  Y R  L      I+ I     +
Sbjct  312   WQSKRDFVFSRQWFHAQDGTYTILQLPVAHKKRPTKSGYRRTTLNPSTWEISSINTPMGT  371

Query  371   VVKHMLA--------VDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLS  526
              +   L         + W  WK+       ++I   ++  V+ L+E     E N S  + 
Sbjct  372   NIAKCLVTQTLEIHEIGWMRWKNSHCSKFEKTIPYALMCQVSGLKEYI---EANPSLKVQ  428

Query  527   FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEP  706
              S+A                    V  ++  +     +S PSS    +   DEFYD +  
Sbjct  429   SSMA--------------------VVQSKVSN-----ISIPSSEYEEQDLRDEFYDAIST  463

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDL-QEVDSEES  883
                 +         +  E      + ++ +    ++ F   +++K   +D  +E+D   +
Sbjct  464   DSSSE------EDESDDEETDHKAKVRLKNVAWAIRSF---SLKKSSVIDANKELDPRVA  514

Query  884   ----EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
                 +P  + G+L +  + S    WA    + F+IRGK Y KD+ K+   + L++++A D
Sbjct  515   PATIDPSNFHGSLHKGKDDSDTNCWASPSGAGFMIRGKNYLKDNNKVIGGDPLLKLLAVD  574

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             WLK D + D +A  P  +VQ  A    P F L++N+Q+P    YSL +YY    P+    
Sbjct  575   WLKVDEKMDRIALHPKCLVQSEAGKKLP-FILVINLQIPARPNYSLVIYYASDRPVNKDS  633

Query  1232  LLERFVNGDDAFRNSRFKLIPYI  1300
             LL +FV+G DAFR+SRFKLIP I
Sbjct  634   LLGKFVDGSDAFRDSRFKLIPSI  656


 Score = 43.5 bits (101),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G W+VK++VG KACL+G+A+  NY +  N+L
Sbjct  658   EGYWMVKRAVGTKACLLGKAVTCNYLRQDNFL  689



>gb|KCW82684.1| hypothetical protein EUGRSUZ_C040621, partial [Eucalyptus grandis]
Length=724

 Score =   148 bits (373),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 123/443 (28%), Positives = 202/443 (46%), Gaps = 52/443 (12%)
 Frame = +2

Query  14    IMAVGVIDETSEAVFRTLMSLGPSRS-EWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             + +VGV+D +++ VF  L++L   R  EWD       ++E  DGH D+++      +L  
Sbjct  252   VKSVGVVDASADTVFEVLLNLERQRRYEWDPFTSDLELVESYDGHYDVVYGTYDPKYLAR  311

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS  370
               ++RD +  R W    DGTY IL   V H+K P +  Y R  L      I+ I     +
Sbjct  312   WQSKRDFVFSRQWFHAQDGTYTILQLPVAHKKRPTKSGYRRTTLNPSTWEISSINTPMGT  371

Query  371   VVKHMLA--------VDWKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLS  526
              +   L         + W  WK+       ++I   ++  V+ L+E     E N S  + 
Sbjct  372   NIAKCLVTQTLEIHEIGWMRWKNSHCSKFEKTIPYALMCQVSGLKEYI---EANPSLKVQ  428

Query  527   FSLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEP  706
              S+A                    V  ++  +     +S PSS    +   DEFYD +  
Sbjct  429   SSMA--------------------VVQSKVSN-----ISIPSSEYEEQDLRDEFYDAIST  463

Query  707   SddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDL-QEVDSEES  883
                 +         +  E      + ++ +    ++ F   +++K   +D  +E+D   +
Sbjct  464   DSSSE------EDESDDEETDHKAKVRLKNVAWAIRSF---SLKKSSVIDANKELDPRVA  514

Query  884   ----EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAAD  1051
                 +P  + G+L +  + S    WA    + F+IRGK Y KD+ K+   + L++++A D
Sbjct  515   PATIDPSNFHGSLHKGKDDSDTNCWASPSGAGFMIRGKNYLKDNNKVIGGDPLLKLLAVD  574

Query  1052  WLKSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTP  1231
             WLK D + D +A  P  +VQ  A    P F L++N+Q+P    YSL +YY    P+    
Sbjct  575   WLKVDEKMDRIALHPKCLVQSEAGKKLP-FILVINLQIPARPNYSLVIYYASDRPVNKDS  633

Query  1232  LLERFVNGDDAFRNSRFKLIPYI  1300
             LL +FV+G DAFR+SRFKLIP I
Sbjct  634   LLGKFVDGSDAFRDSRFKLIPSI  656


 Score = 43.1 bits (100),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  1387  QGSWIVKQSVGKKACLIGQALEVNYFKGKNYL  1482
             +G W+VK++VG KACL+G+A+  NY +  N+L
Sbjct  658   EGYWMVKRAVGTKACLLGKAVTCNYLRQDNFL  689



>ref|XP_003574547.1| PREDICTED: protein ENHANCED DISEASE RESISTANCE 2-like [Brachypodium 
distachyon]
Length=768

 Score =   160 bits (406),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 129/441 (29%), Positives = 203/441 (46%), Gaps = 43/441 (10%)
 Frame = +2

Query  14    IMAVGVIDETSEAVFRTLMSLGP-SRSEWDFCFDRGSVIEHLDGHTDIIHLQLYNHWLPW  190
             + +VGV+    + VF  ++SL    R EWD       ++E +DG+ D+++      +L W
Sbjct  263   LKSVGVVGANPDTVFEMVLSLDKHKRYEWDMLIADLELVETIDGYYDVVYGTYEPKYLNW  322

Query  191   GMNrrdlllrrywrreddGTYVILYHSVVHQKCPPQKDYIRACLKSGGHVITPIKLGKAS  370
               +++D +  R W R  DG Y IL   V H+K PPQ  Y R  +      I  +    +S
Sbjct  323   WKSKKDFVFSRQWFRAQDGAYNILQSPVSHKKKPPQHGYERTHINPTTWEIRRLDTSGSS  382

Query  371   ----VVKHMLAVD---WKCWKSHLKQASSRSITIRMLGVVAALREMFRAKEGNHSSNLSF  529
                 VV  M+ +    W  WK        RSI   +L  VA LRE F A        L+ 
Sbjct  383   TPKCVVTRMVEISLSFWDRWKRRTSSQFDRSIPFALLSQVAGLREYFAANPA-----LTS  437

Query  530   SLAEMTIDieapigeeerreegaVDPTRCEDGMEELLSEPSSLVGLESACDEFYDVLEPS  709
              L    +  +A             +P   +  +E+  SEP+         DEFYD L   
Sbjct  438   DLPSTVVKPKAS------------EPLIIQSELED--SEPN---------DEFYDALVRG  474

Query  710   ddddeegegWSSATSPEFCVDANQQKISSATTLMKKFHDLAVQKKGYVDLQEVDSEES--  883
             +  ++E               A + K+ + +  +  F     + K  ++  E+ +     
Sbjct  475   ESFEDEDSDDDDDDDGVTTPTAGKVKLKNVSWAIAGFA--MKRSKASLERSELVTNSIPI  532

Query  884   --EPCCYGGTLQQDSNYSTPCSWAGGDPSSFLIRGKKYKKDHEKIKAKNTLMQMVAADWL  1057
               +P  + GT+++  +   P SW+      F+IRGK Y  D+ KI   + L++++A DW 
Sbjct  533   TFDPSHFHGTIRRAKSEDDPNSWSVPGGEKFMIRGKTYLTDNTKIAGGDPLLKLIAVDWF  592

Query  1058  KSDRRQDDLAGRPGGIVQKHAADDRPEFFLIVNIQVPGSTTYSLALYYMLKAPLEDTPLL  1237
             K + R D +A  P  +VQ  AA   P F L++N+QVP    Y+L +YY  + P+    LL
Sbjct  593   KVNDRFDSVALHPKSLVQSEAAKKIP-FILVINLQVPAKPNYNLVMYYAAEKPVNKESLL  651

Query  1238  ERFVNGDDAFRNSRFKLIPYI  1300
              RF++G DAFR++RFKLIP I
Sbjct  652   GRFIDGTDAFRDARFKLIPSI  672



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4149312926759