BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24037_g4_i1 len=964 path=[6132:0-144 6277:145-963]

Length=964
                                                                      Score     E

ref|XP_009762542.1|  PREDICTED: probable receptor-like protein ki...    357   6e-117   
ref|XP_009625543.1|  PREDICTED: probable receptor-like protein ki...    356   1e-116   
ref|XP_006348329.1|  PREDICTED: probable receptor-like protein ki...    352   4e-115   
ref|XP_004244293.1|  PREDICTED: probable receptor-like protein ki...    343   2e-111   
ref|XP_006367684.1|  PREDICTED: probable receptor-like protein ki...    335   6e-110   
ref|XP_009623498.1|  PREDICTED: probable receptor-like protein ki...    333   9e-109   
ref|XP_009797897.1|  PREDICTED: probable receptor-like protein ki...    331   2e-108   
ref|XP_006352026.1|  PREDICTED: probable receptor-like protein ki...    328   5e-107   
ref|XP_004251495.1|  PREDICTED: probable receptor-like protein ki...    327   9e-107   
ref|XP_011081342.1|  PREDICTED: probable receptor-like protein ki...    311   1e-100   
ref|XP_010661966.1|  PREDICTED: probable LRR receptor-like serine...    317   4e-99    
ref|XP_010250833.1|  PREDICTED: probable receptor-like protein ki...    308   6e-98    
ref|XP_007039261.1|  LRR receptor-like serine/threonine-protein k...    301   4e-95    
ref|XP_009373678.1|  PREDICTED: probable receptor-like protein ki...    301   5e-95    
ref|XP_008239292.1|  PREDICTED: probable receptor-like protein ki...    300   1e-94    
ref|XP_010053995.1|  PREDICTED: probable receptor-like protein ki...    300   2e-94    
ref|XP_007209984.1|  hypothetical protein PRUPE_ppa005138mg             298   1e-93    
gb|KCW78373.1|  hypothetical protein EUGRSUZ_D02544                     297   3e-93    
ref|XP_008392679.1|  PREDICTED: probable receptor-like protein ki...    295   2e-92    
ref|XP_011004390.1|  PREDICTED: probable receptor-like protein ki...    290   7e-92    
ref|XP_009397858.1|  PREDICTED: probable receptor-like protein ki...    290   9e-92    
ref|XP_002518971.1|  receptor protein kinase, putative                  295   1e-91    Ricinus communis
ref|XP_004953286.1|  PREDICTED: probable receptor-like protein ki...    288   3e-91    
ref|XP_002317644.2|  hypothetical protein POPTR_0011s15020g             288   5e-91    Populus trichocarpa [western balsam poplar]
ref|XP_009382326.1|  PREDICTED: probable receptor-like protein ki...    287   7e-91    
ref|XP_008375434.1|  PREDICTED: probable receptor-like protein ki...    289   1e-90    
ref|XP_009360263.1|  PREDICTED: probable receptor-like protein ki...    290   2e-90    
ref|XP_009393911.1|  PREDICTED: probable receptor-like protein ki...    286   3e-90    
ref|XP_002452840.1|  hypothetical protein SORBIDRAFT_04g033400          286   3e-90    Sorghum bicolor [broomcorn]
ref|NP_001149562.1|  protein kinase APK1A                               284   1e-89    Zea mays [maize]
ref|XP_011070699.1|  PREDICTED: probable receptor-like protein ki...    282   3e-89    
gb|KHG08600.1|  hypothetical protein F383_14918                         283   3e-89    
ref|XP_011038067.1|  PREDICTED: probable receptor-like protein ki...    285   6e-89    
ref|XP_010933767.1|  PREDICTED: probable receptor-like protein ki...    283   7e-89    
gb|KDO76826.1|  hypothetical protein CISIN_1g017627mg                   282   8e-89    
ref|XP_006439156.1|  hypothetical protein CICLE_v10020714mg             282   8e-89    
ref|XP_009400981.1|  PREDICTED: probable receptor-like protein ki...    281   1e-88    
gb|KDP25190.1|  hypothetical protein JCGZ_20346                         281   2e-88    
ref|XP_006476228.1|  PREDICTED: probable receptor-like protein ki...    280   4e-88    
ref|XP_008791632.1|  PREDICTED: probable receptor-like protein ki...    280   6e-88    
ref|NP_001146250.1|  uncharacterized LOC100279823                       279   7e-88    Zea mays [maize]
ref|XP_002298989.1|  hypothetical protein POPTR_0001s45900g             279   1e-87    Populus trichocarpa [western balsam poplar]
ref|XP_010542358.1|  PREDICTED: probable receptor-like protein ki...    278   2e-87    
ref|XP_003572762.1|  PREDICTED: probable receptor-like protein ki...    278   2e-87    
ref|XP_010542343.1|  PREDICTED: probable receptor-like protein ki...    277   3e-87    
gb|EYU35606.1|  hypothetical protein MIMGU_mgv1a0221941mg               275   2e-86    
ref|XP_008796890.1|  PREDICTED: probable receptor-like protein ki...    275   7e-86    
ref|XP_010919361.1|  PREDICTED: probable receptor-like protein ki...    275   8e-86    
ref|XP_010538891.1|  PREDICTED: probable receptor-like protein ki...    273   9e-86    
ref|NP_001053443.1|  Os04g0540900                                       273   1e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004166375.1|  PREDICTED: probable receptor-like protein ki...    272   1e-85    
ref|XP_004309559.1|  PREDICTED: probable receptor-like protein ki...    283   2e-85    
ref|XP_004145888.1|  PREDICTED: probable receptor-like protein ki...    273   2e-85    
gb|EAY86898.1|  hypothetical protein OsI_08281                          270   1e-84    Oryza sativa Indica Group [Indian rice]
ref|XP_006305209.1|  hypothetical protein CARUB_v10009575mg             270   2e-84    
ref|XP_010478743.1|  PREDICTED: probable receptor-like protein ki...    270   4e-84    
ref|NP_001047579.1|  Os02g0648100                                       270   4e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002464377.1|  hypothetical protein SORBIDRAFT_01g017150          269   5e-84    Sorghum bicolor [broomcorn]
ref|XP_010499866.1|  PREDICTED: probable receptor-like protein ki...    269   8e-84    
gb|EYU19451.1|  hypothetical protein MIMGU_mgv1a009696mg                267   2e-83    
ref|XP_006415115.1|  hypothetical protein EUTSA_v10008055mg             268   2e-83    
ref|XP_010677489.1|  PREDICTED: probable receptor-like protein ki...    267   2e-83    
ref|XP_010530420.1|  PREDICTED: probable receptor-like protein ki...    267   3e-83    
gb|EMT05618.1|  Putative LRR receptor-like serine/threonine-prote...    267   3e-83    
ref|XP_010461144.1|  PREDICTED: probable receptor-like protein ki...    267   3e-83    
ref|XP_009123751.1|  PREDICTED: probable receptor-like protein ki...    266   4e-83    
ref|XP_006652593.1|  PREDICTED: probable receptor-like protein ki...    266   7e-83    
ref|XP_008437495.1|  PREDICTED: probable receptor-like protein ki...    266   8e-83    
ref|XP_006647607.1|  PREDICTED: probable receptor-like protein ki...    266   8e-83    
gb|KFK45060.1|  hypothetical protein AALP_AA1G338600                    266   9e-83    
emb|CBI34647.3|  unnamed protein product                                268   1e-82    
ref|NP_973956.1|  probable receptor-like protein kinase                 266   1e-82    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564421.3|  probable receptor-like protein kinase                 265   1e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010110419.1|  putative receptor-like protein kinase              266   2e-82    
ref|XP_002891037.1|  hypothetical protein ARALYDRAFT_313871             270   3e-82    
gb|KFK31987.1|  hypothetical protein AALP_AA6G185500                    264   4e-82    
ref|XP_006397068.1|  hypothetical protein EUTSA_v10028779mg             264   5e-82    
ref|XP_004982611.1|  PREDICTED: probable receptor-like protein ki...    262   3e-81    
emb|CDX93783.1|  BnaA09g23830D                                          261   3e-81    
emb|CDY60675.1|  BnaCnng36800D                                          261   4e-81    
emb|CDY05951.1|  BnaC08g21280D                                          261   5e-81    
gb|AFW68394.1|  putative protein kinase superfamily protein             261   7e-81    
gb|ACG28233.1|  protein kinase domain containing protein                261   1e-80    Zea mays [maize]
ref|XP_010455437.1|  PREDICTED: probable receptor-like protein ki...    260   1e-80    
ref|NP_001152612.1|  protein kinase domain containing protein           260   2e-80    Zea mays [maize]
ref|NP_192777.1|  probable receptor-like protein kinase                 259   2e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874624.1|  kinase family protein                              259   4e-80    
gb|AAG51288.1|AC027035_11  protein kinase, putative                     265   4e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288116.1|  hypothetical protein CARUB_v10001348mg             258   6e-80    
ref|XP_009128714.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    258   9e-80    
ref|XP_010050622.1|  PREDICTED: probable receptor-like protein ki...    258   2e-79    
ref|XP_010437137.1|  PREDICTED: probable receptor-like protein ki...    257   2e-79    
ref|XP_010056100.1|  PREDICTED: probable receptor-like protein ki...    257   5e-79    
emb|CDP04937.1|  unnamed protein product                                254   5e-79    
ref|XP_010056102.1|  PREDICTED: probable receptor-like protein ki...    256   9e-79    
ref|XP_010110420.1|  putative receptor-like protein kinase              256   1e-78    
dbj|BAJ89974.1|  predicted protein                                      255   2e-78    
ref|XP_003574174.1|  PREDICTED: probable receptor-like protein ki...    254   2e-78    
dbj|BAJ91974.1|  predicted protein                                      253   6e-78    
ref|XP_010421958.1|  PREDICTED: probable receptor-like protein ki...    253   7e-78    
gb|ACG35382.1|  leucine-rich repeat receptor protein kinase EXS p...    253   1e-77    Zea mays [maize]
gb|AAK39595.1|AC025296_30  putative receptor protein kinase             252   4e-77    Oryza sativa [red rice]
ref|XP_010941089.1|  PREDICTED: probable receptor-like protein ki...    249   6e-76    
tpg|DAA36645.1|  TPA: putative protein kinase superfamily protein       247   2e-75    
gb|EAY79203.1|  hypothetical protein OsI_34316                          245   3e-75    Oryza sativa Indica Group [Indian rice]
dbj|BAJ85198.1|  predicted protein                                      246   4e-75    
gb|KCW72672.1|  hypothetical protein EUGRSUZ_E01128                     246   4e-75    
ref|XP_010056099.1|  PREDICTED: probable receptor-like protein ki...    246   6e-75    
gb|EAZ16683.1|  hypothetical protein OsJ_32158                          244   8e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008669073.1|  PREDICTED: probable receptor-like protein ki...    247   2e-74    
ref|XP_004976401.1|  PREDICTED: probable receptor-like protein ki...    243   6e-74    
ref|NP_001048733.1|  Os03g0113000                                       243   6e-74    Oryza sativa Japonica Group [Japonica rice]
gb|ACG30302.1|  leucine-rich repeat receptor protein kinase EXS p...    243   6e-74    Zea mays [maize]
ref|XP_002465996.1|  hypothetical protein SORBIDRAFT_01g049750          243   9e-74    Sorghum bicolor [broomcorn]
ref|XP_006842885.1|  hypothetical protein AMTR_s00075p00012310          241   2e-73    
ref|XP_002489042.1|  hypothetical protein SORBIDRAFT_0283s002010        241   7e-73    Sorghum bicolor [broomcorn]
ref|XP_006849213.1|  hypothetical protein AMTR_s00027p00225540          239   2e-72    
ref|NP_001151054.1|  receptor protein kinase CRINKLY4                   239   4e-72    Zea mays [maize]
ref|XP_008801797.1|  PREDICTED: probable receptor-like protein ki...    239   7e-72    
ref|XP_010229317.1|  PREDICTED: probable receptor-like protein ki...    233   3e-70    
ref|XP_004986014.1|  PREDICTED: probable receptor-like protein ki...    234   4e-70    
gb|KCW72673.1|  hypothetical protein EUGRSUZ_E01129                     229   2e-69    
ref|XP_009407855.1|  PREDICTED: probable receptor-like protein ki...    231   7e-69    
ref|XP_003580246.1|  PREDICTED: probable receptor-like protein ki...    227   2e-67    
emb|CDY25254.1|  BnaA02g22020D                                          215   3e-64    
ref|XP_010934611.1|  PREDICTED: probable receptor-like protein ki...    218   3e-64    
dbj|BAJ89188.1|  predicted protein                                      212   4e-62    
ref|XP_006649258.1|  PREDICTED: probable receptor-like protein ki...    209   3e-61    
gb|EMT15653.1|  Putative LRR receptor-like serine/threonine-prote...    207   2e-60    
gb|AFW89822.1|  putative DUF26 domain receptor-like protein kinase      206   4e-59    
gb|AFW89816.1|  putative DUF26 domain receptor-like protein kinase      206   5e-58    
ref|XP_002453132.1|  hypothetical protein SORBIDRAFT_04g000660          203   6e-58    Sorghum bicolor [broomcorn]
gb|AFW89817.1|  putative DUF26 domain receptor-like protein kinase      206   8e-58    
gb|KCW80121.1|  hypothetical protein EUGRSUZ_C01451                     199   2e-57    
gb|AFW89821.1|  putative DUF26 domain receptor-like protein kinase      206   2e-57    
gb|AFW89818.1|  putative DUF26 domain receptor-like protein kinase      206   9e-57    
gb|AFW89820.1|  putative DUF26 domain receptor-like protein kinase      206   2e-56    
gb|AFW89819.1|  putative DUF26 domain receptor-like protein kinase      206   4e-56    
ref|XP_004951214.1|  PREDICTED: probable receptor-like protein ki...    196   2e-55    
gb|EMT21908.1|  Putative LRR receptor-like serine/threonine-prote...    188   3e-54    
ref|NP_001045631.1|  Os02g0106900                                       184   2e-50    Oryza sativa Japonica Group [Japonica rice]
gb|EAY84118.1|  hypothetical protein OsI_05500                          183   2e-50    Oryza sativa Indica Group [Indian rice]
ref|XP_008681400.1|  PREDICTED: uncharacterized LOC100272878 isof...    182   2e-50    
ref|XP_006296547.1|  hypothetical protein CARUB_v100250850mg            181   3e-49    
ref|XP_010245528.1|  PREDICTED: probable receptor-like protein ki...    179   3e-48    
ref|XP_009398654.1|  PREDICTED: probable receptor-like protein ki...    177   1e-47    
ref|XP_009408035.1|  PREDICTED: probable receptor-like protein ki...    177   1e-47    
ref|XP_007011760.1|  Kinase superfamily protein                         176   2e-47    
ref|XP_010265695.1|  PREDICTED: probable receptor-like protein ki...    176   2e-47    
sp|Q9FZB1.1|Y5188_ARATH  RecName: Full=Probable LRR receptor-like...    181   2e-47    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010265697.1|  PREDICTED: probable receptor-like protein ki...    176   2e-47    
ref|NP_175600.2|  protein ROOT HAIR SPECIFIC 6                          181   2e-47    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510551.1|  PREDICTED: probable leucine-rich repeat rece...    174   3e-47    
ref|XP_007222630.1|  hypothetical protein PRUPE_ppa008520mg             173   3e-47    
ref|XP_002972461.1|  hypothetical protein SELMODRAFT_97344              173   4e-47    
ref|XP_002299270.2|  hypothetical protein POPTR_0001s14680g             174   6e-47    Populus trichocarpa [western balsam poplar]
ref|XP_010932226.1|  PREDICTED: probable receptor-like protein ki...    175   6e-47    
ref|XP_008219557.1|  PREDICTED: probable receptor-like protein ki...    175   9e-47    
gb|AAC33228.1|  putative receptor-like protein kinase                   177   2e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510555.1|  PREDICTED: probable LRR receptor-like serine...    171   2e-46    
ref|XP_010513261.1|  PREDICTED: probable LRR receptor-like serine...    177   2e-46    
ref|XP_002985113.1|  hypothetical protein SELMODRAFT_121956             170   2e-46    
ref|XP_008788933.1|  PREDICTED: probable receptor-like protein ki...    174   2e-46    
ref|NP_001137070.1|  uncharacterized LOC100217243                       171   2e-46    Zea mays [maize]
emb|CBI36018.3|  unnamed protein product                                177   2e-46    
ref|XP_008788934.1|  PREDICTED: probable receptor-like protein ki...    174   2e-46    
ref|XP_009144962.1|  PREDICTED: probable LRR receptor-like serine...    177   2e-46    
gb|KHG06993.1|  hypothetical protein F383_33282                         173   2e-46    
ref|XP_008452879.1|  PREDICTED: probable receptor-like protein ki...    170   2e-46    
ref|XP_008452878.1|  PREDICTED: probable receptor-like protein ki...    171   3e-46    
ref|XP_006830243.1|  hypothetical protein AMTR_s00130p00078720          172   3e-46    
ref|XP_009144872.1|  PREDICTED: probable LRR receptor-like serine...    177   3e-46    
ref|XP_006848777.1|  hypothetical protein AMTR_s00026p00089830          173   3e-46    
ref|XP_002969784.1|  hypothetical protein SELMODRAFT_92161              169   4e-46    
ref|XP_010491792.1|  PREDICTED: probable receptor-like protein ki...    172   5e-46    
emb|CDY33856.1|  BnaC06g04970D                                          176   5e-46    
gb|EEC78975.1|  hypothetical protein OsI_19455                          173   5e-46    Oryza sativa Indica Group [Indian rice]
ref|NP_001148054.1|  senescence-induced receptor-like serine/thre...    171   6e-46    Zea mays [maize]
ref|NP_175599.1|  putative serine/threonine protein kinase              176   6e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010419656.1|  PREDICTED: probable receptor-like protein ki...    170   6e-46    
ref|NP_001055185.1|  Os05g0319700                                       173   6e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010654590.1|  PREDICTED: senescence-induced receptor-like ...    177   7e-46    
ref|XP_011073360.1|  PREDICTED: probable receptor-like protein ki...    171   7e-46    
gb|AAF99857.1|AC015448_7  Putative protein kinase                       176   7e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008220337.1|  PREDICTED: probable LRR receptor-like protei...    175   7e-46    
gb|KEH39620.1|  receptor-like kinase                                    171   7e-46    
ref|XP_006292621.1|  hypothetical protein CARUB_v10018863mg             171   9e-46    
ref|NP_180466.2|  leucine-rich repeat protein kinase family protein     176   9e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010274442.1|  PREDICTED: serine/threonine-protein kinase PBS1    171   9e-46    
ref|XP_009145484.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    175   9e-46    
ref|XP_010510554.1|  PREDICTED: probable LRR receptor-like serine...    171   1e-45    
ref|XP_004965735.1|  PREDICTED: probable receptor-like protein ki...    172   1e-45    
ref|XP_009405340.1|  PREDICTED: probable receptor-like protein ki...    174   1e-45    
ref|XP_010481126.1|  PREDICTED: probable LRR receptor-like protei...    177   1e-45    
emb|CDY51448.1|  BnaA05g36650D                                          175   1e-45    
emb|CAN76226.1|  hypothetical protein VITISV_000266                     169   1e-45    Vitis vinifera
gb|KFK35818.1|  hypothetical protein AALP_AA4G041400                    178   1e-45    
gb|KFK35817.1|  hypothetical protein AALP_AA4G041400                    178   1e-45    
gb|ACN59249.1|  leucine-rich repeat receptor-like protein kinase        174   1e-45    Arabidopsis thaliana [mouse-ear cress]
emb|CDY22871.1|  BnaA06g02060D                                          176   1e-45    
ref|XP_010500782.1|  PREDICTED: probable LRR receptor-like serine...    175   2e-45    
ref|XP_011084596.1|  PREDICTED: probable receptor-like protein ki...    170   2e-45    
ref|XP_002979859.1|  hypothetical protein SELMODRAFT_111388             170   2e-45    
ref|XP_010500781.1|  PREDICTED: probable LRR receptor-like serine...    176   2e-45    
gb|EEE63242.1|  hypothetical protein OsJ_18052                          172   2e-45    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010479692.1|  PREDICTED: probable LRR receptor-like serine...    176   2e-45    
ref|XP_008658206.1|  PREDICTED: uncharacterized LOC100217243 isof...    171   2e-45    
ref|XP_010516519.1|  PREDICTED: serine/threonine-protein kinase P...    170   2e-45    
emb|CAB88286.1|  serine/threonine-specific protein kinase-like pr...    169   2e-45    Arabidopsis thaliana [mouse-ear cress]
gb|ACN35389.1|  unknown                                                 169   2e-45    Zea mays [maize]
ref|XP_010545651.1|  PREDICTED: probable LRR receptor-like serine...    175   2e-45    
ref|XP_011033754.1|  PREDICTED: serine/threonine-protein kinase CDL1    169   3e-45    
ref|XP_010419655.1|  PREDICTED: probable receptor-like protein ki...    170   3e-45    
ref|XP_010504826.1|  PREDICTED: PTI1-like tyrosine-protein kinase 2     170   3e-45    
ref|NP_001148336.1|  phytosulfokine receptor precursor                  171   3e-45    Zea mays [maize]
ref|XP_010427774.1|  PREDICTED: PTI1-like tyrosine-protein kinase 2     169   3e-45    
ref|NP_191428.3|  protein kinase family protein                         169   3e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009405342.1|  PREDICTED: probable receptor-like protein ki...    173   3e-45    
emb|CAN79180.1|  hypothetical protein VITISV_019748                     171   3e-45    Vitis vinifera
ref|XP_007023374.1|  Serine/threonine-protein kinase PBS1 isoform 2     171   3e-45    
gb|EEC79556.1|  hypothetical protein OsI_20681                          175   3e-45    Oryza sativa Indica Group [Indian rice]
ref|XP_011073359.1|  PREDICTED: probable receptor-like protein ki...    170   3e-45    
emb|CDY45651.1|  BnaA05g15180D                                          174   4e-45    
ref|XP_009147725.1|  PREDICTED: probable LRR receptor-like serine...    174   4e-45    
ref|XP_009410925.1|  PREDICTED: PTI1-like tyrosine-protein kinase 2     169   4e-45    
ref|XP_004135868.1|  PREDICTED: probable receptor-like protein ki...    170   4e-45    
ref|XP_007023373.1|  Serine/threonine-protein kinase PBS1 isoform 1     171   4e-45    
ref|XP_010654872.1|  PREDICTED: probable receptor-like protein ki...    169   4e-45    
gb|KHG11715.1|  hypothetical protein F383_04417                         170   5e-45    
gb|KGN45228.1|  hypothetical protein Csa_7G432090                       170   5e-45    
ref|XP_002285386.2|  PREDICTED: probable receptor-like protein ki...    170   5e-45    Vitis vinifera
gb|KGN55454.1|  hypothetical protein Csa_4G652670                       168   5e-45    
emb|CAC01703.1|  receptor protein kinase-like protein                   174   5e-45    Arabidopsis thaliana [mouse-ear cress]
gb|KFK35821.1|  hypothetical protein AALP_AA4G041600                    172   6e-45    
ref|NP_566630.1|  protein kinase family protein                         172   6e-45    Arabidopsis thaliana [mouse-ear cress]
ref|NP_175598.1|  putative LRR receptor-like serine/threonine-pro...    174   6e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500779.1|  PREDICTED: probable LRR receptor-like serine...    172   6e-45    
emb|CDY45650.1|  BnaA05g15170D                                          174   7e-45    
gb|AAF99856.1|AC015448_6  Putative protein kinase                       174   7e-45    Arabidopsis thaliana [mouse-ear cress]
gb|KDP42003.1|  hypothetical protein JCGZ_27021                         169   7e-45    
ref|XP_002515904.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    174   8e-45    Ricinus communis
ref|XP_006427538.1|  hypothetical protein CICLE_v10025618mg             167   8e-45    
ref|NP_197192.2|  putative LRR receptor-like serine/threonine-pro...    173   8e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010239937.1|  PREDICTED: probable receptor-like protein ki...    169   8e-45    
ref|XP_004145589.1|  PREDICTED: probable receptor-like protein ki...    167   9e-45    
ref|XP_006290410.1|  hypothetical protein CARUB_v10019082mg             173   9e-45    
ref|XP_002984292.1|  hypothetical protein SELMODRAFT_119669             167   9e-45    
ref|XP_008461169.1|  PREDICTED: probable receptor-like protein ki...    169   1e-44    
emb|CDY49244.1|  BnaA09g55230D                                          168   1e-44    
ref|XP_004486625.1|  PREDICTED: probable receptor-like protein ki...    168   1e-44    
gb|AAG50864.1|AC025294_2  receptor protein kinase, putative, 5' p...    171   1e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392985.1|  hypothetical protein EUTSA_v10011236mg             173   1e-44    
gb|KHG26656.1|  hypothetical protein F383_33408                         169   1e-44    
gb|ACN34797.1|  unknown                                                 169   1e-44    Zea mays [maize]
ref|XP_010535193.1|  PREDICTED: probable LRR receptor-like protei...    173   1e-44    
ref|XP_010525691.1|  PREDICTED: probable receptor-like protein ki...    171   1e-44    
ref|XP_009116549.1|  PREDICTED: serine/threonine-protein kinase A...    167   1e-44    
emb|CAN83403.1|  hypothetical protein VITISV_004459                     173   1e-44    Vitis vinifera
ref|XP_010535194.1|  PREDICTED: probable LRR receptor-like protei...    173   1e-44    
ref|XP_002964857.1|  hypothetical protein SELMODRAFT_82782              166   1e-44    
ref|XP_010525693.1|  PREDICTED: probable receptor-like protein ki...    171   1e-44    
ref|XP_006409933.1|  hypothetical protein EUTSA_v100177840mg            169   2e-44    
emb|CBI36481.3|  unnamed protein product                                169   2e-44    
ref|XP_002876474.1|  kinase family protein                              167   2e-44    
ref|XP_009135746.1|  PREDICTED: receptor-like protein kinase At3g...    169   2e-44    
ref|XP_009385055.1|  PREDICTED: probable receptor-like protein ki...    169   2e-44    
ref|XP_010437970.1|  PREDICTED: probable receptor-like protein ki...    168   2e-44    
ref|XP_010470015.1|  PREDICTED: probable LRR receptor-like serine...    171   2e-44    
ref|NP_175595.2|  putative leucine-rich repeat protein kinase           171   2e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002437355.1|  hypothetical protein SORBIDRAFT_10g025460          169   2e-44    Sorghum bicolor [broomcorn]
ref|XP_010654871.1|  PREDICTED: probable receptor-like protein ki...    168   2e-44    
gb|KDO63400.1|  hypothetical protein CISIN_1g016117mg                   166   2e-44    
ref|XP_010315230.1|  PREDICTED: probable receptor-like protein ki...    171   2e-44    
ref|XP_002527325.1|  Serine/threonine-protein kinase PBS1, putative     167   2e-44    Ricinus communis
gb|KDP23542.1|  hypothetical protein JCGZ_23375                         168   2e-44    
ref|NP_188771.2|  receptor-like protein kinase                          172   2e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009419398.1|  PREDICTED: probable receptor-like protein ki...    171   2e-44    
ref|XP_010104412.1|  Receptor-like serine/threonine-protein kinase      167   3e-44    
ref|XP_010545649.1|  PREDICTED: probable LRR receptor-like serine...    172   3e-44    
ref|XP_010432787.1|  PREDICTED: probable receptor-like protein ki...    167   3e-44    
gb|KDO59725.1|  hypothetical protein CISIN_1g010088mg                   168   3e-44    
ref|XP_006392986.1|  hypothetical protein EUTSA_v10011226mg             172   3e-44    
ref|XP_010462030.1|  PREDICTED: probable LRR receptor-like protei...    170   3e-44    
ref|XP_009803111.1|  PREDICTED: probable leucine-rich repeat rece...    172   3e-44    
ref|XP_009764253.1|  PREDICTED: probable receptor-like protein ki...    167   3e-44    
ref|XP_006306715.1|  hypothetical protein CARUB_v10008240mg             172   4e-44    
ref|XP_006346401.1|  PREDICTED: probable receptor-like protein ki...    170   4e-44    
ref|XP_003607949.1|  Senescence-induced receptor-like serine/thre...    170   4e-44    
gb|AAF99860.1|AC015448_10  Putative protein kinase                      172   4e-44    
emb|CDP18793.1|  unnamed protein product                                167   4e-44    
gb|AES90146.2|  receptor-like kinase                                    170   4e-44    
ref|XP_006306733.1|  hypothetical protein CARUB_v10008262mg             172   4e-44    
gb|EEE64420.1|  hypothetical protein OsJ_19264                          172   4e-44    
ref|XP_009147727.1|  PREDICTED: probable LRR receptor-like protei...    171   4e-44    
ref|XP_010922992.1|  PREDICTED: serine/threonine-protein kinase A...    167   5e-44    
ref|XP_006465261.1|  PREDICTED: probable receptor-like protein ki...    167   5e-44    
ref|XP_010453137.1|  PREDICTED: probable receptor-like protein ki...    165   5e-44    
ref|XP_010446205.1|  PREDICTED: receptor-like protein kinase At5g...    164   5e-44    
gb|EPS58248.1|  protein kinase                                          165   5e-44    
ref|XP_006427540.1|  hypothetical protein CICLE_v10025618mg             167   5e-44    
gb|KDO45590.1|  hypothetical protein CISIN_1g013636mg                   167   5e-44    
ref|XP_009147726.1|  PREDICTED: probable LRR receptor-like protei...    171   5e-44    
emb|CDY22872.1|  BnaA06g02050D                                          171   5e-44    
ref|XP_010063545.1|  PREDICTED: probable receptor-like protein ki...    167   5e-44    
ref|XP_010105445.1|  putative receptor-like protein kinase              166   6e-44    
ref|XP_011015399.1|  PREDICTED: probable receptor-like protein ki...    166   6e-44    
ref|XP_007226449.1|  hypothetical protein PRUPE_ppa024286mg             171   6e-44    
emb|CDY59198.1|  BnaCnng34450D                                          169   6e-44    
ref|XP_010470014.1|  PREDICTED: probable LRR receptor-like serine...    171   6e-44    
gb|KDO59724.1|  hypothetical protein CISIN_1g010088mg                   168   6e-44    
emb|CDY33851.1|  BnaC06g05020D                                          171   7e-44    
ref|XP_004961439.1|  PREDICTED: putative leucine-rich repeat rece...    171   7e-44    
ref|XP_006283813.1|  hypothetical protein CARUB_v10004912mg             166   7e-44    
dbj|BAD94349.1|  Putative protein kinase                                171   7e-44    
emb|CDO98204.1|  unnamed protein product                                167   7e-44    
ref|XP_006446813.1|  hypothetical protein CICLE_v10015515mg             166   7e-44    
ref|XP_010654592.1|  PREDICTED: probable LRR receptor-like serine...    170   7e-44    
ref|XP_006306955.1|  hypothetical protein CARUB_v10008523mg             169   7e-44    
ref|XP_011015392.1|  PREDICTED: probable receptor-like protein ki...    166   7e-44    
gb|KDO63399.1|  hypothetical protein CISIN_1g016117mg                   166   7e-44    
ref|XP_010479693.1|  PREDICTED: probable LRR receptor-like serine...    171   8e-44    
ref|XP_009790472.1|  PREDICTED: probable receptor-like protein ki...    165   8e-44    
ref|XP_006385923.1|  hypothetical protein POPTR_0003s17790g             165   8e-44    
ref|XP_003566695.1|  PREDICTED: putative leucine-rich repeat rece...    171   8e-44    
ref|XP_010920329.1|  PREDICTED: serine/threonine-protein kinase C...    166   8e-44    
ref|XP_006399600.1|  hypothetical protein EUTSA_v10013829mg             165   8e-44    
gb|AAO72542.1|  putative receptor protein kinase                        160   8e-44    
ref|XP_010500770.1|  PREDICTED: probable LRR receptor-like serine...    171   9e-44    
ref|XP_006409929.1|  hypothetical protein EUTSA_v10016227mg             170   1e-43    
ref|XP_010414453.1|  PREDICTED: probable LRR receptor-like serine...    169   1e-43    
ref|XP_010510553.1|  PREDICTED: probable leucine-rich repeat rece...    170   1e-43    
ref|XP_010453136.1|  PREDICTED: probable receptor-like protein ki...    165   1e-43    
ref|XP_010534145.1|  PREDICTED: probable LRR receptor-like serine...    171   1e-43    
ref|XP_010510552.1|  PREDICTED: probable leucine-rich repeat rece...    170   1e-43    
ref|XP_010414455.1|  PREDICTED: probable leucine-rich repeat rece...    170   1e-43    
ref|XP_002440112.1|  hypothetical protein SORBIDRAFT_09g026180          171   1e-43    
ref|XP_010414456.1|  PREDICTED: probable leucine-rich repeat rece...    170   1e-43    
emb|CDY39524.1|  BnaC04g15230D                                          160   1e-43    
ref|XP_006654258.1|  PREDICTED: probable receptor-like protein ki...    165   1e-43    
gb|ACN59300.1|  leucine-rich repeat receptor-like protein kinase        167   1e-43    
emb|CDM84543.1|  unnamed protein product                                166   1e-43    
ref|XP_006468994.1|  PREDICTED: serine/threonine-protein kinase A...    165   1e-43    
ref|XP_006409930.1|  hypothetical protein EUTSA_v10016227mg             170   1e-43    
emb|CDX87853.1|  BnaC06g09150D                                          170   1e-43    
ref|XP_002885306.1|  kinase family protein                              168   1e-43    
ref|XP_011020643.1|  PREDICTED: probable receptor-like protein ki...    165   1e-43    
ref|XP_010690602.1|  PREDICTED: probable receptor-like protein ki...    168   1e-43    
ref|XP_007226820.1|  hypothetical protein PRUPE_ppa017683mg             170   1e-43    
ref|XP_006487054.1|  PREDICTED: probable receptor-like protein ki...    168   1e-43    
ref|XP_004230392.1|  PREDICTED: probable leucine-rich repeat rece...    170   2e-43    
ref|XP_009140957.1|  PREDICTED: probable leucine-rich repeat rece...    169   2e-43    
ref|XP_001785967.1|  predicted protein                                  163   2e-43    
ref|XP_004171848.1|  PREDICTED: probable LRR receptor-like serine...    169   2e-43    
gb|ADE76438.1|  unknown                                                 167   2e-43    
ref|XP_010479694.1|  PREDICTED: probable LRR receptor-like protei...    170   2e-43    
ref|XP_006402759.1|  hypothetical protein EUTSA_v10006022mg             165   2e-43    
ref|XP_010500783.1|  PREDICTED: probable LRR receptor-like protei...    170   2e-43    
gb|KFK35095.1|  hypothetical protein AALP_AA5G234800                    164   2e-43    
ref|XP_008789342.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    164   2e-43    
ref|XP_006306079.1|  hypothetical protein CARUB_v10011410mg             170   2e-43    
ref|XP_008789341.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    164   2e-43    
ref|XP_010466373.1|  PREDICTED: receptor-like protein kinase At3g...    170   2e-43    
ref|XP_006597107.1|  PREDICTED: probable receptor-like protein ki...    165   2e-43    
ref|XP_003566696.1|  PREDICTED: probable LRR receptor-like serine...    170   2e-43    
ref|XP_010273354.1|  PREDICTED: putative wall-associated receptor...    168   2e-43    
ref|XP_003632784.2|  PREDICTED: putative leucine-rich repeat rece...    170   2e-43    
ref|XP_009589309.1|  PREDICTED: probable receptor-like protein ki...    165   2e-43    
ref|NP_178510.1|  putative leucine-rich repeat receptor-like seri...    169   2e-43    
ref|XP_002440107.1|  hypothetical protein SORBIDRAFT_09g026141          170   2e-43    
emb|CDX73519.1|  BnaC08g24840D                                          163   2e-43    
ref|NP_180462.2|  putative LRR receptor-like serine/threonine-pro...    169   2e-43    
ref|XP_010466372.1|  PREDICTED: receptor-like protein kinase At3g...    169   2e-43    
ref|XP_006409941.1|  hypothetical protein EUTSA_v10017541mg             167   3e-43    
ref|XP_009774092.1|  PREDICTED: probable receptor-like protein ki...    167   3e-43    
ref|XP_002961785.1|  hypothetical protein SELMODRAFT_77404              162   3e-43    
ref|XP_006295972.1|  hypothetical protein CARUB_v10025114mg             169   3e-43    
ref|XP_010500785.1|  PREDICTED: probable LRR receptor-like serine...    169   3e-43    
emb|CDY32424.1|  BnaC03g42080D                                          169   3e-43    
ref|XP_010535199.1|  PREDICTED: receptor-like protein kinase At3g...    169   3e-43    
ref|XP_008452880.1|  PREDICTED: probable receptor-like protein ki...    162   3e-43    
ref|XP_008785864.1|  PREDICTED: probable receptor-like protein ki...    167   3e-43    
ref|XP_002966230.1|  hypothetical protein SELMODRAFT_25022              161   3e-43    
sp|Q9SI06.2|Y5573_ARATH  RecName: Full=Putative leucine-rich repe...    169   3e-43    
ref|XP_010479445.1|  PREDICTED: probable receptor-like protein ki...    167   3e-43    
ref|XP_006406282.1|  hypothetical protein EUTSA_v10020016mg             169   3e-43    
ref|XP_009594107.1|  PREDICTED: probable receptor-like protein ki...    167   3e-43    
ref|XP_006655503.1|  PREDICTED: putative leucine-rich repeat rece...    169   3e-43    
ref|XP_009125044.1|  PREDICTED: probable LRR receptor-like serine...    169   3e-43    
ref|XP_009140956.1|  PREDICTED: probable leucine-rich repeat rece...    169   3e-43    
emb|CDY33853.1|  BnaC06g05000D                                          169   4e-43    
ref|XP_002991493.1|  hypothetical protein SELMODRAFT_133636             164   4e-43    
ref|XP_006653071.1|  PREDICTED: probable receptor-like protein ki...    167   4e-43    
ref|XP_009599853.1|  PREDICTED: probable receptor-like protein ki...    163   4e-43    
ref|XP_010034754.1|  PREDICTED: senescence-induced receptor-like ...    169   4e-43    
ref|XP_003568749.1|  PREDICTED: pto-interacting protein 1               164   4e-43    
ref|XP_006422994.1|  hypothetical protein CICLE_v10027951mg             167   4e-43    
emb|CDX71935.1|  BnaC08g29390D                                          167   4e-43    
ref|XP_010463403.1|  PREDICTED: probable LRR receptor-like serine...    168   4e-43    
ref|XP_002887301.1|  kinase family protein                              164   4e-43    
emb|CDY31434.1|  BnaC03g63900D                                          167   4e-43    
gb|KCW53453.1|  hypothetical protein EUGRSUZ_J02698                     167   4e-43    
ref|XP_010479443.1|  PREDICTED: probable receptor-like protein ki...    167   4e-43    
ref|XP_002978933.1|  hypothetical protein SELMODRAFT_177358             164   4e-43    
ref|XP_010489995.1|  PREDICTED: receptor-like protein kinase At3g...    169   5e-43    
ref|XP_010479444.1|  PREDICTED: probable receptor-like protein ki...    167   5e-43    
ref|XP_001771793.1|  predicted protein                                  166   5e-43    
ref|NP_180463.1|  putative leucine-rich repeat protein kinase           167   5e-43    
ref|XP_009122812.1|  PREDICTED: wall-associated receptor kinase-l...    167   5e-43    
ref|XP_001783289.1|  predicted protein                                  165   5e-43    
emb|CDY48885.1|  BnaA03g36240D                                          168   5e-43    
ref|XP_004505235.1|  PREDICTED: probable receptor-like protein ki...    167   5e-43    
ref|XP_006358481.1|  PREDICTED: probable leucine-rich repeat rece...    169   6e-43    
ref|XP_006392987.1|  hypothetical protein EUTSA_v10011228mg             168   6e-43    
ref|XP_010461815.1|  PREDICTED: probable receptor-like protein ki...    166   6e-43    
ref|XP_010473989.1|  PREDICTED: probable LRR receptor-like serine...    168   7e-43    
ref|XP_010523139.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    168   7e-43    
ref|XP_010510549.1|  PREDICTED: probable LRR receptor-like serine...    168   7e-43    
ref|XP_006299926.1|  hypothetical protein CARUB_v10016135mg             168   7e-43    
gb|KEH20271.1|  receptor-like kinase                                    166   7e-43    
ref|XP_006644901.1|  PREDICTED: probable leucine-rich repeat rece...    168   7e-43    
ref|XP_007205186.1|  hypothetical protein PRUPE_ppa005621mg             164   8e-43    
ref|XP_010912032.1|  PREDICTED: probable receptor-like protein ki...    166   8e-43    
ref|XP_006392983.1|  hypothetical protein EUTSA_v10012125mg             167   8e-43    
gb|KHN05835.1|  Putative receptor-like protein kinase                   166   9e-43    
ref|XP_006574888.1|  PREDICTED: probable receptor-like protein ki...    166   9e-43    
emb|CDX99241.1|  BnaC05g33560D                                          166   9e-43    
emb|CDX92321.1|  BnaA05g20860D                                          166   9e-43    
ref|XP_006828351.1|  hypothetical protein AMTR_s00023p00250480          163   9e-43    
ref|XP_010671952.1|  PREDICTED: putative leucine-rich repeat rece...    166   9e-43    
gb|KHN43061.1|  Putative receptor-like protein kinase                   166   1e-42    
ref|XP_010535198.1|  PREDICTED: probable LRR receptor-like serine...    166   1e-42    
ref|XP_010510557.1|  PREDICTED: probable LRR receptor-like serine...    166   1e-42    
gb|EMT06135.1|  Putative LRR receptor-like serine/threonine-prote...    165   1e-42    
ref|XP_006413864.1|  hypothetical protein EUTSA_v10024362mg             167   1e-42    
ref|XP_010034816.1|  PREDICTED: putative leucine-rich repeat rece...    167   1e-42    
emb|CAN63837.1|  hypothetical protein VITISV_007521                     166   1e-42    
ref|XP_002978931.1|  hypothetical protein SELMODRAFT_109804             162   1e-42    
ref|XP_006583888.1|  PREDICTED: probable receptor-like protein ki...    166   1e-42    
ref|XP_010542705.1|  PREDICTED: probable LRR receptor-like serine...    168   1e-42    
ref|XP_010654591.1|  PREDICTED: probable LRR receptor-like serine...    167   1e-42    
dbj|BAF79985.1|  receptor-like kinase                                   163   1e-42    
ref|XP_010500516.1|  PREDICTED: probable receptor-like protein ki...    166   1e-42    
ref|XP_009789534.1|  PREDICTED: serine/threonine-protein kinase PBS1    162   1e-42    
ref|XP_004959969.1|  PREDICTED: probable receptor-like protein ki...    166   1e-42    
ref|XP_006346402.1|  PREDICTED: probable receptor-like protein ki...    166   1e-42    
emb|CBI36022.3|  unnamed protein product                                167   1e-42    
gb|EMT18733.1|  Putative LRR receptor-like serine/threonine-prote...    164   1e-42    
ref|XP_002281041.1|  PREDICTED: serine/threonine-protein kinase CDL1    163   1e-42    
gb|EMT26328.1|  Putative LRR receptor-like serine/threonine-prote...    165   1e-42    
ref|XP_010418808.1|  PREDICTED: probable LRR receptor-like serine...    167   1e-42    
ref|XP_006297151.1|  hypothetical protein CARUB_v10013154mg             166   1e-42    
ref|XP_009768138.1|  PREDICTED: pto-interacting protein 1               163   1e-42    
ref|XP_010262628.1|  PREDICTED: wall-associated receptor kinase-l...    165   1e-42    
gb|EMT19930.1|  Serine/threonine-protein kinase PBS1                    164   1e-42    
ref|XP_010525172.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    162   1e-42    
ref|XP_009593783.1|  PREDICTED: PTI1-like tyrosine-protein kinase 2     162   1e-42    
ref|XP_007157447.1|  hypothetical protein PHAVU_002G070900g             166   1e-42    
ref|XP_003546919.1|  PREDICTED: probable receptor-like protein ki...    163   1e-42    
ref|XP_010423903.1|  PREDICTED: wall-associated receptor kinase-l...    161   1e-42    
gb|KHN22414.1|  Putative receptor-like protein kinase                   163   1e-42    
ref|XP_010500521.1|  PREDICTED: probable receptor-like protein ki...    166   1e-42    
dbj|BAJ86178.1|  predicted protein                                      164   1e-42    
ref|XP_001774205.1|  predicted protein                                  159   1e-42    
ref|XP_002987866.1|  hypothetical protein SELMODRAFT_126642             161   2e-42    
ref|XP_004961614.1|  PREDICTED: serine/threonine-protein kinase P...    164   2e-42    
emb|CBI36020.3|  unnamed protein product                                166   2e-42    
ref|XP_010654898.1|  PREDICTED: probable LRR receptor-like serine...    167   2e-42    
ref|XP_002519935.1|  serine-threonine protein kinase, plant-type,...    161   2e-42    
gb|AFW70452.1|  putative protein kinase superfamily protein             164   2e-42    
ref|XP_006366792.1|  PREDICTED: wall-associated receptor kinase-l...    165   2e-42    
ref|XP_010695054.1|  PREDICTED: serine/threonine-protein kinase CDL1    163   2e-42    
emb|CAB45811.1|  receptor protein kinase-like protein                   167   2e-42    
emb|CDX76454.1|  BnaA08g09460D                                          160   2e-42    
ref|XP_010470017.1|  PREDICTED: probable LRR receptor-like serine...    167   2e-42    
ref|XP_004290926.1|  PREDICTED: probable receptor-like protein ki...    163   2e-42    
ref|XP_004963644.1|  PREDICTED: putative leucine-rich repeat rece...    167   2e-42    
ref|XP_008246507.1|  PREDICTED: probable serine/threonine-protein...    163   2e-42    
ref|XP_010048150.1|  PREDICTED: probable receptor-like protein ki...    163   2e-42    
ref|XP_010447455.1|  PREDICTED: probable receptor-like protein ki...    162   2e-42    
ref|NP_001054345.1|  Os04g0689400                                       165   2e-42    
ref|NP_001185201.1|  probable LRR receptor-like protein kinase          166   2e-42    
ref|XP_006359973.1|  PREDICTED: probable receptor-like protein ki...    161   2e-42    
emb|CDX98321.1|  BnaC06g16820D                                          162   2e-42    
ref|XP_007024354.1|  Leucine-rich repeat transmembrane protein ki...    167   2e-42    
gb|EEC78301.1|  hypothetical protein OsI_18023                          165   2e-42    
gb|KHN12108.1|  Proline-rich receptor-like protein kinase PERK13        164   2e-42    
ref|XP_010690603.1|  PREDICTED: probable receptor-like protein ki...    165   2e-42    
emb|CDY40328.1|  BnaA10g27400D                                          167   2e-42    
gb|EAY98747.1|  hypothetical protein OsI_20680                          167   2e-42    
ref|XP_006300902.1|  hypothetical protein CARUB_v10021271mg             167   2e-42    
ref|XP_004302449.1|  PREDICTED: receptor-like serine/threonine-pr...    162   2e-42    
ref|XP_004498775.1|  PREDICTED: probable receptor-like protein ki...    162   2e-42    
ref|XP_010470016.1|  PREDICTED: probable LRR receptor-like serine...    167   2e-42    
ref|XP_006400933.1|  hypothetical protein EUTSA_v10012663mg             166   2e-42    
ref|XP_006847108.1|  hypothetical protein AMTR_s00017p00219360          163   2e-42    
ref|XP_006392991.1|  hypothetical protein EUTSA_v10012311mg             159   2e-42    
ref|XP_009340218.1|  PREDICTED: probable receptor-like protein ki...    162   2e-42    
ref|NP_001056091.1|  Os05g0524500                                       167   2e-42    
gb|EEE53790.1|  hypothetical protein OsJ_00200                          167   3e-42    
gb|EEE64419.1|  hypothetical protein OsJ_19263                          167   3e-42    



>ref|XP_009762542.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Nicotiana 
sylvestris]
Length=455

 Score =   357 bits (916),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 179/299 (60%), Positives = 222/299 (74%), Gaps = 25/299 (8%)
 Frame = -2

Query  858  WVSVMAFGCLGRKSRRRKAEKDTKES--------------ARRLTRKEVQKLTVDFSRSR  721
            + ++  F CLG K +RR    D+K +               RR T  EV+K T++ SRSR
Sbjct  111  FCAMALFKCLGFKLKRRSGVLDSKVAGDEEENKDCSKKFGVRRFTCDEVEKFTMNLSRSR  170

Query  720  VIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSD  541
            +IA+GGFSTVYL +FPDS LGA+KIID SS+R   +Y+QEL+IL +I+H+NIVK LGY D
Sbjct  171  LIAYGGFSTVYLAQFPDSLLGAVKIIDLSSERFQKVYQQELDILLQIQHENIVKFLGYCD  230

Query  540  DEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIV  361
            +   EEG+LVFEY+ NGTLQEKLHG      + W+NRM IAFQLA+ +EYLHDKC   IV
Sbjct  231  NG--EEGMLVFEYISNGTLQEKLHGTDARK-MSWKNRMAIAFQLAKAIEYLHDKCTLPIV  287

Query  360  HGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTD  181
            HGD+K SN+LLD + NCKLCD+GSAKMGFSST+ PP+S+      NR M+   GSPGYTD
Sbjct  288  HGDIKASNVLLDKKFNCKLCDFGSAKMGFSSTILPPNSST-----NRMML---GSPGYTD  339

Query  180  PHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            PHYLRTGIA+KK+DIYS G+I+LELI+G EA+SSDS  RLISKAG +L+D SKVA MVD
Sbjct  340  PHYLRTGIASKKNDIYSFGIIILELISGFEALSSDSGERLISKAGNILRDASKVAEMVD  398



>ref|XP_009625543.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Nicotiana 
tomentosiformis]
Length=452

 Score =   356 bits (914),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/300 (61%), Positives = 223/300 (74%), Gaps = 26/300 (9%)
 Frame = -2

Query  858  WVSVMA-FGCLGRKSRRRKAEKDTKES--------------ARRLTRKEVQKLTVDFSRS  724
            +  VMA F CLG K +RR    D+K +               RR T  EV+K T++ SRS
Sbjct  107  FFCVMALFKCLGFKLKRRSVVLDSKVAGDEEENKDCLKKFGVRRFTCDEVEKFTMNLSRS  166

Query  723  RVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYS  544
            R+IA+GGFSTVYL +FPDS LGA+KIID SS+R   +YKQEL+IL +I+H+NIVK LGY 
Sbjct  167  RLIAYGGFSTVYLAQFPDSLLGAVKIIDLSSERFQKVYKQELDILLQIQHENIVKFLGYC  226

Query  543  DDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQI  364
            D+   EEG+LVFEYV NGTLQEKLHG      + W+NR+ IAFQLA+ +EYLHDKC   I
Sbjct  227  DNG--EEGMLVFEYVSNGTLQEKLHGIDARK-MSWKNRIAIAFQLAKAIEYLHDKCTLPI  283

Query  363  VHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYT  184
            VHGD+K SN+LLD + NCKLCD+GSAKMGFSST+ PP+S+      NR M+   GSPGYT
Sbjct  284  VHGDIKASNVLLDKKFNCKLCDFGSAKMGFSSTILPPNSST-----NRMML---GSPGYT  335

Query  183  DPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            DPHYLRTGIA+KK+DIYS G+I+LELI+G EA+SSDS  RLISKAG +L+D +KVA MVD
Sbjct  336  DPHYLRTGIASKKNDIYSFGIIILELISGFEALSSDSGERLISKAGNILRDATKVAEMVD  395



>ref|XP_006348329.1| PREDICTED: probable receptor-like protein kinase At1g33260-like 
[Solanum tuberosum]
Length=457

 Score =   352 bits (904),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 182/300 (61%), Positives = 220/300 (73%), Gaps = 28/300 (9%)
 Frame = -2

Query  855  VSVMA-FGCLGRKSRRRKAEKDTKESA---------------RRLTRKEVQKLTVDFSRS  724
            +++MA F CLG K RRR    D + +                R  T  EV+K T++ SRS
Sbjct  113  IALMALFKCLGFKLRRRGGGSDARVTGDLEENVNCSKKLGVKRLFTCDEVEKFTMNLSRS  172

Query  723  RVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYS  544
            R+IA+GGFSTVYL +FPDS L A+KI+D SS+R   +YKQEL+IL +I+H+NIVK LG  
Sbjct  173  RLIAYGGFSTVYLAQFPDSMLAAVKIMDLSSERFQRVYKQELDILLQIQHENIVKFLGNC  232

Query  543  DDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQI  364
            D+   EEG+LVFEYVPNGTLQEKLHG  G   L WRNRM IAFQLA+ +EYLHDKC   I
Sbjct  233  DNG--EEGMLVFEYVPNGTLQEKLHGVDGRKSLSWRNRMAIAFQLAKAIEYLHDKCPLPI  290

Query  363  VHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYT  184
            VHGD+K SNILLD + N KLCD+GSAKMGFSST+ PPS+       NR M+   GSPGYT
Sbjct  291  VHGDIKASNILLDKKYNSKLCDFGSAKMGFSSTILPPSA-------NRMML---GSPGYT  340

Query  183  DPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            DPHYLRTGIA+KK+DIYS G+I+LELI+G EA+SSD+  RLISKAG +L+D SKVA MVD
Sbjct  341  DPHYLRTGIASKKNDIYSYGIIVLELISGFEALSSDNGERLISKAGTILRDSSKVAEMVD  400



>ref|XP_004244293.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Solanum 
lycopersicum]
Length=452

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 180/299 (60%), Positives = 217/299 (73%), Gaps = 28/299 (9%)
 Frame = -2

Query  852  SVMA-FGCLGRKSRRRKAEKDTKESA--------------RRLTRKEVQKLTVDFSRSRV  718
            ++MA F CLG K RRR    D + +               R  T  EV+K T++ SRSR+
Sbjct  109  ALMALFKCLGFKLRRRGKGTDARVTGDLEENGDLKKLGVKRLFTCDEVEKFTMNLSRSRL  168

Query  717  IAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDD  538
            IA+GGFS VYL +FPDS L A+KI+D SS+R   +YKQEL+IL +I+H+NIVK LG  D+
Sbjct  169  IAYGGFSMVYLAQFPDSMLAAVKIMDLSSERFQRVYKQELDILLQIQHENIVKFLGNCDN  228

Query  537  EGVEEGVLVFEYVPNGTLQEKLHGN-GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIV  361
               EEG+LVFEYVPNGTLQEKLHG   G   L WRNRM IAFQLA+ +EYLHDKC   IV
Sbjct  229  G--EEGMLVFEYVPNGTLQEKLHGGVDGRKSLSWRNRMAIAFQLAKAIEYLHDKCPLPIV  286

Query  360  HGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTD  181
            HGD+K SNILLD + N KLCD+GSAKMGFSST+ PPS+       NR M+   GSPGYTD
Sbjct  287  HGDIKASNILLDKKYNSKLCDFGSAKMGFSSTILPPSA-------NRMML---GSPGYTD  336

Query  180  PHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            PHYLRTGIA+KK+DIYS G+I+LELI+G EA+SSD+  RLISKAG +L+D SKV  MVD
Sbjct  337  PHYLRTGIASKKNDIYSYGIIVLELISGFEALSSDNGERLISKAGTILRDSSKVIEMVD  395



>ref|XP_006367684.1| PREDICTED: probable receptor-like protein kinase At1g33260-like 
[Solanum tuberosum]
Length=343

 Score =   335 bits (859),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 174/298 (58%), Positives = 215/298 (72%), Gaps = 29/298 (10%)
 Frame = -2

Query  846  MAF-GCLGRKSRR-------------RKAEKDTK--ESARRLTRKEVQKLTVDFSRSRVI  715
            MAF  C G   RR             ++ E D      A R T +E++K T +FS S +I
Sbjct  1    MAFLRCFGYNVRRAGVADIRVFTEGDKEDESDNTMIADATRYTSEELKKFTANFSNSNLI  60

Query  714  AFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDE  535
            A GGFS VYL  FPDSSL A+KI+D+SS+RL+ +YKQEL+IL +I+HDNIVK+L + +++
Sbjct  61   ACGGFSRVYLANFPDSSLRAVKIMDSSSERLNRIYKQELDILIQIKHDNIVKLLDHCEND  120

Query  534  GVEEG-VLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVH  358
              E G +LVFEYV NGTLQ+KLH N   ++LPWRNRM +AFQLAQ +EYLHDKC  QIVH
Sbjct  121  --ESGNMLVFEYVSNGTLQDKLHENRDMTILPWRNRMAVAFQLAQAIEYLHDKCPLQIVH  178

Query  357  GDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDP  178
             D+K SNILLD + NCKLCD+GSAK+GFSS+V P         KNR ++   GSPGYTDP
Sbjct  179  SDIKSSNILLDDQFNCKLCDFGSAKIGFSSSVSP-------LTKNRVIL---GSPGYTDP  228

Query  177  HYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            HYLRTGIA+KK+DIYS GVI+LELI+G+EA SS S  RLISKA P+L D SKVA M+D
Sbjct  229  HYLRTGIASKKNDIYSFGVIILELISGVEAFSSGSGERLISKAAPILNDVSKVAEMID  286



>ref|XP_009623498.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Nicotiana 
tomentosiformis]
Length=371

 Score =   333 bits (854),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 164/258 (64%), Positives = 204/258 (79%), Gaps = 13/258 (5%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQEL  598
            +R T  E++K T +FS S +IA GGFSTVYL +FP+ +LGA+KI+D+SS+RL+ +YKQEL
Sbjct  72   KRYTSGELKKFTTNFSTSNLIACGGFSTVYLAEFPNLTLGAVKIMDSSSERLNRIYKQEL  131

Query  597  EILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIA  418
            +IL +I+HDNIVK+L + DD  +   +LVFEYV NGTLQ+KLHG     ++PWRNRM +A
Sbjct  132  DILLQIQHDNIVKLLDHCDDAQLG-NMLVFEYVSNGTLQDKLHGKRD-IIIPWRNRMTVA  189

Query  417  FQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTAT  238
            FQL Q +EYLHDKC  QIVH D+K SNILLD + NCKLCD+GSAKMGFSS+V PP+    
Sbjct  190  FQLGQAIEYLHDKCPLQIVHSDIKASNILLDKQFNCKLCDFGSAKMGFSSSVLPPT----  245

Query  237  ATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLI  58
                NR M+   GSPGYTDPHYLRTGIA+KK+DIYS GV++LELI+G+EA SSDS  RLI
Sbjct  246  ----NRLML---GSPGYTDPHYLRTGIASKKNDIYSFGVVILELISGVEAFSSDSGDRLI  298

Query  57   SKAGPMLKDESKVAGMVD  4
            SKA P+LK+ SKVA MVD
Sbjct  299  SKAAPVLKNASKVAEMVD  316



>ref|XP_009797897.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Nicotiana 
sylvestris]
Length=343

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/299 (57%), Positives = 216/299 (72%), Gaps = 31/299 (10%)
 Frame = -2

Query  846  MAF-GCLGRKSRRRKAEKDTKE-----------------SARRLTRKEVQKLTVDFSRSR  721
            MAF GC G K  +R    D +                     R T  E++K T +FS S+
Sbjct  1    MAFLGCFGYKLIKRGGVPDARVIVEDDKDDGLDCTTITGQVTRYTSGELKKFTTNFSTSK  60

Query  720  VIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSD  541
            +IA GGFSTVYL +FP+S+LGA+KI+D+SS+ L+ +YKQEL+IL +I+HDNIV++L + D
Sbjct  61   LIACGGFSTVYLAEFPNSTLGAVKIMDSSSEHLNRIYKQELDILLQIQHDNIVRLLDHCD  120

Query  540  DEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIV  361
            D  +   +LVFEYVPNGTLQ+KLHG    +++PWRNRM +AFQLAQ +EYLH+K   QIV
Sbjct  121  DAELG-NMLVFEYVPNGTLQDKLHGKRD-TIIPWRNRMTVAFQLAQAIEYLHEKSPLQIV  178

Query  360  HGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTD  181
            H D+K SNILLD + NCKLCD+GSAKMGFSS+V PP+        NR M+   GSPGYTD
Sbjct  179  HSDIKASNILLDKQFNCKLCDFGSAKMGFSSSVLPPT--------NRMML---GSPGYTD  227

Query  180  PHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            PHYLRTGIA+KK+DIYS GV++LELI+G+EA SSD+  RLISKA P+LK+ S VA MVD
Sbjct  228  PHYLRTGIASKKNDIYSFGVVILELISGVEAFSSDTGERLISKAAPVLKNVSTVAEMVD  286



>ref|XP_006352026.1| PREDICTED: probable receptor-like protein kinase At1g33260-like 
[Solanum tuberosum]
Length=343

 Score =   328 bits (840),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 173/298 (58%), Positives = 213/298 (71%), Gaps = 29/298 (10%)
 Frame = -2

Query  846  MAF-GCLGRKSRRRK-------AEKDTKES--------ARRLTRKEVQKLTVDFSRSRVI  715
            MAF  C G   RR         AE D ++         A R T +E++K T +FS S +I
Sbjct  1    MAFLRCFGYNVRRTGLTDVRVFAEGDKEDESDNTMIADATRHTSEELKKFTANFSNSNLI  60

Query  714  AFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDE  535
            A GGFS VYL  FPDSS  AIKI+D+SS+RL+ +YKQEL+IL +I+HDNIVK+L + +++
Sbjct  61   ACGGFSRVYLANFPDSSPRAIKIMDSSSERLNRIYKQELDILIQIKHDNIVKLLDHCEND  120

Query  534  GVEEG-VLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVH  358
              E G +LVFEYV NGTLQ+KLH N   ++LPWRNRM +AFQLAQ +EYLHDKC  QIVH
Sbjct  121  --ESGNMLVFEYVSNGTLQDKLHENRDMTILPWRNRMAVAFQLAQAIEYLHDKCPSQIVH  178

Query  357  GDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDP  178
             D+K SNILLD + NCKLCD+GSAK+GFSS+V P         KNR ++   GSPGYTDP
Sbjct  179  SDIKSSNILLDDQFNCKLCDFGSAKIGFSSSVSP-------LTKNRVIL---GSPGYTDP  228

Query  177  HYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            HYLRTGIA+KK+DIYS GVI+LELI+G+EA SS S  RLISKA  +L D SKV  M+D
Sbjct  229  HYLRTGIASKKNDIYSFGVIILELISGVEAFSSGSGERLISKAAAILNDVSKVEEMID  286



>ref|XP_004251495.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Solanum 
lycopersicum]
Length=343

 Score =   327 bits (838),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 160/259 (62%), Positives = 200/259 (77%), Gaps = 11/259 (4%)
 Frame = -2

Query  780  ARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQE  601
            A R T +E++K T +FS S +IA GGFS VYL  FPD S  A+KI+D+SS+RL+ MYKQE
Sbjct  39   ATRYTSQELKKFTANFSNSNLIACGGFSRVYLANFPDLSPRAVKIMDSSSERLNGMYKQE  98

Query  600  LEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGI  421
            L+IL +I+HDNIVK+  + +D      +LVFEYV NGTLQ+KLH N   ++L WRNRMG+
Sbjct  99   LDILIQIKHDNIVKLFDHCEDNEFG-NMLVFEYVSNGTLQDKLHENRDRTILSWRNRMGV  157

Query  420  AFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTA  241
            AFQLAQ +EYLH+KC  QIVH D+K SNILLD + NCKLCD+GSAK+GFSS++ PP+   
Sbjct  158  AFQLAQAIEYLHEKCALQIVHSDIKSSNILLDDQFNCKLCDFGSAKIGFSSSISPPT---  214

Query  240  TATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRL  61
                KNR ++   GSPGYTDPHYLRTGIA+KK+DIYS GVI+LELI+G+EA SS +  RL
Sbjct  215  ----KNRVIL---GSPGYTDPHYLRTGIASKKNDIYSFGVIILELISGVEAFSSCNGERL  267

Query  60   ISKAGPMLKDESKVAGMVD  4
            ISKA P+L D SKVA M+D
Sbjct  268  ISKAAPILNDVSKVAEMMD  286



>ref|XP_011081342.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Sesamum 
indicum]
Length=339

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/253 (63%), Positives = 194/253 (77%), Gaps = 13/253 (5%)
 Frame = -2

Query  759  EVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRI  580
            ++++ T+DFS   VI +GGFSTVYL +FPDSS  A+KI   SS+RL+  YKQELEIL  +
Sbjct  51   DIERCTMDFSL--VIGYGGFSTVYLAQFPDSSSAAVKI-QCSSERLNEAYKQELEILLHV  107

Query  579  RHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQV  400
             H NIVK+LG+ DD   +EGVLV EYVPNG LQEKLHG+   ++LPW+ RM IAFQLAQ 
Sbjct  108  HHPNIVKLLGHCDDR--DEGVLVMEYVPNGNLQEKLHGSN--TLLPWKKRMAIAFQLAQA  163

Query  399  LEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTV-QPPSSTATATAKN  223
            +EYLHDKC  QIVHGD+K SNILLD +LNCKLCD+GSAKMGFSS V QP S TA    +N
Sbjct  164  IEYLHDKCGLQIVHGDIKASNILLDEQLNCKLCDFGSAKMGFSSLVLQPSSPTAR---RN  220

Query  222  RTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGP  43
            R M  M GSPGYTDPHYLRTG+ATKK+D+YS GVI+LELITG+EA +  S  RL +K   
Sbjct  221  RIM--MLGSPGYTDPHYLRTGLATKKNDVYSFGVIVLELITGMEAFNPSSGERLTTKVEL  278

Query  42   MLKDESKVAGMVD  4
            +L++  KV  +VD
Sbjct  279  LLRNLEKVGEIVD  291



>ref|XP_010661966.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g28960 [Vitis vinifera]
Length=662

 Score =   317 bits (813),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 161/270 (60%), Positives = 202/270 (75%), Gaps = 13/270 (5%)
 Frame = -2

Query  801  EKDTKE-SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKR  625
            E D K  S +R +R+E++++T++FS++RVI  GGFSTVYL  FP S++ A+KI     +R
Sbjct  142  EPDKKNGSVKRFSREEIERVTMNFSQTRVIGSGGFSTVYLAHFPGSTMAAVKI-HNGGER  200

Query  624  LHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGG---  454
            L+ ++KQELEIL  + HDNIVK+LGY DD   EEGVLVFE+VP G+LQE LH + G    
Sbjct  201  LNRVFKQELEILLHLDHDNIVKLLGYGDDR--EEGVLVFEHVPKGSLQEMLHDSTGAKEN  258

Query  453  SVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGF  274
            S L W+NRM IAFQLA+ +EYLH+KC   IVHGD+K SNILLD  LNCKLCD+GSAKMGF
Sbjct  259  SPLSWKNRMAIAFQLAEAIEYLHEKCALPIVHGDIKASNILLDEHLNCKLCDFGSAKMGF  318

Query  273  SSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGL  94
            SSTV PPSS+      N+ M  M GSPGY DPHYLRTGI +KK+DIYS GVILLEL+TG+
Sbjct  319  SSTVLPPSSSRM----NQVM--MMGSPGYVDPHYLRTGIPSKKNDIYSFGVILLELLTGM  372

Query  93   EAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            +A  S+    L S AGP+L+D S+V  +VD
Sbjct  373  DAFCSEREQPLTSIAGPILRDASQVGKVVD  402



>ref|XP_010250833.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Nelumbo 
nucifera]
Length=445

 Score =   308 bits (789),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 192/258 (74%), Gaps = 17/258 (7%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQEL  598
            +R +  EV++ TV+FSR  VI  GGFSTVYL  FP+S+LGAIK+   +S+RL+ ++KQEL
Sbjct  144  KRFSWDEVERFTVNFSR--VIGEGGFSTVYLAHFPNSTLGAIKV-HNNSERLNRVFKQEL  200

Query  597  EILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIA  418
            EIL  I+H +I+ +LGY D+   EEGVLVFEYVPNG+LQEKLHG+G  S+LPW+ RM IA
Sbjct  201  EILLHIQHPHIIDLLGYCDER--EEGVLVFEYVPNGSLQEKLHGHGE-SLLPWKTRMSIA  257

Query  417  FQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTAT  238
            +QLAQ + YLHD C  QIVHGD+K SNILLD   NCKLCD+G AKMGFSS V P      
Sbjct  258  YQLAQAIAYLHDNCTLQIVHGDIKASNILLDQHFNCKLCDFGFAKMGFSSAVLP------  311

Query  237  ATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLI  58
             +A N  M    GSPGY DPHYLRTGIA+KK+D+YS GVI+LELITG+EA  S+    L 
Sbjct  312  -SAMNPVM----GSPGYIDPHYLRTGIASKKNDVYSFGVIVLELITGIEAFCSEKEQLLT  366

Query  57   SKAGPMLKDESKVAGMVD  4
            S AGP+L D +KV  MVD
Sbjct  367  SIAGPLLGDLNKVPEMVD  384



>ref|XP_007039261.1| LRR receptor-like serine/threonine-protein kinase, putative [Theobroma 
cacao]
 gb|EOY23762.1| LRR receptor-like serine/threonine-protein kinase, putative [Theobroma 
cacao]
Length=455

 Score =   301 bits (770),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 156/268 (58%), Positives = 188/268 (70%), Gaps = 19/268 (7%)
 Frame = -2

Query  789  KESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMY  610
            +E  R+   +E++ +T +FSR  VI  GGFS VYL     SS GA+K+    S RL+ ++
Sbjct  143  EEFVRKFRWEEIKDVTKNFSR--VIGQGGFSNVYLANLSGSSQGAVKV-QVGSDRLNQVF  199

Query  609  KQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNR  430
            KQEL+IL R+RHDNIVK+LGY DD  +EEG +VFEYVPNG LQEKLH      VLPW+ R
Sbjct  200  KQELDILLRLRHDNIVKLLGYCDD--LEEGAMVFEYVPNGNLQEKLH-EMEREVLPWKTR  256

Query  429  MGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPS  250
              IAFQLAQ +EYLH+KC  QIVHGD+K SNILLD   NCKLCD+GSAKMGFSSTV PPS
Sbjct  257  TAIAFQLAQAIEYLHEKCTLQIVHGDIKASNILLDEHFNCKLCDFGSAKMGFSSTVIPPS  316

Query  249  STATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSN  70
             +       RT   M GSPGYTDPHYLRTG A+KK+D+YSLGVI+LEL+TG+EA   +  
Sbjct  317  CS-------RTKQVMIGSPGYTDPHYLRTGFASKKNDVYSLGVIILELVTGMEAFCPERG  369

Query  69   VRLISKAGPMLKD------ESKVAGMVD  4
              L S   P L+D      E KVA +VD
Sbjct  370  QLLTSIVAPNLRDIAECGAEEKVAELVD  397



>ref|XP_009373678.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Pyrus 
x bretschneideri]
Length=462

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 207/302 (69%), Gaps = 28/302 (9%)
 Frame = -2

Query  855  VSVMA-FGCLGRKSRRRKAEKDTKE----------SARRLTRKEVQKLTVDFSRSRVIAF  709
            VSVM    C G +S+R++   D ++          S ++L    +++ T  FS+  VI  
Sbjct  106  VSVMVVIRCFGFRSKRKQNRIDVEKEDHIEESGEFSVKKLRWDWIERSTDGFSK--VIGT  163

Query  708  GGFSTVYLGKFPD--SSLGAIKI-IDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDD  538
            GGFS VYL + PD  SS G   I +   S+RL   +KQEL+IL R+ H +IVK+LGYSD+
Sbjct  164  GGFSNVYLARNPDPNSSDGFCAIKVHNGSERLSRGFKQELDILLRLEHRHIVKLLGYSDN  223

Query  537  EGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVH  358
            +  EEG LVFEYV NG LQEKLHG    S LPW+NRM IAFQ+AQ LEYLH+KC  QIVH
Sbjct  224  Q--EEGALVFEYVANGNLQEKLHGGDATSALPWKNRMAIAFQIAQALEYLHEKCALQIVH  281

Query  357  GDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDP  178
             D+K SNILLD  LNCKLCD+GSAKMGFSSTVQPPSS      +N  ++TM GSPGYTDP
Sbjct  282  KDIKASNILLDENLNCKLCDFGSAKMGFSSTVQPPSSM-----RNH-VLTMMGSPGYTDP  335

Query  177  HYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLK----DESKVAGM  10
            HYLRTGIA+KK+D+YS GV++LEL+TG+EA  S+    L +  GP L+    D ++VA +
Sbjct  336  HYLRTGIASKKNDVYSFGVLILELVTGMEAFCSEKGQFLTTLVGPRLRYGGCDAAEVADL  395

Query  9    VD  4
            VD
Sbjct  396  VD  397



>ref|XP_008239292.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Prunus 
mume]
Length=475

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/264 (58%), Positives = 195/264 (74%), Gaps = 15/264 (6%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            S R+L+  E+++ T +F +  VI  GG+S VYL + P S   AIKI +  S+RL+ ++KQ
Sbjct  163  SVRKLSWDEIERSTNNFCK--VIGSGGYSNVYLARNP-SGFWAIKI-NNGSERLNQVFKQ  218

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMG  424
            EL+IL  ++H +IVK+LGY D +  EEG LVFEYV NG LQ+KLHG     VLPWRNRM 
Sbjct  219  ELDILLHLQHPHIVKLLGYCDKQ--EEGALVFEYVANGNLQDKLHGGESSPVLPWRNRMA  276

Query  423  IAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSST  244
            IAFQ+AQ LEYLH+KC  QIVH D+K SNILLD +LNCKLCD+GSAKMGFSSTV+PPSS+
Sbjct  277  IAFQIAQALEYLHEKCPLQIVHMDIKASNILLDQDLNCKLCDFGSAKMGFSSTVRPPSSS  336

Query  243  ATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVR  64
              +      ++TM GSPGYTDPHYLRTGIA+KK+D+YS GV++LEL+TG+EA  S+    
Sbjct  337  MKS-----HVLTMMGSPGYTDPHYLRTGIASKKNDVYSFGVLVLELVTGMEAFCSEKGQF  391

Query  63   LISKAGPMLKDE----SKVAGMVD  4
            L S  GP L+D     ++ AGMVD
Sbjct  392  LTSLVGPRLRDGGADLAEAAGMVD  415



>ref|XP_010053995.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Eucalyptus 
grandis]
 gb|KCW78372.1| hypothetical protein EUGRSUZ_D02544 [Eucalyptus grandis]
Length=471

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/278 (56%), Positives = 197/278 (71%), Gaps = 13/278 (5%)
 Frame = -2

Query  837  GCLGRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSS--  664
            G +G+    +         A +   +E+Q +T++FSR+  I  GGFSTVYL     SS  
Sbjct  132  GVVGKSGANKSDGGGDGCCAGKYRWEELQGMTMEFSRA--IGSGGFSTVYLAALDGSSEP  189

Query  663  -LGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGT  487
             L A+K+     +RL   +KQELEIL R+RH+NIVK+LGY DD   +EG LVFEYVPNG 
Sbjct  190  GLAAVKVQCGGGERLSLAFKQELEILLRVRHENIVKLLGYCDDR--DEGALVFEYVPNGN  247

Query  486  LQEKLHGN--GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELN  313
            LQEKLHGN    G+VLPW +R+ IAFQLAQ +EYLH+KC  QIVHGD+K SN+LLD +LN
Sbjct  248  LQEKLHGNHLQRGTVLPWSHRVSIAFQLAQAIEYLHEKCALQIVHGDVKSSNVLLDEDLN  307

Query  312  CKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIY  133
            CKLCD+GSAKMGFSS V PPSST++  AK      + GSPGYTDPHYLRTGIA+KK+DIY
Sbjct  308  CKLCDFGSAKMGFSSLVLPPSSTSSPRAKQ----ILMGSPGYTDPHYLRTGIASKKNDIY  363

Query  132  SLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKV  19
            S GVI+LEL+TG+EA   +  + L S A  +L++E ++
Sbjct  364  SYGVIVLELVTGIEAFCEERGLLLTSIATTLLREEGEL  401



>ref|XP_007209984.1| hypothetical protein PRUPE_ppa005138mg [Prunus persica]
 gb|EMJ11183.1| hypothetical protein PRUPE_ppa005138mg [Prunus persica]
Length=475

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/264 (58%), Positives = 194/264 (73%), Gaps = 15/264 (6%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            S R+L+  E+++ T +F +  VI  GG+S VYL + P S   AIKI +  S+RL+ ++KQ
Sbjct  163  SVRKLSWDEIERSTNNFCK--VIGSGGYSNVYLARKP-SGFWAIKI-NNGSERLNQVFKQ  218

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMG  424
            EL+IL  ++H +IVK+LGY D +  EEG LVFEYV NG LQ+KLHG     VLPWRNRM 
Sbjct  219  ELDILLHLQHPHIVKLLGYCDKQ--EEGALVFEYVANGNLQDKLHGGESSPVLPWRNRMA  276

Query  423  IAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSST  244
            IAFQ+AQ LEYLH+KC  QIVH D+K SNILLD +LNCKLCD+GSAKMGFSSTV+PPSS+
Sbjct  277  IAFQIAQALEYLHEKCPLQIVHMDIKASNILLDQDLNCKLCDFGSAKMGFSSTVRPPSSS  336

Query  243  ATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVR  64
              +      ++TM GSPGYTDPHYLRTGIA+KK+D+YS GV++LEL+TG+EA  S+    
Sbjct  337  MKS-----HVLTMMGSPGYTDPHYLRTGIASKKNDVYSFGVLVLELVTGMEAFCSEKGQF  391

Query  63   LISKAGPMLKD----ESKVAGMVD  4
            L S  GP LKD     ++ A MVD
Sbjct  392  LTSMVGPRLKDGGGNVAEAARMVD  415



>gb|KCW78373.1| hypothetical protein EUGRSUZ_D02544 [Eucalyptus grandis]
Length=469

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/278 (55%), Positives = 195/278 (70%), Gaps = 15/278 (5%)
 Frame = -2

Query  837  GCLGRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSS--  664
            G +G+    +         A +   +E+Q +T++FSR+  I  GGFSTVYL     SS  
Sbjct  132  GVVGKSGANKSDGGGDGCCAGKYRWEELQGMTMEFSRA--IGSGGFSTVYLAALDGSSEP  189

Query  663  -LGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGT  487
             L A+K+     +RL   +KQELEIL R+RH+NIVK+LGY DD G     LVFEYVPNG 
Sbjct  190  GLAAVKVQCGGGERLSLAFKQELEILLRVRHENIVKLLGYCDDRGA----LVFEYVPNGN  245

Query  486  LQEKLHGN--GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELN  313
            LQEKLHGN    G+VLPW +R+ IAFQLAQ +EYLH+KC  QIVHGD+K SN+LLD +LN
Sbjct  246  LQEKLHGNHLQRGTVLPWSHRVSIAFQLAQAIEYLHEKCALQIVHGDVKSSNVLLDEDLN  305

Query  312  CKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIY  133
            CKLCD+GSAKMGFSS V PPSST++  AK      + GSPGYTDPHYLRTGIA+KK+DIY
Sbjct  306  CKLCDFGSAKMGFSSLVLPPSSTSSPRAKQ----ILMGSPGYTDPHYLRTGIASKKNDIY  361

Query  132  SLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKV  19
            S GVI+LEL+TG+EA   +  + L S A  +L++E ++
Sbjct  362  SYGVIVLELVTGIEAFCEERGLLLTSIATTLLREEGEL  399



>ref|XP_008392679.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Malus 
domestica]
Length=482

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/303 (52%), Positives = 204/303 (67%), Gaps = 30/303 (10%)
 Frame = -2

Query  855  VSVMA-FGCLGRKSRRRKAEKDTKE----------SARRLTRKEVQKLTVDFSRSRVIAF  709
            VSVM    C G +S+R++   D ++          S ++L    +++ T  FS+  VI  
Sbjct  126  VSVMVVIRCFGFRSKRKQNRIDVEKEDHNEESGEFSVKKLRWDWIERSTDGFSK--VIGT  183

Query  708  GGFSTVYLGKFPDSSLG----AIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSD  541
            GGFS VYL + PD + G    AIK+    S+RL  ++KQEL+IL R+ H +IVK+LGYSD
Sbjct  184  GGFSNVYLARNPDPNSGDRFCAIKV-HNGSERLSRVFKQELDILLRLEHHHIVKLLGYSD  242

Query  540  DEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIV  361
            ++  EEG LVFEYV  G LQEKLHG      +PW+NRM IAFQ+AQ LEYLH+KC  QIV
Sbjct  243  NQ--EEGALVFEYVXYGNLQEKLHGGDATPAMPWKNRMAIAFQIAQALEYLHEKCALQIV  300

Query  360  HGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTD  181
            H D+K SNILLD  LNCKLCD+GSAKMGFSSTVQPPS           ++TM GSPGYTD
Sbjct  301  HMDIKASNILLDENLNCKLCDFGSAKMGFSSTVQPPSXM------RNHVLTMMGSPGYTD  354

Query  180  PHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLK----DESKVAG  13
            PHYLRTGIA+KK+D+YS GV++LEL+TG+EA  S+    L +  GP L+    D ++VA 
Sbjct  355  PHYLRTGIASKKNDVYSFGVLILELVTGMEAFCSEKGQFLTTLVGPRLRYGGCDAAEVAE  414

Query  12   MVD  4
            +VD
Sbjct  415  LVD  417



>ref|XP_011004390.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Populus 
euphratica]
Length=368

 Score =   290 bits (741),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 159/290 (55%), Positives = 201/290 (69%), Gaps = 35/290 (12%)
 Frame = -2

Query  810  RKAEKD---TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIID  640
            RK EKD       AR+ +  E+++L+++FS+  ++  GGFSTVYL + P SS+GAIKI  
Sbjct  32   RKKEKDFDGANGCARKYSWSEIERLSMNFSQ--IVGSGGFSTVYLARLPGSSIGAIKI-H  88

Query  639  TSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNG  460
              S  L+ ++KQEL+IL  ++HDNIVK+LGY D++  +EG LVFEYV NGTLQ+KLHG G
Sbjct  89   CPSDYLNRVFKQELDILLHLQHDNIVKLLGYCDNQ--DEGALVFEYVSNGTLQDKLHGAG  146

Query  459  G-------GSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLC  301
                     +VL WR RM IA+QLAQ LEYLH+KC  QIVHGD+K SNILLD +LNCKLC
Sbjct  147  REIRESSRSTVLSWRQRMAIAYQLAQALEYLHEKCPLQIVHGDIKPSNILLDEQLNCKLC  206

Query  300  DYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGV  121
            D+G AKMGFSSTV         T+ NR  + M GSPGYTDPHYLRTGIA+KK+D+YS GV
Sbjct  207  DFGFAKMGFSSTVM--------TSNNRKQV-MMGSPGYTDPHYLRTGIASKKNDVYSYGV  257

Query  120  ILLELITGLEAVSSD--SNVRLISKAGPMLK---------DESKVAGMVD  4
            I+LEL+TG+EA   +      L S  GP+LK         + +KVA MVD
Sbjct  258  IILELLTGMEAFCEERGQGQLLTSMIGPILKSIIASGGECNPTKVAEMVD  307



>ref|XP_009397858.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Musa 
acuminata subsp. malaccensis]
Length=385

 Score =   290 bits (742),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 187/260 (72%), Gaps = 14/260 (5%)
 Frame = -2

Query  780  ARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQE  601
            ARR    E++     F+ + V+  GG STVYL + PDSSL A+K+    S+RLH  ++QE
Sbjct  80   ARRFGCAEIESFAGKFATAAVVGEGGCSTVYLARLPDSSLAALKL-HRPSERLHRAFRQE  138

Query  600  LEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGI  421
            L++L R+RH +IV++LGY DD G EEGVLVFEY PNG+L EKLHG  GG VLPW  RM I
Sbjct  139  LDVLLRLRHPHIVRLLGYCDD-GEEEGVLVFEYAPNGSLHEKLHG--GGEVLPWARRMAI  195

Query  420  AFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTA  241
            A+Q+AQ L+YLH+ CDPQ+VHGD+K +N+LLD  L  KLCD+GSA++GFS+ V PP S  
Sbjct  196  AYQVAQALDYLHEGCDPQVVHGDVKAANVLLDRRLEAKLCDFGSARVGFSAAVAPPRSA-  254

Query  240  TATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRL  61
                  R M+   GSPGY DPHYLR+G+ +KKSD+YS GV+LLEL+TG EA  ++   RL
Sbjct  255  ------RAMVV--GSPGYVDPHYLRSGMVSKKSDVYSFGVLLLELLTGAEAFDAERERRL  306

Query  60   ISKAGPMLKD-ESKVAGMVD  4
             ++ GP+L+D + + A +VD
Sbjct  307  TAELGPVLRDPDGRAAEVVD  326



>ref|XP_002518971.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF43504.1| receptor protein kinase, putative [Ricinus communis]
Length=543

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 195/273 (71%), Gaps = 22/273 (8%)
 Frame = -2

Query  801  EKDTKESA--RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSK  628
            EKD  +    ++ +  ++++LT++F+R  V+  GGFSTV+L + P  +LGA+KI   +S 
Sbjct  37   EKDFDDDCCEKKYSWNDIERLTMNFAR--VVGSGGFSTVFLARLPSLTLGAVKI-HGNSD  93

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV  448
             L+ ++KQEL+IL ++RHDNIVK+LG+ DD+  + G LV EYVPNG+LQ+KLHG     +
Sbjct  94   HLNRLFKQELDILLQLRHDNIVKLLGHCDDQ--DRGALVLEYVPNGSLQDKLHG-AATEI  150

Query  447  LPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSS  268
            L W+ RM IAFQLAQ LEYLHDKC  QIVHGD+K SNILLD  LNCKLCD+GSAKMGFSS
Sbjct  151  LSWKRRMAIAFQLAQALEYLHDKCTLQIVHGDIKASNILLDEHLNCKLCDFGSAKMGFSS  210

Query  267  TVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEA  88
             V P S         RT   M GSPGYTDPHYLRTG+A+KK+DIYS GVI+LEL+TG+EA
Sbjct  211  MVMPSS---------RTKQVMMGSPGYTDPHYLRTGMASKKNDIYSYGVIILELVTGMEA  261

Query  87   VSSDSNVRLISKAGPMLK-----DESKVAGMVD  4
               +    L S  GPML+     + +K+A MVD
Sbjct  262  FCEERGQLLTSMMGPMLRNARDCEATKMAEMVD  294



>ref|XP_004953286.1| PREDICTED: probable receptor-like protein kinase At4g10390-like 
[Setaria italica]
Length=354

 Score =   288 bits (736),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/261 (54%), Positives = 186/261 (71%), Gaps = 9/261 (3%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            + RR    E++ +T  FS SRVI  GGFSTVYL     S LGA+K+   SS+RLH  ++Q
Sbjct  43   ATRRFAWAEIESVTAGFS-SRVIGQGGFSTVYLASLSSSRLGAVKV-QRSSERLHRAFRQ  100

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMG  424
            EL +L  +RH ++V++LGY D+   EEGVLVFEY PNG L E+LHG+GG + LPW  RM 
Sbjct  101  ELHVLLSLRHPHVVRLLGYCDER--EEGVLVFEYAPNGDLHERLHGSGGKAALPWARRMA  158

Query  423  IAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSST  244
            IAFQ+A  LE+LH+  DP ++HGD+K SN+LLD+ L+ KLCD+G A +GFS+ +QPP + 
Sbjct  159  IAFQVAMALEHLHETRDPAVIHGDIKASNVLLDASLDAKLCDFGFAHVGFSAALQPPDAA  218

Query  243  ATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVR  64
            A+  +    M    GSPGY DPH+LR+G+ATKKSD+YS GV+LLEL+TG EA+ +D+  R
Sbjct  219  ASRASARSVM----GSPGYVDPHFLRSGVATKKSDVYSYGVLLLELLTGREAICADTGCR  274

Query  63   LISKAGPMLKDESKVAGMVDR  1
            L +  GP L  E KVA +VDR
Sbjct  275  LAAAVGPTLT-EGKVADVVDR  294



>ref|XP_002317644.2| hypothetical protein POPTR_0011s15020g [Populus trichocarpa]
 gb|EEE98256.2| hypothetical protein POPTR_0011s15020g [Populus trichocarpa]
Length=370

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 157/289 (54%), Positives = 198/289 (69%), Gaps = 35/289 (12%)
 Frame = -2

Query  807  KAEKD---TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDT  637
            K EKD   T   AR+ +  E+++L+++FS+  ++  GGFSTVYL   P SS+GAIKI   
Sbjct  35   KEEKDFDGTNGCARKYSWSEIERLSMNFSQ--IVGSGGFSTVYLAHLPGSSIGAIKI-HC  91

Query  636  SSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGG  457
             S  L+ ++KQEL+IL +++HDNIVK+LGY D++  +EG LVFEYV NGTLQ+KLHG G 
Sbjct  92   PSDYLNRVFKQELDILLQLQHDNIVKLLGYCDNQ--DEGALVFEYVSNGTLQDKLHGAGR  149

Query  456  -------GSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCD  298
                    +VL WR RM IA+QLAQ LEYLH+KC  QIVHGD+K SNILLD +LNCKLCD
Sbjct  150  EIRESSRSTVLSWRKRMAIAYQLAQALEYLHEKCPLQIVHGDIKPSNILLDEQLNCKLCD  209

Query  297  YGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVI  118
            +G AKMGFSSTV          + N     M GSPGYTDPHYLRTGIA+KK+D+YS GVI
Sbjct  210  FGFAKMGFSSTV---------MSSNNRKQVMMGSPGYTDPHYLRTGIASKKNDVYSYGVI  260

Query  117  LLELITGLEAVSSD--SNVRLISKAGPMLK---------DESKVAGMVD  4
            +LEL+TG+EA   +      L S  GP+LK         + +KVA MVD
Sbjct  261  ILELVTGMEAFCEERGQGQLLTSMIGPILKSIIASGDECNPTKVAEMVD  309



>ref|XP_009382326.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Musa 
acuminata subsp. malaccensis]
Length=370

 Score =   287 bits (735),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 150/279 (54%), Positives = 187/279 (67%), Gaps = 18/279 (6%)
 Frame = -2

Query  831  LGRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKF-PDSSLGA  655
            LG++    K + D   + RR    EV+ LT +F+ + VI  GGFSTVYL    PD+S  A
Sbjct  48   LGKEPEAAKGDGDV--ALRRFRWAEVESLTGNFAPAAVIGEGGFSTVYLACLAPDASPAA  105

Query  654  IKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEK  475
             K+    S+RLH  ++QEL++L R+RH  IV++LGY DD   E GVLVFEYVPNG+L EK
Sbjct  106  FKL-QRPSERLHRAFRQELDVLIRLRHPYIVRLLGYCDDR--EGGVLVFEYVPNGSLHEK  162

Query  474  LHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDY  295
            LHG+GGG+VLPW  RM IA+QLAQ L+YLHD CD QIVHGD+K SN+LLD  L  KLCD+
Sbjct  163  LHGDGGGAVLPWARRMAIAYQLAQALDYLHDGCDLQIVHGDVKASNVLLDERLEPKLCDF  222

Query  294  GSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVIL  115
            GS ++GFS+ V P           R    M GSPGY DPHYLR+G  +KK+DIYS GV+L
Sbjct  223  GSTRVGFSAAVLP-----------RAAHPMLGSPGYVDPHYLRSGTVSKKNDIYSFGVLL  271

Query  114  LELITGLEAVSSDSNVRLISKAGPMLKDESKVAG-MVDR  1
            LELITG EA  S +   L +  GP L+D    AG +VDR
Sbjct  272  LELITGSEAFDSAAERMLTAAVGPALRDPCARAGELVDR  310



>ref|XP_008375434.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Malus 
domestica]
Length=453

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 159/303 (52%), Positives = 206/303 (68%), Gaps = 30/303 (10%)
 Frame = -2

Query  855  VSVMA-FGCLGRKSRRR----------KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAF  709
            VSVM    C G +S+R+            E+  + S ++L+   +++ T  FS+  VI  
Sbjct  100  VSVMVVMRCFGFRSKRKDNGIVVEKEDHVEESGEFSVKKLSWDWIERSTDGFSK--VIGT  157

Query  708  GGFSTVYLGKFPDSSLG----AIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSD  541
            GGFS VYL + P  + G    +IKI    S+RL  ++KQEL+IL R+ H  IVK+LGYS+
Sbjct  158  GGFSNVYLARNPGPNSGDGFCSIKI-HNGSERLSRVFKQELDILLRLEHHRIVKLLGYSE  216

Query  540  DEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIV  361
            ++  EEG LVFEYV NG LQEKLHG      LPW+NRM IAFQ+AQ LEYLH+KC  QIV
Sbjct  217  NQ--EEGALVFEYVTNGNLQEKLHGGDATPALPWKNRMAIAFQVAQALEYLHEKCALQIV  274

Query  360  HGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTD  181
            H D+K SNILLD  LNCKLCD+GSAKMGFSSTVQPPSS      +N+ ++T+ GSPGYTD
Sbjct  275  HMDIKASNILLDENLNCKLCDFGSAKMGFSSTVQPPSSL-----RNQ-VLTVMGSPGYTD  328

Query  180  PHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKD----ESKVAG  13
            PHYLRTGIA+KK+D+YS GV++LEL+TG+EA  S+    L +  G  L+D     ++VA 
Sbjct  329  PHYLRTGIASKKNDVYSFGVLILELVTGMEAFCSEKGQFLTTLVGGRLRDGGCEAAEVAE  388

Query  12   MVD  4
            +VD
Sbjct  389  LVD  391



>ref|XP_009360263.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Pyrus 
x bretschneideri]
 ref|XP_009360305.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Pyrus 
x bretschneideri]
Length=476

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/300 (53%), Positives = 204/300 (68%), Gaps = 27/300 (9%)
 Frame = -2

Query  855  VSVMA-FGCLGRKSRRR----------KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAF  709
            VSVM    C G +S+R+            E+  + S ++L+   +++ T  FS+  VI  
Sbjct  126  VSVMVVMRCFGFRSKRKDNGIVVEKEDHVEESGEFSVKKLSWDWIERSTDGFSK--VIGT  183

Query  708  GGFSTVYLGKFPDSSLG----AIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSD  541
            GGFS VYL + P  + G    +IKI    S+RL  ++KQEL+IL R+ H  IVK+LGYS+
Sbjct  184  GGFSNVYLARNPGPNSGDGFCSIKI-HNGSERLSRVFKQELDILLRLEHHRIVKLLGYSE  242

Query  540  DEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIV  361
            ++  EEG LVFEYV NG LQEKLHG      LPW+NRM IAFQ+AQ LEYLH+KC  QIV
Sbjct  243  NQ--EEGALVFEYVANGNLQEKLHGGDATPALPWKNRMAIAFQVAQALEYLHEKCALQIV  300

Query  360  HGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTD  181
            H D+K SNILLD  LNCKLCD+GSAKMGFSSTVQPPSS      +N+ ++TM GSPGYTD
Sbjct  301  HMDIKASNILLDENLNCKLCDFGSAKMGFSSTVQPPSSM-----RNQ-VLTMMGSPGYTD  354

Query  180  PHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKD-ESKVAGMVD  4
            PHYLRTGIA+KK+D+YS GV++LEL+TG+EA  S+    L +  G  L+D   + A +VD
Sbjct  355  PHYLRTGIASKKNDVYSFGVLILELVTGMEAFCSEKGQFLTTLVGSRLRDGGCEAAELVD  414



>ref|XP_009393911.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Musa 
acuminata subsp. malaccensis]
Length=378

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 182/256 (71%), Gaps = 13/256 (5%)
 Frame = -2

Query  798  KDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLH  619
            K+   +ARR    E++ +T  F+   V+  GG STVYL   PDSSL A+K+    S+RLH
Sbjct  65   KEKSSAARRFGWAEIESVTGKFAPHAVVGEGGSSTVYLACLPDSSLAALKL-HRPSERLH  123

Query  618  TMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPW  439
              ++QEL++L R+RH +IV++LGY DD   EEGVLVFEYVPNG+LQE+LHG+G   VLPW
Sbjct  124  RAFRQELDVLLRLRHPHIVRLLGYCDDRE-EEGVLVFEYVPNGSLQERLHGDG--EVLPW  180

Query  438  RNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQ  259
              RM +A+Q+AQ LEYLH+ CDPQ+VHGD+K +N+LLD  +  KLCD+GSA+ GFS+ V 
Sbjct  181  ARRMAVAYQVAQALEYLHEGCDPQVVHGDVKAANVLLDGRMEAKLCDFGSARAGFSAAVA  240

Query  258  PPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSS  79
            PP S        R MM   GS GY DPHYLR+G+ +KKSD+YS GV+LLEL+TG EA  +
Sbjct  241  PPRSA-------RAMMV--GSLGYVDPHYLRSGMVSKKSDVYSFGVLLLELVTGAEAFDA  291

Query  78   DSNVRLISKAGPMLKD  31
               +RL +  GP+L+D
Sbjct  292  GRELRLTAAMGPVLRD  307



>ref|XP_002452840.1| hypothetical protein SORBIDRAFT_04g033400 [Sorghum bicolor]
 gb|EES05816.1| hypothetical protein SORBIDRAFT_04g033400 [Sorghum bicolor]
Length=369

 Score =   286 bits (731),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 188/267 (70%), Gaps = 15/267 (6%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            +ARR    E++ +T  FS SRVI  GGFSTVYL     S LGA+K+   SS+RLH  ++Q
Sbjct  50   AARRFAWAEIESVTAGFS-SRVIGQGGFSTVYLACLSSSRLGAVKV-QRSSERLHRAFRQ  107

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV----LPWR  436
            EL++L  +RH +IV++LGY D+   EEGVLVFEY PNG L ++LHG GG +     LPW 
Sbjct  108  ELDVLLSLRHPHIVRLLGYCDER--EEGVLVFEYAPNGDLHQRLHGRGGKATPTPTLPWA  165

Query  435  NRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP  256
             RM +AFQ+A  LE+LH+  DP ++HGD+K SN+LLD+ L+ KLCD+G A +GFS+ +QP
Sbjct  166  RRMAVAFQVAMALEHLHESRDPAVIHGDIKASNVLLDASLDAKLCDFGFAHVGFSAALQP  225

Query  255  PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSD  76
            PSS+A+A         M GSPGY DPH+LR+G+ATKKSD+YS GV+LLEL+TG EA+ +D
Sbjct  226  PSSSASAARP-----VMMGSPGYVDPHFLRSGVATKKSDVYSFGVLLLELLTGREAMCAD  280

Query  75   SNVRLISKAGPMLKDE--SKVAGMVDR  1
            +  RL +  GP L  E   KV  +VDR
Sbjct  281  TGRRLAAAVGPTLTGEGGGKVDDVVDR  307



>ref|NP_001149562.1| protein kinase APK1A [Zea mays]
 gb|ACG35841.1| protein kinase APK1A [Zea mays]
 gb|AFW72560.1| putative protein kinase superfamily protein [Zea mays]
Length=357

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 187/267 (70%), Gaps = 7/267 (3%)
 Frame = -2

Query  798  KDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLH  619
            K +  SARR    E++ +T  FS SRVI  GGFSTVYL     S LGA+K+   SS+RLH
Sbjct  37   KGSGSSARRFAWAEIESVTAGFS-SRVIGQGGFSTVYLACLSSSRLGAVKV-QRSSERLH  94

Query  618  TMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPW  439
              ++QEL +L  +RH +IV++LGY D+   EEGVLVFEY PNG L E+LHG+G  + LPW
Sbjct  95   RAFRQELHVLLSLRHPHIVRLLGYCDER--EEGVLVFEYAPNGDLHERLHGSGK-APLPW  151

Query  438  RNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQ  259
              RM +AFQ+A  LE+LH+  DP ++HGD+K SN+LLD+ L+ KLCD G A +GFS+ +Q
Sbjct  152  ARRMAVAFQVAMALEHLHESRDPAVIHGDVKASNVLLDASLDAKLCDLGFAHVGFSAALQ  211

Query  258  PP-SSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVS  82
            PP +S A A A +     + GSPGY DPH+LR+G+ATKK D+YS GV+LLEL+TG EA+ 
Sbjct  212  PPEASGARARASSAPRAVVMGSPGYVDPHFLRSGVATKKGDVYSFGVLLLELLTGREAIC  271

Query  81   SDSNVRLISKAGPMLKDESKVAGMVDR  1
            +D+  RL +  GP L  E +VA  VDR
Sbjct  272  ADTGRRLAAAVGPTL-GEGRVAEAVDR  297



>ref|XP_011070699.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Sesamum 
indicum]
Length=340

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 150/273 (55%), Positives = 189/273 (69%), Gaps = 24/273 (9%)
 Frame = -2

Query  801  EKDTKESARR------LTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIID  640
            E++T    R+      L+  E++++T++FS   VI  GGFSTVYL +FPDSS  A+K+  
Sbjct  31   EEETSTCVRKHSSNMWLSWDEIRRVTMEFSV--VIGHGGFSTVYLAEFPDSSRAAVKMQC  88

Query  639  TSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNG  460
             S +     Y+QELEIL+R+RH  IVK+LGY DD   EEG+L+ EYVPNG LQEKLHG+ 
Sbjct  89   GSQRLSRRAYRQELEILRRLRHHTIVKLLGYCDDR--EEGILILEYVPNGNLQEKLHGSS  146

Query  459  GGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKM  280
              + LPW  RM IAFQLAQ + YLH  C   IVHGD+K SNILLD +LNCKLCD+GSAKM
Sbjct  147  --TFLPWMTRMAIAFQLAQAIAYLHRNC---IVHGDIKASNILLDEDLNCKLCDFGSAKM  201

Query  279  GFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELIT  100
            G SSTV      A   + +R M+   GS GYTDP YL+TG+A+ K+D+YS GV+LLELIT
Sbjct  202  GLSSTV------ALLDSNSRMMV---GSLGYTDPLYLKTGLASYKNDVYSFGVVLLELIT  252

Query  99   GLEAVSSDSNVRLISKAGPMLKDESKVAGMVDR  1
            G+EA S      L ++AGPML+D  KV  MVDR
Sbjct  253  GMEAFSPGRGEALATRAGPMLRDVEKVGEMVDR  285



>gb|KHG08600.1| hypothetical protein F383_14918 [Gossypium arboreum]
Length=356

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/259 (56%), Positives = 182/259 (70%), Gaps = 13/259 (5%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFP-DSSLGAIKIIDTSSKRLHTMYKQE  601
            ++ +  E++ +T DFS   VI  GGFS VYL     +S  GA+K+      RL+ ++KQE
Sbjct  44   KKFSWDEIKNVTKDFSL--VIGQGGFSNVYLANLSGNSRQGAVKV-HIGGDRLNQVFKQE  100

Query  600  LEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGI  421
            L+IL R+RHDNIVK+LGY +D  +EEG +VFEY+PNG LQEKLH      VLPW+ R  I
Sbjct  101  LDILLRLRHDNIVKLLGYCND--LEEGAMVFEYIPNGNLQEKLHERNN-DVLPWKTRTAI  157

Query  420  AFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTA  241
            A+QLAQ +E+LH+KC  QI+HGD+K SNILLD   NCKLCD+GSAKMGFSSTV PPS + 
Sbjct  158  AYQLAQAIEFLHEKCTLQIIHGDIKASNILLDERFNCKLCDFGSAKMGFSSTVMPPSCSR  217

Query  240  TATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRL  61
            T      T   M GSPGYTDPHYLRTG+A+KK+D+YSLGVI+LEL+TG+EA   +    L
Sbjct  218  T------TKQVMIGSPGYTDPHYLRTGLASKKNDVYSLGVIILELVTGMEAFCPERGQLL  271

Query  60   ISKAGPMLKDESKVAGMVD  4
             S   P LK  S+V   V+
Sbjct  272  TSIMAPNLKAISEVGTAVE  290



>ref|XP_011038067.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Populus 
euphratica]
Length=458

 Score =   285 bits (729),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 162/290 (56%), Positives = 200/290 (69%), Gaps = 36/290 (12%)
 Frame = -2

Query  807  KAEKDTKESARRLTRK----EVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIID  640
            K EKD+        RK    E++KL+++FS+  ++  GGFSTVYLG  PDS+LGAIKI  
Sbjct  124  KKEKDSDHGTHGCVRKYNWSEIEKLSMNFSQ--IVGSGGFSTVYLGLLPDSNLGAIKI-H  180

Query  639  TSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNG  460
              S  L+ ++KQEL+IL +++HDNIVK+LGY D +  +EG LVFEYV NGTLQ+KLHG  
Sbjct  181  CPSDYLNRVFKQELDILLQLQHDNIVKLLGYCDVQ--DEGALVFEYVSNGTLQDKLHGGE  238

Query  459  G-------GSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLC  301
            G        SV+ WRNRM IA+QLAQ LEYLH+KC  QIVHGD+K SNILLD +LNCKLC
Sbjct  239  GEIKKSSSSSVISWRNRMEIAYQLAQALEYLHEKCPLQIVHGDIKPSNILLDEQLNCKLC  298

Query  300  DYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGV  121
            D+G AKMGFSST+         T+ NR  + M GSPGYTDPHYLRTGIA+KK+D+YS GV
Sbjct  299  DFGFAKMGFSSTIM--------TSNNRKQV-MMGSPGYTDPHYLRTGIASKKNDVYSYGV  349

Query  120  ILLELITGLEAVSS--DSNVRLISKAGPMLKD---------ESKVAGMVD  4
            I+LEL+TG+EA     +    L S  GP+LKD           KVA MVD
Sbjct  350  IILELLTGMEAFCEEREQGQLLSSIMGPILKDIIASDNECKAMKVAEMVD  399



>ref|XP_010933767.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Elaeis 
guineensis]
Length=383

 Score =   283 bits (723),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 188/265 (71%), Gaps = 17/265 (6%)
 Frame = -2

Query  789  KESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPD--SSLGAIKIIDTSSKRLHT  616
            + + RR    E++ LT +F  S VI  GG STVYL   P   SSL A+K++  SS+RLH 
Sbjct  72   EPAPRRFGWPEIESLTGNFISSAVIGEGGSSTVYLASLPSPPSSLAALKVL-RSSERLHR  130

Query  615  MYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWR  436
             ++ EL++L R+RH +IV++LG+ DD   EEGVLVFEYVPNGTL EKLHG   G+VLPW 
Sbjct  131  AFRLELDVLLRLRHPHIVRLLGFCDDR--EEGVLVFEYVPNGTLHEKLHG---GAVLPWE  185

Query  435  NRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP  256
             R+ IA+Q+AQ L+YLH++CD  IVHGD+K SN+LL   L+ KLCD+G A+MGFS+ VQP
Sbjct  186  RRVAIAYQVAQALDYLHERCDLHIVHGDIKASNVLLGDTLDAKLCDFGFARMGFSAAVQP  245

Query  255  PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSD  76
            PS+        R++  M GSPGY DPHYLR+GI +KKSD+YS GV+LLELITG+EA  S+
Sbjct  246  PST--------RSVHPMMGSPGYVDPHYLRSGIVSKKSDVYSFGVLLLELITGMEAFCSE  297

Query  75   SNVRLISKAGPMLKDESKVAG-MVD  4
                L +  GP L+D  + AG MVD
Sbjct  298  REQLLTAVMGPALRDTGRGAGEMVD  322



>gb|KDO76826.1| hypothetical protein CISIN_1g017627mg [Citrus sinensis]
Length=368

 Score =   282 bits (721),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 190/269 (71%), Gaps = 14/269 (5%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSL---GAIKIIDTSSKRLHTM  613
            S ++ +  +V++ T +FS+  VI  GGFS VYL +  + S    GAIKI    S RL  +
Sbjct  45   SVKKYSWDDVERFTQNFSQ--VIGSGGFSNVYLARLINDSTSTNGAIKI-HVGSDRLSQV  101

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRN  433
            +KQEL+IL  + HDNIVK++GY DD   +EGVL+FEYVPNGTLQEKLHG    S LPWRN
Sbjct  102  FKQELDILLHLSHDNIVKLIGYCDDR--DEGVLLFEYVPNGTLQEKLHGTPRSSKLPWRN  159

Query  432  RMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPP  253
            RM IAFQLAQ +EYLH++C   IVHGD+K SNILL+  LNCKLCD+GSAKMGFSS V PP
Sbjct  160  RMAIAFQLAQAIEYLHERCTLHIVHGDIKASNILLEEHLNCKLCDFGSAKMGFSSAVLPP  219

Query  252  SSTATATAKNRT-MMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSD  76
            S + + +    T  + M GSPGYTDPHYLRTG+A+ K+D+YS GVILLEL+TG+EA   +
Sbjct  220  SPSPSPSRSRITKQVMMIGSPGYTDPHYLRTGMASTKTDVYSFGVILLELVTGMEAFCPE  279

Query  75   SNVRLISKAGPMLKD-----ESKVAGMVD  4
            +   L S AG ML D      +KV  +VD
Sbjct  280  NGQLLTSLAGSMLNDIADCEATKVNELVD  308



>ref|XP_006439156.1| hypothetical protein CICLE_v10020714mg [Citrus clementina]
 gb|ESR52396.1| hypothetical protein CICLE_v10020714mg [Citrus clementina]
Length=368

 Score =   282 bits (721),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 190/269 (71%), Gaps = 14/269 (5%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSL---GAIKIIDTSSKRLHTM  613
            S ++ +  +V++ T +FS+  VI  GGFS VYL +  + S    GAIKI    S RL  +
Sbjct  45   SVKKYSWDDVERFTQNFSQ--VIGSGGFSNVYLARLINDSTSTNGAIKI-HVGSDRLSQV  101

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRN  433
            +KQEL+IL  + HDNIVK++GY DD   +EGVL+FEYVPNGTLQEKLHG    S LPWRN
Sbjct  102  FKQELDILLHLSHDNIVKLIGYCDDR--DEGVLLFEYVPNGTLQEKLHGTPRSSKLPWRN  159

Query  432  RMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPP  253
            RM IAFQLAQ +EYLH++C   IVHGD+K SNILL+  LNCKLCD+GSAKMGFSS V PP
Sbjct  160  RMAIAFQLAQAIEYLHERCTLHIVHGDIKASNILLEEHLNCKLCDFGSAKMGFSSAVLPP  219

Query  252  SSTATATAKNRT-MMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSD  76
            S + + +    T  + M GSPGYTDPHYLRTG+A+ K+D+YS GVILLEL+TG+EA   +
Sbjct  220  SPSPSPSRSRITKQVMMIGSPGYTDPHYLRTGMASTKTDVYSFGVILLELVTGMEAFCPE  279

Query  75   SNVRLISKAGPMLKD-----ESKVAGMVD  4
            +   L S AG ML D      +KV  +VD
Sbjct  280  NGQLLTSLAGSMLNDIADCEATKVNELVD  308



>ref|XP_009400981.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Musa 
acuminata subsp. malaccensis]
Length=355

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 184/259 (71%), Gaps = 13/259 (5%)
 Frame = -2

Query  774  RLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELE  595
            R    E++ LT  F+ + VI  GG STVYL    D+SLGA+K+    S+RL+  ++QEL+
Sbjct  46   RFGWAEIESLTGKFAAAAVIGEGGSSTVYLALLGDASLGALKL-HRPSERLYRAFRQELD  104

Query  594  ILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAF  415
            +L R+RH +IV++LGY DD   EEGVLVFEYVPNG+L EKLHG GGG VLPW  RM IA+
Sbjct  105  VLLRLRHPHIVRLLGYCDDR-EEEGVLVFEYVPNGSLHEKLHGGGGGEVLPWARRMTIAY  163

Query  414  QLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATA  235
            Q+AQ L+YLH+ CDPQ+VHGD+K +N+LLD  L  KLCD+GSA++GFS+ V PP S    
Sbjct  164  QVAQALDYLHEGCDPQVVHGDVKAANVLLDGRLQAKLCDFGSARVGFSAAVAPPRSADA-  222

Query  234  TAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSD-SNVRLI  58
                     + GSPGY DP+YLR+G+ +KK+D+YS GV+LLEL+TG EA  S+    RL 
Sbjct  223  --------MVVGSPGYVDPYYLRSGMVSKKNDVYSFGVLLLELVTGAEAFDSERERQRLT  274

Query  57   SKAGPMLKD-ESKVAGMVD  4
            ++ GP+L+D E + A  VD
Sbjct  275  AEVGPVLRDPEGRAAEAVD  293



>gb|KDP25190.1| hypothetical protein JCGZ_20346 [Jatropha curcas]
Length=363

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 183/271 (68%), Gaps = 26/271 (10%)
 Frame = -2

Query  780  ARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQE  601
            AR+ +  ++  LT++FSR   I  GGFS VYL +FP S LGA+K     S  L+ ++KQE
Sbjct  42   ARKYSWDDIVSLTMNFSR--WIGSGGFSMVYLAQFPGSILGAVKT-HAGSNHLNRLFKQE  98

Query  600  LEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHG-------NGGGSVLP  442
            L+IL RIRHDNIV++LGY DDE  E   LVFE+VPNG+LQ+KLH        +    VL 
Sbjct  99   LDILLRIRHDNIVRLLGYCDDE--EGDALVFEFVPNGSLQDKLHSVERDTKLSWAWPVLS  156

Query  441  WRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTV  262
            W+ RM IAFQLAQ +EYLH+K  PQIVHGD+K SNILLD  LNCKLCD+GSA MGFSS V
Sbjct  157  WQRRMAIAFQLAQAIEYLHEKHTPQIVHGDIKASNILLDEHLNCKLCDFGSANMGFSSMV  216

Query  261  QPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVS  82
               S         RT   M GSPGYTDP YLRTGIATKK+D+YS GVI+LEL+TG+EA  
Sbjct  217  VHSS---------RTKQVMMGSPGYTDPQYLRTGIATKKNDVYSYGVIILELVTGMEAFC  267

Query  81   SDSNVRLISKAGPMLKDES-----KVAGMVD  4
             +    L S  GP+LKD       KVA +VD
Sbjct  268  EERGQLLTSIMGPVLKDAHDCEAIKVAQIVD  298



>ref|XP_006476228.1| PREDICTED: probable receptor-like protein kinase At1g33260-like 
[Citrus sinensis]
Length=368

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 151/269 (56%), Positives = 189/269 (70%), Gaps = 14/269 (5%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSL---GAIKIIDTSSKRLHTM  613
            S ++ +  +V++ T +FS+  VI  GGFS VYL +  + S    GAIKI    S RL  +
Sbjct  45   SVKKYSWDDVERFTQNFSQ--VIGSGGFSNVYLARLINDSTSTNGAIKI-HVGSDRLSQV  101

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRN  433
            +KQEL+IL  + H NIVK++GY DD   +EGVL+FEYVPNGTLQEKLHG    S LPWRN
Sbjct  102  FKQELDILLHLSHGNIVKLIGYCDDR--DEGVLLFEYVPNGTLQEKLHGTPSSSKLPWRN  159

Query  432  RMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPP  253
            RM IAFQL+Q +EYLH++C   IVHGD+K SNILLD  LNCKLCD+GSAKMGFSS V PP
Sbjct  160  RMAIAFQLSQAIEYLHERCTLHIVHGDIKASNILLDEHLNCKLCDFGSAKMGFSSAVLPP  219

Query  252  SSTATATAKNRT-MMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSD  76
            S + + +    T  + M GSPGYTDPHYLRTG+A+ K+D+YS GVILLEL+TG+EA   +
Sbjct  220  SPSPSPSRSRITKQVMMIGSPGYTDPHYLRTGMASTKTDVYSFGVILLELVTGIEAFCPE  279

Query  75   SNVRLISKAGPMLKD-----ESKVAGMVD  4
            +   L S AG ML D      +KV  +VD
Sbjct  280  NGQLLTSLAGSMLNDIADCEATKVNELVD  308



>ref|XP_008791632.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Phoenix 
dactylifera]
Length=380

 Score =   280 bits (716),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 183/257 (71%), Gaps = 14/257 (5%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            + RR    E++ LT +F+ S V+  GG STVYL   P SSL A+K++  SS+RLH  ++ 
Sbjct  73   APRRFGWTEIESLTGNFTSSAVVGEGGSSTVYLAALP-SSLAALKVL-RSSERLHRAFRI  130

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMG  424
            EL++L R+RH +IV++LG+ D+   EEGVLVFEYVPNGTL EKLHG GG   LPW  R+ 
Sbjct  131  ELDVLHRLRHPHIVRLLGFCDER--EEGVLVFEYVPNGTLHEKLHGGGG--ALPWGRRVA  186

Query  423  IAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSST  244
            IA+QLAQ LEYLH++CD QIVHGD+K SN+LLD  L+ KLCD+G A+MGFS+ VQPPS+ 
Sbjct  187  IAYQLAQALEYLHERCDLQIVHGDIKASNVLLDERLDAKLCDFGFARMGFSAAVQPPST-  245

Query  243  ATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVR  64
                   R+   M GS GY DPHYLR+G  +KK+D+YS GV+LLELI+G+EA  S+    
Sbjct  246  -------RSAHPMMGSLGYVDPHYLRSGTVSKKNDVYSFGVLLLELISGIEAFCSEREQL  298

Query  63   LISKAGPMLKDESKVAG  13
            L +  GP L+D  + AG
Sbjct  299  LTAVMGPALRDTGRGAG  315



>ref|NP_001146250.1| uncharacterized LOC100279823 [Zea mays]
 gb|ACL53570.1| unknown [Zea mays]
 gb|AFW63210.1| putative protein kinase superfamily protein [Zea mays]
Length=360

 Score =   279 bits (714),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 187/263 (71%), Gaps = 7/263 (3%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            +ARR    E++ +T  FS SRVI  GGFSTVYL     S LGA+K+   SS+RLH  ++Q
Sbjct  43   AARRFAWAEIESVTAGFS-SRVIGQGGFSTVYLACLSSSRLGAVKV-QRSSERLHRAFRQ  100

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMG  424
            E ++L  +RH +IV++LGY D+   EEGVLVFEY PNG L  +LHG+GG + LPW  R+ 
Sbjct  101  ERDVLLALRHPHIVRLLGYCDER--EEGVLVFEYAPNGDLHGRLHGSGGKATLPWARRLA  158

Query  423  IAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSST  244
            +AFQ+A  LEYLH+  DP +VHGD+K SN+LLD+ L+ KLCD+GSA +GFS+ +QPP + 
Sbjct  159  VAFQVAMALEYLHESRDPAVVHGDVKASNVLLDASLDAKLCDFGSAHVGFSAALQPPEAA  218

Query  243  ATATAKNRTMM--TMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSN  70
            A + A +       + GSPGY DP +LR+G+AT+KSD+YS GV+LLEL+TG EA+ +D+ 
Sbjct  219  AASRASSARARPDPVVGSPGYVDPLFLRSGVATRKSDVYSFGVLLLELLTGREAICADTG  278

Query  69   VRLISKAGPMLKDESKVAGMVDR  1
             RL +  GP L  E +VA +VDR
Sbjct  279  CRLAAAVGPTLS-EGEVADVVDR  300



>ref|XP_002298989.1| hypothetical protein POPTR_0001s45900g [Populus trichocarpa]
 gb|EEE83794.1| hypothetical protein POPTR_0001s45900g [Populus trichocarpa]
Length=365

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 192/272 (71%), Gaps = 27/272 (10%)
 Frame = -2

Query  807  KAEKDTKESARRLTRK----EVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIID  640
            K EKD+        RK    E++KL+++FS+  ++  GGFSTVYLG  P S+LGAIKI  
Sbjct  31   KKEKDSDHGTHGCVRKYNWSEIEKLSMNFSQ--IVGSGGFSTVYLGHLPGSNLGAIKI-H  87

Query  639  TSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN-  463
              S  L+ ++KQEL+IL +++HDNIVK+LGY D +  +EG LVFEYV NGTLQ+KLHG  
Sbjct  88   CPSDYLNRVFKQELDILLQLQHDNIVKLLGYCDVQ--DEGALVFEYVSNGTLQDKLHGGE  145

Query  462  ------GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLC  301
                     SV+ WRNRM IA+QLAQ LEYLH+KC  QIVHGD+K SNILLD +LNCKLC
Sbjct  146  REIKKSSSSSVISWRNRMEIAYQLAQALEYLHEKCPLQIVHGDIKPSNILLDEQLNCKLC  205

Query  300  DYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGV  121
            D+G AKMGFSST+         T+ NR  + M GSPGYTDPHYLRTGIA+KK+D+YS GV
Sbjct  206  DFGFAKMGFSSTIM--------TSNNRKQV-MMGSPGYTDPHYLRTGIASKKNDVYSYGV  256

Query  120  ILLELITGLEAVSS--DSNVRLISKAGPMLKD  31
            I+LEL+TG+EA     +    L S  GP+LKD
Sbjct  257  IILELVTGMEAFCEEREQGQLLSSIMGPILKD  288



>ref|XP_010542358.1| PREDICTED: probable receptor-like protein kinase At4g10390 isoform 
X2 [Tarenaya hassleriana]
Length=347

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/275 (49%), Positives = 192/275 (70%), Gaps = 16/275 (6%)
 Frame = -2

Query  840  FGCL-----GRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKF  676
             GC+      +K+ R K         R  + +E++ LT +F+R  +I  GG+S+VY+ + 
Sbjct  5    LGCVRFDGSAKKTTRVKDHGCVGSGVRSYSLEEIETLTSNFAR--LIGSGGYSSVYMARL  62

Query  675  PDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVP  496
            P S   A+K+    S RL+ +++ EL++L R+ H NIVK+LGY DD   E G L+ EY+P
Sbjct  63   PGSDKAAVKV-HVGSHRLYQVFRSELDVLLRLHHPNIVKLLGYFDDS--ENGALLLEYIP  119

Query  495  NGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSEL  316
             G L+EKLH +G   VLPWRNR  +A+QLA+ +E++H++C PQIVHGD+K SNILLD   
Sbjct  120  QGNLREKLHCSGK-QVLPWRNRTAVAYQLARAIEHMHEECSPQIVHGDIKSSNILLDKHF  178

Query  315  NCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDI  136
            NCKLCD+GSAK+GFSS VQPP    T + ++R +M M GSPGYTDPHYLRTGIA+KK D+
Sbjct  179  NCKLCDFGSAKVGFSSMVQPP----TMSLRSRQVM-MIGSPGYTDPHYLRTGIASKKMDM  233

Query  135  YSLGVILLELITGLEAVSSDSNVRLISKAGPMLKD  31
            Y  GV++LEL++G EA+ ++  V L++KAGP++ +
Sbjct  234  YGFGVVVLELVSGKEALCAEKGVMLVNKAGPLIHE  268



>ref|XP_003572762.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Brachypodium 
distachyon]
Length=360

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/274 (52%), Positives = 188/274 (69%), Gaps = 20/274 (7%)
 Frame = -2

Query  807  KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSK  628
            K +   ++ ARRL   E++ +T  FS SRVI  GGFSTVYL     S LGA+K+   SS+
Sbjct  39   KPKMGGRQQARRLEWAEIESMTGGFS-SRVIGQGGFSTVYLASLTSSRLGAVKV-QRSSE  96

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGG---  457
            RLH  ++ EL++L  +RH +IV++LG+ D+   EEGVLVFEY PNG L E+LHGN     
Sbjct  97   RLHRAFRHELDVLTSLRHPHIVRLLGFCDER--EEGVLVFEYAPNGDLHERLHGNNNNNK  154

Query  456  --GSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
               +VLPW  RM +AFQ+A  LEYLH++ DP ++HGD+K SN+LL++ L+ KLCD+G A 
Sbjct  155  RTAAVLPWARRMAVAFQVAMALEYLHERRDPAVIHGDVKASNVLLNAALDAKLCDFGVAH  214

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
            +GFS+ V       TA A  R +M   GSPGY DPH+LR+G+ATKKSD+YS GV+LLEL+
Sbjct  215  VGFSAAV-------TARASARPVM---GSPGYVDPHFLRSGVATKKSDVYSFGVLLLELV  264

Query  102  TGLEAVSSDSNVRLISKAGPMLKDESKVAGMVDR  1
            TG EA+ +D+  RL    GP L  E KVA +VDR
Sbjct  265  TGREAMCADTGCRLTVAVGPAL-SEGKVADVVDR  297



>ref|XP_010542343.1| PREDICTED: probable receptor-like protein kinase At4g10390 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010542350.1| PREDICTED: probable receptor-like protein kinase At4g10390 isoform 
X1 [Tarenaya hassleriana]
Length=348

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/275 (49%), Positives = 192/275 (70%), Gaps = 15/275 (5%)
 Frame = -2

Query  840  FGCL-----GRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKF  676
             GC+      +K+ R K         R  + +E++ LT +F+R  +I  GG+S+VY+ + 
Sbjct  5    LGCVRFDGSAKKTTRVKDHGCVGSGVRSYSLEEIETLTSNFAR--LIGSGGYSSVYMARL  62

Query  675  PDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVP  496
            P S   A+K+    S RL+ +++ EL++L R+ H NIVK+LGY DD   E G L+ EY+P
Sbjct  63   PGSDKAAVKV-HVGSHRLYQVFRSELDVLLRLHHPNIVKLLGYFDDSE-ENGALLLEYIP  120

Query  495  NGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSEL  316
             G L+EKLH +G   VLPWRNR  +A+QLA+ +E++H++C PQIVHGD+K SNILLD   
Sbjct  121  QGNLREKLHCSGK-QVLPWRNRTAVAYQLARAIEHMHEECSPQIVHGDIKSSNILLDKHF  179

Query  315  NCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDI  136
            NCKLCD+GSAK+GFSS VQPP    T + ++R +M M GSPGYTDPHYLRTGIA+KK D+
Sbjct  180  NCKLCDFGSAKVGFSSMVQPP----TMSLRSRQVM-MIGSPGYTDPHYLRTGIASKKMDM  234

Query  135  YSLGVILLELITGLEAVSSDSNVRLISKAGPMLKD  31
            Y  GV++LEL++G EA+ ++  V L++KAGP++ +
Sbjct  235  YGFGVVVLELVSGKEALCAEKGVMLVNKAGPLIHE  269



>gb|EYU35606.1| hypothetical protein MIMGU_mgv1a0221941mg, partial [Erythranthe 
guttata]
Length=339

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/278 (51%), Positives = 187/278 (67%), Gaps = 17/278 (6%)
 Frame = -2

Query  807  KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYL-GKFPD----SSLGAIKII  643
            K +  T+   +RL+  ++Q+L +    S +I +GGFSTVYL G+F D    ++  A+KI 
Sbjct  40   KHDDRTQRIVKRLSWDQIQRL-ITIDSSPIIGYGGFSTVYLAGRFQDFSTTTAAAAVKIQ  98

Query  642  DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
            + +S R    YK ELEIL R+ H  IVK++ Y D    EEG LV EY  NG LQ++LH +
Sbjct  99   NCTSHRFRQAYKMELEILLRLHHRYIVKLIAYCDHP--EEGALVLEYASNGNLQQRLHSS  156

Query  462  GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
               + L WR R+ IAFQLAQ + YLHD C P IVHGD+K SN+LLD  L+CKLCD+GSAK
Sbjct  157  N--TSLAWRRRVAIAFQLAQAICYLHDGCSPHIVHGDVKSSNVLLDENLDCKLCDFGSAK  214

Query  282  MGFSSTVQPPSSTATATAK-----NRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVI  118
            +GFSS + PP   A + A+     NRT   + GSPGYTDP YLRTG+A+KK+D+Y  GV+
Sbjct  215  VGFSSAIDPPPPAADSNARRPWRSNRT--AVVGSPGYTDPAYLRTGLASKKNDVYGFGVV  272

Query  117  LLELITGLEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            +LELITG+EA S+    RL ++A PML+D  KVA MVD
Sbjct  273  VLELITGVEAFSAARGERLTARAEPMLRDAGKVAEMVD  310



>ref|XP_008796890.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Phoenix 
dactylifera]
Length=384

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 184/260 (71%), Gaps = 15/260 (6%)
 Frame = -2

Query  774  RLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPD--SSLGAIKIIDTSSKRLHTMYKQE  601
            R   +E++ LT +F+ S VI  GG STVYL   P   SSL A+K++  SS+RLH  ++ E
Sbjct  76   RFEWREIEFLTGNFTTSAVIGEGGSSTVYLAALPSPSSSLAALKVL-RSSERLHRAFRLE  134

Query  600  LEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGI  421
            L++L R+RH +IV++LG+ DD   EEGVLVFEYVPNGTL EKLHG GGG+VLPW  R+ +
Sbjct  135  LDVLLRLRHPHIVRLLGFCDDR--EEGVLVFEYVPNGTLHEKLHG-GGGAVLPWARRVAV  191

Query  420  AFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTA  241
            A+Q+AQ L+YLH++CD  IVHGD+K SN+LL   L+ KLCD+G A MGFS+ V P S+  
Sbjct  192  AYQVAQALDYLHERCDLHIVHGDIKASNVLLGEGLDAKLCDFGFAGMGFSAAVLPSST--  249

Query  240  TATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRL  61
                  R+   M GSPGY DPHYLR+GI +KKSD+YS GV+LLELITG+EA  S+    L
Sbjct  250  ------RSANPMMGSPGYVDPHYLRSGIVSKKSDVYSFGVLLLELITGIEAFCSEREQLL  303

Query  60   ISKAGPMLKD-ESKVAGMVD  4
             +  GP L+D ES    MVD
Sbjct  304  TAVMGPALRDTESGPGEMVD  323



>ref|XP_010919361.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Elaeis 
guineensis]
Length=379

 Score =   275 bits (702),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 182/259 (70%), Gaps = 15/259 (6%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            + RR    E++ LT +F+ S +I  GG STVYL   P SSL A+K++  SS+RLH  ++ 
Sbjct  73   APRRFGWTEIESLTGNFTSSAIIGEGGSSTVYLATLP-SSLAALKVL-RSSERLHRAFRL  130

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMG  424
            EL++L R+RH NIV++LG+ DD   EEGVLVFEYVPNGTL EKLHG G    LPW  R+ 
Sbjct  131  ELDVLLRLRHPNIVRLLGFCDDR--EEGVLVFEYVPNGTLHEKLHGGGA---LPWARRVV  185

Query  423  IAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSST  244
            IA+QLAQ L+YLH++CD QIVHGD+K SN+LLD  L+ KLCD+G A+MGFS+TVQPPS+ 
Sbjct  186  IAYQLAQALDYLHERCDLQIVHGDVKASNVLLDDRLDAKLCDFGFARMGFSATVQPPST-  244

Query  243  ATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVR  64
                   R+   M GS GY DPHYLR+G  +KK+D+YS GV+LLE I+G+EA  S+    
Sbjct  245  -------RSAHPMMGSLGYVDPHYLRSGTISKKNDVYSFGVLLLESISGIEAFCSEKEQL  297

Query  63   LISKAGPMLKDESKVAGMV  7
            L +  GP L+D  +  G +
Sbjct  298  LTAVMGPALRDAGRGVGEI  316



>ref|XP_010538891.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Tarenaya 
hassleriana]
Length=350

 Score =   273 bits (699),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 177/251 (71%), Gaps = 9/251 (4%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            S R     EV+ +T +F+R  V+  GG+S+VY+ + P S   A   +   S RL+ +++ 
Sbjct  31   SVRSYNWDEVESVTSNFAR--VVGSGGYSSVYMARLPGSDKPAALKVHVGSHRLYQVFRA  88

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMG  424
            EL++L R+RH NIVK+LGY DD   E   L+ EY+P+GTLQE LH N    VLPWRNR  
Sbjct  89   ELDVLLRLRHPNIVKLLGYFDDSE-ENCALLLEYLPHGTLQENLHCNSK-QVLPWRNRTA  146

Query  423  IAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSST  244
            IAFQLAQ +E++HDKC PQIVHGD+K SN+LLD   NCK+CD+GSAK+GFSS VQPP   
Sbjct  147  IAFQLAQAIEHMHDKCSPQIVHGDVKSSNVLLDRCFNCKICDFGSAKIGFSSMVQPP---  203

Query  243  ATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVR  64
              A +     +T+ GSPGYTDPHYLRTGIA+KK D+Y  GV++LEL++G EA S+++ V 
Sbjct  204  --AMSPRSKHVTVVGSPGYTDPHYLRTGIASKKMDMYGFGVVVLELVSGKEAFSAENGVM  261

Query  63   LISKAGPMLKD  31
            L+  A P++++
Sbjct  262  LVHMASPLIRE  272



>ref|NP_001053443.1| Os04g0540900 [Oryza sativa Japonica Group]
 emb|CAE02789.2| OSJNBa0011L07.13 [Oryza sativa Japonica Group]
 dbj|BAF15357.1| Os04g0540900 [Oryza sativa Japonica Group]
 emb|CAH67395.1| H0115B09.7 [Oryza sativa Indica Group]
 gb|EAY95012.1| hypothetical protein OsI_16820 [Oryza sativa Indica Group]
 gb|EAZ31493.1| hypothetical protein OsJ_15629 [Oryza sativa Japonica Group]
 dbj|BAG89950.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 183/266 (69%), Gaps = 21/266 (8%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            SAR+L   +V+ +T  FS SRVI  GGFSTVYL     S LGA+K+   SS+RLH  ++Q
Sbjct  52   SARQLAWADVESVTGGFS-SRVIGHGGFSTVYLASLSSSRLGAVKV-HCSSERLHRAFRQ  109

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH----GNGGGSVLPWR  436
            ELE+L  +RH +IV++LGY D+   +EGVLVFEY PNG L E+LH      G  SVLPW 
Sbjct  110  ELEVLLSLRHPHIVRLLGYCDER--DEGVLVFEYAPNGDLHERLHCSEVAGGVASVLPWA  167

Query  435  NRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP  256
             R+ IAFQ+A  LEYLH+   P ++HGD+K SN+LLD+ +N KLCD+G A +GFS+TV  
Sbjct  168  RRVAIAFQVAMALEYLHESRHPAVIHGDIKASNVLLDANMNAKLCDFGFAHVGFSATVGC  227

Query  255  -PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSS  79
             PS+ A           + GSPGY DPH +R+G+ATKKSD+YS GV+LLEL+TG EAV  
Sbjct  228  RPSARA-----------VMGSPGYVDPHLIRSGVATKKSDVYSFGVLLLELVTGKEAVCR  276

Query  78   DSNVRLISKAGPMLKDESKVAGMVDR  1
            D+  RL +  GPML  E KVA +VDR
Sbjct  277  DTGRRLTAAVGPMLS-EGKVADVVDR  301



>ref|XP_004166375.1| PREDICTED: probable receptor-like protein kinase At1g33260-like, 
partial [Cucumis sativus]
Length=324

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/264 (55%), Positives = 185/264 (70%), Gaps = 10/264 (4%)
 Frame = -2

Query  780  ARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQE  601
            A R    E++ LT +FS   ++  GGFS VYL +       A+KI+  +S+RL+ M++QE
Sbjct  4    ATRFRWTEIESLTKNFST--LVGSGGFSNVYLARTAPGMAAAVKILG-ASERLNRMFRQE  60

Query  600  LEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGI  421
            L+IL ++RH NIV  +GY D+   +EG LVFEYVPNG LQEKLH     SVLPW+ R+ I
Sbjct  61   LDILLKLRHRNIVNFVGYCDER--DEGALVFEYVPNGNLQEKLHRRPAASVLPWKIRLLI  118

Query  420  AFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTA  241
            AFQLAQ +EYLH+KC  QIVHGD+K SNILLD +LNCKLCD+GSAKMGFSS V  PSS++
Sbjct  119  AFQLAQAIEYLHEKCSLQIVHGDIKSSNILLDEQLNCKLCDFGSAKMGFSSAVGNPSSSS  178

Query  240  TATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRL  61
            + ++  R    M GSPGYTDP YLRTGIA+KK+D+YS GV+LLEL+TG EA  S+    L
Sbjct  179  SPSSPFRAKQLMMGSPGYTDPQYLRTGIASKKNDVYSFGVVLLELVTGKEAFCSEKGQIL  238

Query  60   ISKAGPMLKD-----ESKVAGMVD  4
             S   P ++D      S+V  +VD
Sbjct  239  TSILPPAVRDGGGIKASEVLELVD  262



>ref|XP_004309559.1| PREDICTED: probable receptor-like protein kinase At1g49730-like 
[Fragaria vesca subsp. vesca]
Length=692

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/273 (56%), Positives = 187/273 (68%), Gaps = 19/273 (7%)
 Frame = -2

Query  801  EKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDS--SLGAIKIIDTSSK  628
             K  +   R+ +  E+ + T +FS   VI  GG+STVYL   PDS     AIKI    S+
Sbjct  157  NKKGESGVRKFSWDEIARFTNNFST--VIGSGGYSTVYLAHSPDSIHRFWAIKI-HNGSE  213

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV  448
            RL+ +++QEL+IL R+ H +IVK+LGY DD   EEG LVFEYV NG LQE LHG    SV
Sbjct  214  RLNQVFRQELDILLRLGHQSIVKLLGYCDDR--EEGALVFEYVANGNLQEILHGEEQ-SV  270

Query  447  LPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSS  268
            LPW+NRM IA+++AQ +EYLH+KC  QIVH D+K SN+LLD  LN KLCD+GSAKMGFSS
Sbjct  271  LPWKNRMLIAYEIAQAIEYLHEKCALQIVHMDIKASNVLLDKNLNSKLCDFGSAKMGFSS  330

Query  267  TVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEA  88
            TVQPPS    A  K   MM   GSPGYTDPHY+RTG A+KK+D+YS GV+LL+L+TG++A
Sbjct  331  TVQPPSP---ALKKQFLMM---GSPGYTDPHYMRTGFASKKNDVYSFGVLLLQLVTGMDA  384

Query  87   VSSDSNVRLISKAGPMLKD-----ESKVAGMVD  4
              SD    L S  GP L D     E  VAGMVD
Sbjct  385  FCSDKGQLLTSMVGPRLVDGGDMEEEVVAGMVD  417



>ref|XP_004145888.1| PREDICTED: probable receptor-like protein kinase At1g33260-like 
[Cucumis sativus]
 gb|KGN49948.1| hypothetical protein Csa_5G146210 [Cucumis sativus]
Length=352

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/264 (55%), Positives = 185/264 (70%), Gaps = 10/264 (4%)
 Frame = -2

Query  780  ARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQE  601
            A R    E++ LT +FS   ++  GGFS VYL +       A+KI+  +S+RL+ M++QE
Sbjct  32   ATRFRWTEIESLTKNFST--LVGSGGFSNVYLARTAPGMAAAVKILG-ASERLNRMFRQE  88

Query  600  LEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGI  421
            L+IL ++RH NIV  +GY D+   +EG LVFEYVPNG LQEKLH     SVLPW+ R+ I
Sbjct  89   LDILLKLRHRNIVNFVGYCDER--DEGALVFEYVPNGNLQEKLHRRPAASVLPWKIRLLI  146

Query  420  AFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTA  241
            AFQLAQ +EYLH+KC  QIVHGD+K SNILLD +LNCKLCD+GSAKMGFSS V  PSS++
Sbjct  147  AFQLAQAIEYLHEKCSLQIVHGDIKSSNILLDEQLNCKLCDFGSAKMGFSSAVGNPSSSS  206

Query  240  TATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRL  61
            + ++  R    M GSPGYTDP YLRTGIA+KK+D+YS GV+LLEL+TG EA  S+    L
Sbjct  207  SPSSPFRAKQLMMGSPGYTDPQYLRTGIASKKNDVYSFGVVLLELVTGKEAFCSEKGQIL  266

Query  60   ISKAGPMLKD-----ESKVAGMVD  4
             S   P ++D      S+V  +VD
Sbjct  267  TSILPPAVRDGGGIKASEVLELVD  290



>gb|EAY86898.1| hypothetical protein OsI_08281 [Oryza sativa Indica Group]
Length=341

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/270 (51%), Positives = 183/270 (68%), Gaps = 13/270 (5%)
 Frame = -2

Query  801  EKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRL  622
            EK     ARR    E++ +T  FS SRVI  GGFSTVYL     S LGA+K+   SS+RL
Sbjct  22   EKGGGVVARRFGWAEIESVTGGFS-SRVIGQGGFSTVYLASLTSSRLGAVKV-QRSSERL  79

Query  621  HTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGG---S  451
            H  + QE ++L  +RH ++V++LGY D+   +EGVLVFEY PNG L E+LH   GG   +
Sbjct  80   HRAFCQERDVLLSLRHPHVVRLLGYCDER--DEGVLVFEYAPNGDLHERLHHRSGGKSRT  137

Query  450  VLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFS  271
            VLPW  RM +AFQ+A  LEYLH+  DP ++HGD+K SN+LLD+  + KLCD+G A +GFS
Sbjct  138  VLPWARRMAVAFQVAMALEYLHESRDPAVIHGDIKSSNVLLDANHDAKLCDFGFAHVGFS  197

Query  270  STVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLE  91
            + V+PPS    A  +      + GSPGY DPH+LR+G+ATKKSD+YS GV+LLEL+TG E
Sbjct  198  AAVRPPSGATRAWGR-----PVMGSPGYADPHFLRSGVATKKSDVYSFGVLLLELVTGRE  252

Query  90   AVSSDSNVRLISKAGPMLKDESKVAGMVDR  1
            A+ + +  RL +  GP +  E K+A +VDR
Sbjct  253  AICAQTGHRLTAAVGPSI-GEGKLADVVDR  281



>ref|XP_006305209.1| hypothetical protein CARUB_v10009575mg [Capsella rubella]
 gb|EOA38107.1| hypothetical protein CARUB_v10009575mg [Capsella rubella]
Length=354

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 178/246 (72%), Gaps = 5/246 (2%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FSR  +I  GG+S++YL +    S+ A   +  SS RL+ +++ ELEIL
Sbjct  38   TWDDVESLTCNFSR--LIGSGGYSSIYLARLSGGSINAALKVHVSSHRLYQVFRSELEIL  95

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H +IVK+LGY DD   E G L+ EY+P G LQEKL+ N    VLPWRNR  IAFQ+
Sbjct  96   LRLQHPHIVKLLGYFDDSE-ESGALLLEYLPQGNLQEKLNRNSK-QVLPWRNRTAIAFQV  153

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H+KC PQIVHGD+K SNILLD   N KLCD+GSAK+GFSS VQP  + +T + 
Sbjct  154  AQAIEHIHEKCSPQIVHGDIKSSNILLDKHFNSKLCDFGSAKVGFSSMVQPSKTMSTMSP  213

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
            +++ +M M GSPGYTDPHYL+TGIA+KK D+Y  GV++LEL++G EAVSS+    L+  A
Sbjct  214  RSKQVM-MIGSPGYTDPHYLKTGIASKKMDMYGFGVVVLELVSGKEAVSSEKGEMLVHAA  272

Query  48   GPMLKD  31
             P++ +
Sbjct  273  APLIHE  278



>ref|XP_010478743.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Camelina 
sativa]
Length=355

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 180/246 (73%), Gaps = 6/246 (2%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FSR  +I  GG+S++YL +   S   A+K+   SS RL+ +++ ELEIL
Sbjct  39   TWDDVESLTSNFSR--LIGSGGYSSIYLARLSGSINAALKV-HVSSHRLYQVFRSELEIL  95

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H +IVK+LGY DD   E G L+ EY+P G LQEKL+ N    VLPWRNR  IA+Q+
Sbjct  96   LRLQHPHIVKLLGYFDDSE-ETGALLLEYLPQGNLQEKLNRNNK-QVLPWRNRTAIAYQV  153

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H+KC PQIVHGD+K SNILLD   N KLCD+GSAK+GFSS VQP  +T+T + 
Sbjct  154  AQAIEHIHEKCSPQIVHGDIKSSNILLDKHFNSKLCDFGSAKVGFSSMVQPSKTTSTMSP  213

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
            +++ +M M GSPGYTDPHYLRTGIA+KK D+Y  GV++LEL++G EAVSS+    L+  A
Sbjct  214  RSKQVM-MIGSPGYTDPHYLRTGIASKKMDMYGFGVVVLELVSGKEAVSSERGEMLVHTA  272

Query  48   GPMLKD  31
             P++ +
Sbjct  273  APLIHE  278



>ref|NP_001047579.1| Os02g0648100 [Oryza sativa Japonica Group]
 dbj|BAD25532.1| putative serine/threonine-specific protein kinase [Oryza sativa 
Japonica Group]
 dbj|BAD25568.1| putative serine/threonine-specific protein kinase [Oryza sativa 
Japonica Group]
 dbj|BAF09493.1| Os02g0648100 [Oryza sativa Japonica Group]
Length=365

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/270 (51%), Positives = 183/270 (68%), Gaps = 13/270 (5%)
 Frame = -2

Query  801  EKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRL  622
            EK     ARR    E++ +T  FS SRVI  GGFSTVYL     S LGA+K+   SS+RL
Sbjct  46   EKGGGVVARRFGWAEIESVTGGFS-SRVIGQGGFSTVYLASLTSSRLGAVKV-QRSSERL  103

Query  621  HTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGG---S  451
            H  + QE ++L  +RH ++V++LGY D+   +EGVLVFEY PNG L E+LH   GG   +
Sbjct  104  HRAFCQERDVLLSLRHPHVVRLLGYCDER--DEGVLVFEYAPNGDLHERLHHRSGGKSRT  161

Query  450  VLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFS  271
            VLPW  RM +AFQ+A  LEYLH+  DP ++HGD+K SN+LLD+  + KLCD+G A +GFS
Sbjct  162  VLPWARRMAVAFQVAMALEYLHESRDPAVIHGDIKSSNVLLDANHDAKLCDFGFAHVGFS  221

Query  270  STVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLE  91
            + V+PPS    A  +      + GSPGY DPH+LR+G+ATKKSD+YS GV+LLEL+TG E
Sbjct  222  AAVRPPSGATRAWGR-----PVMGSPGYADPHFLRSGVATKKSDVYSFGVLLLELVTGRE  276

Query  90   AVSSDSNVRLISKAGPMLKDESKVAGMVDR  1
            A+ + +  RL +  GP +  E K+A +VDR
Sbjct  277  AICAQTGHRLTAAVGPSI-GEGKLADVVDR  305



>ref|XP_002464377.1| hypothetical protein SORBIDRAFT_01g017150 [Sorghum bicolor]
 gb|EER91375.1| hypothetical protein SORBIDRAFT_01g017150 [Sorghum bicolor]
Length=352

 Score =   269 bits (688),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/269 (49%), Positives = 182/269 (68%), Gaps = 16/269 (6%)
 Frame = -2

Query  807  KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSK  628
            +AEK  +   R L+  +V+ +T  F+ S V+  GGFSTVYL +    +L A+K+   SS+
Sbjct  38   QAEKGVEAGPRGLSLAQVKAMTGGFT-SAVVGEGGFSTVYLARL-SGALAAVKV-HRSSE  94

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNG-GGS  451
            RLH +++QEL+ LQR+RH +IV++L + D +  EEGVLV E+  NG L E+LHG G    
Sbjct  95   RLHRVFRQELDTLQRVRHPHIVRLLAFCDQQ--EEGVLVLEFAANGNLHERLHGGGKAAG  152

Query  450  VLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFS  271
             +PW  R+ +A Q A+ LEYLHD+C+PQ+VHGD+K SN+LLD+ ++ KLCD+GSA+MGFS
Sbjct  153  TMPWARRVSVALQTARALEYLHDRCEPQVVHGDVKASNVLLDASMSAKLCDFGSARMGFS  212

Query  270  STVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLE  91
            + V+P SS            TM GSPGY DPHY+RTG+ TKKSD+YS GV+LLEL+TG+E
Sbjct  213  AAVRPRSSA----------HTMLGSPGYVDPHYIRTGVVTKKSDVYSFGVLLLELLTGME  262

Query  90   AVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            A  ++    L +   P L+      GMVD
Sbjct  263  AFCAEEGRLLTAVLAPRLRAGGDARGMVD  291



>ref|XP_010499866.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Camelina 
sativa]
Length=355

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 179/246 (73%), Gaps = 6/246 (2%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FSR  +I  GG+S++YL +   S   A+K+   SS RL+ +++ ELEIL
Sbjct  39   TWDDVESLTSNFSR--LIGSGGYSSIYLARLSGSINAALKV-HVSSHRLYQVFRSELEIL  95

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H +IVK+LGY DD   E G L+ EY+P G LQEKL+ N    VLPWRNR  IAFQ+
Sbjct  96   LRLQHPHIVKLLGYFDDSE-ETGALLLEYLPQGNLQEKLNRNSK-QVLPWRNRTAIAFQV  153

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H+KC PQIVHGD+K SNILLD   N KLCD+GSAK+GFSS VQP  + +T + 
Sbjct  154  AQAIEHIHEKCSPQIVHGDIKSSNILLDKHFNSKLCDFGSAKVGFSSMVQPSKTMSTMSP  213

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
            +++ +M M GSPGYTDPHYLRTGIA+KK D+Y  GV++LEL++G EAVSS+    L+  A
Sbjct  214  RSKQVM-MIGSPGYTDPHYLRTGIASKKMDMYGFGVVVLELVSGKEAVSSERGEMLVHTA  272

Query  48   GPMLKD  31
             P++ +
Sbjct  273  APLIHE  278



>gb|EYU19451.1| hypothetical protein MIMGU_mgv1a009696mg [Erythranthe guttata]
Length=334

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 177/246 (72%), Gaps = 10/246 (4%)
 Frame = -2

Query  792  TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTM  613
            T +S    + +E+QKLT++ S   VI +GGFSTVYL   PDS+  A+KI   SS+RL+  
Sbjct  41   TLKSNSIFSWEEIQKLTMNLSM--VIGYGGFSTVYLAHLPDSTTAAVKI-QCSSERLNQA  97

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV--LPW  439
            +K ELEILQ ++H NIVK++G+  D   EEG+LV E+ PNG LQEKLHG+   +   L W
Sbjct  98   HKLELEILQHLQHPNIVKIIGHCHDR--EEGILVLEHAPNGNLQEKLHGSSKNNNIHLSW  155

Query  438  RNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQ  259
            + R+ IAFQLA+ +EYLH     QI+HGD+K SNILLD  LNCKLCD+GS+KMGFSS V 
Sbjct  156  KKRISIAFQLAKAIEYLHKHPTLQIIHGDIKSSNILLDQNLNCKLCDFGSSKMGFSSLVL  215

Query  258  PPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSS  79
             P+S +      R  +TM GSPGYTDPHYLRTG+A+K++DIYS GV++LELITG++A + 
Sbjct  216  NPNSNSFI---RRNRVTMVGSPGYTDPHYLRTGLASKENDIYSFGVVILELITGIQAFNP  272

Query  78   DSNVRL  61
             +  RL
Sbjct  273  STGERL  278



>ref|XP_006415115.1| hypothetical protein EUTSA_v10008055mg [Eutrema salsugineum]
 gb|ESQ33468.1| hypothetical protein EUTSA_v10008055mg [Eutrema salsugineum]
Length=352

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 180/246 (73%), Gaps = 6/246 (2%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FSR  +I  GG+S++YL +   S+  A+K+    S RL+ ++K ELEIL
Sbjct  37   TWDDVESLTSNFSR--LIGSGGYSSIYLARLSGSNKAALKV-HVGSHRLYQVFKSELEIL  93

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H +IVK+LGY DD   E G L+ EY+P G LQEKL+ N    VLPWRNR  IAFQ+
Sbjct  94   LRLQHPHIVKLLGYFDDSE-ESGALLLEYLPQGNLQEKLNRNSK-QVLPWRNRTAIAFQV  151

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H++C PQIVHGD+K SNILLD   N KLCD+GSAK+GFSS VQP ++T +++ 
Sbjct  152  AQAIEHIHERCSPQIVHGDIKSSNILLDKHFNSKLCDFGSAKVGFSSMVQPSTTTMSSSP  211

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
            +++  + M GSPGYTDPHYLRTGIA+KK D+Y  GV+LLEL++G EAV ++    L+ KA
Sbjct  212  RSK-QVRMIGSPGYTDPHYLRTGIASKKMDLYGFGVVLLELVSGKEAVCAERGEMLVHKA  270

Query  48   GPMLKD  31
             P++ +
Sbjct  271  APLVHE  276



>ref|XP_010677489.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Beta 
vulgaris subsp. vulgaris]
Length=351

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/283 (51%), Positives = 180/283 (64%), Gaps = 41/283 (14%)
 Frame = -2

Query  840  FGCLGRKSRRRKAEKD-------------TKESARRLTRKEVQKLTVDFSRSRVIAFGGF  700
             GC G  S  R    D             + E  +R +  E++ LT+ F    VI  GG+
Sbjct  5    LGCFGCTSGFRAKNDDRVTPERVSVDDEASVEVVKRYSWSEIESLTMKFKE--VIGVGGY  62

Query  699  STVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEG  520
            STVYL KFPDSSLGA+KI + SS+RL+ ++K ELEI Q++ H NIVK+LGY D+   +EG
Sbjct  63   STVYLAKFPDSSLGAVKIYN-SSERLNQVFKSELEISQKLHHANIVKILGYCDER--DEG  119

Query  519  VLVFEYVPNGTLQEKLHGNG--------------GGSVLPWRNRMGIAFQLAQVLEYLHD  382
            VLVFEY+P G LQE+LH                    +L W+ R+ IA+QLAQ LEYLH+
Sbjct  120  VLVFEYIPKGNLQEELHNYNQIPYTSPNKKCNKLKSQLLTWKQRILIAYQLAQALEYLHE  179

Query  381  KCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMF  202
              D  IVHGD+K SN+LLD  LNCKLCD+G +KMGFSS ++PPSS+  A         M 
Sbjct  180  SNDLHIVHGDIKSSNVLLDECLNCKLCDFGFSKMGFSSMIKPPSSSRIA---------MM  230

Query  201  GSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDS  73
            GSPGY DPH+L TGIA+KK+D+YS GVILLELITG EA  S +
Sbjct  231  GSPGYIDPHFLMTGIASKKNDVYSFGVILLELITGFEAFISSA  273



>ref|XP_010530420.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Tarenaya 
hassleriana]
Length=352

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 173/244 (71%), Gaps = 8/244 (3%)
 Frame = -2

Query  762  KEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQR  583
            +E++ LT +F R  +I  GG+S+VY+ + P S   A+K+    S RL+ +++ EL +L R
Sbjct  39   EEIESLTSNFVR--LIGSGGYSSVYMSRLPGSDKAALKV-HVGSHRLYQVFRVELGVLLR  95

Query  582  IRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQ  403
            + H NIVK+LGY DD   E G L+ EY+PNG LQEKL  N    VLPWRNR  IAFQLAQ
Sbjct  96   LHHPNIVKLLGYFDDSE-ENGALLLEYLPNGNLQEKLSCNSK-QVLPWRNRTSIAFQLAQ  153

Query  402  VLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKN  223
             +E++H+KC P IVHGD+K SNILLD   NCKLCD+GSAK+GFSS VQPP  T +  +K 
Sbjct  154  AIEHMHEKCSPPIVHGDIKSSNILLDERFNCKLCDFGSAKVGFSSMVQPPPPTMSPRSKQ  213

Query  222  RTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGP  43
               + M GSPGYTDPHYLRTG+A+KK D+Y  GV++LEL++G EA  ++  + L+ KA P
Sbjct  214  ---VMMIGSPGYTDPHYLRTGVASKKMDMYGFGVVVLELVSGNEAFCAEKGLMLVHKARP  270

Query  42   MLKD  31
            ++ +
Sbjct  271  LIHE  274



>gb|EMT05618.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=353

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/261 (54%), Positives = 187/261 (72%), Gaps = 13/261 (5%)
 Frame = -2

Query  780  ARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQE  601
            ARRL   EV+ +T  FS SRVI  GGFSTVYL     S LGA+K+   SS+RLH +++QE
Sbjct  44   ARRLEWAEVESVTGGFS-SRVIGQGGFSTVYLASLTSSRLGAVKV-QRSSERLHRVFRQE  101

Query  600  LEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGG-SVLPWRNRMG  424
            L++L  +RH +IV++LGY D+   EEGVLVFEY PNG L E+LH +G   + LPW  RM 
Sbjct  102  LDVLMSVRHPHIVRLLGYCDER--EEGVLVFEYAPNGDLHERLHRSGQRRAALPWARRMA  159

Query  423  IAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSST  244
            +AFQ+A  LEYLH+  DP ++HGD+K SN+LLD+ ++ KLCD+G A +GFS+ V P ++ 
Sbjct  160  VAFQVAMALEYLHESQDPAVIHGDVKASNVLLDANMDVKLCDFGFAHVGFSAAVLPAAAR  219

Query  243  ATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVR  64
            A+A    R +M   GSPGY DPH+LR+G+ATKKSD+YS GV+LLEL+TG EA+ +D+  R
Sbjct  220  ASA----RHVM---GSPGYVDPHFLRSGVATKKSDVYSFGVLLLELVTGREAICADTGCR  272

Query  63   LISKAGPMLKDESKVAGMVDR  1
            L     P++  E KVA +VDR
Sbjct  273  LTVTVAPVVS-EGKVADVVDR  292



>ref|XP_010461144.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Camelina 
sativa]
Length=354

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 178/246 (72%), Gaps = 6/246 (2%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FSR  +I  GG+S++YL +   S   A+K+   SS RL+ +++ ELEIL
Sbjct  39   TWDDVESLTSNFSR--LIGSGGYSSIYLARLSGSINAALKV-HVSSHRLYQVFRSELEIL  95

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H +IVK+LGY DD   E G L+ EY+P G LQEKL+ N    VLPWRNR  IAFQ+
Sbjct  96   LRLQHPHIVKLLGYFDDSE-ETGALLLEYLPQGNLQEKLNRNSK-QVLPWRNRTAIAFQV  153

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H+KC PQIVHGD+K SNILLD   N KLCD+GSAK+GFSS VQP  + +T + 
Sbjct  154  AQAIEHIHEKCSPQIVHGDIKSSNILLDKHFNSKLCDFGSAKVGFSSMVQPSKTMSTMSP  213

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
            +++ +M M GSPGYTDPHYLRTGIA+KK D+Y  GV++LEL++G EA SS+    L+  A
Sbjct  214  RSKQVM-MIGSPGYTDPHYLRTGIASKKMDMYGFGVVVLELVSGKEAASSERGEMLVHTA  272

Query  48   GPMLKD  31
             P++ +
Sbjct  273  APLIHE  278



>ref|XP_009123751.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Brassica 
rapa]
Length=347

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 178/246 (72%), Gaps = 8/246 (3%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FSR  +I  GG+S++YL +   +   A K+    S RL+ +++ ELEIL
Sbjct  34   TWDDVESLTSNFSR--LIGSGGYSSIYLARLSGAKKAAFKV-HVGSHRLYQVFRSELEIL  90

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H +IVK+LGY DD   E G L+ EY+P G LQEKL+ N    VLPWRNR  +AFQ+
Sbjct  91   LRLQHPHIVKLLGYFDDSE-ETGALLLEYLPQGNLQEKLNHNSK-QVLPWRNRTALAFQV  148

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H+KC PQIVHGD+K SNILLD  LNCKLCD+GSA++GFSS VQP ++ ++  +
Sbjct  149  AQAMEHIHEKCSPQIVHGDIKSSNILLDKNLNCKLCDFGSARVGFSSMVQPSTTMSSPRS  208

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
            K    + M GSPGYTDPHYLRTGIA+KK D+Y  GV++LEL++G EAVS++    L+  A
Sbjct  209  KQ---VRMIGSPGYTDPHYLRTGIASKKMDMYGFGVVVLELVSGKEAVSAEKGEMLVHTA  265

Query  48   GPMLKD  31
             P+++D
Sbjct  266  APLIQD  271



>ref|XP_006652593.1| PREDICTED: probable receptor-like protein kinase At1g33260-like 
[Oryza brachyantha]
Length=360

 Score =   266 bits (681),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 138/265 (52%), Positives = 183/265 (69%), Gaps = 20/265 (8%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            +AR+L   EV+ +T  FS SRVI  GGFSTVYL     S LGA+K+   SS+RLH  ++Q
Sbjct  52   AARQLAWAEVESVTGGFS-SRVIGHGGFSTVYLASLSSSRLGAVKV-HCSSERLHRAFRQ  109

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN---GGGSVLPWRN  433
            ELE+L  +RH +IV++LGY D+   +EGVLVFEY PNG L E+LHG    G  +VLPW  
Sbjct  110  ELEVLLSLRHPHIVRLLGYCDER--DEGVLVFEYAPNGDLHERLHGGEVAGVAAVLPWSR  167

Query  432  RMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP-  256
            R+ IAFQ+A  LEYLH+   P ++HGD+K SN+LLD+ ++ KLCD+G A +GFS+TV   
Sbjct  168  RVAIAFQVAMALEYLHESRHPAVIHGDIKASNVLLDASMDAKLCDFGFAHVGFSATVGCR  227

Query  255  PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSD  76
            PS+ A           + GSPGY DPH +R+G+ATKK+D+YS GV+LLEL+TG EAV  +
Sbjct  228  PSARA-----------VMGSPGYVDPHLIRSGVATKKTDVYSFGVLLLELVTGKEAVCRE  276

Query  75   SNVRLISKAGPMLKDESKVAGMVDR  1
            +  RL +  GP L  E KV+ +VDR
Sbjct  277  TGRRLTAAVGPTLS-EGKVSDVVDR  300



>ref|XP_008437495.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Cucumis 
melo]
Length=354

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 184/266 (69%), Gaps = 12/266 (5%)
 Frame = -2

Query  780  ARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQE  601
            A R    +++  T +FS   ++  GGFSTVYL +       A+KI+  +S+RL+ M++QE
Sbjct  32   ATRFRWTDIETFTKNFST--LVGSGGFSTVYLARTAPGMAAAVKILG-ASERLNRMFRQE  88

Query  600  LEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGI  421
            L+IL ++RH NIV  +GY D+   +EG LVFEYVPNG LQEKLH     +VLPW+ R+ I
Sbjct  89   LDILLQLRHRNIVNFVGYCDER--DEGALVFEYVPNGNLQEKLHRRPASTVLPWKIRLVI  146

Query  420  AFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTV--QPPSS  247
            AFQLAQ +EYLH+KC  QIVHGD+K SNILLD + NCKLCD+GSAKMGFSS V     SS
Sbjct  147  AFQLAQAIEYLHEKCSLQIVHGDIKSSNILLDEQFNCKLCDFGSAKMGFSSAVGNPSSSS  206

Query  246  TATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNV  67
            +++ ++  R    M GSPGYTDP YLRTGIA+KK+D+YS GV+LLEL+TG EA  S+   
Sbjct  207  SSSPSSPFRAKQLMMGSPGYTDPQYLRTGIASKKNDVYSFGVVLLELVTGKEAFCSEKGQ  266

Query  66   RLISKAGPMLKD-----ESKVAGMVD  4
             L S   P ++D      S+VA +VD
Sbjct  267  ILTSILPPTVRDGGGIKPSEVAELVD  292



>ref|XP_006647607.1| PREDICTED: probable receptor-like protein kinase At1g33260-like 
[Oryza brachyantha]
Length=359

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 134/261 (51%), Positives = 183/261 (70%), Gaps = 14/261 (5%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQEL  598
            RR    E++ +T  FS SRVI  GGFSTVYL     S LGA+K+   SS+RLH  + QE 
Sbjct  51   RRFEWAEIESVTGGFS-SRVIGQGGFSTVYLASLTSSRLGAVKV-QRSSERLHRAFCQER  108

Query  597  EILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNG--GGSVLPWRNRMG  424
            ++L  +RH ++V++LGY D+   +EGVLVFEY PNG L E+LH +G    +VLPW  RM 
Sbjct  109  DVLLWLRHPHVVRLLGYCDER--DEGVLVFEYAPNGDLHERLHRSGEKNRAVLPWARRMA  166

Query  423  IAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSST  244
            IAFQ+A  LEYLH+  DP ++HGD+K SN+LLD+  + KLCD+G A +GFS+ V+PP++ 
Sbjct  167  IAFQVAMALEYLHESRDPAVIHGDIKASNVLLDANHDAKLCDFGFAHVGFSAAVRPPATR  226

Query  243  ATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVR  64
            A+     R +M   GSPGY DPH+LR+G+ATKKSD+YS GV+LLEL+TG EA+ +++  R
Sbjct  227  AS----GRPVM---GSPGYADPHFLRSGVATKKSDVYSFGVLLLELVTGREAICAETGCR  279

Query  63   LISKAGPMLKDESKVAGMVDR  1
            L +  GP + D   +A +VDR
Sbjct  280  LTATVGPSISD-GNLADVVDR  299



>gb|KFK45060.1| hypothetical protein AALP_AA1G338600 [Arabis alpina]
Length=356

 Score =   266 bits (680),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 178/246 (72%), Gaps = 9/246 (4%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FS   +I  GG+S +YL +   S   A+K+   SS RL+ +++ ELEIL
Sbjct  42   TWDDVESLTSNFST--LIGSGGYSRIYLARLSSSYKAALKV-HVSSHRLYQVFRSELEIL  98

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H +IVK+LGY DD   E G L+ EY+P G LQEKL+ N    VLPWRNR+ IAFQ+
Sbjct  99   LRLQHPHIVKLLGYFDDSE-ESGALLLEYLPQGNLQEKLNRNSK-QVLPWRNRIAIAFQV  156

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H+ C PQIVHGD+K SNILLD++ NCKLCD+GSAK+GFSS VQP ++T+  + 
Sbjct  157  AQAIEHIHENCSPQIVHGDIKSSNILLDNDFNCKLCDFGSAKVGFSSMVQPSTTTSPRSK  216

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
            + R    M GSPGYTDPHYLRTGIA+KK DIY  GV++LEL++G +AVS++    L+  A
Sbjct  217  QVR----MIGSPGYTDPHYLRTGIASKKMDIYGFGVVVLELVSGKDAVSAERGEMLVHTA  272

Query  48   GPMLKD  31
             P++ +
Sbjct  273  APLIHE  278



>emb|CBI34647.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 166/223 (74%), Gaps = 12/223 (5%)
 Frame = -2

Query  663  LGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTL  484
            + A+KI     +RL+ ++KQELEIL  + HDNIVK+LGY DD   EEGVLVFE+VP G+L
Sbjct  1    MAAVKI-HNGGERLNRVFKQELEILLHLDHDNIVKLLGYGDDR--EEGVLVFEHVPKGSL  57

Query  483  QEKLHGNGGG---SVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELN  313
            QE LH + G    S L W+NRM IAFQLA+ +EYLH+KC   IVHGD+K SNILLD  LN
Sbjct  58   QEMLHDSTGAKENSPLSWKNRMAIAFQLAEAIEYLHEKCALPIVHGDIKASNILLDEHLN  117

Query  312  CKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIY  133
            CKLCD+GSAKMGFSSTV PPSS+      N+ M  M GSPGY DPHYLRTGI +KK+DIY
Sbjct  118  CKLCDFGSAKMGFSSTVLPPSSSRM----NQVM--MMGSPGYVDPHYLRTGIPSKKNDIY  171

Query  132  SLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            S GVILLEL+TG++A  S+    L S AGP+L+D S+V  +VD
Sbjct  172  SFGVILLELLTGMDAFCSEREQPLTSIAGPILRDASQVGKVVD  214



>ref|NP_973956.1| probable receptor-like protein kinase [Arabidopsis thaliana]
 dbj|BAE99529.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31576.1| probable receptor-like protein kinase [Arabidopsis thaliana]
Length=348

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 178/246 (72%), Gaps = 7/246 (3%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FSR  +I  GG+S++YL +   S   A+K+   SS RL+ +++ ELEIL
Sbjct  34   TWDDVESLTSNFSR--LIGTGGYSSIYLARVSGSINAALKV-HVSSHRLYQVFRSELEIL  90

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H +IVK+LGY DD   E G L+ EY+P G LQEKL+ N    VLPWRNR  IAFQ+
Sbjct  91   LRLQHPHIVKLLGYFDDS--ESGALLLEYLPQGNLQEKLNRNSK-QVLPWRNRTAIAFQV  147

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H+KC PQIVHGD+K SNILLD   N KLCD+GSAK+GFSS VQP  +T+T + 
Sbjct  148  AQAIEHIHEKCSPQIVHGDIKSSNILLDKHFNSKLCDFGSAKVGFSSMVQPSKTTSTMSP  207

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
            +++ +M M GSPGYTDPHYLRTGIA+KK D+Y  GV++LEL++G EAVSS+    L+   
Sbjct  208  RSKQVM-MIGSPGYTDPHYLRTGIASKKMDMYGFGVVVLELVSGKEAVSSERGEMLVHST  266

Query  48   GPMLKD  31
              ++ +
Sbjct  267  ASLIHE  272



>ref|NP_564421.3| probable receptor-like protein kinase [Arabidopsis thaliana]
 sp|B3LFC0.1|Y1332_ARATH RecName: Full=Probable receptor-like protein kinase At1g33260 
[Arabidopsis thaliana]
 gb|ACF16170.1| At1g33260 [Arabidopsis thaliana]
 gb|AEE31575.1| probable receptor-like protein kinase [Arabidopsis thaliana]
Length=349

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 178/246 (72%), Gaps = 6/246 (2%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FSR  +I  GG+S++YL +   S   A+K+   SS RL+ +++ ELEIL
Sbjct  34   TWDDVESLTSNFSR--LIGTGGYSSIYLARVSGSINAALKV-HVSSHRLYQVFRSELEIL  90

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H +IVK+LGY DD   E G L+ EY+P G LQEKL+ N    VLPWRNR  IAFQ+
Sbjct  91   LRLQHPHIVKLLGYFDDSE-ESGALLLEYLPQGNLQEKLNRNSK-QVLPWRNRTAIAFQV  148

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H+KC PQIVHGD+K SNILLD   N KLCD+GSAK+GFSS VQP  +T+T + 
Sbjct  149  AQAIEHIHEKCSPQIVHGDIKSSNILLDKHFNSKLCDFGSAKVGFSSMVQPSKTTSTMSP  208

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
            +++ +M M GSPGYTDPHYLRTGIA+KK D+Y  GV++LEL++G EAVSS+    L+   
Sbjct  209  RSKQVM-MIGSPGYTDPHYLRTGIASKKMDMYGFGVVVLELVSGKEAVSSERGEMLVHST  267

Query  48   GPMLKD  31
              ++ +
Sbjct  268  ASLIHE  273



>ref|XP_010110419.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXC26251.1| putative receptor-like protein kinase [Morus notabilis]
Length=379

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/271 (52%), Positives = 186/271 (69%), Gaps = 27/271 (10%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGK--FPDSS-----LGAIKIIDTSSKRLH  619
            R+ + +E++K T +F  SRVI +GGFSTVYL     P ++     L AIKII+ S     
Sbjct  57   RKFSWEEIEKFTNNFCSSRVIGYGGFSTVYLAGDLIPSTTSTGGNLAAIKIINGSR----  112

Query  618  TMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGG----GS  451
             ++KQEL+IL+++ H NIV ++GY DD G ++G LV +Y+ NG L++KLHG  G     +
Sbjct  113  -LFKQELDILRQLHHRNIVGLIGYCDDRG-DQGALVLDYISNGGLEDKLHGGVGETSTTT  170

Query  450  VLPWRNRMGIAFQLAQVLEYLHDKCDP-QIVHGDLKGSNILLDSELNCKLCDYGSAKMGF  274
             LPWRNRM IA Q+A+ LEYLH+KC    IVHGD+K SN+LLD  LNC+LCD+GSA +GF
Sbjct  171  TLPWRNRMAIALQVAEALEYLHEKCGGLPIVHGDIKASNVLLDRHLNCRLCDFGSANVGF  230

Query  273  SSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGL  94
            SS V P          NR +M   GSPGYTDPHYLRTGI +KK+D+YS GV+LLEL+TG+
Sbjct  231  SSAVTP------GMRPNRAVM--MGSPGYTDPHYLRTGIPSKKNDVYSFGVLLLELVTGM  282

Query  93   EAVSSDSNVRLISKAGPML-KDESKVAGMVD  4
            +A  S+SN  L S+ GP L  D+  VA +VD
Sbjct  283  QAFCSESNRTLASRVGPTLGGDDMVVAELVD  313



>ref|XP_002891037.1| hypothetical protein ARALYDRAFT_313871 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67296.1| hypothetical protein ARALYDRAFT_313871 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 179/246 (73%), Gaps = 6/246 (2%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FSR  +I  GG+S++YL +   S+  A+K+   SS RL+ +++ ELEIL
Sbjct  33   TWDDVESLTSNFSR--LIGTGGYSSIYLARLSGSNNAALKV-HVSSHRLYQVFRSELEIL  89

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H +IVK+LGY DD   E G L+ EY+P G LQEKL+ N    VLPWRNR  IAFQ+
Sbjct  90   LRLQHPHIVKLLGYFDDSE-ESGALLLEYLPQGNLQEKLNRNSK-QVLPWRNRTAIAFQV  147

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H+KC PQIVHGD+K SNILLD   N KLCD+GSAK+GFSS VQP  +T+T + 
Sbjct  148  AQAIEHIHEKCSPQIVHGDIKSSNILLDKHFNSKLCDFGSAKVGFSSMVQPSKTTSTMSP  207

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
            +++ +M M GSPGYTDPHYLRTGIA+KK D+Y  GV++LEL++G EAVS +    L+   
Sbjct  208  RSKQVM-MIGSPGYTDPHYLRTGIASKKMDMYGFGVVVLELVSGKEAVSGERGEMLVHTT  266

Query  48   GPMLKD  31
             P++ D
Sbjct  267  APLIHD  272



>gb|KFK31987.1| hypothetical protein AALP_AA6G185500 [Arabis alpina]
Length=346

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 177/243 (73%), Gaps = 10/243 (4%)
 Frame = -2

Query  759  EVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRI  580
            +++ +T +FSR  +I  GG+S++Y+ +   S  GA+K+   SS RL+ ++K EL+IL  +
Sbjct  39   DLEAITSNFSR--LIGSGGYSSIYMARLSGSDKGALKV-HVSSHRLYQIFKVELQILLHL  95

Query  579  RHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQV  400
            +H  IVK+LGY DD   E G L+ EY+P G LQEKLH      VLPWRNR+ IAFQL Q 
Sbjct  96   QHPYIVKLLGYFDDSE-ENGSLLLEYLPQGNLQEKLHSKSK-QVLPWRNRITIAFQLIQA  153

Query  399  LEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNR  220
            +E++H+KC PQIVHGD+K SN+LLD + NCKLCD+GSAK+GFSS VQPP    T + +++
Sbjct  154  IEHIHEKCSPQIVHGDIKSSNVLLDKDFNCKLCDFGSAKVGFSSMVQPP----TMSPRSK  209

Query  219  TMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPM  40
             +M M GSPGYTDPHYLRTG+A+KK DIY  GV++LEL++G EAVS++    L+  A P+
Sbjct  210  QVM-MVGSPGYTDPHYLRTGVASKKMDIYGFGVVVLELVSGKEAVSAEGGKMLVHTAAPL  268

Query  39   LKD  31
            L +
Sbjct  269  LHE  271



>ref|XP_006397068.1| hypothetical protein EUTSA_v10028779mg [Eutrema salsugineum]
 gb|ESQ38521.1| hypothetical protein EUTSA_v10028779mg [Eutrema salsugineum]
Length=345

 Score =   264 bits (674),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 179/246 (73%), Gaps = 10/246 (4%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FSR  +I  GG+S++Y+ +   S   A+K+   SS RL+ +++ EL+IL
Sbjct  36   TWDDVKALTSNFSR--LIGSGGYSSIYMARSGGSDKAALKV-HVSSHRLYQIFRVELDIL  92

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H NIVK+LGY DD   E G L+ EY+P G LQEKLH N    +LPWRNR+ +AFQL
Sbjct  93   LRLQHPNIVKLLGYFDDSE-ENGALLLEYLPQGNLQEKLHINSK-QILPWRNRITVAFQL  150

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H+KC PQIVHGD+K SNILLD   NCKLCD+GSAK+GFSS VQP    +  ++
Sbjct  151  AQAIEHIHEKCIPQIVHGDIKSSNILLDKSFNCKLCDFGSAKVGFSSMVQP----SKMSS  206

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
            ++R +M M GSPGYTDPHYLRTGIA+KK D+Y  GV+LLEL++G EA +++    L+  A
Sbjct  207  RSRQVM-MVGSPGYTDPHYLRTGIASKKMDMYGFGVVLLELVSGKEAFNAEKGEMLVHIA  265

Query  48   GPMLKD  31
             P++ +
Sbjct  266  APLIHE  271



>ref|XP_004982611.1| PREDICTED: probable receptor-like protein kinase At1g33260-like 
[Setaria italica]
Length=355

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 177/259 (68%), Gaps = 16/259 (6%)
 Frame = -2

Query  807  KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSK  628
            K EK  +   R L+  +V+ +T  F+ S V+  GGFSTVYL +    +L A+K+   SS+
Sbjct  36   KVEKGAEAGPRGLSWAQVEAMTGGFT-SAVVGEGGFSTVYLARL-SGALAAVKV-HRSSE  92

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNG-GGS  451
            RLH +++QEL+ LQR+RH +IV++LG+ D +  EEGVLV E+  NG L E+LHG G    
Sbjct  93   RLHRVFRQELDALQRVRHPHIVRLLGFCDQQ--EEGVLVLEFAANGNLHERLHGGGKAAG  150

Query  450  VLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFS  271
             +PW  R+ +A Q+A+ LEYLHD+C+PQ+VHGD+K SN+LLD+ +  KLCD+GSA+MGFS
Sbjct  151  TMPWARRVSVALQVARALEYLHDQCEPQVVHGDVKASNVLLDASMAAKLCDFGSARMGFS  210

Query  270  STVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLE  91
            + V+P SS            TM GSPGY DPHY+R+G+ TKKSD+YS GV+LLEL+TG+E
Sbjct  211  AAVRPRSSA----------HTMLGSPGYVDPHYIRSGVVTKKSDVYSFGVLLLELLTGME  260

Query  90   AVSSDSNVRLISKAGPMLK  34
            A   +    L +   P L+
Sbjct  261  AFCPEEGRLLTAVLAPRLR  279



>emb|CDX93783.1| BnaA09g23830D [Brassica napus]
Length=337

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 173/246 (70%), Gaps = 18/246 (7%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FSR  +I  GG+S++YL +   +   A K+    S RL+ +++ ELEIL
Sbjct  34   TWDDVESLTSNFSR--LIGSGGYSSIYLARLSGAKKAAFKV-HVGSHRLYQVFRSELEIL  90

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H +IVK+LGY DD   E G L+ EY+P G LQEKL+ N    VLPWRNR  +AFQ+
Sbjct  91   LRLQHPHIVKLLGYFDDS--ETGALLLEYLPQGNLQEKLNHNSK-QVLPWRNRTALAFQV  147

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H+KC PQIVHGD+K SNILLD  LNCKLCD+GSA++GFSS VQP ++      
Sbjct  148  AQAMEHIHEKCSPQIVHGDIKSSNILLDKNLNCKLCDFGSARVGFSSMVQPSTT------  201

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
                   M GSPGYTDPHYLRTGIA+KK D+Y  GV++LEL++G EAVS++    L+  A
Sbjct  202  ------MMIGSPGYTDPHYLRTGIASKKMDMYGFGVVVLELVSGKEAVSAEKGEMLVHTA  255

Query  48   GPMLKD  31
             P+++D
Sbjct  256  APLIQD  261



>emb|CDY60675.1| BnaCnng36800D [Brassica napus]
Length=338

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 172/246 (70%), Gaps = 17/246 (7%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FSR  +I  GG+S++YL +   +   A K+    S RL+ +++ ELEIL
Sbjct  34   TWGDVESLTSNFSR--LIGSGGYSSIYLARLSGAKKAAFKV-HVGSHRLYQVFRSELEIL  90

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H +IVK+LGY DD   E G L+ EY+P G LQEKL+ N    VLPWRNR  IAFQ+
Sbjct  91   LRLQHPHIVKLLGYFDDSE-ETGALLLEYLPQGNLQEKLNHNSK-QVLPWRNRTAIAFQV  148

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H+KC PQIVHGD+K SNILLD  LNCKLCD+GSA++GFSS VQP ++      
Sbjct  149  AQAMEHIHEKCSPQIVHGDIKSSNILLDKNLNCKLCDFGSARVGFSSMVQPSTT------  202

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
                   M GSPGYTDPHYLRTGIA+KK D+Y  GV++LEL++G EAVS++    L+  A
Sbjct  203  ------MMIGSPGYTDPHYLRTGIASKKMDMYGFGVVVLELVSGKEAVSAEKGEMLVHTA  256

Query  48   GPMLKD  31
             P++ D
Sbjct  257  APLIHD  262



>emb|CDY05951.1| BnaC08g21280D [Brassica napus]
Length=327

 Score =   261 bits (666),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 172/246 (70%), Gaps = 17/246 (7%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FSR  +I  GG+S++YL +   +   A K+    S RL+ +++ ELEIL
Sbjct  34   TWDDVESLTSNFSR--LIGSGGYSSIYLARLSGAKKAAFKV-HVGSHRLYQVFRSELEIL  90

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H +IVK+LGY DD   E G L+ EY+P G LQEKL+ N    VLPWRNR  IAFQ+
Sbjct  91   LRLQHPHIVKLLGYFDDSE-ETGALLLEYLPQGNLQEKLNHNSK-QVLPWRNRTAIAFQV  148

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H+KC PQIVHGD+K SNILLD  LNCKLCD+GSA++GFSS VQP ++      
Sbjct  149  AQAMEHIHEKCSPQIVHGDIKSSNILLDKNLNCKLCDFGSARVGFSSMVQPSTT------  202

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
                   M GSPGYTDPHYLRTGIA+KK D+Y  GV++LEL++G EAVS++    L+  A
Sbjct  203  ------MMIGSPGYTDPHYLRTGIASKKMDMYGFGVVVLELVSGKEAVSAEKGEMLVHTA  256

Query  48   GPMLKD  31
             P++ D
Sbjct  257  APLIHD  262



>gb|AFW68394.1| putative protein kinase superfamily protein [Zea mays]
Length=352

 Score =   261 bits (667),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/260 (49%), Positives = 179/260 (69%), Gaps = 15/260 (6%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQEL  598
            R L+  +V+ +T  F+ S V+  GGFSTVYL +    +L A+K+   SS+RLH +++QEL
Sbjct  45   RGLSWAQVEAMTGRFT-SAVVGEGGFSTVYLARLSGGALAAVKV-HRSSERLHRVFRQEL  102

Query  597  EILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNG-GGSVLPWRNRMGI  421
            + L+R+RH +IV++L + D +  EEGVLV E+  NG L E+LHG G     +PW  R+  
Sbjct  103  DALRRVRHPHIVRLLAFCDQQ--EEGVLVLEFAANGNLHERLHGGGKAAGTMPWARRVSA  160

Query  420  AFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTA  241
            A Q+A+ LEYLHD+C+PQ+VHGD+K SN+LLD+ ++ KLCD+GSA+ GFS+ V+P  S  
Sbjct  161  ALQVARALEYLHDRCEPQVVHGDVKASNVLLDAAMSAKLCDFGSARTGFSAAVRPRPSAR  220

Query  240  TATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRL  61
            TA         M GSPGY DPHY+R+G+ TKKSD+YS GV+LLEL+TG+EA  ++   RL
Sbjct  221  TA---------MLGSPGYVDPHYIRSGVVTKKSDVYSFGVLLLELLTGMEAFCAEEGGRL  271

Query  60   ISKA-GPMLKDESKVAGMVD  4
            ++ A  P L+      GMVD
Sbjct  272  LTAAVAPRLRAGDPPRGMVD  291



>gb|ACG28233.1| protein kinase domain containing protein [Zea mays]
Length=350

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/259 (49%), Positives = 179/259 (69%), Gaps = 16/259 (6%)
 Frame = -2

Query  807  KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSK  628
            KAEK  +   R L+  +V+ +T  F+ S V+  GGFSTVYL +    +L A+K+   SS+
Sbjct  33   KAEKGVEAGPRGLSWAQVEAMTGGFT-SAVVGEGGFSTVYLARL-SGALAAVKV-HRSSE  89

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNG-GGS  451
            RLH +++QEL+ LQR+RH +IV++L + D +  +EGVLV E+  NG L E+LHG G    
Sbjct  90   RLHRVFRQELDALQRVRHPHIVRLLAFCDQQ--DEGVLVLEFAANGNLHERLHGGGKAAG  147

Query  450  VLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFS  271
             +PW  R+ +A Q+A+ LE+LHD+C+PQ+VHGD+K SN+LLD+ ++ KLCD+GSA+MGFS
Sbjct  148  TMPWARRVSVALQVARALEHLHDRCEPQVVHGDVKASNVLLDASMSAKLCDFGSARMGFS  207

Query  270  STVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLE  91
            + V+P SS            TM GSPGY DPHY+R+G+ TKKSD+YS GV+LLEL+TG+E
Sbjct  208  AAVRPRSSA----------RTMLGSPGYVDPHYIRSGVVTKKSDVYSFGVLLLELLTGME  257

Query  90   AVSSDSNVRLISKAGPMLK  34
            A  ++    L S   P L+
Sbjct  258  AFCAEEGRLLTSVVAPRLR  276



>ref|XP_010455437.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Camelina 
sativa]
Length=342

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 176/243 (72%), Gaps = 10/243 (4%)
 Frame = -2

Query  759  EVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRI  580
            +V+ LT +FSR  +I  GG+S++Y+ +F  S   A+K+   SS RL+ +++ EL+IL R+
Sbjct  35   DVETLTSNFSR--LIGSGGYSSIYMARFSGSDKAALKV-HVSSHRLYQVFRLELDILLRL  91

Query  579  RHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQV  400
            +H NIVK+LGY DD   E G L+ EY+P G LQEKLH +    VLPWRNR  IAFQL Q 
Sbjct  92   QHPNIVKLLGYFDDSE-ETGALLLEYLPQGNLQEKLHSSSK-QVLPWRNRTAIAFQLVQA  149

Query  399  LEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNR  220
            + ++H++C PQIVHGD+K SN+LLD   +CKLCD+GSAK+GFSS VQPP    T + ++R
Sbjct  150  IVHIHEECTPQIVHGDIKSSNVLLDKNFDCKLCDFGSAKVGFSSMVQPP----TMSTRSR  205

Query  219  TMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPM  40
              + M GSPGYTDPHYL+TGIA+KK DIY  GV++LEL++G EA S++    L+  A P+
Sbjct  206  -QVRMVGSPGYTDPHYLKTGIASKKMDIYGFGVVVLELVSGKEAFSAERGEMLVHIAAPL  264

Query  39   LKD  31
            +++
Sbjct  265  IRE  267



>ref|NP_001152612.1| protein kinase domain containing protein [Zea mays]
 gb|ACG48562.1| protein kinase domain containing protein [Zea mays]
 tpg|DAA49306.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=353

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 179/259 (69%), Gaps = 16/259 (6%)
 Frame = -2

Query  807  KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSK  628
            KAEK  +   R L+  +V+ +T  F+ S V+  GGFSTVYL +    +L A+K+   SS+
Sbjct  36   KAEKGVEAGPRGLSWAQVEAMTGGFT-SAVVGEGGFSTVYLARL-SGALAAVKV-HRSSE  92

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNG-GGS  451
            RLH +++QEL+ LQR+RH +IV++L + D +  +EGVLV E+  NG L E+LHG G    
Sbjct  93   RLHRVFRQELDALQRVRHPHIVRLLAFCDQQ--DEGVLVLEFAANGNLHERLHGGGKAAG  150

Query  450  VLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFS  271
             +PW  R+ +A Q+A+ LE+LHD+C+PQ+VHGD+K SN+LLD+ ++ KLCD+GSA+MGFS
Sbjct  151  TMPWARRVSVALQVARALEHLHDRCEPQVVHGDVKASNVLLDASMSAKLCDFGSARMGFS  210

Query  270  STVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLE  91
            + V+P SS            TM GSPGY DPHY+R+G+ TKKSD+YS GV+LLEL+TG+E
Sbjct  211  AAVRPRSSA----------RTMLGSPGYVDPHYIRSGVVTKKSDVYSFGVLLLELLTGME  260

Query  90   AVSSDSNVRLISKAGPMLK  34
            A  ++    L +   P L+
Sbjct  261  AFCAEEGRLLTAVVAPRLR  279



>ref|NP_192777.1| probable receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9SV83.1|Y4103_ARATH RecName: Full=Probable receptor-like protein kinase At4g10390 
[Arabidopsis thaliana]
 emb|CAB39792.1| putative protein kinase [Arabidopsis thaliana]
 emb|CAB78162.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM13194.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAN15565.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEE82875.1| probable receptor-like protein kinase [Arabidopsis thaliana]
Length=342

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 174/243 (72%), Gaps = 10/243 (4%)
 Frame = -2

Query  759  EVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRI  580
            +V+ LT +FSR  +I  GG+S++Y+ +F  S   A+K+   SS RL+ +++ EL+IL R+
Sbjct  35   DVETLTSNFSR--LIGSGGYSSIYMARFSGSDKAALKV-HVSSHRLYQVFRLELDILLRL  91

Query  579  RHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQV  400
            +H NIVK+LGY DD   E G L+ EY+P G LQEKL  N    VL WRNR+ IA QL Q 
Sbjct  92   QHPNIVKLLGYFDDSE-ENGALLLEYLPQGNLQEKLQSNSK-QVLQWRNRVAIALQLVQA  149

Query  399  LEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNR  220
            +E++H+KC PQIVHGD+K SN+LLD   +CKLCD+GSAK+GFSS VQPP    T + ++R
Sbjct  150  IEHIHEKCSPQIVHGDIKSSNVLLDKNFDCKLCDFGSAKVGFSSMVQPP----TMSPRSR  205

Query  219  TMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPM  40
              + M GSPGYTDPHYLRTGIA+KK D+Y  GV++LEL++G EA S++    L+  A P+
Sbjct  206  -QVKMVGSPGYTDPHYLRTGIASKKMDMYGFGVVVLELVSGKEAFSAERGEMLVHIAAPL  264

Query  39   LKD  31
            + +
Sbjct  265  MNE  267



>ref|XP_002874624.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50883.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=342

 Score =   259 bits (661),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/243 (52%), Positives = 173/243 (71%), Gaps = 10/243 (4%)
 Frame = -2

Query  759  EVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRI  580
            +V+ LT +FSR  +I  GG+S++Y+ +F  S   A+K+   SS RL+ +++ EL+IL R+
Sbjct  35   DVETLTSNFSR--LIGSGGYSSIYMARFSGSDKAALKV-HVSSHRLYQVFRLELDILLRL  91

Query  579  RHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQV  400
            +H NIVK+LGY DD   E G L+ EY+P G LQEKL  N    VL WRNR+ IA QL Q 
Sbjct  92   QHPNIVKLLGYFDDSE-ENGALLLEYLPQGNLQEKLQSNSK-QVLQWRNRVAIALQLVQA  149

Query  399  LEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNR  220
            +E++H+KC PQIVHGD+K SN+LLD   NCKLCD+GSAK+GFSS VQPP    T + ++R
Sbjct  150  IEHIHEKCTPQIVHGDIKASNVLLDKNFNCKLCDFGSAKVGFSSMVQPP----TMSPRSR  205

Query  219  TMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPM  40
              + M GSPGYTDPHY +TGIA+KK D+Y  GV++LEL++G EA S++    L+  A P+
Sbjct  206  -QVRMVGSPGYTDPHYFKTGIASKKMDMYGFGVVVLELVSGKEAFSAERGEMLVHIAAPL  264

Query  39   LKD  31
            + +
Sbjct  265  MNE  267



>gb|AAG51288.1|AC027035_11 protein kinase, putative [Arabidopsis thaliana]
Length=528

 Score =   265 bits (676),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 178/246 (72%), Gaps = 6/246 (2%)
 Frame = -2

Query  768  TRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEIL  589
            T  +V+ LT +FSR  +I  GG+S++YL +   S   A+K+   SS RL+ +++ ELEIL
Sbjct  34   TWDDVESLTSNFSR--LIGTGGYSSIYLARVSGSINAALKV-HVSSHRLYQVFRSELEIL  90

Query  588  QRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQL  409
             R++H +IVK+LGY DD   E G L+ EY+P G LQEKL+ N    VLPWRNR  IAFQ+
Sbjct  91   LRLQHPHIVKLLGYFDDSE-ESGALLLEYLPQGNLQEKLNRNSK-QVLPWRNRTAIAFQV  148

Query  408  AQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATA  229
            AQ +E++H+KC PQIVHGD+K SNILLD   N KLCD+GSAK+GFSS VQP  +T+T + 
Sbjct  149  AQAIEHIHEKCSPQIVHGDIKSSNILLDKHFNSKLCDFGSAKVGFSSMVQPSKTTSTMSP  208

Query  228  KNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKA  49
            +++ +M M GSPGYTDPHYLRTGIA+KK D+Y  GV++LEL++G EAVSS+    L+   
Sbjct  209  RSKQVM-MIGSPGYTDPHYLRTGIASKKMDMYGFGVVVLELVSGKEAVSSERGEMLVHST  267

Query  48   GPMLKD  31
              ++ +
Sbjct  268  ASLIHE  273



>ref|XP_006288116.1| hypothetical protein CARUB_v10001348mg [Capsella rubella]
 gb|EOA21014.1| hypothetical protein CARUB_v10001348mg [Capsella rubella]
Length=342

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 126/243 (52%), Positives = 174/243 (72%), Gaps = 10/243 (4%)
 Frame = -2

Query  759  EVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRI  580
            +V+ LT +FSR  +I  GG+S++Y+ +F  S   A+K+   SS  L+ +++ EL+IL R+
Sbjct  35   DVETLTSNFSR--LIGSGGYSSIYMARFSGSDKAALKV-HVSSHSLYQVFRLELDILLRL  91

Query  579  RHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQV  400
            +H NIVK+LGY DD   E G L+ EY+P G LQEKLH +    VLPWRNR  IAFQL Q 
Sbjct  92   QHPNIVKLLGYFDDSE-ENGALLLEYLPQGNLQEKLHSSSK-QVLPWRNRTTIAFQLVQA  149

Query  399  LEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNR  220
            +E++H+KC PQIVHGD+K SN+LLD   +CKLCD+GSAK+GFSS VQPP    T + ++R
Sbjct  150  IEHIHEKCTPQIVHGDIKSSNVLLDKNFDCKLCDFGSAKVGFSSMVQPP----TMSTRSR  205

Query  219  TMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPM  40
              + M GSPGYTDPHYL+TGIA K  D+Y  GV++LEL++G EA S++    L+  A P+
Sbjct  206  -QVKMVGSPGYTDPHYLKTGIALKNMDMYGFGVVVLELVSGKEAFSAERGEMLVHIAAPL  264

Query  39   LKD  31
            +++
Sbjct  265  IRE  267



>ref|XP_009128714.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor-like protein 
kinase At4g10390 [Brassica rapa]
Length=334

 Score =   258 bits (658),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 172/242 (71%), Gaps = 10/242 (4%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            S  R +  +V+ LT +FSR  +I  GG+S++Y+ +   S+  A+K+   SS RL+ +++ 
Sbjct  31   SVTRYSWDDVEALTSNFSR--LIGSGGYSSIYMARLSSSAKAALKV-HVSSHRLYKIFRL  87

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMG  424
            EL+IL R++H NIVK+LGY DD   E G L+ EY+P G LQE LH N    VLPWRNR+ 
Sbjct  88   ELDILLRLQHPNIVKLLGYFDDSE-ENGALLLEYLPQGNLQENLHSNSK-QVLPWRNRVA  145

Query  423  IAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSST  244
            IAFQL Q +E++H+KC PQIVHGD+K SN+LLD   N KLCD+GSAK+GFSS VQP    
Sbjct  146  IAFQLVQAIEHIHEKCIPQIVHGDIKSSNVLLDKNFNSKLCDFGSAKVGFSSMVQP----  201

Query  243  ATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVR  64
             +A +     +TM GSPGYTDPHYLRTG+A+KK D+Y  GV++LELI+G EA+S+ +   
Sbjct  202  -SAISPRSRHVTMVGSPGYTDPHYLRTGVASKKMDMYGFGVVVLELISGKEALSAGNGEM  260

Query  63   LI  58
            L+
Sbjct  261  LV  262



>ref|XP_010050622.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Eucalyptus 
grandis]
Length=372

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/292 (49%), Positives = 196/292 (67%), Gaps = 25/292 (9%)
 Frame = -2

Query  837  GCLGRKSRRRKAEKDTKESA-RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSL  661
            GC GR         D+ E+A +R    E++++T  FS   V+  GGFSTVY+G+FP    
Sbjct  30   GCSGRYG-------DSAETAVKRWEWGEIERITGCFSE--VVGEGGFSTVYMGRFPGCGG  80

Query  660  GA------IKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYV  499
            G+      +K+     +RL   +KQEL++L ++ H+NIVK+LGY DD   ++G L+FEYV
Sbjct  81   GSTAAAAAVKVHCGGGERLSMAFKQELDVLLQLEHENIVKLLGYCDD--ADQGALIFEYV  138

Query  498  PNGTLQEKLHGNGGG--SVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLD  325
              GTL E+LHG+G    S LPW++R+ IAFQLAQ +E+LH++C   I+HGD+K SN+LLD
Sbjct  139  SGGTLHERLHGSGSNKRSTLPWKSRVKIAFQLAQAIEHLHERCTLHIIHGDIKSSNVLLD  198

Query  324  SELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKK  145
             + +CKLCD+GSAKMGFSS + PPSS  +++   R    + GSPGYTDP YLRTGIA+KK
Sbjct  199  GDSDCKLCDFGSAKMGFSSMIPPPSSLPSSSPYVRRKNIIMGSPGYTDPAYLRTGIASKK  258

Query  144  SDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLK-----DESKVAGMVD  4
            +DIYS GV++LEL+TGLEA  +D  + L S A  M K     D S+V  MVD
Sbjct  259  NDIYSFGVLVLELVTGLEAFRADKGLVLASMAAHMTKDVDRMDVSEVTNMVD  310



>ref|XP_010437137.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Camelina 
sativa]
Length=342

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 176/243 (72%), Gaps = 10/243 (4%)
 Frame = -2

Query  759  EVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRI  580
            +V+ LT +FSR  +I  GG+S++Y+ +F  S   A+K+   SS RL+ +++ EL+IL R+
Sbjct  35   DVETLTSNFSR--LIGSGGYSSIYMARFSGSDKAALKV-HVSSHRLYQVFRLELDILLRL  91

Query  579  RHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQV  400
            +H NIVK+LGY DD   E G L+ EY+P G LQEKLH +    VLPWRNR  IAFQL Q 
Sbjct  92   QHPNIVKLLGYFDDSE-ETGALLLEYLPQGNLQEKLHSSSK-QVLPWRNRTAIAFQLVQA  149

Query  399  LEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNR  220
            + ++H++C PQIVHGD+K SN+LLD   +CKLCD+GSAK+GFSS VQPP    T + ++R
Sbjct  150  IVHIHEECTPQIVHGDIKSSNVLLDKNFDCKLCDFGSAKVGFSSMVQPP----TMSTRSR  205

Query  219  TMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPM  40
              + M GSPGYTDP+YL+TGIA+KK D+Y  GV++LEL++G EA S++    L+  A P+
Sbjct  206  -QVRMVGSPGYTDPYYLKTGIASKKMDMYGFGVVVLELVSGKEAFSAERGEMLVHIAAPL  264

Query  39   LKD  31
            +++
Sbjct  265  IRE  267



>ref|XP_010056100.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Eucalyptus 
grandis]
 gb|KCW72674.1| hypothetical protein EUGRSUZ_E01131 [Eucalyptus grandis]
Length=368

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/278 (51%), Positives = 192/278 (69%), Gaps = 18/278 (6%)
 Frame = -2

Query  795  DTKESA--RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGA-----IKIIDT  637
            D  E+A  +RL   E++++T  FS   V+  GGFSTVY+G+ P    G+     +K+   
Sbjct  33   DAAEAAAVKRLEWGEIERITRRFSV--VVGEGGFSTVYMGRLPVCGGGSAAAAAVKVHCG  90

Query  636  SSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGG  457
              +RL   +KQEL++L R++H+NIV++LGY DD   ++G L+FEYV  GTL ++LHG  G
Sbjct  91   GGERLSLAFKQELDLLLRLKHENIVRILGYCDD--ADQGALIFEYVSGGTLYDRLHGRSG  148

Query  456  G--SVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
               S LPW++R+ IAFQLAQ +EYLH++C   I+HGD+K SN+LLD + NCKLCD+GSAK
Sbjct  149  NKRSTLPWKSRVKIAFQLAQAIEYLHERCIVHIIHGDIKSSNVLLDGDSNCKLCDFGSAK  208

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
            MGFSST+ PPSS+ +++   R    + GSPGYTDP YLRTGIA KK+DIYS GV++LEL+
Sbjct  209  MGFSSTIPPPSSSPSSSPYVRRKNIIMGSPGYTDPAYLRTGIALKKNDIYSFGVLVLELV  268

Query  102  TGLEAVSSDSNVRLISKAGPMLK-----DESKVAGMVD  4
            TGLEA  +D  + L S A  M K     D S+V  MVD
Sbjct  269  TGLEAFRADKGLVLASMAAHMAKDVDRMDVSEVTNMVD  306



>emb|CDP04937.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 172/228 (75%), Gaps = 19/228 (8%)
 Frame = -2

Query  639  TSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHG--  466
            +SS+RLH ++KQEL+IL R+RHD+IVK+LGYSDD   EE +LVFEYVPNG LQ+KLH   
Sbjct  6    SSSQRLHRVFKQELDILLRLRHDHIVKLLGYSDDP--EESILVFEYVPNGNLQDKLHTAK  63

Query  465  --NGGGS------------VLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILL  328
               GG +            VL W +R+ IAFQLAQ LEYLH KC  QIVHGD+K SNILL
Sbjct  64   ARRGGKTGAGADGEEEEEGVLSWNSRIKIAFQLAQALEYLHHKCPLQIVHGDIKASNILL  123

Query  327  DSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATK  148
            DS LNCKLCD+GSAKMGF+S+V PP S+++++A + + M M GSPGY DPHYLRTGIA+K
Sbjct  124  DSHLNCKLCDFGSAKMGFASSVLPPFSSSSSSATSSSRM-MLGSPGYADPHYLRTGIASK  182

Query  147  KSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            K+D+YS GVILLELITG EA+ S +  +L S A P L+D SK+  ++D
Sbjct  183  KNDVYSFGVILLELITGREALCSRTGHKLTSIAAPALRDPSKLPQLLD  230



>ref|XP_010056102.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Eucalyptus 
grandis]
Length=370

 Score =   256 bits (654),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 143/292 (49%), Positives = 195/292 (67%), Gaps = 25/292 (9%)
 Frame = -2

Query  837  GCLGRKSRRRKAEKDTKESA-RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSL  661
            GC GR         D  E+A +R    E++++T  FS   V+  GGFSTVY+G+FP    
Sbjct  30   GCSGRCG-------DAAETAVKRWEWGEIERITGCFSE--VVGEGGFSTVYMGRFPGCGG  80

Query  660  GA------IKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYV  499
            G+      +K+     +RL   +KQEL++L ++ H+NIV++LGY DD   ++G L+FEYV
Sbjct  81   GSTAAAAAVKVHCGGGERLSMAFKQELDVLLQLEHENIVRLLGYCDD--ADQGALIFEYV  138

Query  498  PNGTLQEKLHGNGGG--SVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLD  325
              GTL E+LHG+G    S LPW++R+ IAFQLAQ +E+LH++C   I+HGD+K SN+LLD
Sbjct  139  SGGTLHERLHGSGSNKRSTLPWKSRVKIAFQLAQAIEHLHERCTLHIIHGDIKSSNVLLD  198

Query  324  SELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKK  145
             + +CKLCD+GSAKMGFSS + PPSS  +++   R    + GSPGYTDP YLRTGIA+KK
Sbjct  199  GDSDCKLCDFGSAKMGFSSMIPPPSSLPSSSPYVRRKNIIMGSPGYTDPAYLRTGIASKK  258

Query  144  SDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLK-----DESKVAGMVD  4
            +DIYS GV++LEL+TGLEA  +D  + L S A  M K     D S+V  MVD
Sbjct  259  NDIYSFGVLVLELVTGLEAFRADKGLVLASMAAHMTKDVDRMDVSEVTNMVD  310



>ref|XP_010110420.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXC26252.1| putative receptor-like protein kinase [Morus notabilis]
Length=379

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/271 (49%), Positives = 183/271 (68%), Gaps = 27/271 (10%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGK--FPDSS-----LGAIKIIDTSSKRLH  619
            R+ + +E++K T +F  SRVI +GGFSTVYL     P ++     L AIKII+ S     
Sbjct  57   RKFSWEEIEKFTKNFCSSRVIGYGGFSTVYLAGDLIPSTTSTGTNLAAIKIINGSR----  112

Query  618  TMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGG----GS  451
             ++KQEL+IL+++ H NIV ++GY DD   ++  LV +Y+ NG L++KLHG  G     +
Sbjct  113  -LFKQELDILRQLHHRNIVGLIGYCDDRD-DQWALVLDYISNGGLEDKLHGGVGETSTTT  170

Query  450  VLPWRNRMGIAFQLAQVLEYLHDKCDP-QIVHGDLKGSNILLDSELNCKLCDYGSAKMGF  274
             LPWRNR  IA Q+A+ LEYLH+ C    IVHGD+K SN+LLD  LNC+LCD+GSA +GF
Sbjct  171  TLPWRNRKAIALQVAEALEYLHEMCGGLPIVHGDIKASNVLLDHHLNCRLCDFGSANIGF  230

Query  273  SSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGL  94
            SS V P          NR +M   GSPGYTDPHYLRTG+ +KK+D+YS GV+LLEL+TG+
Sbjct  231  SSAVTP------GMRPNRAVM--MGSPGYTDPHYLRTGLPSKKNDVYSFGVLLLELVTGM  282

Query  93   EAVSSDSNVRLISKAGPML-KDESKVAGMVD  4
            +A  S+SN  L+S+ GP   +D+  +A +VD
Sbjct  283  QAFCSESNRTLVSRVGPTFGRDDVDIAELVD  313



>dbj|BAJ89974.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92756.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/273 (49%), Positives = 181/273 (66%), Gaps = 13/273 (5%)
 Frame = -2

Query  813  RRKAEKDTKES-ARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDT  637
            R  AE   K   ARRL   EV+ +T  FS SRVI  GGFSTVYL     S LGA+K+   
Sbjct  26   RVSAEPSGKSGRARRLDWAEVESVTGGFS-SRVIGQGGFSTVYLASLTSSRLGAVKV-QR  83

Query  636  SSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGG  457
            SS+RLH +++ EL++L  +RH ++V++L Y D+   EEGVLVFEY PNG L E+LH +G 
Sbjct  84   SSERLHRLFRHELDVLLSLRHPHVVRLLAYCDER--EEGVLVFEYAPNGDLHERLHRSGQ  141

Query  456  G-SVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKM  280
              + LPW  RM +AFQ+A  LEYLH+  DP ++HGD+K SN+LLD+ ++ KLCD+G A  
Sbjct  142  KRAALPWARRMAVAFQVAMALEYLHESQDPAVIHGDVKASNVLLDANMDVKLCDFGFAHA  201

Query  279  GFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELIT  100
            GFS+          A A   +   + GSPGY DP +LR+G+ATKKSD+YS GV+LLEL+T
Sbjct  202  GFSAA------VLPAAAARASARHVMGSPGYVDPLFLRSGVATKKSDVYSFGVLLLELVT  255

Query  99   GLEAVSSDSNVRLISKAGPMLKDESKVAGMVDR  1
            G EA+ +D+  RL     P++  E +VA +VDR
Sbjct  256  GREAICADTGCRLAVTVAPVVS-EGRVADVVDR  287



>ref|XP_003574174.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Brachypodium 
distachyon]
Length=353

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 174/256 (68%), Gaps = 17/256 (7%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            +AR+L+  +V+++T  F+ S V+  GGFSTVYL +    +L A K+   SS+RLH +++Q
Sbjct  44   AARQLSWAQVERMTGGFT-SAVVGEGGFSTVYLARL-SGALAAAKV-HRSSERLHRVFRQ  100

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNG-GGSVLPWRNRM  427
            ELE L R+RH ++V++L + + +  +EGVLV E+  NG L EKLHG G     +PW  R+
Sbjct  101  ELETLLRVRHPHVVRLLAFCEQQ--DEGVLVLEFAANGNLHEKLHGGGKAAGTMPWARRV  158

Query  426  GIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSS  247
             +A Q+AQ LEYLHD+C+PQ+VHGD+K SN+LLDS ++ KLCD+GSA+MGFS+ V+P   
Sbjct  159  SVALQVAQALEYLHDRCEPQVVHGDVKASNVLLDSAMSAKLCDFGSARMGFSAAVRP---  215

Query  246  TATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNV  67
                    R   TM GSPGY DPHY+R+G+ TKK+D+YS GV+LLEL+TG+EA       
Sbjct  216  --------RAHQTMLGSPGYVDPHYIRSGVVTKKTDVYSFGVLLLELLTGMEAFCPVEGR  267

Query  66   RLISKAGPMLKDESKV  19
             L +   P LK    V
Sbjct  268  LLTAVLAPRLKPAGGV  283



>dbj|BAJ91974.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87848.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=346

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/259 (48%), Positives = 177/259 (68%), Gaps = 16/259 (6%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQEL  598
            R+L+  +V+++T  F+ S V+  GGFSTVYL +    +L A+K+   SS+R+H +++QEL
Sbjct  42   RQLSWAQVERMTGGFT-SAVVGEGGFSTVYLARL-SGALAAVKV-HRSSERIHRVFRQEL  98

Query  597  EILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNG-GGSVLPWRNRMGI  421
            E L R+RH +IV++LG+ + +  +EGVLV E+  NG L EKLHG G     +PW  R+ +
Sbjct  99   ETLLRVRHPHIVRLLGFCEQQ--DEGVLVLEFAANGNLYEKLHGGGKAAGAMPWARRVSV  156

Query  420  AFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTA  241
            A Q+AQ LEYLH++C+PQ+VHGD+K SN+LLD+ ++ KLCD+GSA+MGFS+ V+P SS  
Sbjct  157  AVQVAQALEYLHERCEPQVVHGDVKASNVLLDASMSAKLCDFGSARMGFSAAVRPRSSA-  215

Query  240  TATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRL  61
                      TM GSPGY DPHY+R+G+ TKK+D+YS GV+LLEL+TG+EA        L
Sbjct  216  ---------HTMLGSPGYVDPHYIRSGVVTKKTDVYSFGVLLLELLTGMEAFCPVEGRLL  266

Query  60   ISKAGPMLKDESKVAGMVD  4
             +   P LK       +VD
Sbjct  267  TAVLAPRLKAAGDARMLVD  285



>ref|XP_010421958.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Camelina 
sativa]
Length=342

 Score =   253 bits (646),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 175/243 (72%), Gaps = 10/243 (4%)
 Frame = -2

Query  759  EVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRI  580
            +V+ LT +FSR  +I  GG+S++Y+ +F  S   A+K+   SS RL+ +++ EL+IL R+
Sbjct  35   DVETLTSNFSR--LIGSGGYSSIYMARFSGSDKAALKV-HVSSHRLYQVFRLELDILLRL  91

Query  579  RHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQV  400
            +H NIVK+LGY DD   E G L+ EY+P G LQEKLH +    VLPWRNR  IA+QL Q 
Sbjct  92   QHPNIVKLLGYFDDSE-ETGALLLEYLPQGNLQEKLHSSSK-QVLPWRNRTTIAYQLVQA  149

Query  399  LEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNR  220
            + ++H++C PQIVHGD+K SN+LLD   +CKLCD+GSAK+GFSS VQPP    T + ++R
Sbjct  150  IVHIHEECTPQIVHGDIKSSNVLLDKNFDCKLCDFGSAKVGFSSMVQPP----TMSTRSR  205

Query  219  TMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPM  40
              + M GSPGYTDPHYL+TGIA+KK D+Y  GV++LEL++G EA S++    L+  A  +
Sbjct  206  -QVRMVGSPGYTDPHYLKTGIASKKMDMYGFGVVVLELVSGKEAFSAERGEMLVHIAASL  264

Query  39   LKD  31
            +++
Sbjct  265  IRE  267



>gb|ACG35382.1| leucine-rich repeat receptor protein kinase EXS precursor [Zea 
mays]
Length=354

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/269 (48%), Positives = 178/269 (66%), Gaps = 17/269 (6%)
 Frame = -2

Query  801  EKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRL  622
            E +   +AR+L   EV+  T  FS SRV+  GGFSTVYL     S LGA+K+   SS+RL
Sbjct  42   EAEDGGAARQLAWAEVETATGGFS-SRVVGRGGFSTVYLASLSSSRLGAVKV-HCSSERL  99

Query  621  HTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLP  442
               +++EL++L  +RH ++V++L Y D+   +EGVLVFEY PNG L E+LHG  G   LP
Sbjct  100  RRAFRRELDVLLSLRHPHVVRLLAYCDER--DEGVLVFEYAPNGDLHERLHGGAGAGTLP  157

Query  441  WRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTV  262
            W  R+ +AFQ+A  LEYLH+  DP +VHGD+K SN+LLD+ ++ KLCD+G A +G S+T+
Sbjct  158  WARRVAVAFQVASALEYLHEGRDPAVVHGDIKASNVLLDASMDAKLCDFGFAHVGVSATM  217

Query  261  --QPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEA  88
              + PS  A           + GSPGY DPH LR+G+ATK SD+YS GV+LLEL+TG EA
Sbjct  218  GGRRPSDRA-----------VMGSPGYVDPHLLRSGVATKASDVYSFGVLLLELLTGKEA  266

Query  87   VSSDSNVRLISKAGPMLKDESKVAGMVDR  1
            V  ++  RL +   P L D  ++ G++D+
Sbjct  267  VCRETGHRLTAAVRPKLSDGDQLPGVLDQ  295



>gb|AAK39595.1|AC025296_30 putative receptor protein kinase [Oryza sativa Japonica Group]
 gb|AAP54619.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
Length=365

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/255 (48%), Positives = 172/255 (67%), Gaps = 16/255 (6%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQEL  598
            RRL+  +V+ +T  F+ S V+  GGFSTVYL +    +L A+K+   SS+RLH +++QEL
Sbjct  57   RRLSWAQVEAMTGGFT-SAVVGEGGFSTVYLARVA-GALAAVKV-HRSSERLHRVFRQEL  113

Query  597  EILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNG-GGSVLPWRNRMGI  421
            + L R+RH +IV++L + + +  EEGVLV E+  NG L E+LHG G     +PW  R  +
Sbjct  114  DALLRVRHPHIVRLLAFCEQQ--EEGVLVLEFAANGNLHERLHGGGKAAGTMPWARRASV  171

Query  420  AFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTA  241
            A Q+A+ LEYLHD+C+P +VHGD+K SN+LLD  ++ KLCD+GSA+MGFS+ V+P SS  
Sbjct  172  ALQVARALEYLHDRCEPAVVHGDVKASNVLLDEAMSAKLCDFGSARMGFSAAVRPRSSA-  230

Query  240  TATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRL  61
                      TM GSPGY DPHY+R+G+ TKKSD+YS GV+LLEL+TG+EA  +     L
Sbjct  231  ---------HTMLGSPGYVDPHYIRSGMVTKKSDVYSFGVLLLELLTGMEAFCAAEGRLL  281

Query  60   ISKAGPMLKDESKVA  16
             +   P L+  S  A
Sbjct  282  TAVLAPRLRPASCAA  296



>ref|XP_010941089.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Elaeis 
guineensis]
Length=371

 Score =   249 bits (635),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 173/256 (68%), Gaps = 22/256 (9%)
 Frame = -2

Query  789  KESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFP--DSSLGAIKIIDTSSKRLHT  616
            K + RR    EV+ LT +F+ + VI  GGFSTVYL + P  DSSL A+K++ T  +RLH 
Sbjct  65   KAAVRRYAWPEVESLTGNFTAT-VIGEGGFSTVYLARLPGADSSLAAVKVLCTG-ERLHR  122

Query  615  MYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWR  436
             + QEL++L+R+ H  IV++LG+ DD   EEGVLV EYVPNG+LQEKLHG GG   LPW 
Sbjct  123  AFLQELDVLRRLSHPRIVRLLGFCDDR--EEGVLVLEYVPNGSLQEKLHGGGG--ALPWA  178

Query  435  NRMGIAFQLAQVLEYLHDKC-DPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQ  259
             RM IAF++A  +EYLH+ C +  IVHGD+  +N+LLD+ L+ KLCD+GSA+ GFSS V 
Sbjct  179  RRMRIAFEVAGAVEYLHEGCGELPIVHGDVTAANVLLDNRLDPKLCDFGSAQAGFSSAV-  237

Query  258  PPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSS  79
                        R+   M GSPGY DPHYLRTG+ +K  D+Y  GV+LLELITGL AV S
Sbjct  238  ------------RSAGAMVGSPGYADPHYLRTGMVSKSMDVYGFGVLLLELITGLPAVIS  285

Query  78   DSNVRLISKAGPMLKD  31
            +    L ++  P L++
Sbjct  286  EEGRVLTAEMRPRLRE  301



>tpg|DAA36645.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=352

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/269 (48%), Positives = 178/269 (66%), Gaps = 19/269 (7%)
 Frame = -2

Query  801  EKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRL  622
            E +   +AR+L   EV+  T  FS SRV+  GGFSTVYL     S LGA+K+   SS+RL
Sbjct  42   EAEDGGAARQLAWAEVETATGGFS-SRVVGRGGFSTVYLASLSSSRLGAVKV-HCSSERL  99

Query  621  HTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLP  442
               +++EL++L  +RH ++V++L Y D+   +EGVLVFEY PNG L E+LHG  G   LP
Sbjct  100  RRAFRRELDVLLSLRHPHVVRLLAYCDER--DEGVLVFEYAPNGDLHERLHGGAG--TLP  155

Query  441  WRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTV  262
            W  R+ +AFQ+A  LEYLH+  DP +VHGD+K SN+LLD+ ++ KLCD+G A +G S+T+
Sbjct  156  WARRVAVAFQVASALEYLHEGRDPAVVHGDIKASNVLLDAGMDAKLCDFGFAHVGVSATM  215

Query  261  --QPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEA  88
              + PS  A           + GSPGY DPH LR+G+ATK SD+YS GV+LLEL+TG EA
Sbjct  216  GGRRPSDRA-----------VMGSPGYVDPHLLRSGVATKASDVYSFGVLLLELLTGKEA  264

Query  87   VSSDSNVRLISKAGPMLKDESKVAGMVDR  1
            V  ++  RL +   P L D  ++ G++D+
Sbjct  265  VCRETGHRLTAAVRPKLSDGDQLPGVLDQ  293



>gb|EAY79203.1| hypothetical protein OsI_34316 [Oryza sativa Indica Group]
Length=299

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 162/238 (68%), Gaps = 15/238 (6%)
 Frame = -2

Query  726  SRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGY  547
            S V+  GGFSTVYL +    +L A+K+   SS+RLH +++QEL+ L R+RH +IV++L +
Sbjct  7    SAVVGEGGFSTVYLARVA-GALAAVKV-HRSSERLHRVFRQELDALLRVRHPHIVRLLAF  64

Query  546  SDDEGVEEGVLVFEYVPNGTLQEKLHGNG-GGSVLPWRNRMGIAFQLAQVLEYLHDKCDP  370
             + +  EEGVLV E+  NG L E+LHG G     +PW  R  +A Q+A+ LEYLHD+C+P
Sbjct  65   CEQQ--EEGVLVLEFAANGNLHERLHGGGKAAGTMPWARRASVALQVARALEYLHDRCEP  122

Query  369  QIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPG  190
             +VHGD+K SN+LLD+ ++ KLCD+GSA+MGFS+ V+P SS            TM GSPG
Sbjct  123  AVVHGDVKASNVLLDAAMSAKLCDFGSARMGFSAAVRPRSSA----------HTMLGSPG  172

Query  189  YTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKVA  16
            Y DPHY+R+G+ TKKSD+YS GV+LLEL+TG+EA  +     L +   P L+  S  A
Sbjct  173  YVDPHYIRSGMVTKKSDVYSFGVLLLELLTGMEAFCAAEGRLLTAVLAPRLRPASGAA  230



>dbj|BAJ85198.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88111.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=351

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/267 (49%), Positives = 170/267 (64%), Gaps = 16/267 (6%)
 Frame = -2

Query  801  EKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRL  622
            +++   +ARR+   EV+  T  FS SRVI  GGFSTVYL     S L A+K+   SS+RL
Sbjct  41   QEEADGAARRMAWAEVESATGAFS-SRVIGHGGFSTVYLASLSSSRLAAVKV-HCSSERL  98

Query  621  HTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLP  442
            H  ++QEL +L  +RH +IV++LGY DD   +EGVLVFEY PNG L + LHG+     LP
Sbjct  99   HRAFRQELHVLLSLRHPHIVRLLGYCDDR--DEGVLVFEYAPNGDLHQTLHGDA--PPLP  154

Query  441  WRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTV  262
            W  R+ IAFQ A  LEYLH+   P ++HGD+K SN+LLD  ++ KLCD+G A  G S T 
Sbjct  155  WSRRVAIAFQAATALEYLHEGRSPAVIHGDIKASNVLLDGNMDAKLCDFGFAHSGVSITA  214

Query  261  QPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVS  82
                S+  A         + GSPGY DP  LRTG+A K+SD+YS GV+LLEL+TG EAV 
Sbjct  215  GRGRSSGRA---------IMGSPGYVDPQLLRTGVANKESDVYSFGVLLLELVTGREAVC  265

Query  81   SDSNVRLISKAGPMLKDESKVAGMVDR  1
             D+  RL +   P++ D   VA +VDR
Sbjct  266  RDTGRRLTAVVCPIVND-GNVAEVVDR  291



>gb|KCW72672.1| hypothetical protein EUGRSUZ_E01128, partial [Eucalyptus grandis]
Length=363

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 132/270 (49%), Positives = 184/270 (68%), Gaps = 16/270 (6%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFP-----DSSLGAIKIIDTSSKRLHTM  613
            +RL   E++++T  FS   V+  GGFSTVY+G+ P      ++  A+K+     +RL   
Sbjct  44   KRLEWGEIERITGCFSV--VVGEGGFSTVYMGRLPVCRGGSAAAAAVKVHCGGGERLSMA  101

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGG--SVLPW  439
            +KQEL++L R++H+NIV++LGY DD   ++G L+FEYV  GTL E+LHG+G    S LPW
Sbjct  102  FKQELDVLHRLKHENIVRLLGYCDD--ADQGALIFEYVSGGTLHERLHGSGSNKRSTLPW  159

Query  438  RNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQ  259
            ++R+ IAFQLAQ +E+LH++C   I+HGD+K SN+LLD + NC+LCD+GSAKMGFSS + 
Sbjct  160  KSRVKIAFQLAQAIEHLHERCTLHIIHGDIKSSNVLLDGDSNCRLCDFGSAKMGFSSMIP  219

Query  258  PPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSS  79
            PP S+ +++   R    + GS GYTDP YLR GIA+KK+DIYS GV++LEL+TGLEA  +
Sbjct  220  PPWSSPSSSPYVRRKNIIVGSLGYTDPVYLRNGIASKKNDIYSFGVLVLELVTGLEAFRA  279

Query  78   DSNVRLISKAGPMLK-----DESKVAGMVD  4
            D    L S A  M       D  +V  MVD
Sbjct  280  DKGQVLASMAAHMTNGVDCMDVGEVMKMVD  309



>ref|XP_010056099.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Eucalyptus 
grandis]
Length=371

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/270 (49%), Positives = 184/270 (68%), Gaps = 16/270 (6%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFP-----DSSLGAIKIIDTSSKRLHTM  613
            +RL   E++++T  FS   V+  GGFSTVY+G+ P      ++  A+K+     +RL   
Sbjct  44   KRLEWGEIERITGCFSV--VVGEGGFSTVYMGRLPVCRGGSAAAAAVKVHCGGGERLSMA  101

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGG--SVLPW  439
            +KQEL++L R++H+NIV++LGY DD   ++G L+FEYV  GTL E+LHG+G    S LPW
Sbjct  102  FKQELDVLHRLKHENIVRLLGYCDD--ADQGALIFEYVSGGTLHERLHGSGSNKRSTLPW  159

Query  438  RNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQ  259
            ++R+ IAFQLAQ +E+LH++C   I+HGD+K SN+LLD + NC+LCD+GSAKMGFSS + 
Sbjct  160  KSRVKIAFQLAQAIEHLHERCTLHIIHGDIKSSNVLLDGDSNCRLCDFGSAKMGFSSMIP  219

Query  258  PPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSS  79
            PP S+ +++   R    + GS GYTDP YLR GIA+KK+DIYS GV++LEL+TGLEA  +
Sbjct  220  PPWSSPSSSPYVRRKNIIVGSLGYTDPVYLRNGIASKKNDIYSFGVLVLELVTGLEAFRA  279

Query  78   DSNVRLISKAGPMLK-----DESKVAGMVD  4
            D    L S A  M       D  +V  MVD
Sbjct  280  DKGQVLASMAAHMTNGVDCMDVGEVMKMVD  309



>gb|EAZ16683.1| hypothetical protein OsJ_32158 [Oryza sativa Japonica Group]
Length=299

 Score =   244 bits (622),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 161/238 (68%), Gaps = 15/238 (6%)
 Frame = -2

Query  726  SRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGY  547
            S V+  GGFSTVYL +    +L A+K+   SS+RLH +++QEL+ L R+RH +IV++L +
Sbjct  7    SAVVGEGGFSTVYLARVA-GALAAVKV-HRSSERLHRVFRQELDALLRVRHPHIVRLLAF  64

Query  546  SDDEGVEEGVLVFEYVPNGTLQEKLHGNG-GGSVLPWRNRMGIAFQLAQVLEYLHDKCDP  370
             + +  EEGVLV E+  NG L E+LHG G     +PW  R  +A Q+A+ LEYLHD+C+P
Sbjct  65   CEQQ--EEGVLVLEFAANGNLHERLHGGGKAAGTMPWARRASVALQVARALEYLHDRCEP  122

Query  369  QIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPG  190
             +VHGD+K SN+LLD  ++ KLCD+GSA+MGFS+ V+P SS            TM GSPG
Sbjct  123  AVVHGDVKASNVLLDEAMSAKLCDFGSARMGFSAAVRPRSSA----------HTMLGSPG  172

Query  189  YTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKVA  16
            Y DPHY+R+G+ TKKSD+YS GV+LLEL+TG+EA  +     L +   P L+  S  A
Sbjct  173  YVDPHYIRSGMVTKKSDVYSFGVLLLELLTGMEAFCAAEGRLLTAVLAPRLRPASCAA  230



>ref|XP_008669073.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Zea 
mays]
Length=450

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/269 (48%), Positives = 178/269 (66%), Gaps = 19/269 (7%)
 Frame = -2

Query  801  EKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRL  622
            E +   +AR+L   EV+  T  FS SRV+  GGFSTVYL     S LGA+K+   SS+RL
Sbjct  140  EAEDGGAARQLAWAEVETATGGFS-SRVVGRGGFSTVYLASLSSSRLGAVKV-HCSSERL  197

Query  621  HTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLP  442
               +++EL++L  +RH ++V++L Y D+   +EGVLVFEY PNG L E+LHG  G   LP
Sbjct  198  RRAFRRELDVLLSLRHPHVVRLLAYCDER--DEGVLVFEYAPNGDLHERLHGGAG--TLP  253

Query  441  WRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTV  262
            W  R+ +AFQ+A  LEYLH+  DP +VHGD+K SN+LLD+ ++ KLCD+G A +G S+T+
Sbjct  254  WARRVAVAFQVASALEYLHEGRDPAVVHGDIKASNVLLDAGMDAKLCDFGFAHVGVSATM  313

Query  261  --QPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEA  88
              + PS  A           + GSPGY DPH LR+G+ATK SD+YS GV+LLEL+TG EA
Sbjct  314  GGRRPSDRA-----------VMGSPGYVDPHLLRSGVATKASDVYSFGVLLLELLTGKEA  362

Query  87   VSSDSNVRLISKAGPMLKDESKVAGMVDR  1
            V  ++  RL +   P L D  ++ G++D+
Sbjct  363  VCRETGHRLTAAVRPKLSDGDQLPGVLDQ  391



>ref|XP_004976401.1| PREDICTED: probable receptor-like protein kinase At1g33260-like 
[Setaria italica]
Length=352

 Score =   243 bits (621),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 134/274 (49%), Positives = 183/274 (67%), Gaps = 21/274 (8%)
 Frame = -2

Query  807  KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSK  628
            +AE+    +AR+L   EV+  T  FS SRV+  GGFSTVYL   P S LGA+K+   SS+
Sbjct  38   EAEEQGGGAARQLAWAEVEAATRGFS-SRVVGRGGFSTVYLASLPSSRLGAVKV-SCSSE  95

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV  448
            RLH  +++ELE+L  +RH  +V++LGY D+   +EGVLVFEY PNG L E+LHG+G G+ 
Sbjct  96   RLHRAFRRELEVLLSLRHPYVVRLLGYCDER--DEGVLVFEYAPNGDLHERLHGDGDGAA  153

Query  447  --LPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGF  274
               PW  R+ +A Q+A  LEYLH+  D  ++HGD+K SN+LLD+ LN KLCD+G A +G 
Sbjct  154  GAFPWERRVAVALQVAAALEYLHEGRDQAVIHGDIKASNVLLDANLNAKLCDFGFAHVGV  213

Query  273  SSTVQP---PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
            S+TV     PS+ A           + GSPGY DPH LR+G+ATKKSD+YS GV+LLEL+
Sbjct  214  SATVGGGGRPSARA-----------VMGSPGYVDPHLLRSGVATKKSDVYSFGVLLLELL  262

Query  102  TGLEAVSSDSNVRLISKAGPMLKDESKVAGMVDR  1
            TG EAV  ++  RL +  GP +    KV+ ++D+
Sbjct  263  TGKEAVCRETGHRLTAAVGPKVSG-GKVSDVMDQ  295



>ref|NP_001048733.1| Os03g0113000 [Oryza sativa Japonica Group]
 gb|AAO17012.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF93617.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10647.1| Os03g0113000 [Oryza sativa Japonica Group]
 gb|EAY88255.1| hypothetical protein OsI_09707 [Oryza sativa Indica Group]
 gb|EAZ25334.1| hypothetical protein OsJ_09146 [Oryza sativa Japonica Group]
 dbj|BAG92424.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96592.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86647.1| unnamed protein product [Oryza sativa Japonica Group]
Length=343

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 172/250 (69%), Gaps = 14/250 (6%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            SAR+L+  +V+ +T  F+ S V+  GGFSTVYLG+    SL A+K+   SS+RL   ++Q
Sbjct  47   SARQLSWAQVEAMTRGFT-SAVVGEGGFSTVYLGRVA-GSLAAVKV-HRSSERLQRAFRQ  103

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMG  424
            EL+ L R+RH +IV++L + D    +EGVLV E+ PNG L E+LHG GGG  +PW  R+ 
Sbjct  104  ELDALLRVRHPHIVRLLAFCDQR--DEGVLVLEFAPNGNLHEQLHGGGGGGAMPWARRVA  161

Query  423  IAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSST  244
            +A Q+A+ LEYLHD+C+PQ+VHGD+K SN+LLD+ +  +LCD+GSA+ GFS+ V  P   
Sbjct  162  VALQVARALEYLHDRCEPQVVHGDVKSSNVLLDAAMGARLCDFGSARAGFSAAVHCPRPR  221

Query  243  ATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVR  64
             +A A       + GSPGY DPHYLR+G+ TKKSD+YS GV+LLEL+TG +A      + 
Sbjct  222  PSALA-------VLGSPGYVDPHYLRSGVVTKKSDVYSFGVLLLELLTGTQAFR--DGML  272

Query  63   LISKAGPMLK  34
            L +   P LK
Sbjct  273  LTAAVAPKLK  282



>gb|ACG30302.1| leucine-rich repeat receptor protein kinase EXS precursor [Zea 
mays]
Length=350

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 173/259 (67%), Gaps = 16/259 (6%)
 Frame = -2

Query  801  EKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSS-LGAIKIIDTSSKR  625
            E +   + R+L   EV+  T  FS S+V+  GGFSTVYL   P SS LGA+K+   SS+R
Sbjct  41   EAEDSGATRQLAWAEVEAATGGFS-SKVVGRGGFSTVYLASLPTSSRLGAVKV-HCSSER  98

Query  624  LHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGG-SV  448
            LH  +++EL++L  +RH ++V++LGY D+   +EG LVFEY PNG L E+LHG   G  V
Sbjct  99   LHRAFRRELDVLLSLRHPHVVRLLGYCDER--DEGALVFEYAPNGDLHERLHGGAAGVQV  156

Query  447  LPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSS  268
            LPW  R+ +AFQ+A  LEYLH+  DP +VHGD+K SN+LLD+ ++ +LCD+G A +G ++
Sbjct  157  LPWARRVAVAFQVATALEYLHEGRDPAVVHGDVKASNVLLDAGMDARLCDFGFAHVGVAA  216

Query  267  TVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEA  88
            T+            +R +M   GSPGY DPH LR+G+ TKKSD+YS GV+LLEL+TG EA
Sbjct  217  TM-------GGRPSDRAVM---GSPGYVDPHLLRSGVPTKKSDVYSFGVLLLELLTGKEA  266

Query  87   VSSDSNVRLISKAGPMLKD  31
            V  ++  RL +   P L D
Sbjct  267  VCRETGHRLTAAVRPKLSD  285



>ref|XP_002465996.1| hypothetical protein SORBIDRAFT_01g049750 [Sorghum bicolor]
 gb|EER92994.1| hypothetical protein SORBIDRAFT_01g049750 [Sorghum bicolor]
Length=365

 Score =   243 bits (620),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 167/232 (72%), Gaps = 12/232 (5%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            +AR+L+  +V+ +T  F+ S V+  GGFSTVYL +    SL A+K+   SS+RLH  ++Q
Sbjct  56   TARQLSWAQVEAMTGGFT-SAVVGEGGFSTVYLARLA-GSLAAVKV-HRSSERLHRAFRQ  112

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMG  424
            EL+ L R+RH +IV++LG+ D    +EGVLV E+ PNG L E+LHG G    +PW  R+ 
Sbjct  113  ELDALLRVRHPHIVRLLGFCDQR--DEGVLVLEFAPNGNLHEQLHG-GAAPTMPWARRVS  169

Query  423  IAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSST  244
            +A Q+A+ LEYLH++C+PQ+VHGD+K SN+LLD+ +  +LCD+GSA+ GFS+ V      
Sbjct  170  VALQVARALEYLHERCEPQVVHGDVKASNVLLDAGMGARLCDFGSARAGFSAAV-----V  224

Query  243  ATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEA  88
            A   A+ R +  + GSPGY DPHYLR+G+ TKKSD+YS GV+LLEL+TG++A
Sbjct  225  ARPGARPR-VRAVLGSPGYVDPHYLRSGVVTKKSDVYSFGVLLLELLTGVQA  275



>ref|XP_006842885.1| hypothetical protein AMTR_s00075p00012310 [Amborella trichopoda]
 gb|ERN04560.1| hypothetical protein AMTR_s00075p00012310 [Amborella trichopoda]
Length=336

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 136/278 (49%), Positives = 187/278 (67%), Gaps = 28/278 (10%)
 Frame = -2

Query  843  AFGCL-----GRKSR--RRKAEKDTKESA----RRLTRKEVQKLTVDFSRSRVIAFGGFS  697
             F C      G+K+R   R A K+ +E A    RR + +EV+++T +FS   VI  GGFS
Sbjct  3    CFACFRVRNKGKKNRGGERVAPKEEEEIAGEVVRRFSWREVEEMTKNFSC--VIGEGGFS  60

Query  696  TVYLGKFPDSSL--GAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDD-EGVE  526
            TVYLG     SL  GA+K+   +S+R++ +++QELE+L  +RH+NIVK LGY D+ +  +
Sbjct  61   TVYLGFLCSDSLDHGAVKV-HRNSERMNRVFRQELEVLMDVRHENIVKFLGYCDECDEKD  119

Query  525  EGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLK  346
            EG L+FEYVPNG+L + LH     + LPW++R  IA  LA+ +E++HD+C   IVH D+K
Sbjct  120  EGALIFEYVPNGSLHDHLHT--LSTPLPWQSRTSIALNLARAIEFIHDRCTKHIVHCDVK  177

Query  345  GSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLR  166
             SN+LLD  LN KLCD+GSA++GFSSTV         T + R    + GSPGY DPHYLR
Sbjct  178  PSNVLLDQNLNPKLCDFGSARVGFSSTV-------LNTCEGRR-APVVGSPGYVDPHYLR  229

Query  165  TGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISK  52
            TGI +KK+D+YS GV+LLELITG+EA  S+   RL++K
Sbjct  230  TGIISKKNDVYSFGVLLLELITGIEAFCSEKG-RLLAK  266



>ref|XP_002489042.1| hypothetical protein SORBIDRAFT_0283s002010 [Sorghum bicolor]
 gb|EES20448.1| hypothetical protein SORBIDRAFT_0283s002010 [Sorghum bicolor]
Length=361

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 125/262 (48%), Positives = 177/262 (68%), Gaps = 17/262 (6%)
 Frame = -2

Query  780  ARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQE  601
            AR+L   EV+  T  FS S+V+  GGFSTVYL     S LGA+K+   SS+RLH  +++E
Sbjct  58   ARQLAWAEVETATGGFS-SKVVGRGGFSTVYLASLSSSRLGAVKV-HCSSERLHRAFRRE  115

Query  600  LEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGI  421
            L++L  +RH +IV++LGY D+   +EGVLVFEY PNG L + LHG+GG  VLPW  R+ +
Sbjct  116  LDVLLSLRHPHIVRLLGYCDER--DEGVLVFEYAPNGDLHDALHGHGG--VLPWARRVAV  171

Query  420  AFQLAQVLEYLHDKCDPQ--IVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSS  247
            A Q+A  LEYLH+  DP   ++HGD+K SN+LLD+ ++ KLCD+G A +G S+T+     
Sbjct  172  ALQVATALEYLHEGRDPAPAVIHGDIKASNVLLDANMDAKLCDFGFAHVGVSATM-----  226

Query  246  TATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNV  67
                  +  +   + GSPGY DPH LR+G+AT+KSD+YS GV+LLEL+TG EAV  ++  
Sbjct  227  ---GGGRRPSDRAVMGSPGYVDPHLLRSGVATRKSDVYSFGVLLLELLTGKEAVCRETGH  283

Query  66   RLISKAGPMLKDESKVAGMVDR  1
            RL +   P L D  +V+ ++D+
Sbjct  284  RLTAAVRPQLGD-GQVSDVLDQ  304



>ref|XP_006849213.1| hypothetical protein AMTR_s00027p00225540 [Amborella trichopoda]
 gb|ERN10794.1| hypothetical protein AMTR_s00027p00225540 [Amborella trichopoda]
Length=340

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 178/261 (68%), Gaps = 18/261 (7%)
 Frame = -2

Query  828  GRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSL--GA  655
            G +   ++ E+   E  RR + ++V+++T +FS   VI  GGFSTVYLG     SL  GA
Sbjct  19   GERVAPKEEEEVAGELVRRFSWRDVEEMTRNFSC--VIGEGGFSTVYLGYLCSDSLDHGA  76

Query  654  IKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEK  475
            +K+    S+R+  +++QELE+L  +RH+NIVK LGY D++  +EG L+FEYVPNGTL + 
Sbjct  77   VKV-HRESERMKRVFRQELEVLMDVRHENIVKFLGYCDEK--DEGALIFEYVPNGTLHDH  133

Query  474  LHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDY  295
            LH     + LPW++R  IA  LA+ +E++HD+C   IVH D+K SN+LLD  LN KLCD+
Sbjct  134  LHT--LSTPLPWQSRTSIALNLARAIEFIHDRCTKHIVHCDVKPSNVLLDQNLNPKLCDF  191

Query  294  GSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVIL  115
            GSA++GFSST+         T + R    + GSPGY DPHYLRTGI +KK+D+YS GV+L
Sbjct  192  GSARVGFSSTI-------LNTCEGRR-APVVGSPGYVDPHYLRTGIISKKNDVYSFGVLL  243

Query  114  LELITGLEAVSSDSNVRLISK  52
            LELITG+EA  S+   RL++K
Sbjct  244  LELITGIEAFCSEKG-RLLAK  263



>ref|NP_001151054.1| receptor protein kinase CRINKLY4 [Zea mays]
 gb|ACG41432.1| receptor protein kinase CRINKLY4 precursor [Zea mays]
 gb|AFW89823.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=362

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 169/236 (72%), Gaps = 13/236 (6%)
 Frame = -2

Query  792  TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTM  613
            T  +AR+L+  +V+ +T  F+ S ++  GGFSTVYL +    SL A+K+   SS+RLH  
Sbjct  56   TTANARQLSWAQVEAMTGGFT-SAIVGEGGFSTVYLARLA-GSLAAVKV-HRSSERLHRA  112

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV-LPWR  436
            ++QEL+ L R+RH +IV++L + D    +EGVLV E+ PNG+L E+LHG G G+  +PW 
Sbjct  113  FRQELDALLRVRHPHIVRLLAFCDQR--DEGVLVLEFAPNGSLHEQLHGGGAGAAPMPWA  170

Query  435  NRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP  256
             R+ +A Q+A+ LEYLH++C+PQ+VHGD+K SN+LLD+ +  +LCD+GSA+ GFS+ V  
Sbjct  171  RRVPVALQVARALEYLHERCEPQVVHGDVKASNVLLDAGMGARLCDFGSARAGFSAAVAV  230

Query  255  PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEA  88
             ++     A       +FGSPGY DPHYLR+G+ TKKSD+YS GV+LLEL+TG++A
Sbjct  231  AAAGPRPRA-------VFGSPGYVDPHYLRSGVVTKKSDVYSFGVLLLELLTGVQA  279



>ref|XP_008801797.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Phoenix 
dactylifera]
Length=398

 Score =   239 bits (610),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 134/267 (50%), Positives = 175/267 (66%), Gaps = 24/267 (9%)
 Frame = -2

Query  792  TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPD--SSLGAIKIIDTSSKRLH  619
            TKE+ RR    EV+ LT +F+ + VI  GGFSTVYL   P   SSL A+K++  S +RLH
Sbjct  92   TKEAVRRYGWPEVESLTGNFT-AEVIGEGGFSTVYLACLPGAASSLAAVKVL-RSGERLH  149

Query  618  TMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPW  439
              + QEL++L+R+ H  IV++LG+ DD   EEGVLV EYVP+G+L EKLHG G    L W
Sbjct  150  RAFLQELDVLRRLSHPRIVRLLGFCDDR--EEGVLVLEYVPSGSLHEKLHGGG---ALAW  204

Query  438  RNRMGIAFQLAQVLEYLHDKC-DPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTV  262
              RM IA+++A  +EYLH+   +  IVHGD+  SN+LLDS L+ KLCD+GSA+ GFSS V
Sbjct  205  ARRMRIAYEVAGAVEYLHEGSGELPIVHGDITASNVLLDSRLDPKLCDFGSARAGFSSAV  264

Query  261  QPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVS  82
                         R+   M GSPGY DPHYLRTG+ +K +D+YS GV+LL LITGL AV 
Sbjct  265  -------------RSAGPMVGSPGYADPHYLRTGMVSKSTDVYSFGVLLLVLITGLPAVG  311

Query  81   SDSNVRLISKAGPMLKD-ESKVAGMVD  4
            S+    L  + GP L++ E K   +VD
Sbjct  312  SEEGRVLTVEMGPRLREAEGKAWEVVD  338



>ref|XP_010229317.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Brachypodium 
distachyon]
Length=350

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 166/264 (63%), Gaps = 23/264 (9%)
 Frame = -2

Query  795  DTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHT  616
            D   + R+LT  EV+ +T +F+ S V+  GG STVYLG+ P   L A+K+    S+RL  
Sbjct  24   DKGGAVRQLTWAEVEAMTGNFT-SAVVGEGGSSTVYLGRLPAQQLAAVKV-HRGSQRLRR  81

Query  615  MYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHG----NGGGS-  451
             ++ EL  L R RH +IV++L + D    +EGVLV E  PNG+L + LHG     GGG+ 
Sbjct  82   AFRHELHALLRARHPHIVRLLAFCDQ--TDEGVLVLELAPNGSLHDHLHGINYPQGGGAS  139

Query  450  -----VLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSA  286
                  +PW  R+ +A Q+A+ LEYLH+ C+PQ+VHGD+K SN+LLD+ ++ +LCD+GSA
Sbjct  140  SPGPVPMPWAWRLRVALQVARALEYLHEACEPQVVHGDVKASNVLLDAAMDARLCDFGSA  199

Query  285  KMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLEL  106
              GFS++V+P S              M GSPGY DPHYLR+G+ TKKSD+YS GV+LLEL
Sbjct  200  HAGFSASVRPTSPRGG---------VMVGSPGYVDPHYLRSGLVTKKSDVYSFGVLLLEL  250

Query  105  ITGLEAVSSDSNVRLISKAGPMLK  34
            +TG      D    L S   P++K
Sbjct  251  LTGAPPFRVDDGRLLTSLVAPVIK  274



>ref|XP_004986014.1| PREDICTED: probable receptor-like protein kinase At1g33260-like 
[Setaria italica]
Length=365

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 180/265 (68%), Gaps = 15/265 (6%)
 Frame = -2

Query  783  SARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQ  604
            SAR+L+  +V+ +T  F+ S V+  GGFSTVYL +    SL A+K+   SS+RLH  ++Q
Sbjct  52   SARQLSWAQVEAMTGGFT-SAVVGEGGFSTVYLARLA-GSLAAVKV-HRSSERLHRAFRQ  108

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGS-VLP--WRN  433
            EL+ L R+RH +IV++L + D    +EGVLV E+ PNG L ++LHG GGG   +P  W  
Sbjct  109  ELDALLRVRHPHIVRLLAFCDQR--DEGVLVLEFAPNGNLHDQLHGGGGGKGAVPMLWAR  166

Query  432  RMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPP  253
            R+ +A Q+A+ LEYLHD+C+PQ+VHGD+K SN+LLD+ +  +LCD+GSA+ GFS+ V   
Sbjct  167  RVSVALQVARALEYLHDRCEPQVVHGDVKASNVLLDAAMGARLCDFGSARAGFSAAVAGA  226

Query  252  SSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDS  73
            S     +A  R ++   GSPGY DPHYLR+G+ TKKSD+YS GV+LLEL+TG++A     
Sbjct  227  SPRPRPSASARAVL---GSPGYVDPHYLRSGVVTKKSDVYSFGVLLLELLTGVQAF---C  280

Query  72   NVRLISKA-GPMLKDESKVAGMVDR  1
            + RL++ A  P +        +VD+
Sbjct  281  DGRLLTAAVAPRISAACDAGELVDQ  305



>gb|KCW72673.1| hypothetical protein EUGRSUZ_E01129 [Eucalyptus grandis]
Length=297

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 166/241 (69%), Gaps = 17/241 (7%)
 Frame = -2

Query  687  LGKFPDSSLGA------IKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVE  526
            +G+FP    G+      +K+     +RL   +KQEL++L ++ H+NIV++LGY DD G  
Sbjct  1    MGRFPGCGGGSTAAAAAVKVHCGGGERLSMAFKQELDVLLQLEHENIVRLLGYCDDAGA-  59

Query  525  EGVLVFEYVPNGTLQEKLHGNGGG--SVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGD  352
               L+FEYV  GTL E+LHG+G    S LPW++R+ IAFQLAQ +E+LH++C   I+HGD
Sbjct  60   ---LIFEYVSGGTLHERLHGSGSNKRSTLPWKSRVKIAFQLAQAIEHLHERCTLHIIHGD  116

Query  351  LKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHY  172
            +K SN+LLD + +CKLCD+GSAKMGFSS + PPSS  +++   R    + GSPGYTDP Y
Sbjct  117  IKSSNVLLDGDSDCKLCDFGSAKMGFSSMIPPPSSLPSSSPYVRRKNIIMGSPGYTDPAY  176

Query  171  LRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLK-----DESKVAGMV  7
            LRTGIA+KK+DIYS GV++LEL+TGLEA  +D  + L S A  M K     D S+V  MV
Sbjct  177  LRTGIASKKNDIYSFGVLVLELVTGLEAFRADKGLVLASMAAHMTKDVDRMDVSEVTNMV  236

Query  6    D  4
            D
Sbjct  237  D  237



>ref|XP_009407855.1| PREDICTED: probable receptor-like protein kinase At1g33260 [Musa 
acuminata subsp. malaccensis]
Length=383

 Score =   231 bits (589),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 172/264 (65%), Gaps = 21/264 (8%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRL-HTMYKQE  601
            RR   +EV+ L  D + + VI  GGFSTVYL + PDS+L A+K+       L    ++QE
Sbjct  70   RRHRWQEVEALLGDRAAAAVIGEGGFSTVYLARLPDSTLAALKVYAGGGGELPRRAFRQE  129

Query  600  LEILQRIRHDNIVKVLGYSDDEGVEE--GVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRM  427
            L++L R+RH  IV++L YSDD   ++  GVL+ EYVPNGTL EKLHG  GGS LPW  R 
Sbjct  130  LDVLLRLRHPRIVRLLAYSDDREEDDDEGVLMLEYVPNGTLHEKLHG--GGSTLPWAART  187

Query  426  GIAFQLAQVLEYLHDKCDPQ--IVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPP  253
             +A+++A  +EYLHD       IVHGDL  +N+LL  +L  KLCD+GSA++GFS+ V+P 
Sbjct  188  RVAYEVAGAVEYLHDGGGSSLPIVHGDLTTANVLLHVDLGPKLCDFGSARVGFSAAVRPA  247

Query  252  SSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDS  73
            +              + GSPGYTDPHYLRTGIA+KK+D+YS GV+LLEL+TG  AV S+ 
Sbjct  248  AP-------------VVGSPGYTDPHYLRTGIASKKTDVYSFGVLLLELLTGRPAVGSEG  294

Query  72   NVRLISKAGPMLKDE-SKVAGMVD  4
             + L +   P L+   S VA +VD
Sbjct  295  GMTLAAAMAPRLRGAGSGVAEVVD  318



>ref|XP_003580246.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Brachypodium 
distachyon]
Length=368

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 165/256 (64%), Gaps = 12/256 (5%)
 Frame = -2

Query  759  EVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIID-TSSKRLHTMYKQELEILQR  583
            EV+  T  FS  RVI  GGFSTVYL     S LGA+K++    S+R    ++QEL++L  
Sbjct  60   EVESATGSFS-FRVIGRGGFSTVYLAALSSSRLGAVKVVQHCGSERHSRAFRQELDVLLT  118

Query  582  IRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGG-GSVLPWRNRMGIAFQLA  406
            +RH ++V++LGY+ DE  +EGVLVFEY PNG L E LHG G   ++LPW  R+ IAFQ+ 
Sbjct  119  LRHPHVVRLLGYNCDE-RDEGVLVFEYAPNGDLHESLHGRGADNALLPWPRRVAIAFQVG  177

Query  405  QVLEYLHDKCDPQ--IVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATAT  232
              LEYLHD+   +  I+HGD+K SN+LLD+ ++ KLCD+G A+   SS            
Sbjct  178  MALEYLHDESSSREVIIHGDIKASNVLLDANMDAKLCDFGFAQS--SSGGVKAHRAGGGR  235

Query  231  AKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISK  52
               R +M   GSPGY DPH LRTG+A+K SD+YS GV+LLEL++G EAV  ++  RL   
Sbjct  236  PSGRAIM---GSPGYVDPHLLRTGVASKASDVYSFGVLLLELVSGREAVCRETGRRLTQV  292

Query  51   AGPMLKDESKVAGMVD  4
             GP +  E KVA +VD
Sbjct  293  VGPAVS-EGKVADVVD  307



>emb|CDY25254.1| BnaA02g22020D [Brassica napus]
Length=255

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 130/179 (73%), Gaps = 7/179 (4%)
 Frame = -2

Query  567  IVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYL  388
            IVK+LGY DD   E G L+ EY+P G LQE LH N    VLPWRNR+ IAFQL Q +E++
Sbjct  9    IVKLLGYFDDSE-ENGALLLEYLPQGNLQENLHSNSK-QVLPWRNRVAIAFQLVQAIEHI  66

Query  387  HDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMT  208
            H+KC PQIVHGD+K SN+LLD   N KLCD+GSAK+GFSS VQP     +A +     +T
Sbjct  67   HEKCIPQIVHGDIKSSNVLLDKNFNSKLCDFGSAKVGFSSMVQP-----SAISPRSRHVT  121

Query  207  MFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKD  31
            M GSPGYTDPHYLRTG+A+KK D+Y  GV++LELI+G EA+S+ +   L+  A P++ +
Sbjct  122  MVGSPGYTDPHYLRTGVASKKMDMYGFGVVVLELISGKEALSAGNGEMLVHVAAPLMHE  180



>ref|XP_010934611.1| PREDICTED: probable receptor-like protein kinase At4g10390 [Elaeis 
guineensis]
Length=363

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 172/267 (64%), Gaps = 26/267 (10%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYL----GKFPDSSLGAIKIIDTSSKRLHTMY  610
            RR    EV+ LT +F+ + VI  GGFS VYL    G    SSL A+K+   S +RLH  +
Sbjct  45   RRYGWLEVESLTGNFTAA-VIGEGGFSIVYLARLTGAAAPSSLAAVKV-HRSGERLHRAF  102

Query  609  KQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWR--  436
             QEL++L R+RH  IV++LG+ DD   EEGVLV EYVPNG+L EKL G GGG        
Sbjct  103  LQELDVLIRLRHPRIVRLLGFCDDR--EEGVLVLEYVPNGSLHEKLRGGGGGDGGAALGW  160

Query  435  -NRMGIAFQLAQVLEYLHDKC-DPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTV  262
              RM IA+++A  +EYLHD C +  IVHGD+  +N+LLD  L+ KLCD+GSA+ GFSS V
Sbjct  161  ARRMWIAYEVAGAVEYLHDGCGELPIVHGDITTANVLLDDGLDPKLCDFGSARAGFSSAV  220

Query  261  QPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVS  82
                         R+   M GSPGY DPHYLRTG+ +K +D+YS GV+LLELITGL AV 
Sbjct  221  -------------RSAGPMIGSPGYADPHYLRTGMVSKSTDVYSFGVLLLELITGLPAVG  267

Query  81   SDSNVRLISKAGPMLKDESK-VAGMVD  4
            S     L ++ GP+L+++ + VA +VD
Sbjct  268  SGEGRVLTAEMGPLLREDGRAVAEVVD  294



>dbj|BAJ89188.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=347

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 171/253 (68%), Gaps = 20/253 (8%)
 Frame = -2

Query  780  ARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSS-LGAIKIIDTSSKRLHTMYKQ  604
            AR+L+  +V+ +T  F+ S V+  GGFSTVYL +   SS L A+K+   SS+RL   ++Q
Sbjct  40   ARQLSWAQVEAMTAGFT-SAVVGEGGFSTVYLARLAGSSQLAAVKV-HRSSERLRRAFRQ  97

Query  603  ELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGG--SVLPWRNR  430
            EL+ L R+RH +IV++L + D    +EGVLV E+ PNG+L + LH +       LPW  R
Sbjct  98   ELDALLRVRHPHIVRLLAFCDQR--DEGVLVLEFAPNGSLHDHLHASKASVSPPLPWARR  155

Query  429  MGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPS  250
              +A Q+A+ LEYLHD+C+PQ+VHGD+K SN+LLD+ +  +LCD+GSA+ GFS       
Sbjct  156  AAVALQVARALEYLHDRCEPQVVHGDVKASNVLLDAAMGARLCDFGSARAGFS------G  209

Query  249  STATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSN  70
            S A A    R ++   GSPGY DPHYLR+G+ TKKSD+YSLGV+LLEL+TG +     S+
Sbjct  210  SAAVAVRPPRAVL---GSPGYVDPHYLRSGVLTKKSDVYSLGVLLLELLTGTQPF---SD  263

Query  69   VRLISKA-GPMLK  34
             RL++ A  PM+K
Sbjct  264  GRLLTSAVAPMIK  276



>ref|XP_006649258.1| PREDICTED: probable receptor-like protein kinase At1g33260-like 
[Oryza brachyantha]
Length=322

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/273 (43%), Positives = 169/273 (62%), Gaps = 38/273 (14%)
 Frame = -2

Query  807  KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSK  628
            +  K+   SAR+L+  +V+ +T  F+ S V+  GGFSTVYL +    SL A+K+   SS+
Sbjct  36   RQSKNAATSARQLSWAQVEAMTRGFT-SAVVGEGGFSTVYLARVA-GSLAAVKV-HRSSE  92

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHG--NGGG  454
            RL   ++QEL+ L R+RH +IV++L + D    +EGVLV E+ PNG L ++LHG  +G G
Sbjct  93   RLQRAFRQELDALLRVRHPHIVRLLAFCDQR--DEGVLVLEFAPNGNLHDQLHGGESGKG  150

Query  453  SVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGF  274
             V+PW  R+ +A Q+A+ LEYLHD+C+PQ+VHGD+K SN+LL++                
Sbjct  151  GVMPWARRVAVALQVARALEYLHDRCEPQVVHGDVKSSNVLLEA----------------  194

Query  273  SSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGL  94
               V  P    +A A       + GSPGY DPHYLR+G+ TKKSD+YS GV+LLEL+TG 
Sbjct  195  ---VHCPRPRPSALA-------VLGSPGYVDPHYLRSGVVTKKSDVYSYGVLLLELLTGT  244

Query  93   EAVSSDSNVRLISKA-GPMLK-DESKVAGMVDR  1
            +A       RL++ A  P L+ D   V  +VD+
Sbjct  245  QAFCDG---RLLTAAVAPKLRADPFDVQRLVDQ  274



>gb|EMT15653.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=337

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 142/217 (65%), Gaps = 13/217 (6%)
 Frame = -2

Query  648  IIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH  469
            ++  SS+RLH  ++QEL++L  +RH +IV++LGY D+   +EGVLVFEY PNG L ++LH
Sbjct  73   LVHCSSERLHRAFRQELDVLLSLRHPHIVRLLGYCDER--DEGVLVFEYAPNGDLHQRLH  130

Query  468  G-NGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYG  292
            G     + LPW  R+ IAFQ+A  LEYLH+   P +VHGD+K SN+LLD  ++ KLCD+G
Sbjct  131  GGEDAAAPLPWSRRVAIAFQVATALEYLHEGSGPAVVHGDIKASNVLLDGNMDAKLCDFG  190

Query  291  SAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILL  112
             A  G S+T     S+  A         + GSPGY DP  LRTG+A ++SD+YS GV+LL
Sbjct  191  FAHSGVSATAGRGRSSGRA---------IMGSPGYVDPQLLRTGVANEQSDVYSFGVLLL  241

Query  111  ELITGLEAVSSDSNVRLISKAGPMLKDESKVAGMVDR  1
            EL+TG EAV  ++  RL +   P +  +  VA  VDR
Sbjct  242  ELVTGREAVCRETGRRLTAVVCPTIS-KGNVADAVDR  277



>gb|AFW89822.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=413

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 146/214 (68%), Gaps = 13/214 (6%)
 Frame = -2

Query  792  TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTM  613
            T  +AR+L+  +V+ +T  F+ S ++  GGFSTVYL +    SL A+K+   SS+RLH  
Sbjct  56   TTANARQLSWAQVEAMTGGFT-SAIVGEGGFSTVYLARL-AGSLAAVKV-HRSSERLHRA  112

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV-LPWR  436
            ++QEL+ L R+RH +IV++L + D    +EGVLV E+ PNG+L E+LHG G G+  +PW 
Sbjct  113  FRQELDALLRVRHPHIVRLLAFCDQR--DEGVLVLEFAPNGSLHEQLHGGGAGAAPMPWA  170

Query  435  NRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP  256
             R+ +A Q+A+ LEYLH++C+PQ+VHGD+K SN+LLD+ +  +LCD+GSA+ GF      
Sbjct  171  RRVPVALQVARALEYLHERCEPQVVHGDVKASNVLLDAGMGARLCDFGSARAGF------  224

Query  255  PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIA  154
             S+     A       +FGSPGY DPHYLR+G++
Sbjct  225  -SAAVAVAAAGPRPRAVFGSPGYVDPHYLRSGVS  257



>gb|AFW89816.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=506

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 146/214 (68%), Gaps = 13/214 (6%)
 Frame = -2

Query  792  TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTM  613
            T  +AR+L+  +V+ +T  F+ S ++  GGFSTVYL +    SL A+K+   SS+RLH  
Sbjct  56   TTANARQLSWAQVEAMTGGFT-SAIVGEGGFSTVYLARL-AGSLAAVKV-HRSSERLHRA  112

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV-LPWR  436
            ++QEL+ L R+RH +IV++L + D    +EGVLV E+ PNG+L E+LHG G G+  +PW 
Sbjct  113  FRQELDALLRVRHPHIVRLLAFCDQR--DEGVLVLEFAPNGSLHEQLHGGGAGAAPMPWA  170

Query  435  NRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP  256
             R+ +A Q+A+ LEYLH++C+PQ+VHGD+K SN+LLD+ +  +LCD+GSA+ GF      
Sbjct  171  RRVPVALQVARALEYLHERCEPQVVHGDVKASNVLLDAGMGARLCDFGSARAGF------  224

Query  255  PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIA  154
             S+     A       +FGSPGY DPHYLR+G++
Sbjct  225  -SAAVAVAAAGPRPRAVFGSPGYVDPHYLRSGVS  257



>ref|XP_002453132.1| hypothetical protein SORBIDRAFT_04g000660 [Sorghum bicolor]
 gb|EES06108.1| hypothetical protein SORBIDRAFT_04g000660 [Sorghum bicolor]
Length=405

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 117/273 (43%), Positives = 156/273 (57%), Gaps = 19/273 (7%)
 Frame = -2

Query  804  AEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIID-TSSK  628
            A K   +  RRL  +EV+ LT  F  + V+  GG STVYL +  D S  A+K+      +
Sbjct  78   AVKKEAQVPRRLAWREVEALTGGFDEAAVVGRGGSSTVYLARLMDGSPVAVKVHRWCGGE  137

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGS-  451
            R    ++QEL++L+R+RH NIV +L YSDD   EEG LV EY+  GTL + LHG   G+ 
Sbjct  138  RRLRAFRQELDLLRRLRHPNIVALLAYSDDH-EEEGALVLEYLAGGTLADALHGATAGTA  196

Query  450  -VLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGF  274
             +L W  RM I   +A  LE+LHD     +VHGD+  SN+LLD     +LCD GSA  GF
Sbjct  197  PLLSWAQRMRILHDVACALEHLHDGGSTAVVHGDVSASNVLLDGGGGARLCDLGSACEGF  256

Query  273  SSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGL  94
            S+ V P  +T              GSPGY DP +LRTGI + KSD+Y  GV+LLE +TGL
Sbjct  257  SAAVAPARAT-----------VAVGSPGYADPFFLRTGIVSSKSDVYGFGVLLLEAVTGL  305

Query  93   EAVSSD---SNVRLISKAGPMLKDESKVAGMVD  4
             A   +   S   L ++  P ++    VAG+VD
Sbjct  306  PAAGGEEAASGENLTARIVPRVRARG-VAGLVD  337



>gb|AFW89817.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=534

 Score =   206 bits (523),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 146/214 (68%), Gaps = 13/214 (6%)
 Frame = -2

Query  792  TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTM  613
            T  +AR+L+  +V+ +T  F+ S ++  GGFSTVYL +    SL A+K+   SS+RLH  
Sbjct  56   TTANARQLSWAQVEAMTGGFT-SAIVGEGGFSTVYLARL-AGSLAAVKV-HRSSERLHRA  112

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV-LPWR  436
            ++QEL+ L R+RH +IV++L + D    +EGVLV E+ PNG+L E+LHG G G+  +PW 
Sbjct  113  FRQELDALLRVRHPHIVRLLAFCDQR--DEGVLVLEFAPNGSLHEQLHGGGAGAAPMPWA  170

Query  435  NRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP  256
             R+ +A Q+A+ LEYLH++C+PQ+VHGD+K SN+LLD+ +  +LCD+GSA+ GF      
Sbjct  171  RRVPVALQVARALEYLHERCEPQVVHGDVKASNVLLDAGMGARLCDFGSARAGF------  224

Query  255  PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIA  154
             S+     A       +FGSPGY DPHYLR+G++
Sbjct  225  -SAAVAVAAAGPRPRAVFGSPGYVDPHYLRSGVS  257



>gb|KCW80121.1| hypothetical protein EUGRSUZ_C01451 [Eucalyptus grandis]
Length=288

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/241 (46%), Positives = 156/241 (65%), Gaps = 28/241 (12%)
 Frame = -2

Query  687  LGKFPDSSLGA------IKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVE  526
            +G+FP    G+      +K+     +RL   +KQEL++L ++ H+NIVK+LGY DD   +
Sbjct  1    MGRFPGCGGGSTAAAAAVKVHCGGGERLSMAFKQELDVLLQLEHENIVKLLGYCDD--AD  58

Query  525  EGVLVFEYVPNGTLQEKLHGNGGG--SVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGD  352
            +G L+FEYV  GTL E+LHG+G    S LPW++R+ IAFQLAQ +E+LH++C   I+HGD
Sbjct  59   QGALIFEYVSGGTLHERLHGSGSNKRSTLPWKSRVKIAFQLAQAIEHLHERCTLHIIHGD  118

Query  351  LKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHY  172
            +K SN+LLD + +CKLCD+GSAKMGFSS + PPSS  +++              Y     
Sbjct  119  IKSSNVLLDGDSDCKLCDFGSAKMGFSSMIPPPSSLPSSSP-------------YVRRKN  165

Query  171  LRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLK-----DESKVAGMV  7
            +  GIA+KK+DIYS GV++LEL+TGLEA  +D  + L S A  M K     D S+V  MV
Sbjct  166  IIMGIASKKNDIYSFGVLVLELVTGLEAFRADKGLVLASMAAHMTKDVDRMDVSEVTNMV  225

Query  6    D  4
            D
Sbjct  226  D  226



>gb|AFW89821.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=626

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 149/214 (70%), Gaps = 13/214 (6%)
 Frame = -2

Query  792  TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTM  613
            T  +AR+L+  +V+ +T  F+ S ++  GGFSTVYL +    SL A+K+   SS+RLH  
Sbjct  56   TTANARQLSWAQVEAMTGGFT-SAIVGEGGFSTVYLARLA-GSLAAVKV-HRSSERLHRA  112

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV-LPWR  436
            ++QEL+ L R+RH +IV++L + D    +EGVLV E+ PNG+L E+LHG G G+  +PW 
Sbjct  113  FRQELDALLRVRHPHIVRLLAFCDQR--DEGVLVLEFAPNGSLHEQLHGGGAGAAPMPWA  170

Query  435  NRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP  256
             R+ +A Q+A+ LEYLH++C+PQ+VHGD+K SN+LLD+ +  +LCD+GSA+ GFS+ V  
Sbjct  171  RRVPVALQVARALEYLHERCEPQVVHGDVKASNVLLDAGMGARLCDFGSARAGFSAAVAV  230

Query  255  PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIA  154
             ++     A       +FGSPGY DPHYLR+G++
Sbjct  231  AAAGPRPRA-------VFGSPGYVDPHYLRSGVS  257



>gb|AFW89818.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=709

 Score =   206 bits (524),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 149/214 (70%), Gaps = 13/214 (6%)
 Frame = -2

Query  792  TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTM  613
            T  +AR+L+  +V+ +T  F+ S ++  GGFSTVYL +    SL A+K+   SS+RLH  
Sbjct  56   TTANARQLSWAQVEAMTGGFT-SAIVGEGGFSTVYLARL-AGSLAAVKV-HRSSERLHRA  112

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV-LPWR  436
            ++QEL+ L R+RH +IV++L + D    +EGVLV E+ PNG+L E+LHG G G+  +PW 
Sbjct  113  FRQELDALLRVRHPHIVRLLAFCDQR--DEGVLVLEFAPNGSLHEQLHGGGAGAAPMPWA  170

Query  435  NRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP  256
             R+ +A Q+A+ LEYLH++C+PQ+VHGD+K SN+LLD+ +  +LCD+GSA+ GFS+ V  
Sbjct  171  RRVPVALQVARALEYLHERCEPQVVHGDVKASNVLLDAGMGARLCDFGSARAGFSAAVAV  230

Query  255  PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIA  154
             ++     A       +FGSPGY DPHYLR+G++
Sbjct  231  AAAGPRPRA-------VFGSPGYVDPHYLRSGVS  257



>gb|AFW89820.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=853

 Score =   206 bits (524),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 149/214 (70%), Gaps = 13/214 (6%)
 Frame = -2

Query  792  TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTM  613
            T  +AR+L+  +V+ +T  F+ S ++  GGFSTVYL +    SL A+K+   SS+RLH  
Sbjct  56   TTANARQLSWAQVEAMTGGFT-SAIVGEGGFSTVYLARLA-GSLAAVKV-HRSSERLHRA  112

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV-LPWR  436
            ++QEL+ L R+RH +IV++L + D    +EGVLV E+ PNG+L E+LHG G G+  +PW 
Sbjct  113  FRQELDALLRVRHPHIVRLLAFCDQR--DEGVLVLEFAPNGSLHEQLHGGGAGAAPMPWA  170

Query  435  NRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP  256
             R+ +A Q+A+ LEYLH++C+PQ+VHGD+K SN+LLD+ +  +LCD+GSA+ GFS+ V  
Sbjct  171  RRVPVALQVARALEYLHERCEPQVVHGDVKASNVLLDAGMGARLCDFGSARAGFSAAVAV  230

Query  255  PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIA  154
             ++     A       +FGSPGY DPHYLR+G++
Sbjct  231  AAAGPRPRA-------VFGSPGYVDPHYLRSGVS  257



>gb|AFW89819.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=954

 Score =   206 bits (523),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 149/214 (70%), Gaps = 13/214 (6%)
 Frame = -2

Query  792  TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTM  613
            T  +AR+L+  +V+ +T  F+ S ++  GGFSTVYL +    SL A+K+   SS+RLH  
Sbjct  56   TTANARQLSWAQVEAMTGGFT-SAIVGEGGFSTVYLARLA-GSLAAVKV-HRSSERLHRA  112

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV-LPWR  436
            ++QEL+ L R+RH +IV++L + D    +EGVLV E+ PNG+L E+LHG G G+  +PW 
Sbjct  113  FRQELDALLRVRHPHIVRLLAFCDQR--DEGVLVLEFAPNGSLHEQLHGGGAGAAPMPWA  170

Query  435  NRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP  256
             R+ +A Q+A+ LEYLH++C+PQ+VHGD+K SN+LLD+ +  +LCD+GSA+ GFS+ V  
Sbjct  171  RRVPVALQVARALEYLHERCEPQVVHGDVKASNVLLDAGMGARLCDFGSARAGFSAAVAV  230

Query  255  PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIA  154
             ++     A       +FGSPGY DPHYLR+G++
Sbjct  231  AAAGPRPRA-------VFGSPGYVDPHYLRSGVS  257



>ref|XP_004951214.1| PREDICTED: probable receptor-like protein kinase At1g33260-like 
[Setaria italica]
Length=392

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 151/265 (57%), Gaps = 22/265 (8%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIID-TSSKRLHTMYKQE  601
            RRL  +EV+ LT  F  + V+  GG S VYL +  D +  A+K+      +R    ++QE
Sbjct  76   RRLAWREVEALTGGFDEAAVVGRGGSSIVYLARLRDGAPVAVKVHRWCGGERRLRAFRQE  135

Query  600  LEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGI  421
            L++L+R+RH +IV +L YSDD   E G LV EY+  GTL ++LHG      L W  RM I
Sbjct  136  LDLLRRLRHPHIVALLAYSDDH-EEGGALVLEYLAGGTLADRLHGGATAPPLSWPQRMRI  194

Query  420  AFQLAQVLEYLHDKCD-----PQIVHGDLKGSNILLDSE-LNCKLCDYGSAKMGFSSTVQ  259
               +A  LE+LHD        P +VHGD+  SN+LLD   L  +LCD GSA  GFS+ V 
Sbjct  195  VHDVACALEHLHDASAGGGGAPPVVHGDVSASNVLLDGRGLGARLCDLGSACEGFSAAVA  254

Query  258  PPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSS  79
            P  +               GSPGY DP +LRTGI +KKSD+YS GV+LLE +TGL A   
Sbjct  255  PTRAA-------------VGSPGYADPFFLRTGIVSKKSDVYSFGVLLLEAVTGLPAAGE  301

Query  78   DSNVRLISKAGPMLKDESKVAGMVD  4
              +  L ++  P ++    VAG+VD
Sbjct  302  PGSENLAARILPRVRARG-VAGLVD  325



>gb|EMT21908.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=216

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 131/177 (74%), Gaps = 6/177 (3%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQEL  598
            R+L+  +V+++T  F+ S V+  GGFSTVYL +    +L A+K+   SS+R+H +++QEL
Sbjct  41   RQLSWAQVERMTGGFT-SAVVGEGGFSTVYLARL-SGALAAVKV-HRSSERIHRVFRQEL  97

Query  597  EILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNG-GGSVLPWRNRMGI  421
            E L RIRH +IV++LG+ + +  +EGVLV E+  NG L EKLHG G     +PW  R+ +
Sbjct  98   ETLLRIRHPHIVRLLGFCEQQ--DEGVLVLEFAANGNLYEKLHGGGKAAGAMPWAWRVSV  155

Query  420  AFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPS  250
            A Q+AQ LEYLH++C+PQ+VHGD+K SN+LLD+ ++ KLCD+GSA+MGFS+ V+P S
Sbjct  156  ALQVAQALEYLHERCEPQVVHGDVKASNVLLDASMSAKLCDFGSARMGFSAAVRPRS  212



>ref|NP_001045631.1| Os02g0106900 [Oryza sativa Japonica Group]
 dbj|BAD27925.1| serine/threonine-specific receptor protein kinase-like protein 
[Oryza sativa Japonica Group]
 dbj|BAD28093.1| serine/threonine-specific receptor protein kinase-like protein 
[Oryza sativa Japonica Group]
 dbj|BAF07545.1| Os02g0106900 [Oryza sativa Japonica Group]
Length=406

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 155/282 (55%), Gaps = 39/282 (14%)
 Frame = -2

Query  792  TKESAR--RLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLH  619
            TKE     +LT +EV+ LT  F  + V+  GG STVYL     SS     +    + ++H
Sbjct  85   TKEEGEPWKLTWREVEALTGGFDEAAVVGRGGSSTVYLA----SSCRVAVVSPPVAVKVH  140

Query  618  TM---------YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHG  466
                       ++QEL++L+R+RH +IV +L YSDD   E G LV EY+  GTL ++LHG
Sbjct  141  RWCGGERWLRAFRQELDLLRRLRHPHIVSLLAYSDDH-EEGGALVLEYLSGGTLADRLHG  199

Query  465  NGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSE-LNCKLCDYGS  289
             G    LPWR+RM +   +A  LE+LHD   P +VHGD+  SN+LLD   L  +LCD GS
Sbjct  200  -GASPPLPWRHRMRVVHDVAGALEHLHDGA-PPVVHGDVSASNVLLDGRGLGARLCDLGS  257

Query  288  AKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLE  109
            A  GFS+ V P  +               GSPGY DP +LRTGI +KKSD+YS GV+LLE
Sbjct  258  ACEGFSAAVAPTRAA-------------VGSPGYVDPFFLRTGIVSKKSDVYSFGVLLLE  304

Query  108  LITGLEAV------SSDSNVRLISKAGPMLKDESKVAGMVDR  1
             ITG  A              L ++  P ++ E  V G+ DR
Sbjct  305  AITGSPAAGIPGPDGGAGGGNLTARLLPRVRTEG-VDGLADR  345



>gb|EAY84118.1| hypothetical protein OsI_05500 [Oryza sativa Indica Group]
Length=406

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 155/282 (55%), Gaps = 39/282 (14%)
 Frame = -2

Query  792  TKESAR--RLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLH  619
            TKE     +LT +EV+ LT  F  + V+  GG STVYL     SS     +    + ++H
Sbjct  85   TKEEGEPWKLTWREVEALTGGFDEAAVVGRGGSSTVYLA----SSCRVAVVSPPVAVKVH  140

Query  618  TM---------YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHG  466
                       ++QEL++L+R+RH +IV +L YSDD   E G LV EY+  GTL ++LHG
Sbjct  141  RWCGGERWLRAFRQELDLLRRLRHPHIVSLLAYSDDH-EEGGALVLEYLSGGTLADRLHG  199

Query  465  NGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSE-LNCKLCDYGS  289
             G    LPWR+RM +   +A  LE+LHD   P +VHGD+  SN+LLD   L  +LCD GS
Sbjct  200  -GASPPLPWRHRMRVVHDVAGALEHLHDGA-PPVVHGDVSASNVLLDGRGLGARLCDLGS  257

Query  288  AKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLE  109
            A  GFS+ V P  +               GSPGY DP +LRTGI +KKSD+YS GV+LLE
Sbjct  258  ACEGFSAAVAPTRAA-------------VGSPGYVDPFFLRTGIVSKKSDVYSFGVLLLE  304

Query  108  LITGLEAV------SSDSNVRLISKAGPMLKDESKVAGMVDR  1
             ITG  A              L ++  P ++ E  V G+ DR
Sbjct  305  AITGSPAAGIPGPDGGAGGGNLTARLLPRVRTEG-VDGLADR  345



>ref|XP_008681400.1| PREDICTED: uncharacterized LOC100272878 isoform X1 [Zea mays]
 gb|AFW69737.1| putative protein kinase superfamily protein [Zea mays]
Length=382

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/271 (42%), Positives = 151/271 (56%), Gaps = 24/271 (9%)
 Frame = -2

Query  801  EKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIID-TSSKR  625
            +K+ +E+ RRL  +EV+ LT  F  S V+  GG S VYL +  D S  A+K+      +R
Sbjct  64   KKEEEEAPRRLAWREVEALTGGFDESAVVGRGGSSAVYLARLLDGSPVAVKVHRWCGGER  123

Query  624  LHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVL  445
                ++QEL++L+R+RH NIV +L YSDD   EEG LV EY+  GTL + LHG      L
Sbjct  124  RLRAFRQELDLLRRLRHPNIVALLAYSDDH-EEEGALVLEYLAGGTLADALHGTAAAP-L  181

Query  444  PWRNRMGIAFQLAQVLEYLH----DKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMG  277
            PW  RM     +A  LE+LH          +VHGD+  SN+LL  +   +LCD GSA  G
Sbjct  182  PWAQRMRALHDVACALEHLHCGGGGGTSTAVVHGDVSASNVLL-FDGGARLCDLGSACEG  240

Query  276  FSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG  97
            FS+ V                    GSPGY DP +LRTGI + KSD+Y  GV+LLE +TG
Sbjct  241  FSAAVA-------------PARAAVGSPGYADPFFLRTGIVSTKSDVYGFGVLLLEAVTG  287

Query  96   LEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            L   S   N  L ++  P ++ E  VAG+VD
Sbjct  288  LPPASEAQN--LTARILPRVR-ERGVAGLVD  315



>ref|XP_006296547.1| hypothetical protein CARUB_v100250850mg, partial [Capsella rubella]
 gb|EOA29445.1| hypothetical protein CARUB_v100250850mg, partial [Capsella rubella]
Length=461

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 139/227 (61%), Gaps = 16/227 (7%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQEL  598
            RR T  EV+ +T +F R  VI  GGF  VY G   D+   A+K++  SS + +  +K E+
Sbjct  142  RRFTYSEVEAVTNNFER--VIGEGGFGIVYHGLLNDNEQVAVKVLSRSSTQGYKQFKAEV  199

Query  597  EILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIA  418
            E+L R+ H N+V ++GY ++E  +   LV+EY  NG L++ L G    +VL W +R+GIA
Sbjct  200  ELLLRVHHTNLVNLVGYCNEE--DHLALVYEYAANGDLKQHLSGASSSTVLNWVSRLGIA  257

Query  417  FQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTAT  238
             + AQ LEYLH  C+P ++H D+K +NILLD  L+ KL D+G ++  F   V+   ST  
Sbjct  258  METAQGLEYLHIGCEPPMIHRDVKTTNILLDEHLHAKLADFGLSR-SFPIGVESHVSTNV  316

Query  237  ATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG  97
            A           G+PGY DP Y RT   T+KSD+YSLG++LLE+IT 
Sbjct  317  A-----------GTPGYLDPEYYRTNWLTEKSDVYSLGIVLLEIITN  352



>ref|XP_010245528.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Nelumbo 
nucifera]
Length=449

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 148/254 (58%), Gaps = 19/254 (7%)
 Frame = -2

Query  756  VQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIR  577
            ++  T +F  S ++  GGF  VY  +F D+ L A+K +++  +     ++ E+++L  IR
Sbjct  144  LEAATNNFRESNILGEGGFGRVYKARFDDNRLAAVKKLESGGQDAEKEFENEVDLLSCIR  203

Query  576  HDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVL  397
            H NI+ ++G+   +  +   LV+E + NG+L+ +LHG   GS L W  RM IA + A+ L
Sbjct  204  HPNIISLMGHCIHK--QTRFLVYELMQNGSLETQLHGPSHGSALTWHIRMKIALEAARGL  261

Query  396  EYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRT  217
            EYLH+ C+P ++H DLK SNILLDS  N KL D+G A               TA A+N+ 
Sbjct  262  EYLHEHCNPPVIHRDLKSSNILLDSNFNAKLSDFGLA--------------VTAGAQNKN  307

Query  216  MMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAG  46
             + + G+ GY  P YL  G  T+KSD+Y+ GV+LLEL+ G   +E ++      +++ A 
Sbjct  308  NIKLSGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMAPAQCQSIVTWAM  367

Query  45   PMLKDESKVAGMVD  4
            P L D SK+  +VD
Sbjct  368  PQLTDRSKLPNIVD  381



>ref|XP_009398654.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Musa 
acuminata subsp. malaccensis]
Length=460

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/254 (38%), Positives = 145/254 (57%), Gaps = 19/254 (7%)
 Frame = -2

Query  756  VQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIR  577
            ++  T  FS   ++  GGFS VY       +  A+K +D   +     ++ E+E+L RIR
Sbjct  155  LESATNKFSEGNILGEGGFSHVYKASLNGEAFAAVKKLDGGGQDCEREFENEIELLGRIR  214

Query  576  HDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVL  397
            H NIV +LGY      E  +LV+E + NG+L+ +LHG   GS LPW  RM IA  +A+ L
Sbjct  215  HPNIVSLLGYCVHG--ETRMLVYELMQNGSLETQLHGPSHGSALPWHTRMKIALDIARGL  272

Query  396  EYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRT  217
            EYLH+ C+P ++H DLK SNILLDS+ N K+ D+G A +G + +              + 
Sbjct  273  EYLHEHCNPPVIHRDLKSSNILLDSDFNAKISDFGLAVIGRNHS--------------KG  318

Query  216  MMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAG  46
             + + G+ GY  P YL  G  T+KSD+Y+ G++LLEL+ G   +E ++      +++ A 
Sbjct  319  GLKVSGTLGYVAPEYLLDGKLTEKSDVYAFGIVLLELLLGRKPVEKMAPSQCQSIVAWAM  378

Query  45   PMLKDESKVAGMVD  4
            P L D SK+  +VD
Sbjct  379  PQLTDRSKLPSIVD  392



>ref|XP_009408035.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Musa 
acuminata subsp. malaccensis]
Length=447

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/276 (37%), Positives = 152/276 (55%), Gaps = 29/276 (11%)
 Frame = -2

Query  792  TKESARRLTRKEVQKLTVD----------FSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
            +K ++ ++T K+    T+D          FS S ++  GGFS VY   F      A+K +
Sbjct  124  SKLNSFKMTNKKTLLPTIDYASLESATNKFSVSNILGEGGFSHVYKATFNREVFAAVKKL  183

Query  642  DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
            D   +     +  E+++L R+RH NIV +LGY      E  +LV+E + NG+L+ +LHG 
Sbjct  184  DGCGQDCEREFANEIDLLGRVRHPNIVPLLGYCVHG--ETRLLVYELMQNGSLETQLHGP  241

Query  462  GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
              GS L W  RM IA  +A+ LEYLH+ C+P ++H DLK SNILLDS+ N K+ D+G A 
Sbjct  242  SHGSALTWHLRMKIALDIARGLEYLHEHCNPPVIHRDLKSSNILLDSDFNAKISDFGLAV  301

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
            +              +   N+  + + G+ GY  P YL  G  T+KSD+Y+ GV+LLEL+
Sbjct  302  L--------------SRNHNKGTLKLSGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELL  347

Query  102  TG---LEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
             G   +E + S     +++ A P L D SKV  +VD
Sbjct  348  MGRKPVEKLESSQCQSIVTWAMPQLTDRSKVPNIVD  383



>ref|XP_007011760.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY29379.1| Kinase superfamily protein [Theobroma cacao]
Length=435

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/262 (38%), Positives = 149/262 (57%), Gaps = 19/262 (7%)
 Frame = -2

Query  780  ARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQE  601
            A  +  K ++K T  F +  ++  GGF  VY  +F D S  A+K +D +S      ++ E
Sbjct  130  ASFMDYKILEKATSKFHQGNILGEGGFGCVYKAQFDDGSYAAVKKLDCASHDAEKEFENE  189

Query  600  LEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGI  421
            +++L + +H NI+ +LGYS D   E   +V+E + NG+L+ +LHG   GS L W+ RM I
Sbjct  190  VDLLCKFKHSNIISLLGYSSDN--ETRFIVYELMQNGSLETQLHGPSHGSSLTWQRRMKI  247

Query  420  AFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTA  241
            A   A+ LEYLH+ C P ++H DLK SNILLDS+ N KL D+G A               
Sbjct  248  ALDTARGLEYLHEHCSPPVIHRDLKSSNILLDSDFNAKLSDFGLA--------------V  293

Query  240  TATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSN  70
            T  A+N+  + + G+ GY  P YL  G  T KSD+Y+ GV+LLEL+ G   +E ++    
Sbjct  294  TDAAQNKNNLKLSGTLGYVAPEYLLDGKLTDKSDVYAFGVVLLELLLGRKPVEKLAPAQC  353

Query  69   VRLISKAGPMLKDESKVAGMVD  4
              +++ A P L D SK+  +VD
Sbjct  354  QSIVTWAMPQLTDRSKLPNIVD  375



>ref|XP_010265695.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Nelumbo nucifera]
Length=444

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 146/254 (57%), Gaps = 20/254 (8%)
 Frame = -2

Query  756  VQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIR  577
            ++  T +F  S V+  GGF  +Y  +F ++ L A+K ++   +     ++ E+++L R+R
Sbjct  140  LEAATNNFRESNVVGEGGFGCIYKARFDENFLAAVKRLEGGGQDAEKEFENEVDLLSRLR  199

Query  576  HDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVL  397
            H NI+ +LGY      E   LV E + NG+L+ +LHG   GS L W  RM IA + A+ L
Sbjct  200  HSNIISLLGYCIH--AETRFLVCELMQNGSLETQLHGPSHGSALTWHIRMKIALETAKGL  257

Query  396  EYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRT  217
            EYLH+ C+P ++H DLK SNILLDS  N KL D+G A               T+ A+N+ 
Sbjct  258  EYLHEHCNPPVIHRDLKSSNILLDSNFNAKLSDFGLA--------------VTSGAQNKN  303

Query  216  MMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAG  46
             + + G+ GY  P YL  G  T+KSD+Y+ GV+LLEL+ G   +E + S     +++ A 
Sbjct  304  -IKLSGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMESTECQSIVTWAL  362

Query  45   PMLKDESKVAGMVD  4
            P L D SK+  +VD
Sbjct  363  PQLTDRSKLPNIVD  376



>sp|Q9FZB1.1|Y5188_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At1g51880; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF99858.1|AC015448_8 Putative protein kinase [Arabidopsis thaliana]
 gb|ACN59250.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=872

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/248 (42%), Positives = 148/248 (60%), Gaps = 27/248 (11%)
 Frame = -2

Query  816  RRRKAEKD--------TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSL  661
            RR+  E +        TKE  RR+T  EV K+T +F R  V+  GGF TVY G   D+ +
Sbjct  535  RRKNGESNKGTNPSIITKE--RRITYPEVLKMTNNFER--VLGKGGFGTVYHGNLEDTQV  590

Query  660  GAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQ  481
             A+K++  SS + +  +K E+E+L R+ H N+V ++GY DD   +   L++EY+ NG L+
Sbjct  591  -AVKMLSHSSAQGYKEFKAEVELLLRVHHRNLVGLVGYCDDG--DNLALIYEYMANGDLK  647

Query  480  EKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLC  301
            E + G  GG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL+     KL 
Sbjct  648  ENMSGKRGGNVLTWENRMQIAVEAAQGLEYLHNGCTPPMVHRDVKTTNILLNERYGAKLA  707

Query  300  DYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGV  121
            D+G ++   S  V   S  +T  A         G+PGY DP Y RT   ++KSD+YS GV
Sbjct  708  DFGLSR---SFPVDGESHVSTVVA---------GTPGYLDPEYYRTNWLSEKSDVYSFGV  755

Query  120  ILLELITG  97
            +LLE++T 
Sbjct  756  VLLEIVTN  763



>ref|XP_010265697.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Nelumbo nucifera]
Length=442

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 146/254 (57%), Gaps = 20/254 (8%)
 Frame = -2

Query  756  VQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIR  577
            ++  T +F  S V+  GGF  +Y  +F ++ L A+K ++   +     ++ E+++L R+R
Sbjct  138  LEAATNNFRESNVVGEGGFGCIYKARFDENFLAAVKRLEGGGQDAEKEFENEVDLLSRLR  197

Query  576  HDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVL  397
            H NI+ +LGY      E   LV E + NG+L+ +LHG   GS L W  RM IA + A+ L
Sbjct  198  HSNIISLLGYCIH--AETRFLVCELMQNGSLETQLHGPSHGSALTWHIRMKIALETAKGL  255

Query  396  EYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRT  217
            EYLH+ C+P ++H DLK SNILLDS  N KL D+G A               T+ A+N+ 
Sbjct  256  EYLHEHCNPPVIHRDLKSSNILLDSNFNAKLSDFGLA--------------VTSGAQNKN  301

Query  216  MMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAG  46
             + + G+ GY  P YL  G  T+KSD+Y+ GV+LLEL+ G   +E + S     +++ A 
Sbjct  302  -IKLSGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMESTECQSIVTWAL  360

Query  45   PMLKDESKVAGMVD  4
            P L D SK+  +VD
Sbjct  361  PQLTDRSKLPNIVD  374



>ref|NP_175600.2| protein ROOT HAIR SPECIFIC 6 [Arabidopsis thaliana]
 gb|AEE32728.1| probable LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
Length=880

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/248 (42%), Positives = 148/248 (60%), Gaps = 27/248 (11%)
 Frame = -2

Query  816  RRRKAEKD--------TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSL  661
            RR+  E +        TKE  RR+T  EV K+T +F R  V+  GGF TVY G   D+ +
Sbjct  543  RRKNGESNKGTNPSIITKE--RRITYPEVLKMTNNFER--VLGKGGFGTVYHGNLEDTQV  598

Query  660  GAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQ  481
             A+K++  SS + +  +K E+E+L R+ H N+V ++GY DD   +   L++EY+ NG L+
Sbjct  599  -AVKMLSHSSAQGYKEFKAEVELLLRVHHRNLVGLVGYCDDG--DNLALIYEYMANGDLK  655

Query  480  EKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLC  301
            E + G  GG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL+     KL 
Sbjct  656  ENMSGKRGGNVLTWENRMQIAVEAAQGLEYLHNGCTPPMVHRDVKTTNILLNERYGAKLA  715

Query  300  DYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGV  121
            D+G ++   S  V   S  +T  A         G+PGY DP Y RT   ++KSD+YS GV
Sbjct  716  DFGLSR---SFPVDGESHVSTVVA---------GTPGYLDPEYYRTNWLSEKSDVYSFGV  763

Query  120  ILLELITG  97
            +LLE++T 
Sbjct  764  VLLEIVTN  771



>ref|XP_010510551.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g28990 [Camelina sativa]
Length=351

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 141/249 (57%), Gaps = 17/249 (7%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQEL  598
            RR T  EV  +T +F R  V+  GGF  VY G    +   A+K++  SS + +  +K E+
Sbjct  32   RRFTHDEVTTMTNNFQR--VLGEGGFGVVYHGLINGAEQIAVKVLSQSSAQGYKQFKAEV  89

Query  597  EILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIA  418
            E+L R+ H N+V ++GY D EG   G L++EY+PNG L++ L G   GSVL W+ R+ I 
Sbjct  90   ELLLRVHHINLVNLVGYCD-EGEHLG-LIYEYMPNGDLKQHLSGKWSGSVLSWKTRLIIT  147

Query  417  FQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTAT  238
               AQ LEYLH  C P +VH D+K SNILLD     KL D+G ++  F +  +   ST  
Sbjct  148  VDAAQGLEYLHTGCKPAMVHRDVKSSNILLDEHFQAKLADFGLSR-SFPTANETYVSTVV  206

Query  237  ATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVS-SDSNVRL  61
            A           G+PGY DP Y +T   ++KSD+YS G++LLE+IT    +  +     +
Sbjct  207  A-----------GTPGYLDPEYYQTNWLSEKSDVYSFGIVLLEIITNRPIIQHAREKTHI  255

Query  60   ISKAGPMLK  34
            +   G ML+
Sbjct  256  VEWVGLMLQ  264



>ref|XP_007222630.1| hypothetical protein PRUPE_ppa008520mg [Prunus persica]
 gb|EMJ23829.1| hypothetical protein PRUPE_ppa008520mg [Prunus persica]
Length=328

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/279 (37%), Positives = 153/279 (55%), Gaps = 21/279 (8%)
 Frame = -2

Query  831  LGRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAI  652
            +G+ +  R   K  K S   +  K ++K T +F  S +I  GGF  VY  +  D+ L A+
Sbjct  1    MGKFNSIRMVSK--KGSVSVIEYKVLEKGTNNFRDSNIIGEGGFGCVYKARLDDNLLVAV  58

Query  651  KIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKL  472
            K +D +S+     ++ E+E+L +I+H NI+  LG S D       +V+E + NG+L+ +L
Sbjct  59   KKLDCASQDAEREFENEVELLHKIQHPNIISFLGCSTDGDTR--FIVYELMHNGSLETQL  116

Query  471  HGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYG  292
            HG   GS L W  RM IA   A+ LE+LH+ C+P ++H DLK SNILLD+  N KL D+G
Sbjct  117  HGPSRGSALTWHMRMKIALDAARGLEHLHEYCNPPVIHRDLKTSNILLDANFNAKLSDFG  176

Query  291  SAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILL  112
             A                  AKN   + + G+ GY  P YL  G  T KSD+Y+ G++LL
Sbjct  177  LA--------------VADGAKNSNNIKLSGTLGYVAPEYLLDGKLTDKSDVYAFGIVLL  222

Query  111  ELITG---LEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            EL+ G   +E ++      +++ A P L D SK+  +VD
Sbjct  223  ELLLGRRPVEKLAPTQCQSIVTWAMPQLTDRSKLPNIVD  261



>ref|XP_002972461.1| hypothetical protein SELMODRAFT_97344 [Selaginella moellendorffii]
 gb|EFJ26547.1| hypothetical protein SELMODRAFT_97344 [Selaginella moellendorffii]
Length=345

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 106/272 (39%), Positives = 148/272 (54%), Gaps = 20/272 (7%)
 Frame = -2

Query  807  KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSK  628
            ++E+D    A+  T K++Q  T +FS    I  GGF  VY G  PD  L A+K++D   K
Sbjct  6    RSERDEVSKAQVFTYKQLQSATNNFSPLNKIGHGGFGLVYRGVLPDGRLAAVKLMDRQGK  65

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV  448
            +    ++ E+++L R+    ++ ++GY  D+     +LV+ Y+ NG+LQE LH  G  S 
Sbjct  66   QGEREFRVEVDMLTRLHSPYLLDLIGYCADKDYR--LLVYSYMANGSLQEHLHSKGK-ST  122

Query  447  LPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSS  268
            L W  R+ +AF  A+ LEYLH+   P I+H D K SNILLD   +  L D+G AK G   
Sbjct  123  LDWGTRILVAFDAAKGLEYLHEYVIPPIIHRDFKSSNILLDEHNDVVLADFGLAKTGADK  182

Query  267  TVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEA  88
                PS+             + G+ GY  P Y  TG  T KSD+YS GV+LLELITG   
Sbjct  183  IAGQPST------------RVLGTQGYLAPEYAMTGHLTTKSDVYSYGVVLLELITGRLP  230

Query  87   VSSD----SNVRLISKAGPMLKDESKVAGMVD  4
            V +      NV L++ A P L D  K+A MVD
Sbjct  231  VDAKRPPGQNV-LVNWALPRLTDREKLAQMVD  261



>ref|XP_002299270.2| hypothetical protein POPTR_0001s14680g [Populus trichocarpa]
 gb|EEE84075.2| hypothetical protein POPTR_0001s14680g [Populus trichocarpa]
Length=391

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 109/296 (37%), Positives = 154/296 (52%), Gaps = 31/296 (10%)
 Frame = -2

Query  849  VMAFGCLG--RKSRRRKAEKDTKESARRLTRKE---------VQKLTVDFSRSRVIAFGG  703
            V+ F C    R  + RK    +K      TRK          +Q  T +F    V+  GG
Sbjct  48   VLFFSCFWIYRLKKSRKCRAKSKGDGIFFTRKGSVAVMEYQLLQAATNNFREDNVLGQGG  107

Query  702  FSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEE  523
               VY  +F +  L A+K  +  ++ +   ++ EL  L +I+H NI+ +LGY      E 
Sbjct  108  HGCVYKARFSEKLLAAVKRFEGEAQDIGREFENELNWLTKIQHQNIISLLGYCLHG--ET  165

Query  522  GVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKG  343
              LV+E + NG+L+ +LHG   GS L W  RM IA  +A+ LEYLH+ C+P +VH DLK 
Sbjct  166  RFLVYEMMQNGSLESQLHGPTHGSALTWHLRMKIAVDVARGLEYLHEHCNPPVVHRDLKS  225

Query  342  SNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRT  163
            SNILLDS  N KL D+G A             T+   +KN   + + G+ GY  P YL  
Sbjct  226  SNILLDSSFNAKLSDFGLA------------VTSGIQSKN---IELSGTLGYVAPEYLLD  270

Query  162  GIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            G  T KSD+Y+ GV+LLEL+ G   +E +S D    ++S A P   D SK+  +VD
Sbjct  271  GKLTDKSDVYAFGVVLLELLIGRKPVEQMSPDQCQSIVSWAMPQFTDRSKLPNIVD  326



>ref|XP_010932226.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Elaeis 
guineensis]
Length=455

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 99/254 (39%), Positives = 143/254 (56%), Gaps = 19/254 (7%)
 Frame = -2

Query  756  VQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIR  577
            ++  T  FS S V+  GGF  VY G F    L A+K +D   +     ++ EL++L RIR
Sbjct  150  LESATNKFSESNVLGEGGFGCVYKGCFDGGILAAVKKLDGGGQDCEREFENELDLLGRIR  209

Query  576  HDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVL  397
            H NI+ +LGY      E  +LV++ + NG+L+ +LHG   GS L W  RM IA   A+ L
Sbjct  210  HPNIISLLGYCVHG--ETRLLVYDLMQNGSLETQLHGPSHGSALTWHIRMKIALDTARGL  267

Query  396  EYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRT  217
            EYLH+ C+P ++H DLK SNILLDSE N K+ D+G A               T    ++ 
Sbjct  268  EYLHEHCNPPVIHRDLKSSNILLDSEFNAKISDFGLA--------------VTGGNHHKG  313

Query  216  MMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAG  46
             + + G+ GY  P YL  G  T+KSD+Y+ GV+LLEL+ G   +E ++      +++ A 
Sbjct  314  NVKLSGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMAPSQCQSIVTWAM  373

Query  45   PMLKDESKVAGMVD  4
            P L D SK+  +VD
Sbjct  374  PQLTDRSKLPNIVD  387



>ref|XP_008219557.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Prunus 
mume]
Length=453

 Score =   175 bits (443),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 103/279 (37%), Positives = 153/279 (55%), Gaps = 21/279 (8%)
 Frame = -2

Query  831  LGRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAI  652
            +G+ +  R   K  K S   +  K ++K T +F  S +I  GGF  VY  +  D+ L A+
Sbjct  126  MGKFNSIRMVSK--KGSVSVIEYKVLEKGTNNFRDSNIIGEGGFGCVYKARLDDNLLVAV  183

Query  651  KIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKL  472
            K +D +S+     ++ E+E+L +I+H NI+  LG S D       +V+E + NG+L+ +L
Sbjct  184  KKLDCASQDAEREFENEVELLHKIQHPNIISFLGCSTDGDTR--FIVYELMHNGSLETQL  241

Query  471  HGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYG  292
            HG   GS L W  RM IA   A+ LE+LH+ C+P ++H DLK SNILLD+  N KL D+G
Sbjct  242  HGPSHGSALTWHMRMKIALDAARGLEHLHEYCNPPVIHRDLKTSNILLDANFNAKLSDFG  301

Query  291  SAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILL  112
             A                  AKN   + + G+ GY  P YL  G  T KSD+Y+ G++LL
Sbjct  302  LA--------------VADGAKNSNSIKLSGTLGYVAPEYLLDGKLTDKSDVYAFGIVLL  347

Query  111  ELITG---LEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            ELI G   +E ++      +++ A P L D SK+  +VD
Sbjct  348  ELILGRRPVEKLAPTQCQSIVTWAMPQLTDRSKLPNIVD  386



>gb|AAC33228.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=717

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 142/237 (60%), Gaps = 18/237 (8%)
 Frame = -2

Query  807  KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSK  628
            K+E  TK+  RR T  EV+ +T  F R  VI  GGF  VY G   D+   A+K++  SS 
Sbjct  390  KSEILTKK--RRFTYSEVEAVTNKFER--VIGEGGFGIVYHGHLNDTEQVAVKLLSHSST  445

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV  448
            + +  +K E+E+L R+ H N+V ++GY ++E  +   LV+EY  NG L++ L G    + 
Sbjct  446  QGYKQFKAEVELLLRVHHTNLVNLVGYCNEE--DHLALVYEYAANGDLKQHLSGESSSAA  503

Query  447  LPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSS  268
            L W +R+GIA + AQ LEYLH  C+P ++H D+K +NILLD   + KL D+G ++  F  
Sbjct  504  LNWASRLGIATETAQGLEYLHIGCEPPMIHRDVKTTNILLDEHFHAKLADFGLSR-SFPV  562

Query  267  TVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG  97
             V+   ST  A           G+PGY DP Y RT   T+KSD+YS+G++LLE+IT 
Sbjct  563  GVESHVSTNVA-----------GTPGYLDPEYYRTNWLTEKSDVYSMGIVLLEIITN  608



>ref|XP_010510555.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g28960 isoform X2 [Camelina sativa]
Length=348

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 132/226 (58%), Gaps = 16/226 (7%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQEL  598
            +R T  EV   T +F R  V+  GGF  VY G    +   A+K++  SS + +  +K E+
Sbjct  29   KRFTYSEVAAFTDNFER--VLGEGGFGVVYHGSLNGTQPIAVKLLSQSSVQGYKEFKAEV  86

Query  597  EILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIA  418
            E+L R+ H N+V ++GY D+EG     L++EY PNG L++ L G  GGS L W +R+ I 
Sbjct  87   ELLLRVHHVNLVSLVGYCDEEG--HLALLYEYAPNGDLKQHLSGERGGSPLKWSSRLKIV  144

Query  417  FQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTAT  238
             + AQ LEYLH  C P +VH D+K +NILLD     KL D+G ++   S  +   +  +T
Sbjct  145  VETAQGLEYLHTGCQPPMVHRDVKTTNILLDEHFQAKLADFGLSR---SFPIGGETHVST  201

Query  237  ATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELIT  100
            A A         G+PGY DP Y RT    +KSD+YS G++LLE+IT
Sbjct  202  AVA---------GTPGYLDPEYYRTNRLNEKSDVYSFGIVLLEIIT  238



>ref|XP_010513261.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g28960 [Camelina sativa]
Length=732

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 133/228 (58%), Gaps = 20/228 (9%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQEL  598
            RR T  EV+ +T +F R  VI  GGF  VY G   D+   A+K++  S  + H  +K+E+
Sbjct  413  RRFTYPEVEAITNNFQR--VIGEGGFGIVYHGSLSDTEKVAVKLLSQSPTQGHKQFKEEV  470

Query  597  EILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIA  418
            E+L R+ H N+V ++GY  +E  +   LV+EY  NG L++ L G  GG+ L W NR+ IA
Sbjct  471  ELLLRVHHVNLVSLVGYCFEE--DHLALVYEYTTNGDLKQHLSGERGGATLSWENRLNIA  528

Query  417  FQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTAT  238
              +AQ LEYLH  C P ++H D+K +NIL+D     KL D+G A+              +
Sbjct  529  TDIAQGLEYLHTGCRPPMIHRDVKTTNILIDENFQAKLVDFGLAR--------------S  574

Query  237  ATAKNRTMMTMF--GSPGYTDPHYLRTGIATKKSDIYSLGVILLELIT  100
                N T MT    G+PGY DP Y +T   T+KSD+YS G++LLE+IT
Sbjct  575  FPTGNETHMTTIVAGTPGYLDPEYNQTNWLTEKSDVYSFGIVLLEIIT  622



>ref|XP_002985113.1| hypothetical protein SELMODRAFT_121956, partial [Selaginella 
moellendorffii]
 gb|EFJ13607.1| hypothetical protein SELMODRAFT_121956, partial [Selaginella 
moellendorffii]
Length=314

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 148/256 (58%), Gaps = 20/256 (8%)
 Frame = -2

Query  762  KEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQR  583
            K ++  T  FS   +I  GGF+ VY  +  D    A+K + T + +    ++ E++++ R
Sbjct  5    KMLESATDRFSEENLIGEGGFARVYKAQLDDDHAIAVKKLSTENDQADEEFRAEIDLMGR  64

Query  582  IRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQ  403
            I H N++ +LG+S  +G E+ +L++E + NG+LQ++L G   G+ L W  R+ IA   A+
Sbjct  65   IHHHNLIALLGFSS-QG-EDRLLIYELMTNGSLQDQLQGPAQGAALTWHLRLKIALDAAR  122

Query  402  VLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKN  223
             LEYLHD CDP ++H D K SNILLD + N KL D+G A M     VQ  + +       
Sbjct  123  GLEYLHDHCDPPVIHRDFKSSNILLDEDFNAKLSDFGLALM-----VQEGAGS-------  170

Query  222  RTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNV---RLISK  52
               + + G+ GY  P Y+ TGI T+KSD+Y+ GV+LLELITG + +          L++ 
Sbjct  171  ---LQLQGTFGYVAPEYILTGILTEKSDVYAFGVVLLELITGRKPIDVSMPTGCQSLVTW  227

Query  51   AGPMLKDESKVAGMVD  4
            A P L D +++  +VD
Sbjct  228  ATPQLTDRTRLPLIVD  243



>ref|XP_008788933.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Phoenix dactylifera]
Length=460

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 140/250 (56%), Gaps = 19/250 (8%)
 Frame = -2

Query  744  TVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNI  565
            T  FS S ++  GGF  VY   F    L A+K +D   +     ++ EL++L RIRH NI
Sbjct  159  TNKFSESNILGEGGFGCVYKACFDGGLLAAVKKLDGGGQDCEREFENELDLLGRIRHPNI  218

Query  564  VKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLH  385
            V +LGY      E  +LV++ + NG+L+ +LHG   GS L W  RM IA   A+ LEYLH
Sbjct  219  VSLLGYCIHG--ETRLLVYDLMQNGSLETQLHGPSHGSALTWHIRMKIALDTARGLEYLH  276

Query  384  DKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTM  205
            + C+P ++H DLK SNILLDSE N K+ D+G A               T    N+  + +
Sbjct  277  EHCNPPVIHRDLKSSNILLDSEFNAKISDFGLA--------------VTGGNHNKGSVKL  322

Query  204  FGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAGPMLK  34
             G+ GY  P YL  G  T+KSD+Y+ GV+LLEL+ G   +E ++      +++ A P L 
Sbjct  323  SGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMAPSQCQSIVTWAMPQLT  382

Query  33   DESKVAGMVD  4
            D +K+  +VD
Sbjct  383  DRTKLPNIVD  392



>ref|NP_001137070.1| uncharacterized LOC100217243 [Zea mays]
 gb|ACF83197.1| unknown [Zea mays]
 gb|AFW87261.1| putative protein kinase superfamily protein [Zea mays]
Length=332

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/254 (38%), Positives = 140/254 (55%), Gaps = 19/254 (7%)
 Frame = -2

Query  756  VQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIR  577
            ++  T +FS S V+  GGF  VY   F      A+K ++         ++ EL++L RIR
Sbjct  28   LEAATGEFSESNVLGVGGFGCVYKAVFDGGVTAAVKRLEGGGPECEKEFENELDLLGRIR  87

Query  576  HDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVL  397
            H NIV +LG+   EG     +V+E +  G+L  +LHG   GS L W  RM IA  +A+ L
Sbjct  88   HPNIVSLLGFCVHEG--NHYIVYELMEKGSLDTQLHGASHGSALTWHIRMKIALDMARGL  145

Query  396  EYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRT  217
            EYLH+ C P ++H DLK SNILLDS+ N K+ D+G A               T+   ++ 
Sbjct  146  EYLHEHCSPPVIHRDLKSSNILLDSDFNAKISDFGLA--------------VTSGNIDKG  191

Query  216  MMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAG  46
             M + G+ GY  P YL  G  T+KSD+Y+ GV+LLEL+ G   +E +S      +++ A 
Sbjct  192  SMKLSGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSQTQCQSIVTWAM  251

Query  45   PMLKDESKVAGMVD  4
            P L D +K+  +VD
Sbjct  252  PQLTDRTKLPNIVD  265



>emb|CBI36018.3| unnamed protein product [Vitis vinifera]
Length=773

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/259 (39%), Positives = 139/259 (54%), Gaps = 16/259 (6%)
 Frame = -2

Query  810  RKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSS  631
            R  E   K      T  +V  +T  FSR+  I  GGF  VYLG   D +  A+K+   SS
Sbjct  439  RPKEGSLKSGNSEFTFSDVATITNYFSRT--IGRGGFGQVYLGTLTDGTQVAVKMRSQSS  496

Query  630  KRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGS  451
             +     + E ++L R+ H N+V+++GY  D       L++EY+ NG LQ KL G     
Sbjct  497  IQSPKALQAEAKLLTRVHHKNLVRLIGYCKDG--THMALIYEYMSNGNLQNKLLGREAAD  554

Query  450  VLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFS  271
            VL W+ R+ IA   A  LEYLH+ C P IVH D+K SNILL   L  K+ D+G   M   
Sbjct  555  VLNWKQRLQIAVDAAHGLEYLHNGCKPPIVHRDMKSSNILLTETLQAKVADFG---MSRD  611

Query  270  STVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLE  91
              ++  +  +T  A         G+PGY DP Y  TGI  KKSD+YS G++LLELITG  
Sbjct  612  LAIESGAFISTVPA---------GTPGYLDPEYQSTGILNKKSDVYSFGIVLLELITGQP  662

Query  90   AVSSDSNVRLISKAGPMLK  34
            A+ +  N+ ++    PM+K
Sbjct  663  AIKNPGNIHIVGWVSPMIK  681



>ref|XP_008788934.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Phoenix dactylifera]
Length=458

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 140/250 (56%), Gaps = 19/250 (8%)
 Frame = -2

Query  744  TVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNI  565
            T  FS S ++  GGF  VY   F    L A+K +D   +     ++ EL++L RIRH NI
Sbjct  157  TNKFSESNILGEGGFGCVYKACFDGGLLAAVKKLDGGGQDCEREFENELDLLGRIRHPNI  216

Query  564  VKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLH  385
            V +LGY      E  +LV++ + NG+L+ +LHG   GS L W  RM IA   A+ LEYLH
Sbjct  217  VSLLGYCIHG--ETRLLVYDLMQNGSLETQLHGPSHGSALTWHIRMKIALDTARGLEYLH  274

Query  384  DKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTM  205
            + C+P ++H DLK SNILLDSE N K+ D+G A               T    N+  + +
Sbjct  275  EHCNPPVIHRDLKSSNILLDSEFNAKISDFGLA--------------VTGGNHNKGSVKL  320

Query  204  FGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAGPMLK  34
             G+ GY  P YL  G  T+KSD+Y+ GV+LLEL+ G   +E ++      +++ A P L 
Sbjct  321  SGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMAPSQCQSIVTWAMPQLT  380

Query  33   DESKVAGMVD  4
            D +K+  +VD
Sbjct  381  DRTKLPNIVD  390



>ref|XP_009144962.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51860 [Brassica rapa]
Length=795

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/257 (39%), Positives = 151/257 (59%), Gaps = 17/257 (7%)
 Frame = -2

Query  774  RLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELE  595
            R+T  EV K+T +F R  V+  GGF TVY G F D+ + A+K++  SS + +  +  E+E
Sbjct  478  RVTYPEVLKMTNNFQR--VLGKGGFGTVYHGNFDDAQV-AVKMLSHSSAQGYKEFNAEVE  534

Query  594  ILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAF  415
            +L R+ H ++V+++GY DD   +   L++EY+ NG L+E + G  GG+VL W NRM IA 
Sbjct  535  LLSRVHHRHLVRLVGYCDDG--DNLALIYEYMANGDLKEHMSGKRGGNVLTWENRMQIAV  592

Query  414  QLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATA  235
            + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G ++  F    +   STA A
Sbjct  593  EAAQGLEYLHNGCQPPMVHRDVKTTNILLNERYGAKLADFGLSR-SFPIDGEYHVSTAVA  651

Query  234  TAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLIS  55
                       G+PGY DP Y RT   ++KSDIYS G++LLE+IT    +        I+
Sbjct  652  -----------GTPGYLDPEYHRTNSLSEKSDIYSFGIVLLEIITNQPVIDKTRERTHIN  700

Query  54   KAGPMLKDESKVAGMVD  4
            +   ++  +  +  ++D
Sbjct  701  EWAVLMLTKGDIRNLID  717



>gb|KHG06993.1| hypothetical protein F383_33282 [Gossypium arboreum]
Length=437

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/279 (37%), Positives = 151/279 (54%), Gaps = 21/279 (8%)
 Frame = -2

Query  831  LGRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAI  652
            LG+    R   K+    A  +  K ++K T  F    ++  GGF  VY  +F D S  A+
Sbjct  117  LGKLKSMRTVSKEGY--ASFMDYKILEKATNKFHHGNILGEGGFGCVYKAQFNDGSYAAV  174

Query  651  KIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKL  472
            K +D +S+     Y+ E+ +L R +H NI+ +LGYS D       +V+E + NG+L+ +L
Sbjct  175  KKLDCASQDAEKEYENEVGLLCRFKHSNIISLLGYSSDNDTR--FIVYELMENGSLETQL  232

Query  471  HGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYG  292
            HG   GS L W  RM IA   A+ LEYLH+ C+P ++H DLK SNILLD + N KL D+G
Sbjct  233  HGPSHGSSLTWHRRMKIALDTARGLEYLHEHCNPPVIHRDLKSSNILLDLDFNAKLSDFG  292

Query  291  SAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILL  112
             A               T  A N+  + + G+ GY  P YL  G  T KSD+Y+ GV+LL
Sbjct  293  LA--------------VTDAATNKNNLKLSGTLGYLAPEYLLDGKLTDKSDVYAFGVVLL  338

Query  111  ELITG---LEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            EL+ G   +E ++      +++ A P L D SK+  +VD
Sbjct  339  ELLLGRKPVEKLAPAQCQSIVTWAMPQLTDRSKLPNIVD  377



>ref|XP_008452879.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Cucumis melo]
Length=318

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 146/256 (57%), Gaps = 19/256 (7%)
 Frame = -2

Query  762  KEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQR  583
            K ++K T +F  S V+  GGF+ VY     D+ + A+K +D S  +  T ++ E+ IL R
Sbjct  20   KVLEKATGNFGESNVLGEGGFARVYKALLDDNLVVAVKKLDCSGLQADTEFENEVNILSR  79

Query  582  IRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQ  403
            I H NI+  LG S  EG +  ++V+E + NG+L+ +LHG   GS L W  RM IA  +A+
Sbjct  80   IHHPNIICQLGCSS-EG-DAKLIVYELMENGSLETQLHGPSRGSALNWHMRMKIALDVAR  137

Query  402  VLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKN  223
             LEYLH+ C P ++H DLK SNILLD+  N KL D+G A               T   +N
Sbjct  138  GLEYLHEHCQPAVIHRDLKTSNILLDANFNAKLADFGIA--------------ITDGTQN  183

Query  222  RTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISK  52
               + + G+ GY  P YL  G  T+KSD+Y+ G+++LEL+ G   +E   +  +  +++ 
Sbjct  184  NNKIKLSGTLGYVAPEYLLHGKLTEKSDVYAFGIVVLELLLGRRPVEKRPTPQSHSIVTW  243

Query  51   AGPMLKDESKVAGMVD  4
            A P L D SK+  +VD
Sbjct  244  AMPQLTDRSKLPNIVD  259



>ref|XP_008452878.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Cucumis melo]
Length=367

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 155/285 (54%), Gaps = 28/285 (10%)
 Frame = -2

Query  822  KSRRRKAEKDT---------KESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPD  670
            KS+R+  EK           K     +  K ++K T +F  S V+  GGF+ VY     D
Sbjct  40   KSKRKDVEKGMGLAPFVTGKKGCVSVIDFKVLEKATGNFGESNVLGEGGFARVYKALLDD  99

Query  669  SSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNG  490
            + + A+K +D S  +  T ++ E+ IL RI H NI+  LG S  EG +  ++V+E + NG
Sbjct  100  NLVVAVKKLDCSGLQADTEFENEVNILSRIHHPNIICQLGCSS-EG-DAKLIVYELMENG  157

Query  489  TLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNC  310
            +L+ +LHG   GS L W  RM IA  +A+ LEYLH+ C P ++H DLK SNILLD+  N 
Sbjct  158  SLETQLHGPSRGSALNWHMRMKIALDVARGLEYLHEHCQPAVIHRDLKTSNILLDANFNA  217

Query  309  KLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYS  130
            KL D+G A               T   +N   + + G+ GY  P YL  G  T+KSD+Y+
Sbjct  218  KLADFGIA--------------ITDGTQNNNKIKLSGTLGYVAPEYLLHGKLTEKSDVYA  263

Query  129  LGVILLELITG---LEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
             G+++LEL+ G   +E   +  +  +++ A P L D SK+  +VD
Sbjct  264  FGIVVLELLLGRRPVEKRPTPQSHSIVTWAMPQLTDRSKLPNIVD  308



>ref|XP_006830243.1| hypothetical protein AMTR_s00130p00078720 [Amborella trichopoda]
 gb|ERM97659.1| hypothetical protein AMTR_s00130p00078720 [Amborella trichopoda]
Length=399

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 146/270 (54%), Gaps = 21/270 (8%)
 Frame = -2

Query  792  TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTM  613
            T++  +  T K++   T  FS   +I  GGF +VY G  PD    A+K++D S K+    
Sbjct  75   TEKGIQVYTYKQLYSATNGFSSGNIIGHGGFGSVYRGVLPDGRRIAVKLMDRSGKQGEEE  134

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH----GNGGGSVL  445
            +  E+E+L R+R   ++ +LG+  D   E  +LV+EY+ NG+LQE L+     NGG S L
Sbjct  135  FTMEVELLSRLRSPYLLGLLGHCSDN--EHKLLVYEYMANGSLQELLYLDNGSNGGASKL  192

Query  444  PWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSST  265
             W  R+ IA   A+ LEYLH+  +P I+H D K SNILLD   + K+ D+G AK+G    
Sbjct  193  EWETRLRIALDAAKGLEYLHEHVNPPIIHRDFKSSNILLDKNFHAKVSDFGLAKLG----  248

Query  264  VQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAV  85
                S  A      R +    G+ GY  P Y  TG  T KSD+YS GV+LLEL+TG   V
Sbjct  249  ----SEKAGGHVSTRVL----GTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLTGRVPV  300

Query  84   S---SDSNVRLISKAGPMLKDESKVAGMVD  4
                      L+S A P L D  KV  ++D
Sbjct  301  DMKRPPGECVLVSWALPRLTDREKVIEIMD  330



>ref|XP_009144872.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51860 [Brassica rapa]
Length=890

 Score =   177 bits (450),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 144/242 (60%), Gaps = 17/242 (7%)
 Frame = -2

Query  822  KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
            KS  R +        RR+T  EV ++T +F R  V+  GGF TVY G F D+ + A+K++
Sbjct  557  KSETRPSNPSIITKDRRITYPEVLRMTNNFQR--VLGKGGFGTVYHGNFDDAQV-AVKML  613

Query  642  DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
              SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  614  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLRENMSGK  671

Query  462  GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G ++
Sbjct  672  RGGNVLTWENRMQIAVEAAQGLEYLHNGCRPPMVHRDVKTTNILLNERSGAKLADFGLSR  731

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
               S  +      +T  A         G+PGY DP Y RT   ++KSD+YS GV+LLE++
Sbjct  732  ---SFPIDGECHVSTVVA---------GTPGYLDPEYYRTNWLSEKSDVYSFGVVLLEIV  779

Query  102  TG  97
            T 
Sbjct  780  TN  781



>ref|XP_006848777.1| hypothetical protein AMTR_s00026p00089830 [Amborella trichopoda]
 gb|ERN10358.1| hypothetical protein AMTR_s00026p00089830 [Amborella trichopoda]
Length=452

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 144/250 (58%), Gaps = 19/250 (8%)
 Frame = -2

Query  744  TVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNI  565
            T +FS S ++  GG   +Y  +F D+ L A+K +D+        ++ E++++ +IRH N+
Sbjct  156  TNNFSSSNILGEGGSGRIYKARFDDNILAAVKKLDSVGPESEHEFENEVDLMSKIRHPNL  215

Query  564  VKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLH  385
            V +LGY      +   LV+E + NG+L+ +LHG   GS L W  RM IA   A+ LEYLH
Sbjct  216  VSLLGYCVYG--QSRFLVYELMQNGSLESQLHGPSRGSGLTWHLRMKIALDAARGLEYLH  273

Query  384  DKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTM  205
            + C+P ++H DLK SNILLDS  N KL D+G A               T  A+++T + +
Sbjct  274  EHCNPPVIHRDLKSSNILLDSAFNAKLADFGLA--------------VTVGAQSKTNVKL  319

Query  204  FGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAGPMLK  34
             G+ GY  P YL  G  T+KSD+YS GV+LLEL+ G   +E ++      +++ A P L 
Sbjct  320  SGTLGYVAPEYLLDGKLTEKSDVYSFGVVLLELLMGRKPVEKLAPAQCQSIVTWAMPQLT  379

Query  33   DESKVAGMVD  4
            D SK+  +VD
Sbjct  380  DRSKLPNIVD  389



>ref|XP_002969784.1| hypothetical protein SELMODRAFT_92161, partial [Selaginella moellendorffii]
 gb|EFJ28908.1| hypothetical protein SELMODRAFT_92161, partial [Selaginella moellendorffii]
Length=314

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 147/256 (57%), Gaps = 20/256 (8%)
 Frame = -2

Query  762  KEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQR  583
            K ++  T  FS   +I  GGF+ VY  +  D    A+K + T + +    ++ E+ ++ R
Sbjct  5    KMLESATDRFSEENLIGEGGFARVYKAQLDDDHAIAVKKLSTENDQADEEFRAEINLMGR  64

Query  582  IRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQ  403
            I H N++ +LG+S  +G E+ +L++E + NG+LQ++L G   G+ L W  R+ IA   A+
Sbjct  65   IHHPNLIALLGFSS-QG-EDRLLIYELMTNGSLQDQLQGPAQGAALTWHLRLKIALDAAR  122

Query  402  VLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKN  223
             LEYLHD CDP ++H D K SNILLD + N KL D+G A M     VQ  + +       
Sbjct  123  GLEYLHDHCDPPVIHRDFKSSNILLDEDFNAKLSDFGLALM-----VQEGAGS-------  170

Query  222  RTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNV---RLISK  52
               + + G+ GY  P Y+ TGI T+KSD+Y+ GV+LLELITG + +          L++ 
Sbjct  171  ---LQLQGTFGYVAPEYILTGILTEKSDVYAFGVVLLELITGRKPIDVSMPTGCQSLVTW  227

Query  51   AGPMLKDESKVAGMVD  4
            A P L D +++  +VD
Sbjct  228  ATPQLTDRTRLPLIVD  243



>ref|XP_010491792.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Camelina 
sativa]
Length=429

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 104/282 (37%), Positives = 160/282 (57%), Gaps = 21/282 (7%)
 Frame = -2

Query  837  GCLGRKSRRRKAEKDTKESARRLTRKE-VQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSL  661
            GC G  S +   +K TK+    L   + ++K T  F  S ++  GGF  VY+    +++ 
Sbjct  101  GCSGFTSSKTLDKKTTKQGMVSLMDYDMIEKGTSGFKESNILGQGGFGCVYIATLENNTQ  160

Query  660  GAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQ  481
             A+K +D +++     YK E+EIL +++H NI+ +LGYS ++      +V+E +PN +L+
Sbjct  161  AAVKKLDCANEEAAKEYKSEVEILSKLKHPNIISLLGYSTNDTAR--FIVYELMPNVSLE  218

Query  480  EKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLC  301
              LHG   GS + W  RM IA  +++ LEYLH+ C P I+H DLK SNILLDS  N K+ 
Sbjct  219  SHLHGASHGSTITWPMRMKIALDVSRGLEYLHEHCHPAIIHRDLKSSNILLDSNFNAKIS  278

Query  300  DYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGV  121
            D+G A       V  P        KN+ +  + G+ GY  P YL  G  T+KSD+Y+ GV
Sbjct  279  DFGLA------VVDGP--------KNK-IHKLSGTVGYVAPEYLLDGKLTEKSDVYAFGV  323

Query  120  ILLELITG---LEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            +LLEL+ G   +E ++      +I+ A P L D +K+ G++D
Sbjct  324  VLLELLLGKKPVEKLAPGECQSIITWAMPYLTDRTKLPGVID  365



>emb|CDY33856.1| BnaC06g04970D [Brassica napus]
Length=711

 Score =   176 bits (445),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 142/242 (59%), Gaps = 17/242 (7%)
 Frame = -2

Query  822  KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
            KS  R +        RR+T  EV K+T +F R  V+  GGF TVY G   D+ + A+K++
Sbjct  381  KSETRSSNPSIISKDRRITYSEVLKMTNNFER--VLGKGGFGTVYHGNLDDAQV-AVKML  437

Query  642  DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
              SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  438  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLRENMSGK  495

Query  462  GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL      KL D+G ++
Sbjct  496  RGGNVLTWENRMQIAVESAQGLEYLHNGCRPPMVHRDVKTTNILLTERYGAKLADFGLSR  555

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
               S  +      +T  A         G+PGY DP Y RT   ++KSD+YS GV+LLE++
Sbjct  556  ---SFPIDGECHVSTVVA---------GTPGYLDPEYYRTNWLSEKSDVYSFGVVLLEIV  603

Query  102  TG  97
            T 
Sbjct  604  TN  605



>gb|EEC78975.1| hypothetical protein OsI_19455 [Oryza sativa Indica Group]
Length=463

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 107/313 (34%), Positives = 161/313 (51%), Gaps = 44/313 (14%)
 Frame = -2

Query  858  WVSVMAFGCLGRKSRRRKAEKDTKES----------------ARRLTRK---------EV  754
            ++S +    L R+SRR    K T+ S                + +++RK          +
Sbjct  100  FLSTLYAWTLWRRSRRSTGGKVTRSSDAAKGIKLVPILSRFNSVKMSRKRLVGMFEYPSL  159

Query  753  QKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRH  574
            +  T  FS S ++  GGF  VY   F      A+K +D         ++ EL++L RIRH
Sbjct  160  EAATEKFSESNMLGVGGFGRVYKAAFDAGVTAAVKRLDGGGPDCEKEFENELDLLGRIRH  219

Query  573  DNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLE  394
             NIV +LG+   EG     +V+E +  G+L+ +LHG+  GS L W  RM IA   A+ LE
Sbjct  220  PNIVSLLGFCIHEG--NHYIVYELMEKGSLETQLHGSSHGSTLSWHIRMKIALDTARGLE  277

Query  393  YLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTM  214
            YLH+ C P ++H DLK SNILLDS+ N K+ D+G A               ++ + N+  
Sbjct  278  YLHEHCSPPVIHRDLKSSNILLDSDFNAKIADFGLA--------------VSSGSVNKGS  323

Query  213  MTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAGP  43
            + + G+ GY  P YL  G  T+KSD+Y+ GV+LLEL+ G   +E +S      +++ A P
Sbjct  324  VKLSGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVTWAMP  383

Query  42   MLKDESKVAGMVD  4
             L D SK+  +VD
Sbjct  384  QLTDRSKLPSIVD  396



>ref|NP_001148054.1| senescence-induced receptor-like serine/threonine-protein kinase 
[Zea mays]
 gb|ACG29599.1| senescence-induced receptor-like serine/threonine-protein kinase 
precursor [Zea mays]
Length=371

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 110/264 (42%), Positives = 152/264 (58%), Gaps = 22/264 (8%)
 Frame = -2

Query  789  KESA-RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIID-TSSKRLHT  616
            KE A RRL  +EV+ LT  F  + V+  GG STVYL +  D S  A+K+      +R   
Sbjct  61   KEPAPRRLAWREVEALTGGFDEAAVVGRGGSSTVYLARLLDGSPVAVKVHRWCGGERRLR  120

Query  615  MYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWR  436
             ++QEL++L+R+RH +IV +L YSDD   +EG LV EY+  GTL + LHG    + LPW 
Sbjct  121  AFRQELDLLRRLRHPHIVALLAYSDDH-EDEGALVLEYLGGGTLADALHGTAA-APLPWA  178

Query  435  NRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP  256
             RM +   +A  LE+LH      +VHGD+  SN+LL S+   +LCD GSA  GFS+ V P
Sbjct  179  QRMRVLHDVACALEHLHGG-GASVVHGDVSASNVLL-SDGGARLCDLGSACEGFSAAVAP  236

Query  255  PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSD  76
              +   +              GY DP +LRTGI + +SD+Y  GV+LLE +TGL A S  
Sbjct  237  ARAAVASP-------------GYADPFFLRTGIVSSRSDVYGFGVLLLEAVTGLPAASEA  283

Query  75   SNVRLISKAGPMLKDESKVAGMVD  4
             N  L ++  P ++    VAG+VD
Sbjct  284  EN--LTARILPRVRARG-VAGLVD  304



>ref|NP_175599.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AEE32727.1| protein kinase-like protein [Arabidopsis thaliana]
Length=837

 Score =   176 bits (447),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 96/247 (39%), Positives = 147/247 (60%), Gaps = 17/247 (7%)
 Frame = -2

Query  822  KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
            KS  R +        R++T  +V K+T +F R  V+  GGF TVY G   D+ + A+K++
Sbjct  504  KSETRSSNPSIMRKDRKITYPQVLKMTNNFER--VLGKGGFGTVYHGNMEDAQV-AVKML  560

Query  642  DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
              SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  561  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLRENMLGK  618

Query  462  GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL+++   KL D+G ++
Sbjct  619  RGGNVLTWENRMQIAVEAAQGLEYLHNGCTPPMVHRDVKTTNILLNAQCGAKLADFGLSR  678

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
               S  +      +T  A         G+PGY DP Y RT   ++KSD+YS GV+LLE++
Sbjct  679  ---SFPIDGECHVSTVVA---------GTPGYLDPEYYRTNWLSEKSDVYSFGVVLLEIV  726

Query  102  TGLEAVS  82
            T    ++
Sbjct  727  TNQPVIN  733



>ref|XP_010419656.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Camelina sativa]
Length=364

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 160/282 (57%), Gaps = 22/282 (8%)
 Frame = -2

Query  837  GCLGRKSRRRKAEKDTKESARRLTRKE-VQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSL  661
            GC G  S +   +K TK+    L   + ++K T  F  S ++  GGF  VYL    +++ 
Sbjct  37   GC-GFTSSKTLDKKTTKQGMVSLIDYDMIEKGTSGFKESNILGQGGFGCVYLATLENNTQ  95

Query  660  GAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQ  481
             A+K +D +++     YK E+EIL +++H NI+ +LGYS ++      +V+E +PN +L+
Sbjct  96   AAVKKLDCANEEAAKEYKSEVEILSKLKHPNIISLLGYSTNDTAR--FIVYELMPNVSLE  153

Query  480  EKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLC  301
              LHG   GS + W  RM IA  +++ LEYLH+ C P I+H DLK SNILLDS  N K+ 
Sbjct  154  SHLHGASHGSTITWPMRMKIALDISRGLEYLHEHCHPAIIHRDLKSSNILLDSNFNAKIS  213

Query  300  DYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGV  121
            D+G A       V  P        KN+ +  + G+ GY  P YL  G  T+KSD+Y+ GV
Sbjct  214  DFGLA------VVDGP--------KNK-IHKLSGTVGYVAPEYLLDGQLTEKSDVYAFGV  258

Query  120  ILLELITG---LEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            +LLEL+ G   +E ++      +I+ A P L D +K+ G++D
Sbjct  259  VLLELLLGKKPVEKLAPGECQSIITWAMPYLTDRTKLPGVID  300



>ref|NP_001055185.1| Os05g0319700 [Oryza sativa Japonica Group]
 gb|AAV44083.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAV44123.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17099.1| Os05g0319700 [Oryza sativa Japonica Group]
 dbj|BAG97991.1| unnamed protein product [Oryza sativa Japonica Group]
Length=478

 Score =   173 bits (438),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 107/313 (34%), Positives = 161/313 (51%), Gaps = 44/313 (14%)
 Frame = -2

Query  858  WVSVMAFGCLGRKSRRRKAEKDTKES----------------ARRLTRK---------EV  754
            ++S +    L R+SRR    K T+ S                + +++RK          +
Sbjct  115  FLSTLYAWTLWRRSRRSTGGKVTRSSDAAKGIKLVPILSRFNSVKMSRKRLVGMFEYPSL  174

Query  753  QKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRH  574
            +  T  FS S ++  GGF  VY   F      A+K +D         ++ EL++L RIRH
Sbjct  175  EAATEKFSESNMLGVGGFGRVYKAAFDAGVTAAVKRLDGGGPDCEKEFENELDLLGRIRH  234

Query  573  DNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLE  394
             NIV +LG+   EG     +V+E +  G+L+ +LHG+  GS L W  RM IA   A+ LE
Sbjct  235  PNIVSLLGFCIHEG--NHYIVYELMEKGSLETQLHGSSHGSTLSWHIRMKIALDTARGLE  292

Query  393  YLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTM  214
            YLH+ C P ++H DLK SNILLDS+ N K+ D+G A               ++ + N+  
Sbjct  293  YLHEHCSPPVIHRDLKSSNILLDSDFNAKIADFGLA--------------VSSGSVNKGS  338

Query  213  MTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAGP  43
            + + G+ GY  P YL  G  T+KSD+Y+ GV+LLEL+ G   +E +S      +++ A P
Sbjct  339  VKLSGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVTWAMP  398

Query  42   MLKDESKVAGMVD  4
             L D SK+  +VD
Sbjct  399  QLTDRSKLPSIVD  411



>ref|XP_010654590.1| PREDICTED: senescence-induced receptor-like serine/threonine-protein 
kinase [Vitis vinifera]
Length=890

 Score =   177 bits (448),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 101/260 (39%), Positives = 139/260 (53%), Gaps = 16/260 (6%)
 Frame = -2

Query  813  RRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTS  634
             R  E   K      T  +V  +T  FSR+  I  GGF  VYLG   D +  A+K+   S
Sbjct  555  ERPKEGSLKSGNSEFTFSDVATITNYFSRT--IGRGGFGQVYLGTLTDGTQVAVKMRSQS  612

Query  633  SKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGG  454
            S +     + E ++L R+ H N+V+++GY  D       L++EY+ NG LQ KL G    
Sbjct  613  SIQSPKALQAEAKLLTRVHHKNLVRLIGYCKDG--THMALIYEYMSNGNLQNKLLGREAA  670

Query  453  SVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGF  274
             VL W+ R+ IA   A  LEYLH+ C P IVH D+K SNILL   L  K+ D+G   M  
Sbjct  671  DVLNWKQRLQIAVDAAHGLEYLHNGCKPPIVHRDMKSSNILLTETLQAKVADFG---MSR  727

Query  273  SSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGL  94
               ++  +  +T  A         G+PGY DP Y  TGI  KKSD+YS G++LLELITG 
Sbjct  728  DLAIESGAFISTVPA---------GTPGYLDPEYQSTGILNKKSDVYSFGIVLLELITGQ  778

Query  93   EAVSSDSNVRLISKAGPMLK  34
             A+ +  N+ ++    PM+K
Sbjct  779  PAIKNPGNIHIVGWVSPMIK  798



>ref|XP_011073360.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Sesamum indicum]
Length=398

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 138/250 (55%), Gaps = 19/250 (8%)
 Frame = -2

Query  744  TVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNI  565
            T +F  + ++  GG   VY   F D S  A+K I    +     ++ E+E L +I+H NI
Sbjct  102  TNNFDEANILGEGGLGRVYKAHFNDHSHAAVKKIYAGGQEAEREFENEVEALSKIQHQNI  161

Query  564  VKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLH  385
            V +LGY      E   LV+E + NG+L+  LHG    S L W  RM IA  +A+ LEYLH
Sbjct  162  VSLLGYCIHG--EARFLVYEMMENGSLEFHLHGPSPRSTLTWHLRMKIALDVARGLEYLH  219

Query  384  DKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTM  205
            ++C+P ++H DLK SNILLDS  N KL D+G A  G +S              N+T + +
Sbjct  220  ERCNPPVIHRDLKSSNILLDSNFNAKLSDFGLAITGGNS--------------NKTNVKL  265

Query  204  FGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAGPMLK  34
             G+ GY  P YL  G  T KSD+Y+ GV+LLEL+TG   +E V+      + + A P L 
Sbjct  266  SGTLGYVAPEYLLDGKLTDKSDVYAFGVVLLELLTGRRPVERVAEAQCQSITTWAMPQLT  325

Query  33   DESKVAGMVD  4
            D SK+  +VD
Sbjct  326  DRSKLPSIVD  335



>gb|AAF99857.1|AC015448_7 Putative protein kinase [Arabidopsis thaliana]
Length=865

 Score =   176 bits (447),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 96/247 (39%), Positives = 147/247 (60%), Gaps = 17/247 (7%)
 Frame = -2

Query  822  KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
            KS  R +        R++T  +V K+T +F R  V+  GGF TVY G   D+ + A+K++
Sbjct  532  KSETRSSNPSIMRKDRKITYPQVLKMTNNFER--VLGKGGFGTVYHGNMEDAQV-AVKML  588

Query  642  DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
              SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  589  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLRENMLGK  646

Query  462  GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL+++   KL D+G ++
Sbjct  647  RGGNVLTWENRMQIAVEAAQGLEYLHNGCTPPMVHRDVKTTNILLNAQCGAKLADFGLSR  706

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
               S  +      +T  A         G+PGY DP Y RT   ++KSD+YS GV+LLE++
Sbjct  707  ---SFPIDGECHVSTVVA---------GTPGYLDPEYYRTNWLSEKSDVYSFGVVLLEIV  754

Query  102  TGLEAVS  82
            T    ++
Sbjct  755  TNQPVIN  761



>ref|XP_008220337.1| PREDICTED: probable LRR receptor-like protein kinase At1g51890 
[Prunus mume]
Length=644

 Score =   175 bits (443),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 104/253 (41%), Positives = 147/253 (58%), Gaps = 20/253 (8%)
 Frame = -2

Query  825  RKSRRRKAEKDT---KESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGA  655
            RK+RR      T   K   R+ T+ E+ K+T   S S +I  GGF  VY G     +  A
Sbjct  333  RKTRRLTIFIQTEPFKIQGRKFTKSEIDKIT---SNSTLIGRGGFGEVYHGTLEKDTQVA  389

Query  654  IKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEK  475
            +KI++ SS++    ++ E+++L R+ H N+V  +GY D EG +   LV+EYV NG LQ+K
Sbjct  390  VKILNLSSRQGSEEFQNEVKLLMRVHHRNLVSFIGYCD-EG-DTMALVYEYVGNGNLQQK  447

Query  474  LHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDY  295
            +   G    L W+ R+ IA   A+ LEYLHD C P I+H DLK SNILL+  L  K+ D+
Sbjct  448  ISAAGADIGLTWKQRLQIAVDTARGLEYLHDGCKPPILHRDLKPSNILLNETLQAKIADF  507

Query  294  GSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVIL  115
            G +K           + AT TA +  +  + G+ GY DP Y  TG  T+KSD+YS G++L
Sbjct  508  GISK-----------ALATETATH-ALTDLRGTYGYLDPQYCTTGQLTRKSDVYSFGIVL  555

Query  114  LELITGLEAVSSD  76
            LELITG  A+ +D
Sbjct  556  LELITGRPAIITD  568



>gb|KEH39620.1| receptor-like kinase [Medicago truncatula]
Length=415

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 149/267 (56%), Gaps = 23/267 (9%)
 Frame = -2

Query  795  DTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHT  616
            D K S      + ++  T  FS+  ++   G   VY  +F +    A+K  D+++ R   
Sbjct  105  DKKSSIAIFDFQLLESATNSFSQDNIMGETGSIIVYRARFDEHFQAAVKKADSNADR---  161

Query  615  MYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWR  436
             ++ E+ +L +IRH NI+K+LGY   +G E   LV+EY+ +G+L+ +LHG   GS L W 
Sbjct  162  EFENEVSLLSKIRHQNIIKILGYCI-QG-ESRFLVYEYMESGSLESQLHGPTRGSSLTWY  219

Query  435  NRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP  256
             R+ IA  +A+ LEYLH+  +P +VH DLK SN+LLDS+ N KL D+G            
Sbjct  220  IRLRIAIDVARALEYLHEHSNPPVVHRDLKSSNVLLDSDFNAKLSDFG------------  267

Query  255  PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAV  85
                A A+      M M G+ GY  P Y+  G  T KSD+Y+ GV+LLEL+TG   +  +
Sbjct  268  ---LAVASGVQHKNMKMSGTLGYVAPEYISHGKLTDKSDVYAFGVVLLELLTGRKPMHNM  324

Query  84   SSDSNVRLISKAGPMLKDESKVAGMVD  4
            SSD    L++ A P L D SK+  ++D
Sbjct  325  SSDQYQSLVTWAMPQLTDRSKLPSILD  351



>ref|XP_006292621.1| hypothetical protein CARUB_v10018863mg [Capsella rubella]
 gb|EOA25519.1| hypothetical protein CARUB_v10018863mg [Capsella rubella]
Length=400

 Score =   171 bits (433),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 107/276 (39%), Positives = 148/276 (54%), Gaps = 21/276 (8%)
 Frame = -2

Query  810  RKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSS  631
            +K +  T    +  T K++   T  FS+S V+  GGF  VY G   D    AIK +D + 
Sbjct  62   QKLQDVTDNGLQIFTFKQLHSATGGFSKSNVVGHGGFGLVYRGVLSDGRKVAIKFMDHAG  121

Query  630  KRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH-GNGGG  454
            K+    +K E+E+L R+R   ++ +LGY  D      +LV+E++ NG LQE L+  N  G
Sbjct  122  KQGEEEFKMEVELLSRLRSPYLLALLGYCSDN--SHKLLVYEFMANGGLQEHLYLNNRSG  179

Query  453  SVLP---WRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
            SV P   W  RM IA + A+ LEYLH++  P ++H D K SNILLD   N K+ D+G AK
Sbjct  180  SVPPRLDWETRMRIALEAAKGLEYLHEQVSPPVIHRDFKSSNILLDRNFNAKVSDFGLAK  239

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
            +G        S  A      R +    G+ GY  P Y  TG  T KSD+YS GV+LLEL+
Sbjct  240  VG--------SDKAGGHVSTRVL----GTQGYVAPEYALTGHLTTKSDVYSYGVVLLELL  287

Query  102  TGLEAVS---SDSNVRLISKAGPMLKDESKVAGMVD  4
            TG   V    +     L+S A P+L D  KV  ++D
Sbjct  288  TGRVPVDMKRATGEGVLVSWALPLLADREKVVDIMD  323



>ref|NP_180466.2| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AEC08198.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=872

 Score =   176 bits (446),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 142/237 (60%), Gaps = 18/237 (8%)
 Frame = -2

Query  807  KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSK  628
            K+E  TK+  RR T  EV+ +T  F R  VI  GGF  VY G   D+   A+K++  SS 
Sbjct  545  KSEILTKK--RRFTYSEVEAVTNKFER--VIGEGGFGIVYHGHLNDTEQVAVKLLSHSST  600

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV  448
            + +  +K E+E+L R+ H N+V ++GY ++E  +   LV+EY  NG L++ L G    + 
Sbjct  601  QGYKQFKAEVELLLRVHHTNLVNLVGYCNEE--DHLALVYEYAANGDLKQHLSGESSSAA  658

Query  447  LPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSS  268
            L W +R+GIA + AQ LEYLH  C+P ++H D+K +NILLD   + KL D+G ++  F  
Sbjct  659  LNWASRLGIATETAQGLEYLHIGCEPPMIHRDVKTTNILLDEHFHAKLADFGLSR-SFPV  717

Query  267  TVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG  97
             V+   ST  A           G+PGY DP Y RT   T+KSD+YS+G++LLE+IT 
Sbjct  718  GVESHVSTNVA-----------GTPGYLDPEYYRTNWLTEKSDVYSMGIVLLEIITN  763



>ref|XP_010274442.1| PREDICTED: serine/threonine-protein kinase PBS1 [Nelumbo nucifera]
Length=404

 Score =   171 bits (433),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 153/284 (54%), Gaps = 24/284 (8%)
 Frame = -2

Query  828  GRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIK  649
            G K      +  T++  +  T K++   T  F +S VI  GGF +VY G   D    A+K
Sbjct  57   GEKGGYATVQVATEKGLQLFTYKQLHSATSGFGKSNVIGHGGFGSVYRGVLSDGRKIAVK  116

Query  648  IIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH  469
            ++D + K+    +K E+E+L R+R+  ++ +LGY  D   +  +LV+E++ NG LQE L+
Sbjct  117  LMDRAGKQGEEEFKMEVELLSRLRYPYLLALLGYCSDN--DHKLLVYEFMANGGLQEHLY  174

Query  468  ----GNGGG-SVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKL  304
                GN GG S L W  R+ IA + A+ LEYLH+   P ++H D K SNILLD   + K+
Sbjct  175  PDKNGNSGGVSKLDWETRLRIALEAAKGLEYLHEHVSPPVIHRDFKSSNILLDKSFHAKV  234

Query  303  CDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLG  124
             D+G AK+G        S  A      R +    G+ GY  P Y  TG  T KSD+YS G
Sbjct  235  SDFGLAKLG--------SDKAGGHVSTRVL----GTQGYVAPEYALTGHLTTKSDVYSYG  282

Query  123  VILLELITGLEAVS----SDSNVRLISKAGPMLKDESKVAGMVD  4
            V+LLEL+TG   V     S   V L+S A P L D  KV  ++D
Sbjct  283  VVLLELLTGRVPVDMKRPSGEGV-LVSWALPRLTDREKVVQIMD  325



>ref|XP_009145484.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
At3g21340 [Brassica rapa]
Length=721

 Score =   175 bits (443),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 161/292 (55%), Gaps = 25/292 (9%)
 Frame = -2

Query  852  SVMAFGCLGRKSRR-RKAEKDTKESA--------RRLTRKEVQKLTVDFSRSRVIAFGGF  700
            S +AF  + RK +    A+  T  S+        RR T  EV  +T +F +  ++  GGF
Sbjct  368  SALAFFFVFRKKKTPNSADPRTTRSSVPAIMTKNRRFTYSEVVTMTNNFEK--ILGKGGF  425

Query  699  STVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEG  520
              VY G    +   A+K++  SS + +  +K E+E+L R+ H N+V+++GY D EG E  
Sbjct  426  GMVYHGTVNGTEQVAVKVLSHSSSQGYKEFKAEVELLLRVHHKNLVRLVGYCD-EG-ENL  483

Query  519  VLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGS  340
             L++EY+ NG L+E + G  GGS+L W  R+ I  Q AQ LEYLH+ C P ++H D+K +
Sbjct  484  ALIYEYMANGDLREHMSGKRGGSILNWETRLKIVVQSAQGLEYLHNGCKPPMIHRDVKTT  543

Query  339  NILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTG  160
            NILL+     KL D+G ++   S  V+  +  +T  A         G+PGY DP Y RT 
Sbjct  544  NILLNEHFQAKLADFGLSR---SFPVEGETHVSTVVA---------GTPGYLDPEYYRTN  591

Query  159  IATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
               +KSD+YS G++LLE+IT    ++ +     I++   ++  E  +  +VD
Sbjct  592  WLNEKSDVYSFGIVLLEIITNQPVINQNRENPYIAEWVGVMLTEGDIQNIVD  643



>ref|XP_010510554.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g28960 isoform X1 [Camelina sativa]
Length=426

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/226 (42%), Positives = 131/226 (58%), Gaps = 16/226 (7%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQEL  598
            +R T  EV   T +F R  V+  GGF  VY G    +   A+K++  SS + +  +K E+
Sbjct  107  KRFTYSEVAAFTDNFER--VLGEGGFGVVYHGSLNGTQPIAVKLLSQSSVQGYKEFKAEV  164

Query  597  EILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIA  418
            E+L R+ H N+V ++GY D+EG     L++EY PNG L++ L G  GGS L W +R+ I 
Sbjct  165  ELLLRVHHVNLVSLVGYCDEEG--HLALLYEYAPNGDLKQHLSGERGGSPLKWSSRLKIV  222

Query  417  FQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTAT  238
             + AQ LEYLH  C P +VH D+K +NILLD     KL D+G ++  F    +   STA 
Sbjct  223  VETAQGLEYLHTGCQPPMVHRDVKTTNILLDEHFQAKLADFGLSR-SFPIGGETHVSTAV  281

Query  237  ATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELIT  100
            A           G+PGY DP Y RT    +KSD+YS G++LLE+IT
Sbjct  282  A-----------GTPGYLDPEYYRTNRLNEKSDVYSFGIVLLEIIT  316



>ref|XP_004965735.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Setaria italica]
Length=464

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 139/254 (55%), Gaps = 19/254 (7%)
 Frame = -2

Query  756  VQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIR  577
            ++  T  FS S V+  GGF  VY   F      A+K ++         ++ EL++L RIR
Sbjct  160  LEAATGKFSESNVLGVGGFGCVYKAVFDGGITAAVKRLEGGGPECEQEFENELDLLGRIR  219

Query  576  HDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVL  397
            H NIV +LG+   EG     +V+E +  G+L  +LHG   GS L W  RM IA  +A+ L
Sbjct  220  HPNIVSLLGFCVHEG--NHYIVYELMEKGSLDTQLHGPSHGSALSWHIRMKIALDMARGL  277

Query  396  EYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRT  217
            EYLH+ C P ++H DLK SNILLDS+ N K+ D+G A               T+   ++ 
Sbjct  278  EYLHEHCSPPVIHRDLKSSNILLDSDFNAKISDFGLA--------------VTSGNIDKG  323

Query  216  MMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVR---LISKAG  46
             M + G+ GY  P YL  G  T+KSD+Y+ GV+LLEL+ G + V   S  +   +++ A 
Sbjct  324  TMNLSGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSQTQCQSIVTWAM  383

Query  45   PMLKDESKVAGMVD  4
            P L D SK+  +VD
Sbjct  384  PQLTDRSKLPNIVD  397



>ref|XP_009405340.1| PREDICTED: probable receptor-like protein kinase At1g49730 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009405341.1| PREDICTED: probable receptor-like protein kinase At1g49730 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=679

 Score =   174 bits (442),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/269 (38%), Positives = 153/269 (57%), Gaps = 17/269 (6%)
 Frame = -2

Query  810  RKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSS  631
            R+ ++      RR   KE++K T +FS   VI  GGF TVY  +F D  + A+K +D  S
Sbjct  308  RRCQEGPSAMFRRFAYKEMKKATENFST--VIGKGGFGTVYKAQFVDGPIAAVKRMDKVS  365

Query  630  KRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGS  451
            K+    + +E+E+L R+ H ++V + G+  +    E  LV+EY+ NG+L++ LH +G   
Sbjct  366  KQGEEEFCREIELLARLHHRHLVALKGFCAERN--ERFLVYEYMENGSLKDHLHSSGRKR  423

Query  450  VLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFS  271
             L WR R+ IA  +A  LEYLH  CDP + H D+K SNILLD +   K+ D+G A     
Sbjct  424  -LSWRTRLQIAIDVANALEYLHFYCDPPLCHRDIKSSNILLDEKFVAKVADFGLAH----  478

Query  270  STVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLE  91
                  +S + A +       + G+PGY DP Y+ T   T+KSDIYS GV+LLEL++G  
Sbjct  479  ------ASRSDAISFEPVNTDIRGTPGYMDPEYVVTQELTEKSDIYSYGVLLLELVSGRR  532

Query  90   AVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            A+  + N  L+  +   L  +S++  +VD
Sbjct  533  AIHENRN--LVEWSQKFLATDSRLPELVD  559



>ref|XP_010481126.1| PREDICTED: probable LRR receptor-like protein kinase At1g51890 
[Camelina sativa]
Length=1029

 Score =   177 bits (448),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 151/266 (57%), Gaps = 22/266 (8%)
 Frame = -2

Query  855  VSVMAFGCLGRKSRRRKAEKDTKES------ARRLTRKEVQKLTVDFSRSRVIAFGGFST  694
            ++ +A   +    RR+K    T E+       R+ T  E+ K+T +F R  V+  GG+  
Sbjct  519  IAFLAIFTICFIFRRKKQRAPTNENRTIGTKERKFTYSEILKMTNNFER--VLGKGGYGR  576

Query  693  VYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVL  514
            VY G   D+ +    +  +S+ + +  +K E+E+L R+ H N+V ++GY DD   +   L
Sbjct  577  VYYGNLDDTQVAVKMLFHSSADQDYKHFKAEVELLLRVHHRNLVGLVGYCDDG--DNLAL  634

Query  513  VFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNI  334
            ++EY+ NG L+E + GN  G VL W NRM IA + AQ LEYLH+   P +VH D+K +NI
Sbjct  635  IYEYIANGDLRENMSGNRCGHVLTWENRMQIAMEAAQGLEYLHNGSRPPMVHRDVKPTNI  694

Query  333  LLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIA  154
            LL+     KL D+G ++   SS V   SS +TA A         G+PGY DP Y  T + 
Sbjct  695  LLNEVFQAKLADFGLSR---SSPVDGESSISTAVA---------GTPGYLDPEYYGTNLL  742

Query  153  TKKSDIYSLGVILLELITGLEAVSSD  76
            ++K+D+YS GV+LLE+IT    + S+
Sbjct  743  SEKTDVYSFGVVLLEIITNQPVIDSN  768



>emb|CDY51448.1| BnaA05g36650D [Brassica napus]
Length=758

 Score =   175 bits (443),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 161/292 (55%), Gaps = 25/292 (9%)
 Frame = -2

Query  852  SVMAFGCLGRKSRR-RKAEKDTKESA--------RRLTRKEVQKLTVDFSRSRVIAFGGF  700
            S +AF  + RK +    A+  T  S+        RR T  EV  +T +F +  ++  GGF
Sbjct  421  SALAFFFVFRKKKTPNSADPRTTRSSVPAIMTKNRRFTYSEVVTMTNNFEK--ILGKGGF  478

Query  699  STVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEG  520
              VY G    +   A+K++  SS + +  +K E+E+L R+ H N+V+++GY D EG E  
Sbjct  479  GMVYHGTVNGTEQVAVKVLSHSSSQGYKEFKAEVELLLRVHHKNLVRLVGYCD-EG-ENL  536

Query  519  VLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGS  340
             L++EY+ NG L+E + G  GGS+L W  R+ I  Q AQ LEYLH+ C P ++H D+K +
Sbjct  537  ALIYEYMANGDLREHMSGKRGGSILNWETRLKIVVQSAQGLEYLHNGCKPPMIHRDVKTT  596

Query  339  NILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTG  160
            NILL+     KL D+G ++   S  V+  +  +T  A         G+PGY DP Y RT 
Sbjct  597  NILLNEHFQAKLADFGLSR---SFPVEGETHVSTVVA---------GTPGYLDPEYYRTN  644

Query  159  IATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
               +KSD+YS G++LLE+IT    ++ +     I++   ++  E  +  +VD
Sbjct  645  WLNEKSDVYSFGIVLLEIITNQPVINQNRENPYIAEWVGVMLTEGDIQNIVD  696



>emb|CAN76226.1| hypothetical protein VITISV_000266 [Vitis vinifera]
Length=342

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/265 (38%), Positives = 149/265 (56%), Gaps = 19/265 (7%)
 Frame = -2

Query  789  KESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMY  610
            K S   +  K ++  T +F  S ++  GGF  VY  +  D+S  A+K ID   +     +
Sbjct  24   KGSVSLIDYKVLETATNNFQESNILGEGGFGCVYKARLDDNSHVAVKKIDGRGQDAEREF  83

Query  609  KQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNR  430
            + E+++L +I+H NI+ +LGYS  E  E   LV+E + NG+L+ +LHG   GS L W  R
Sbjct  84   ENEVDLLTKIQHPNIISLLGYSXHE--ESKFLVYELMQNGSLETELHGPSHGSSLTWHIR  141

Query  429  MGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPS  250
            M IA   A+ LEYLH+ C+P ++H DLK SNILLDS  N KL D+G A +          
Sbjct  142  MKIALDAARGLEYLHEHCNPPVIHRDLKSSNILLDSNFNAKLSDFGLAVID---------  192

Query  249  STATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSS  79
                   +N+  + + G+ GY  P YL  G  T KSD+Y+ GV+LLEL+ G   +E ++ 
Sbjct  193  -----GPQNKNNLKLSGTLGYLAPEYLLDGKLTDKSDVYAFGVVLLELLLGRKPVEKLAP  247

Query  78   DSNVRLISKAGPMLKDESKVAGMVD  4
                 +++ A P L D SK+ G+VD
Sbjct  248  AQCQSIVTWAMPQLTDRSKLPGIVD  272



>gb|KFK35818.1| hypothetical protein AALP_AA4G041400 [Arabis alpina]
Length=3012

 Score =   178 bits (452),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 144/242 (60%), Gaps = 17/242 (7%)
 Frame = -2

Query  822   KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
             KS  R +        RR+T  E+ K+T +F R  V+  GGF TVY G   D+ + A+K++
Sbjct  2014  KSETRSSNPSIISKDRRITYPEILKMTNNFDR--VLGKGGFGTVYHGNLDDAQV-AVKML  2070

Query  642   DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
               SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  2071  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLKENMSGK  2128

Query  462   GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GGG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G ++
Sbjct  2129  GGGNVLTWENRMQIAVEAAQGLEYLHNGCRPPMVHRDVKTTNILLNERSQAKLADFGLSR  2188

Query  282   MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
                S  +      +T  A         G+PGY DP Y RT   ++KSD+YS GV+LLE++
Sbjct  2189  ---SFPIDGECHVSTVVA---------GTPGYLDPDYYRTNWLSEKSDVYSYGVVLLEIV  2236

Query  102   TG  97
             T 
Sbjct  2237  TN  2238


 Score =   177 bits (450),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/273 (37%), Positives = 154/273 (56%), Gaps = 17/273 (6%)
 Frame = -2

Query  822   KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
             KS  R +        RR+   EV K+T +F R  V+  GGF TVY G   D+ + A+K++
Sbjct  1314  KSETRSSNPSIISKDRRIAYPEVLKMTNNFER--VLGKGGFGTVYHGNLDDAQV-AVKML  1370

Query  642   DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
               SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  1371  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLRENMSGK  1428

Query  462   GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GGG++L W NRM IA + AQ LEYLHD C P +VH D+K +NILL+     KL D+G ++
Sbjct  1429  GGGNILTWENRMQIAVEAAQGLEYLHDGCTPPMVHRDVKTTNILLNERSGAKLADFGLSR  1488

Query  282   MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
                S  +      +T  A         G+PGY DP Y RT   ++ SD+YS GV+LLE++
Sbjct  1489  ---SFPIDGECHVSTVVA---------GTPGYLDPEYYRTNWLSETSDVYSFGVVLLEIV  1536

Query  102   TGLEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
             T    +  +     I++   ++  +  +  +VD
Sbjct  1537  TNQPVIDKNRERTHINEWVGVMLSKGDIKNIVD  1569


 Score =   169 bits (427),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 143/239 (60%), Gaps = 19/239 (8%)
 Frame = -2

Query  792   TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTM  613
             TKE  R+ T  EV K+T +F R  V+  GGF TVY G   D+ + A+K++  SS + +  
Sbjct  788   TKE--RKFTYSEVLKMTNNFER--VLGKGGFGTVYHGNLDDTQV-AVKMLSHSSSQGYKE  842

Query  612   YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRN  433
             +K E+E+L R+ H ++V ++GY DD   ++  L++EY+ NG L+E L G   G+VL W  
Sbjct  843   FKAEVELLLRVHHRHLVGLVGYCDDG--DKLALIYEYMENGDLRENLLGKRRGNVLSWET  900

Query  432   RMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPP  253
             R+ IA + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G ++          
Sbjct  901   RLQIAVEAAQGLEYLHNGCRPPMVHRDVKPTNILLNERSQAKLADFGLSR----------  950

Query  252   SSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSD  76
               +     ++  M  + G+PGY DP Y RT   ++KSD+YS G++LLE++T    ++ +
Sbjct  951   --SFPVDGESHVMTVVAGTPGYLDPEYYRTNWLSEKSDVYSFGIVLLEIVTNQPVINKN  1007


 Score =   162 bits (410),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 95/251 (38%), Positives = 140/251 (56%), Gaps = 18/251 (7%)
 Frame = -2

Query  828   GRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIK  649
             GR  R  +    TK   RR T  EV  +T +F R  V+  GGF  VY G    +   A+K
Sbjct  2678  GRSPRSSEPAIMTKN--RRFTYSEVVTMTNNFQR--VLGKGGFGIVYHGFVNGTEQVAVK  2733

Query  648   IIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH  469
              +  SS + +  +K E+E+L R+ H N+V ++GY D EG E   L++EY+ NG L+E + 
Sbjct  2734  KLSHSSSQGYKQFKAEVELLLRVHHKNLVGLVGYCD-EG-ENLALIYEYMANGDLKEHMS  2791

Query  468   GNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGS  289
             G     +L W  R+ I  + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G 
Sbjct  2792  GTRNRLILNWGTRLKIVLESAQGLEYLHNGCKPPMVHRDVKTTNILLNEHFQAKLADFGL  2851

Query  288   AKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLE  109
             ++   S  ++  +  +T  A         G+PGY DP Y RT   T+KSD+YS G++LLE
Sbjct  2852  SR---SFPIEGETHVSTVVA---------GTPGYLDPEYYRTNWLTEKSDVYSFGIVLLE  2899

Query  108   LITGLEAVSSD  76
             +IT    ++ +
Sbjct  2900  IITNQPVINQN  2910


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 79/142 (56%), Gaps = 12/142 (8%)
 Frame = -2

Query  429  MGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPS  250
            M IA + AQ LEYLH+   P +VH D+K +NILL+   + KL D+G ++   SS V   S
Sbjct  1    MQIAMEAAQGLEYLHNGSIPPMVHRDVKTTNILLNELFHAKLADFGLSR---SSPVDGES  57

Query  249  STATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSN  70
              +T  A         G+PGY DP Y RT + ++KSD+YS GV+LLE++T    +  +  
Sbjct  58   YESTLVA---------GTPGYLDPEYYRTNLLSEKSDVYSFGVVLLEIVTNQPVIDKNRK  108

Query  69   VRLISKAGPMLKDESKVAGMVD  4
               I++    +  E  +  ++D
Sbjct  109  KPHITEWVRFMLMEGDIRNVID  130



>gb|KFK35817.1| hypothetical protein AALP_AA4G041400 [Arabis alpina]
Length=2849

 Score =   178 bits (451),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 144/242 (60%), Gaps = 17/242 (7%)
 Frame = -2

Query  822   KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
             KS  R +        RR+T  E+ K+T +F R  V+  GGF TVY G   D+ + A+K++
Sbjct  1851  KSETRSSNPSIISKDRRITYPEILKMTNNFDR--VLGKGGFGTVYHGNLDDAQV-AVKML  1907

Query  642   DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
               SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  1908  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLKENMSGK  1965

Query  462   GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GGG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G ++
Sbjct  1966  GGGNVLTWENRMQIAVEAAQGLEYLHNGCRPPMVHRDVKTTNILLNERSQAKLADFGLSR  2025

Query  282   MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
                S  +      +T  A         G+PGY DP Y RT   ++KSD+YS GV+LLE++
Sbjct  2026  ---SFPIDGECHVSTVVA---------GTPGYLDPDYYRTNWLSEKSDVYSYGVVLLEIV  2073

Query  102   TG  97
             T 
Sbjct  2074  TN  2075


 Score =   177 bits (450),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/273 (37%), Positives = 154/273 (56%), Gaps = 17/273 (6%)
 Frame = -2

Query  822   KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
             KS  R +        RR+   EV K+T +F R  V+  GGF TVY G   D+ + A+K++
Sbjct  1314  KSETRSSNPSIISKDRRIAYPEVLKMTNNFER--VLGKGGFGTVYHGNLDDAQV-AVKML  1370

Query  642   DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
               SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  1371  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLRENMSGK  1428

Query  462   GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GGG++L W NRM IA + AQ LEYLHD C P +VH D+K +NILL+     KL D+G ++
Sbjct  1429  GGGNILTWENRMQIAVEAAQGLEYLHDGCTPPMVHRDVKTTNILLNERSGAKLADFGLSR  1488

Query  282   MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
                S  +      +T  A         G+PGY DP Y RT   ++ SD+YS GV+LLE++
Sbjct  1489  ---SFPIDGECHVSTVVA---------GTPGYLDPEYYRTNWLSETSDVYSFGVVLLEIV  1536

Query  102   TGLEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
             T    +  +     I++   ++  +  +  +VD
Sbjct  1537  TNQPVIDKNRERTHINEWVGVMLSKGDIKNIVD  1569


 Score =   169 bits (427),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 143/239 (60%), Gaps = 19/239 (8%)
 Frame = -2

Query  792   TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTM  613
             TKE  R+ T  EV K+T +F R  V+  GGF TVY G   D+ + A+K++  SS + +  
Sbjct  788   TKE--RKFTYSEVLKMTNNFER--VLGKGGFGTVYHGNLDDTQV-AVKMLSHSSSQGYKE  842

Query  612   YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRN  433
             +K E+E+L R+ H ++V ++GY DD   ++  L++EY+ NG L+E L G   G+VL W  
Sbjct  843   FKAEVELLLRVHHRHLVGLVGYCDDG--DKLALIYEYMENGDLRENLLGKRRGNVLSWET  900

Query  432   RMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPP  253
             R+ IA + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G ++          
Sbjct  901   RLQIAVEAAQGLEYLHNGCRPPMVHRDVKPTNILLNERSQAKLADFGLSR----------  950

Query  252   SSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSD  76
               +     ++  M  + G+PGY DP Y RT   ++KSD+YS G++LLE++T    ++ +
Sbjct  951   --SFPVDGESHVMTVVAGTPGYLDPEYYRTNWLSEKSDVYSFGIVLLEIVTNQPVINKN  1007


 Score =   162 bits (410),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 95/251 (38%), Positives = 140/251 (56%), Gaps = 18/251 (7%)
 Frame = -2

Query  828   GRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIK  649
             GR  R  +    TK   RR T  EV  +T +F R  V+  GGF  VY G    +   A+K
Sbjct  2515  GRSPRSSEPAIMTKN--RRFTYSEVVTMTNNFQR--VLGKGGFGIVYHGFVNGTEQVAVK  2570

Query  648   IIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH  469
              +  SS + +  +K E+E+L R+ H N+V ++GY D EG E   L++EY+ NG L+E + 
Sbjct  2571  KLSHSSSQGYKQFKAEVELLLRVHHKNLVGLVGYCD-EG-ENLALIYEYMANGDLKEHMS  2628

Query  468   GNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGS  289
             G     +L W  R+ I  + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G 
Sbjct  2629  GTRNRLILNWGTRLKIVLESAQGLEYLHNGCKPPMVHRDVKTTNILLNEHFQAKLADFGL  2688

Query  288   AKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLE  109
             ++   S  ++  +  +T  A         G+PGY DP Y RT   T+KSD+YS G++LLE
Sbjct  2689  SR---SFPIEGETHVSTVVA---------GTPGYLDPEYYRTNWLTEKSDVYSFGIVLLE  2736

Query  108   LITGLEAVSSD  76
             +IT    ++ +
Sbjct  2737  IITNQPVINQN  2747


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 79/142 (56%), Gaps = 12/142 (8%)
 Frame = -2

Query  429  MGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPS  250
            M IA + AQ LEYLH+   P +VH D+K +NILL+   + KL D+G ++   SS V   S
Sbjct  1    MQIAMEAAQGLEYLHNGSIPPMVHRDVKTTNILLNELFHAKLADFGLSR---SSPVDGES  57

Query  249  STATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSN  70
              +T  A         G+PGY DP Y RT + ++KSD+YS GV+LLE++T    +  +  
Sbjct  58   YESTLVA---------GTPGYLDPEYYRTNLLSEKSDVYSFGVVLLEIVTNQPVIDKNRK  108

Query  69   VRLISKAGPMLKDESKVAGMVD  4
               I++    +  E  +  ++D
Sbjct  109  KPHITEWVRFMLMEGDIRNVID  130



>gb|ACN59249.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=648

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 142/242 (59%), Gaps = 17/242 (7%)
 Frame = -2

Query  822  KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
            KS  R +        R++T  EV K+T +F R  V+  GGF TVY G   D +  A+K++
Sbjct  315  KSETRSSNPSIITRERKITYPEVLKMTNNFER--VLGKGGFGTVYHGNL-DGAEVAVKML  371

Query  642  DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
              SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  372  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLRENMSGK  429

Query  462  GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G ++
Sbjct  430  RGGNVLTWENRMQIAVEAAQGLEYLHNGCRPPMVHRDVKTTNILLNERCGAKLADFGLSR  489

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
               S  +      +T  A         G+PGY DP Y RT   ++KSD+YS GV+LLE++
Sbjct  490  ---SFPIDGECHVSTVVA---------GTPGYLDPEYYRTNWLSEKSDVYSFGVVLLEIV  537

Query  102  TG  97
            T 
Sbjct  538  TN  539



>emb|CDY22871.1| BnaA06g02060D [Brassica napus]
Length=885

 Score =   176 bits (445),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 142/242 (59%), Gaps = 17/242 (7%)
 Frame = -2

Query  822  KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
            KS  R +        RR+T  EV K+T +F R  V+  GGF TVY G   D+ + A+K++
Sbjct  555  KSETRSSNPSIISKDRRITYSEVLKMTNNFQR--VLGKGGFGTVYHGNLDDAEV-AVKML  611

Query  642  DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
              SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  612  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLRENMSGK  669

Query  462  GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL      KL D+G ++
Sbjct  670  RGGNVLTWENRMQIAVESAQGLEYLHNGCRPPMVHRDVKTTNILLTERYGAKLADFGLSR  729

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
               S  +      +T  A         G+PGY DP Y RT   ++KSD+YS GV+LLE++
Sbjct  730  ---SFPIDGECHVSTVVA---------GTPGYLDPEYYRTNWLSEKSDVYSFGVVLLEIV  777

Query  102  TG  97
            T 
Sbjct  778  TN  779



>ref|XP_010500782.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51860 isoform X2 [Camelina sativa]
Length=865

 Score =   175 bits (444),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/247 (39%), Positives = 145/247 (59%), Gaps = 17/247 (7%)
 Frame = -2

Query  822  KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
            KS  R +        R++T  EV K+T +F R  V+  GGF TVY G   D+ + A+K++
Sbjct  532  KSETRSSNPSIMTKERKITYPEVLKMTNNFER--VLGKGGFGTVYHGNLDDAQV-AVKML  588

Query  642  DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
              SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  589  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLRENMSGK  646

Query  462  GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G ++
Sbjct  647  RGGNVLTWENRMQIAVEAAQGLEYLHNGCRPPMVHRDVKTTNILLNERCGAKLADFGLSR  706

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
               S  +      +T  A         G+PGY DP Y +T   ++KSD+YS GV+LLE++
Sbjct  707  ---SFPIDGECHVSTVVA---------GTPGYLDPEYYKTNWLSEKSDVYSFGVVLLEIV  754

Query  102  TGLEAVS  82
            T    ++
Sbjct  755  TNQPVIN  761



>ref|XP_011084596.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Sesamum 
indicum]
Length=412

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/250 (39%), Positives = 135/250 (54%), Gaps = 19/250 (8%)
 Frame = -2

Query  744  TVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNI  565
            T +F+   V+  GG   VY   F D    A+K I  + +     Y+ E+ +L RI+H NI
Sbjct  114  TNNFNEGNVVGEGGLGRVYKAYFNDHLRAAVKKIYAAGQEAEREYENEVHLLSRIQHQNI  173

Query  564  VKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLH  385
            V +LGY      E   LV+E + NG+L+  LHG    S L W  RM IA  +A+ LEYLH
Sbjct  174  VSLLGYCIHG--EARFLVYELMENGSLESHLHGPSCRSALTWHQRMKIALDVARGLEYLH  231

Query  384  DKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTM  205
            + C+P ++H DLK SNILLD   N K+ D+G A  G +S              N+T + +
Sbjct  232  EHCNPPVIHRDLKPSNILLDPNFNAKISDFGLAIAGGNS--------------NKTNIKL  277

Query  204  FGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAGPMLK  34
             G+ GY  P YL  G  T KSD+Y+ GV+LLEL+ G   +E V       +++ A P L 
Sbjct  278  TGTLGYVAPEYLLDGKLTDKSDVYAFGVVLLELLMGRRPVERVDETQCQSIVTWASPQLT  337

Query  33   DESKVAGMVD  4
            D SK+  +VD
Sbjct  338  DRSKLPNIVD  347



>ref|XP_002979859.1| hypothetical protein SELMODRAFT_111388 [Selaginella moellendorffii]
 gb|EFJ19261.1| hypothetical protein SELMODRAFT_111388 [Selaginella moellendorffii]
Length=398

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/281 (36%), Positives = 152/281 (54%), Gaps = 20/281 (7%)
 Frame = -2

Query  828  GRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIK  649
             R  R+      +   A+  T K++Q  T +F+ S  +  GGF +V+ G  PD    AIK
Sbjct  48   ARAPRQEGTYNGSTSEAQVFTYKQMQAATNNFTTSNEVGQGGFGSVFRGVLPDGRTAAIK  107

Query  648  IIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH  469
             +D   K+    ++ E+++L R+   ++++++GY  D+  E  +LV+E++PNG++QE LH
Sbjct  108  QLDRGGKQGDREFRVEVDMLSRLHSPHLLELIGYCADQ--EHRLLVYEFMPNGSVQEHLH  165

Query  468  GNGGG---SVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCD  298
             +G      +L W  RM +A   A+ LEYLH+   P I+H D K SNILL+ + N K+ D
Sbjct  166  SDGTSGRPPMLDWDTRMRVALDAARGLEYLHEMVSPPIIHRDFKSSNILLNDKYNAKVSD  225

Query  297  YGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVI  118
            +G AK+G        S  A      R +    G+ GY  P Y  TG  T KSD+YS GV+
Sbjct  226  FGLAKLG--------SDKAGGHVSTRVL----GTQGYVAPEYALTGHLTTKSDVYSFGVV  273

Query  117  LLELITGLEAVS---SDSNVRLISKAGPMLKDESKVAGMVD  4
            LLEL+TG   V          L+S A P L D +K+  ++D
Sbjct  274  LLELLTGRVPVDMKRPPGEGVLVSWALPRLTDRNKMVEIID  314



>ref|XP_010500781.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51860 isoform X1 [Camelina sativa]
Length=889

 Score =   176 bits (445),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/255 (39%), Positives = 151/255 (59%), Gaps = 19/255 (7%)
 Frame = -2

Query  846  MAFGCLGRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDS  667
            +A G +  ++R       TKE  R++T  EV K+T +F R  V+  GGF TVY G   D+
Sbjct  550  VASGIVKSETRSSNPSIMTKE--RKITYPEVLKMTNNFER--VLGKGGFGTVYHGNLDDA  605

Query  666  SLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGT  487
             + A+K++  SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG 
Sbjct  606  QV-AVKMLSHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGD  662

Query  486  LQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCK  307
            L+E + G  GG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL+     K
Sbjct  663  LRENMSGKRGGNVLTWENRMQIAVEAAQGLEYLHNGCRPPMVHRDVKTTNILLNERCGAK  722

Query  306  LCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSL  127
            L D+G ++   S  +      +T  A         G+PGY DP Y +T   ++KSD+YS 
Sbjct  723  LADFGLSR---SFPIDGECHVSTVVA---------GTPGYLDPEYYKTNWLSEKSDVYSF  770

Query  126  GVILLELITGLEAVS  82
            GV+LLE++T    ++
Sbjct  771  GVVLLEIVTNQPVIN  785



>gb|EEE63242.1| hypothetical protein OsJ_18052 [Oryza sativa Japonica Group]
Length=539

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/304 (35%), Positives = 157/304 (52%), Gaps = 44/304 (14%)
 Frame = -2

Query  831  LGRKSRRRKAEKDTKES----------------ARRLTRK---------EVQKLTVDFSR  727
            L R+SRR    K T+ S                + +++RK          ++  T  FS 
Sbjct  185  LWRRSRRSTGGKVTRSSDAAKGIKLVPILSRFNSVKMSRKRLVGMFEYPSLEAATEKFSE  244

Query  726  SRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGY  547
            S ++  GGF  VY   F      A+K +D         ++ EL++L RIRH NIV +LG+
Sbjct  245  SNMLGVGGFGRVYKAAFDAGVTAAVKRLDGGGPDCEKEFENELDLLGRIRHPNIVSLLGF  304

Query  546  SDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQ  367
               EG     +V+E +  G+L+ +LHG+  GS L W  RM IA   A+ LEYLH+ C P 
Sbjct  305  CIHEG--NHYIVYELMEKGSLETQLHGSSHGSTLSWHIRMKIALDTARGLEYLHEHCSPP  362

Query  366  IVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGY  187
            ++H DLK SNILLDS+ N K+ D+G A               ++ + N+  + + G+ GY
Sbjct  363  VIHRDLKSSNILLDSDFNAKIADFGLA--------------VSSGSVNKGSVKLSGTLGY  408

Query  186  TDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAGPMLKDESKVA  16
              P YL  G  T+KSD+Y+ GV+LLEL+ G   +E +S      +++ A P L D SK+ 
Sbjct  409  VAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVTWAMPQLTDRSKLP  468

Query  15   GMVD  4
             +VD
Sbjct  469  SIVD  472



>ref|XP_010479692.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51860 [Camelina sativa]
Length=889

 Score =   176 bits (445),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/247 (39%), Positives = 145/247 (59%), Gaps = 17/247 (7%)
 Frame = -2

Query  822  KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
            KS  R +        R++T  EV K+T +F R  V+  GGF TVY G   D+ + A+K++
Sbjct  556  KSETRSSNPSIMTKERKITYPEVLKMTNNFER--VLGKGGFGTVYHGNLDDAQV-AVKML  612

Query  642  DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
              SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  613  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLRENMSGK  670

Query  462  GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G ++
Sbjct  671  RGGNVLTWENRMQIAVEAAQGLEYLHNGCRPPMVHRDVKTTNILLNERCGAKLADFGLSR  730

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
               S  +      +T  A         G+PGY DP Y +T   ++KSD+YS GV+LLE++
Sbjct  731  ---SFPIDGECHVSTVVA---------GTPGYLDPEYYKTNWLSEKSDVYSFGVVLLEIV  778

Query  102  TGLEAVS  82
            T    ++
Sbjct  779  TNQPVIN  785



>ref|XP_008658206.1| PREDICTED: uncharacterized LOC100217243 isoform X1 [Zea mays]
 gb|AFW87264.1| putative protein kinase superfamily protein [Zea mays]
Length=465

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/254 (38%), Positives = 140/254 (55%), Gaps = 19/254 (7%)
 Frame = -2

Query  756  VQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIR  577
            ++  T +FS S V+  GGF  VY   F      A+K ++         ++ EL++L RIR
Sbjct  161  LEAATGEFSESNVLGVGGFGCVYKAVFDGGVTAAVKRLEGGGPECEKEFENELDLLGRIR  220

Query  576  HDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVL  397
            H NIV +LG+   EG     +V+E +  G+L  +LHG   GS L W  RM IA  +A+ L
Sbjct  221  HPNIVSLLGFCVHEG--NHYIVYELMEKGSLDTQLHGASHGSALTWHIRMKIALDMARGL  278

Query  396  EYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRT  217
            EYLH+ C P ++H DLK SNILLDS+ N K+ D+G A               T+   ++ 
Sbjct  279  EYLHEHCSPPVIHRDLKSSNILLDSDFNAKISDFGLA--------------VTSGNIDKG  324

Query  216  MMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVR---LISKAG  46
             M + G+ GY  P YL  G  T+KSD+Y+ GV+LLEL+ G + V   S  +   +++ A 
Sbjct  325  SMKLSGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSQTQCQSIVTWAM  384

Query  45   PMLKDESKVAGMVD  4
            P L D +K+  +VD
Sbjct  385  PQLTDRTKLPNIVD  398



>ref|XP_010516519.1| PREDICTED: serine/threonine-protein kinase PBS1-like [Camelina 
sativa]
Length=400

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/276 (39%), Positives = 147/276 (53%), Gaps = 21/276 (8%)
 Frame = -2

Query  810  RKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSS  631
            +K +  T    +  T K++   T  FS+S V+  GGF  VY G   D    AIK +D + 
Sbjct  62   QKVQDLTGNGLQIFTFKQLHSATGGFSKSNVVGHGGFGLVYRGVLNDGRKVAIKFMDHAG  121

Query  630  KRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH-GNGGG  454
            K+    +K E+E+L R+R   ++ +LGY  D      +LV+E++ NG LQE L+  N  G
Sbjct  122  KQGEEEFKMEVELLSRLRSPYLLALLGYCSDN--SHKLLVYEFMANGGLQEHLYLNNRSG  179

Query  453  SVLP---WRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
            SV P   W  RM IA + A+ LEYLH++  P ++H D K SNILLD   N K+ D+G AK
Sbjct  180  SVAPRLDWETRMRIALEAAKGLEYLHEQVSPPVIHRDFKSSNILLDRNFNAKVSDFGLAK  239

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
            +G        S  A      R +    G+ GY  P Y  TG  T KSD+YS GV+LLEL+
Sbjct  240  VG--------SDKAGGHVSTRVL----GTQGYVAPEYALTGHLTTKSDVYSYGVVLLELL  287

Query  102  TGLEAVS---SDSNVRLISKAGPMLKDESKVAGMVD  4
            TG   V    +     L+S A P L D  KV  ++D
Sbjct  288  TGRVPVDMKRAAGEGVLVSWALPQLADREKVVDIMD  323



>emb|CAB88286.1| serine/threonine-specific protein kinase-like protein [Arabidopsis 
thaliana]
Length=386

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/276 (39%), Positives = 149/276 (54%), Gaps = 21/276 (8%)
 Frame = -2

Query  810  RKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSS  631
            +K +  T+   +  T K++   T  FS+S V+  GGF  VY G   D    AIK++D + 
Sbjct  48   QKVQDVTENGLQIFTFKQLHSATGGFSKSNVVGNGGFGLVYRGVLNDGRKVAIKLMDHAG  107

Query  630  KRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH-GNGGG  454
            K+    +K E+E+L R+R   ++ +LGY  D      +LV+E++ NG LQE L+  N  G
Sbjct  108  KQGEEEFKMEVELLSRLRSPYLLALLGYCSDN--SHKLLVYEFMANGGLQEHLYLPNRSG  165

Query  453  SVLP---WRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
            SV P   W  RM IA + A+ LEYLH++  P ++H D K SNILLD   N K+ D+G AK
Sbjct  166  SVPPRLDWETRMRIAVEAAKGLEYLHEQVSPPVIHRDFKSSNILLDRNFNAKVSDFGLAK  225

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
            +G        S  A      R +    G+ GY  P Y  TG  T KSD+YS GV+LLEL+
Sbjct  226  VG--------SDKAGGHVSTRVL----GTQGYVAPEYALTGHLTTKSDVYSYGVVLLELL  273

Query  102  TGLEAVS---SDSNVRLISKAGPMLKDESKVAGMVD  4
            TG   V    +     L+S A P L D  KV  ++D
Sbjct  274  TGRVPVDMKRATGEGVLVSWALPQLADRDKVVDIMD  309



>gb|ACN35389.1| unknown [Zea mays]
 gb|AFW66814.1| putative protein kinase superfamily protein [Zea mays]
Length=374

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/266 (41%), Positives = 151/266 (57%), Gaps = 23/266 (9%)
 Frame = -2

Query  789  KESA-RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIID-TSSKRLHT  616
            KE A RRL  +EV+ LT  F  + V+  GG STVYL +  D S  A+K+      +R   
Sbjct  61   KEPAPRRLAWREVEALTGGFDEAAVVGRGGSSTVYLARLLDGSPVAVKVHRWCGGERRLR  120

Query  615  MYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWR  436
             ++QEL++L+R+RH +IV +L YSDD   +EG LV EY+  GTL + LHG      LPW 
Sbjct  121  AFRQELDLLRRLRHPHIVALLAYSDDH-EDEGALVLEYLGGGTLADALHGTAAAP-LPWA  178

Query  435  NRMGIAFQLAQVLEYLHDKCD--PQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTV  262
             RM +   +A  LE+LH        +VHGD+  SN+LL S+   +LCD GSA  GFS+ V
Sbjct  179  QRMRVLHDVACALEHLHGGGGGGASVVHGDVSASNVLL-SDGGVRLCDLGSACEGFSAAV  237

Query  261  QPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVS  82
             P  +   +              GY DP +LRTGI + +SD+Y  GV+LLE +TGL A S
Sbjct  238  APARAAVASP-------------GYADPFFLRTGIVSSRSDVYGFGVLLLEAVTGLPAAS  284

Query  81   SDSNVRLISKAGPMLKDESKVAGMVD  4
               N  L ++  P ++    VAG+VD
Sbjct  285  EAEN--LTARILPRVRARG-VAGLVD  307



>ref|XP_010545651.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51820 [Tarenaya hassleriana]
Length=899

 Score =   175 bits (444),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 143/251 (57%), Gaps = 18/251 (7%)
 Frame = -2

Query  828  GRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIK  649
            GR  +  +    TK   R+    EVQ +T +F R  V+  GGF  VY G   D+    +K
Sbjct  564  GRSPQSSQPSIVTKN--RKFVYSEVQAMTNNFER--VLGKGGFGVVYHGYVNDTEQVVVK  619

Query  648  IIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH  469
            ++  SS + +  +K E+E+L R+ H N+V ++GY D EG E   L++EY+ NG L+E L 
Sbjct  620  MLSQSSAQGYKQFKAEVELLLRVHHKNLVSLVGYCD-EG-ENLALIYEYMANGDLKEHLS  677

Query  468  GNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGS  289
            G  GGSVL W  R+ I  + AQ LEYLH+ C P +VH D+K +NILL+  L  KL D+G 
Sbjct  678  GKRGGSVLSWGTRLKIVAEAAQGLEYLHNGCKPPMVHRDVKTTNILLNEHLQAKLADFGL  737

Query  288  AKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLE  109
            ++  F +  +   ST  A           G+PGY DP Y RT   T+KSD+YS G++LLE
Sbjct  738  SR-SFPTEGETHVSTVVA-----------GTPGYLDPEYYRTNWLTEKSDVYSFGIVLLE  785

Query  108  LITGLEAVSSD  76
            +IT    V  +
Sbjct  786  IITNRPVVEQN  796



>ref|XP_011033754.1| PREDICTED: serine/threonine-protein kinase CDL1 [Populus euphratica]
Length=398

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 102/263 (39%), Positives = 144/263 (55%), Gaps = 21/263 (8%)
 Frame = -2

Query  771  LTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEI  592
             T K++Q  T  FS+S V+ +GGF  VY G   D    AIK++D + K+    +K E+E+
Sbjct  76   FTFKQLQSATGGFSKSNVVGYGGFGLVYRGVLSDGRKVAIKLMDQAGKQGEEEFKVEVEL  135

Query  591  LQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH----GNGGGSVLPWRNRMG  424
            L R+    ++ +LGY  D+     VLV+E++PNG LQE LH     N     L W  R+ 
Sbjct  136  LSRLHSPYLLALLGYCSDDN--HKVLVYEFMPNGGLQEHLHHITSSNTVSVSLDWETRLR  193

Query  423  IAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSST  244
            IA + A+ LEYLH+  +P ++H D K SNILLD  L+ K+ D+G AK+G      P  + 
Sbjct  194  IALEAAKGLEYLHEHVNPPVIHRDFKSSNILLDRNLHAKVSDFGLAKLG------PDKAG  247

Query  243  ATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNV-  67
               + +      + G+ GY  P Y  TG  T KSD+YS GV+LLEL+TG   V       
Sbjct  248  GHVSTR------VLGTQGYIAPEYALTGHLTTKSDVYSYGVVLLELLTGRVPVDIKRPAG  301

Query  66   --RLISKAGPMLKDESKVAGMVD  4
               L+S A P L D  KV  ++D
Sbjct  302  EGVLVSWALPRLTDREKVVEIMD  324



>ref|XP_010419655.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Camelina sativa]
Length=427

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 160/282 (57%), Gaps = 22/282 (8%)
 Frame = -2

Query  837  GCLGRKSRRRKAEKDTKESARRLTRKE-VQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSL  661
            GC G  S +   +K TK+    L   + ++K T  F  S ++  GGF  VYL    +++ 
Sbjct  100  GC-GFTSSKTLDKKTTKQGMVSLIDYDMIEKGTSGFKESNILGQGGFGCVYLATLENNTQ  158

Query  660  GAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQ  481
             A+K +D +++     YK E+EIL +++H NI+ +LGYS ++      +V+E +PN +L+
Sbjct  159  AAVKKLDCANEEAAKEYKSEVEILSKLKHPNIISLLGYSTNDTAR--FIVYELMPNVSLE  216

Query  480  EKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLC  301
              LHG   GS + W  RM IA  +++ LEYLH+ C P I+H DLK SNILLDS  N K+ 
Sbjct  217  SHLHGASHGSTITWPMRMKIALDISRGLEYLHEHCHPAIIHRDLKSSNILLDSNFNAKIS  276

Query  300  DYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGV  121
            D+G A       V  P        KN+ +  + G+ GY  P YL  G  T+KSD+Y+ GV
Sbjct  277  DFGLA------VVDGP--------KNK-IHKLSGTVGYVAPEYLLDGQLTEKSDVYAFGV  321

Query  120  ILLELITG---LEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
            +LLEL+ G   +E ++      +I+ A P L D +K+ G++D
Sbjct  322  VLLELLLGKKPVEKLAPGECQSIITWAMPYLTDRTKLPGVID  363



>ref|XP_010504826.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Camelina sativa]
Length=409

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 107/276 (39%), Positives = 147/276 (53%), Gaps = 21/276 (8%)
 Frame = -2

Query  810  RKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSS  631
            +K +  T    +  T K++   T  FS+S V+  GGF  VY G   D    AIK +D + 
Sbjct  62   QKVQDLTDNGLQIFTFKQLHSATGGFSKSNVVGHGGFGLVYRGVLNDGRKVAIKFMDHAG  121

Query  630  KRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH-GNGGG  454
            K+    +K E+E+L R+R   ++ +LGY  D      +LV+E++ NG LQE L+  N  G
Sbjct  122  KQGEEEFKMEVELLSRLRSPYLLALLGYCSDN--RHKLLVYEFMANGGLQEHLYLNNRSG  179

Query  453  SVLP---WRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
            SV P   W  RM IA + A+ LEYLH++  P ++H D K SNILLD   N K+ D+G AK
Sbjct  180  SVPPRLDWETRMRIALEAAKGLEYLHEQVSPPVIHRDFKSSNILLDRNFNAKVSDFGLAK  239

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
            +G        S  A      R +    G+ GY  P Y  TG  T KSD+YS GV+LLEL+
Sbjct  240  VG--------SDKAGGHVSTRVL----GTQGYVAPEYALTGHLTTKSDVYSYGVVLLELL  287

Query  102  TGLEAVS---SDSNVRLISKAGPMLKDESKVAGMVD  4
            TG   V    +     L+S A P L D  KV  ++D
Sbjct  288  TGRVPVDMKRATGEGVLVSWALPQLADREKVVDIMD  323



>ref|NP_001148336.1| phytosulfokine receptor precursor [Zea mays]
 gb|ACG30844.1| phytosulfokine receptor precursor [Zea mays]
Length=449

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/254 (38%), Positives = 139/254 (55%), Gaps = 19/254 (7%)
 Frame = -2

Query  756  VQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIR  577
            ++  T  FS S V+  GGF  VY   F      A+K ++         ++ EL++L RIR
Sbjct  145  LEAATGKFSASNVLGVGGFGCVYKAVFDGGVAAAVKRLEAGGPECEKEFENELDLLGRIR  204

Query  576  HDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVL  397
            H NIV +LG+   EG     +V+E +  G+L  +LHG   GS L W  RM IA  +A+ L
Sbjct  205  HPNIVTLLGFCVHEG--NHYIVYELMHKGSLDTQLHGASRGSALSWHVRMKIALDMARGL  262

Query  396  EYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRT  217
            EYLH+ C P ++H DLK SNILLDS+ N K+ D+G A               T+   ++ 
Sbjct  263  EYLHEHCSPPVIHRDLKSSNILLDSDFNAKISDFGLA--------------VTSGNIDKG  308

Query  216  MMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVR---LISKAG  46
             M + G+ GY  P YL  G  T+KSD+Y+ GV+LLEL+ G + V   S  +   +++ A 
Sbjct  309  SMKLSGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSQTQCQSIVTWAM  368

Query  45   PMLKDESKVAGMVD  4
            P L D +K+  +VD
Sbjct  369  PQLTDRTKLPNIVD  382



>ref|XP_010427774.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Camelina sativa]
Length=409

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 107/276 (39%), Positives = 147/276 (53%), Gaps = 21/276 (8%)
 Frame = -2

Query  810  RKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSS  631
            +K +  T    +  T K++   T  FS+S V+  GGF  VY G   D    AIK +D + 
Sbjct  62   QKVQDLTGNGLQIFTFKQLHSATGGFSKSNVVGHGGFGLVYRGVLNDGRKVAIKFMDHAG  121

Query  630  KRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH-GNGGG  454
            K+    +K E+E+L R+R   ++ +LGY  D      +LV+E++ NG LQE L+  N  G
Sbjct  122  KQGEEEFKMEVELLSRLRSPYLLALLGYCSDN--SHKLLVYEFMANGGLQEHLYLNNRSG  179

Query  453  SVLP---WRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
            SV P   W  RM IA + A+ LEYLH++  P ++H D K SNILLD   N K+ D+G AK
Sbjct  180  SVPPRLDWETRMRIALEAAKGLEYLHEQVSPPVIHRDFKSSNILLDRNFNAKVSDFGLAK  239

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
            +G        S  A      R +    G+ GY  P Y  TG  T KSD+YS GV+LLEL+
Sbjct  240  VG--------SDKAGGHVSTRVL----GTQGYVAPEYALTGHLTTKSDVYSYGVVLLELL  287

Query  102  TGLEAVS---SDSNVRLISKAGPMLKDESKVAGMVD  4
            TG   V    +     L+S A P L D  KV  ++D
Sbjct  288  TGRVPVDMKRATGEGVLVSWALPQLADREKVVDIMD  323



>ref|NP_191428.3| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE79818.1| protein kinase family protein [Arabidopsis thaliana]
Length=400

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 107/276 (39%), Positives = 149/276 (54%), Gaps = 21/276 (8%)
 Frame = -2

Query  810  RKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSS  631
            +K +  T+   +  T K++   T  FS+S V+  GGF  VY G   D    AIK++D + 
Sbjct  62   QKVQDVTENGLQIFTFKQLHSATGGFSKSNVVGNGGFGLVYRGVLNDGRKVAIKLMDHAG  121

Query  630  KRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLH-GNGGG  454
            K+    +K E+E+L R+R   ++ +LGY  D      +LV+E++ NG LQE L+  N  G
Sbjct  122  KQGEEEFKMEVELLSRLRSPYLLALLGYCSDN--SHKLLVYEFMANGGLQEHLYLPNRSG  179

Query  453  SVLP---WRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
            SV P   W  RM IA + A+ LEYLH++  P ++H D K SNILLD   N K+ D+G AK
Sbjct  180  SVPPRLDWETRMRIAVEAAKGLEYLHEQVSPPVIHRDFKSSNILLDRNFNAKVSDFGLAK  239

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
            +G        S  A      R +    G+ GY  P Y  TG  T KSD+YS GV+LLEL+
Sbjct  240  VG--------SDKAGGHVSTRVL----GTQGYVAPEYALTGHLTTKSDVYSYGVVLLELL  287

Query  102  TGLEAVS---SDSNVRLISKAGPMLKDESKVAGMVD  4
            TG   V    +     L+S A P L D  KV  ++D
Sbjct  288  TGRVPVDMKRATGEGVLVSWALPQLADRDKVVDIMD  323



>ref|XP_009405342.1| PREDICTED: probable receptor-like protein kinase At1g49730 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=676

 Score =   173 bits (439),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/258 (39%), Positives = 149/258 (58%), Gaps = 17/258 (7%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQEL  598
            RR   KE++K T +FS   VI  GGF TVY  +F D  + A+K +D  SK+    + +E+
Sbjct  316  RRFAYKEMKKATENFST--VIGKGGFGTVYKAQFVDGPIAAVKRMDKVSKQGEEEFCREI  373

Query  597  EILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIA  418
            E+L R+ H ++V + G+  +    E  LV+EY+ NG+L++ LH +G    L WR R+ IA
Sbjct  374  ELLARLHHRHLVALKGFCAERN--ERFLVYEYMENGSLKDHLHSSGRKR-LSWRTRLQIA  430

Query  417  FQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTAT  238
              +A  LEYLH  CDP + H D+K SNILLD +   K+ D+G A           +S + 
Sbjct  431  IDVANALEYLHFYCDPPLCHRDIKSSNILLDEKFVAKVADFGLAH----------ASRSD  480

Query  237  ATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLI  58
            A +       + G+PGY DP Y+ T   T+KSDIYS GV+LLEL++G  A+  + N  L+
Sbjct  481  AISFEPVNTDIRGTPGYMDPEYVVTQELTEKSDIYSYGVLLLELVSGRRAIHENRN--LV  538

Query  57   SKAGPMLKDESKVAGMVD  4
              +   L  +S++  +VD
Sbjct  539  EWSQKFLATDSRLPELVD  556



>emb|CAN79180.1| hypothetical protein VITISV_019748 [Vitis vinifera]
Length=453

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/247 (39%), Positives = 140/247 (57%), Gaps = 16/247 (6%)
 Frame = -2

Query  744  TVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNI  565
            T +FS S V+  GG   VY  +F ++ L A+K ++   +     ++ E++ L +I+H NI
Sbjct  155  TNNFSESNVLGEGGSGRVYKARFNENFLAAVKRLERGGQDGEREFENEVDWLSKIQHQNI  214

Query  564  VKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLH  385
            V +LG       E   LV+E + NG+L+ +LHG   GS L W  RM IA  +A+ LEYLH
Sbjct  215  VSLLGCCIHG--ETRFLVYEMMQNGSLEAQLHGPSHGSTLTWHLRMKIAVDVARGLEYLH  272

Query  384  DKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTM  205
            + C+P ++H DLK SNILLDS+ N KL D+G A               T+  +N+  + +
Sbjct  273  EHCNPPVIHRDLKSSNILLDSDFNAKLSDFGLA--------------ITSGTQNKNNLKL  318

Query  204  FGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISKAGPMLKDES  25
             G+ GY  P YL  G  T KSD+Y+ GVILLEL+ G + V   ++    S A P L D S
Sbjct  319  SGTVGYVAPEYLLDGKLTDKSDVYAFGVILLELLMGRKPVEKMASAECQSIAMPQLTDRS  378

Query  24   KVAGMVD  4
            K+  +VD
Sbjct  379  KLPNIVD  385



>ref|XP_007023374.1| Serine/threonine-protein kinase PBS1 isoform 2 [Theobroma cacao]
 gb|EOY25996.1| Serine/threonine-protein kinase PBS1 isoform 2 [Theobroma cacao]
Length=463

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 139/250 (56%), Gaps = 20/250 (8%)
 Frame = -2

Query  744  TVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNI  565
            T +F  S V+  GG   VY   F +  L A+K +D   +     ++ ELE L +I+H NI
Sbjct  156  TNNFQESNVLGEGGRGRVYKAHFDEKFLAAVKKLDGGGQDAEREFENELEWLVKIQHQNI  215

Query  564  VKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLH  385
            V +LGY      E  +LV+E + NG+L+ +LHG   GS L W  RM IA  +A+ LE+LH
Sbjct  216  VSLLGYCIHG--ETRLLVYEMMQNGSLESQLHGPTQGSALTWHLRMKIAIDVARALEHLH  273

Query  384  DKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTM  205
            + C P +VH D+K SNILLDS  N KL D+G A               T  ++N+  + +
Sbjct  274  EHCSPPVVHRDIKSSNILLDSNFNAKLSDFGLA--------------VTTGSQNKN-VKL  318

Query  204  FGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAGPMLK  34
             G+ GY  P YL  G  T KSD+Y+ GV+LLEL+ G   LE +S      L++ A P L 
Sbjct  319  SGTLGYVAPEYLLEGKLTDKSDVYAFGVVLLELLIGKKPLEKMSPTQCQSLVTWAMPQLT  378

Query  33   DESKVAGMVD  4
            D SK+  +VD
Sbjct  379  DRSKLPNIVD  388



>gb|EEC79556.1| hypothetical protein OsI_20681 [Oryza sativa Indica Group]
Length=958

 Score =   175 bits (444),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 109/283 (39%), Positives = 155/283 (55%), Gaps = 21/283 (7%)
 Frame = -2

Query  846  MAFGCLGRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDS  667
            M +G     SR   +    +   RR T  E++K+T  F R  V+  GGF  VY G   D 
Sbjct  620  MRYGPTNNGSRHNSS---LRLENRRFTYNELEKITNKFQR--VLGQGGFGKVYDGFLEDG  674

Query  666  SLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGT  487
            +  A+K+   SS +    +  E +IL RI H N+V ++GY  DE  +   LV+EY+  GT
Sbjct  675  TEVAVKVRTESSNQGDKEFLVEAQILTRIHHKNLVSMIGYCKDE--KYMALVYEYMSEGT  732

Query  486  LQEKLHGNGG-GSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNC  310
            LQE + G G  G  L W+ R+ IA + AQ LEYLH  C+P ++H D+KG+NILL++ L  
Sbjct  733  LQEHIAGKGNDGRYLTWKERLRIALESAQGLEYLHKGCNPPLIHRDVKGTNILLNTRLEA  792

Query  309  KLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYS  130
            K+ D+G +K+       P + T  +T K      + G+PGY DP Y  T   T KSD+YS
Sbjct  793  KIADFGLSKV-----FNPENGTHVSTNK------LVGTPGYVDPEYQSTMQPTTKSDVYS  841

Query  129  LGVILLELITGLEAVSSDSN-VRLISKAGPMLKDESKVAGMVD  4
             GV+LLEL+TG  A+  D   + +I  A   L     + G+VD
Sbjct  842  FGVVLLELVTGKPAILRDPEPISIIHWAQQRLA-RGNIEGVVD  883



>ref|XP_011073359.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Sesamum indicum]
Length=447

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 138/250 (55%), Gaps = 19/250 (8%)
 Frame = -2

Query  744  TVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNI  565
            T +F  + ++  GG   VY   F D S  A+K I    +     ++ E+E L +I+H NI
Sbjct  151  TNNFDEANILGEGGLGRVYKAHFNDHSHAAVKKIYAGGQEAEREFENEVEALSKIQHQNI  210

Query  564  VKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLH  385
            V +LGY      E   LV+E + NG+L+  LHG    S L W  RM IA  +A+ LEYLH
Sbjct  211  VSLLGYCIHG--EARFLVYEMMENGSLEFHLHGPSPRSTLTWHLRMKIALDVARGLEYLH  268

Query  384  DKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTM  205
            ++C+P ++H DLK SNILLDS  N KL D+G A  G +S              N+T + +
Sbjct  269  ERCNPPVIHRDLKSSNILLDSNFNAKLSDFGLAITGGNS--------------NKTNVKL  314

Query  204  FGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAGPMLK  34
             G+ GY  P YL  G  T KSD+Y+ GV+LLEL+TG   +E V+      + + A P L 
Sbjct  315  SGTLGYVAPEYLLDGKLTDKSDVYAFGVVLLELLTGRRPVERVAEAQCQSITTWAMPQLT  374

Query  33   DESKVAGMVD  4
            D SK+  +VD
Sbjct  375  DRSKLPSIVD  384



>emb|CDY45651.1| BnaA05g15180D, partial [Brassica napus]
Length=869

 Score =   174 bits (442),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 143/242 (59%), Gaps = 17/242 (7%)
 Frame = -2

Query  822  KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
            KS  R +        RR+T  EV ++T +F R  V+  GGF TVY G   D+ + A+K++
Sbjct  558  KSETRPSNPSIITKDRRITYPEVLRMTNNFQR--VLGKGGFGTVYHGDLDDAQV-AVKML  614

Query  642  DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
              SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  615  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLRENMSGK  672

Query  462  GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G ++
Sbjct  673  CGGNVLTWENRMQIAVEAAQGLEYLHNGCRPPMVHRDVKTTNILLNERSGAKLADFGLSR  732

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
               S  +      +T  A         G+PGY DP Y RT   ++KSD+YS GV+LLE++
Sbjct  733  ---SFPIDGECHVSTVVA---------GTPGYLDPEYYRTNWLSEKSDVYSFGVVLLEIV  780

Query  102  TG  97
            T 
Sbjct  781  TN  782



>ref|XP_009147725.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51860 [Brassica rapa]
Length=885

 Score =   174 bits (442),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 142/242 (59%), Gaps = 17/242 (7%)
 Frame = -2

Query  822  KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
            KS  R +        RR+T  EV K+T +F R  V+  GGF TVY G   D+ + A+K++
Sbjct  555  KSETRSSNPSIISKDRRITYSEVLKMTNNFQR--VLGKGGFGTVYHGNLDDAEV-AVKML  611

Query  642  DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
              SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  612  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLRENMSGK  669

Query  462  GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GG+V+ W NRM IA + AQ LEYLH+ C P +VH D+K +NILL      KL D+G ++
Sbjct  670  RGGNVITWENRMQIAVESAQGLEYLHNGCRPPMVHRDVKTTNILLTERYGAKLADFGLSR  729

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
               S  +      +T  A         G+PGY DP Y RT   ++KSD+YS GV+LLE++
Sbjct  730  ---SFPIDGECHVSTVVA---------GTPGYLDPEYYRTNWLSEKSDVYSFGVVLLEIV  777

Query  102  TG  97
            T 
Sbjct  778  TN  779



>ref|XP_009410925.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Musa acuminata 
subsp. malaccensis]
Length=411

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 143/261 (55%), Gaps = 22/261 (8%)
 Frame = -2

Query  762  KEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQR  583
            K++   T  F +  V+  G F +VY G  PD    A+K++D+  K+    +K E+E+L R
Sbjct  88   KQLHTATGGFGKGNVVGHGSFGSVYRGALPDGRKVAVKLMDSGGKQGEEEFKMEVELLTR  147

Query  582  IRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV-----LPWRNRMGIA  418
            +R   ++ ++GY  + G    +LV+EY+ +G+LQE L+  GGGS      L W  RM IA
Sbjct  148  LRSAYLLGLIGYCSEGG--HRLLVYEYMASGSLQEHLYPTGGGSYGGVSNLEWETRMKIA  205

Query  417  FQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTAT  238
             + A+ LEYLH++ +P ++H D K SNILLD     K+ D+G AK G        S  A 
Sbjct  206  LEAAKGLEYLHEEVNPPVIHRDFKSSNILLDKNFRAKVSDFGLAKFG--------SEKAG  257

Query  237  ATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSD---SNV  67
                 R +    G+ GY  P Y  TG  T KSD+YS GV+LLEL+TG   V  +      
Sbjct  258  GHVSTRVL----GTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLTGRIPVDMNRPPGEG  313

Query  66   RLISKAGPMLKDESKVAGMVD  4
             L+S A P L D  KVA ++D
Sbjct  314  VLVSWALPRLTDREKVAQIMD  334



>ref|XP_004135868.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Cucumis sativus]
 ref|XP_004173587.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Cucumis sativus]
Length=441

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 104/265 (39%), Positives = 146/265 (55%), Gaps = 20/265 (8%)
 Frame = -2

Query  789  KESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMY  610
            K S   +  K ++  T +FS+S V+  GG   VY   F D  L A+K ID         +
Sbjct  127  KGSVSTIDYKLLEAATDNFSKSNVLGEGGSGHVYKACFNDKLLAAVKRIDNGGLDAEREF  186

Query  609  KQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNR  430
            + E+  L +IRH N++K+LG+      E   LV+E + NG+L+ +LHG   GS L W  R
Sbjct  187  ENEVNWLSKIRHQNVIKLLGHCIHG--ETRFLVYEMMQNGSLESQLHGPSHGSALTWHIR  244

Query  429  MGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPS  250
            M IA  +A+ LEYLH+  +P +VH DLK SNILLDS+ N KL D+G              
Sbjct  245  MKIAVDVARGLEYLHEHRNPPVVHRDLKSSNILLDSDFNAKLSDFG--------------  290

Query  249  STATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSS  79
             T    A+N+  + + G+ GY  P YL  G  T KSD+Y+ GV+LLEL+TG   +E +  
Sbjct  291  LTVNLGAQNKN-IKLSGTLGYVAPEYLLDGKLTDKSDVYAFGVVLLELLTGKMPVEKMGP  349

Query  78   DSNVRLISKAGPMLKDESKVAGMVD  4
              +  L+S A P L D SK+  +VD
Sbjct  350  TQSQSLVSWAIPQLSDRSKLPKIVD  374



>ref|XP_007023373.1| Serine/threonine-protein kinase PBS1 isoform 1 [Theobroma cacao]
 gb|EOY25995.1| Serine/threonine-protein kinase PBS1 isoform 1 [Theobroma cacao]
Length=475

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 139/250 (56%), Gaps = 20/250 (8%)
 Frame = -2

Query  744  TVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNI  565
            T +F  S V+  GG   VY   F +  L A+K +D   +     ++ ELE L +I+H NI
Sbjct  156  TNNFQESNVLGEGGRGRVYKAHFDEKFLAAVKKLDGGGQDAEREFENELEWLVKIQHQNI  215

Query  564  VKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLH  385
            V +LGY      E  +LV+E + NG+L+ +LHG   GS L W  RM IA  +A+ LE+LH
Sbjct  216  VSLLGYCIHG--ETRLLVYEMMQNGSLESQLHGPTQGSALTWHLRMKIAIDVARALEHLH  273

Query  384  DKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTM  205
            + C P +VH D+K SNILLDS  N KL D+G A               T  ++N+  + +
Sbjct  274  EHCSPPVVHRDIKSSNILLDSNFNAKLSDFGLA--------------VTTGSQNKN-VKL  318

Query  204  FGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAGPMLK  34
             G+ GY  P YL  G  T KSD+Y+ GV+LLEL+ G   LE +S      L++ A P L 
Sbjct  319  SGTLGYVAPEYLLEGKLTDKSDVYAFGVVLLELLIGKKPLEKMSPTQCQSLVTWAMPQLT  378

Query  33   DESKVAGMVD  4
            D SK+  +VD
Sbjct  379  DRSKLPNIVD  388



>ref|XP_010654872.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Vitis vinifera]
Length=396

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/250 (39%), Positives = 143/250 (57%), Gaps = 19/250 (8%)
 Frame = -2

Query  744  TVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNI  565
            T +FS S V+  GG   VY  +F ++ L A+K +D   +     ++ E++ L +I+H NI
Sbjct  95   TNNFSESNVLGEGGSGRVYKARFNENFLAAVKRLDRGGQDGEREFENEVDWLSKIQHQNI  154

Query  564  VKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLH  385
            V +LG       E   LV+E + NG+L+ +LHG   GS L W  RM IA  +A+ LE+LH
Sbjct  155  VSLLGCCIHG--ETRFLVYEMMQNGSLEAQLHGPSHGSTLTWHLRMKIAVDVARGLEHLH  212

Query  384  DKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTM  205
            + C+P ++H DLK SNILLDS+ N KL D+G A               T+  +N+  + +
Sbjct  213  EHCNPPVIHRDLKSSNILLDSDFNAKLSDFGLA--------------ITSGTQNKNNLKL  258

Query  204  FGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAGPMLK  34
             G+ GY  P YL  G  T KSD+Y+ GVILLEL+ G   +E ++S     +++ A P L 
Sbjct  259  SGTVGYVAPEYLLDGKLTDKSDVYAFGVILLELLMGRKPVEKMASAECQSIVTWAMPQLT  318

Query  33   DESKVAGMVD  4
            D SK+  +VD
Sbjct  319  DRSKLPNIVD  328



>gb|KHG11715.1| hypothetical protein F383_04417 [Gossypium arboreum]
Length=441

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/247 (39%), Positives = 137/247 (55%), Gaps = 20/247 (8%)
 Frame = -2

Query  735  FSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKV  556
            F  S V+  GG   VY  +F D  L A+K +D         ++ E++ L +IRH N+V +
Sbjct  157  FGESNVLGEGGRGRVYKARFDDKFLAAVKKLDNGGVDAEREFENEVDWLVKIRHQNVVSL  216

Query  555  LGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKC  376
            LGY      E  +LV+E + NG+L+ +LHG   GS L W  RM IA  +A+ LEYLH+ C
Sbjct  217  LGYCIHG--ETKLLVYEMMQNGSLESQLHGPSQGSALTWHLRMKIAIDVARALEYLHENC  274

Query  375  DPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGS  196
            +P +VH D+K SNILLDS  N KL D+G A               T  ++N+  + + G+
Sbjct  275  NPPVVHRDIKSSNILLDSNFNAKLSDFGLA--------------VTTGSQNKN-VKLSGT  319

Query  195  PGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAGPMLKDES  25
             GY  P YL  G  T KSD+Y+ GV+LLEL+ G   LE +S   +  L++   P L D  
Sbjct  320  LGYVAPEYLLEGKLTDKSDVYAFGVVLLELLIGKKPLEKMSPTQHQSLVTWVMPQLTDRL  379

Query  24   KVAGMVD  4
            K+  +VD
Sbjct  380  KLPKLVD  386



>gb|KGN45228.1| hypothetical protein Csa_7G432090 [Cucumis sativus]
Length=455

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 104/265 (39%), Positives = 146/265 (55%), Gaps = 20/265 (8%)
 Frame = -2

Query  789  KESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMY  610
            K S   +  K ++  T +FS+S V+  GG   VY   F D  L A+K ID         +
Sbjct  141  KGSVSTIDYKLLEAATDNFSKSNVLGEGGSGHVYKACFNDKLLAAVKRIDNGGLDAEREF  200

Query  609  KQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNR  430
            + E+  L +IRH N++K+LG+      E   LV+E + NG+L+ +LHG   GS L W  R
Sbjct  201  ENEVNWLSKIRHQNVIKLLGHCIHG--ETRFLVYEMMQNGSLESQLHGPSHGSALTWHIR  258

Query  429  MGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPS  250
            M IA  +A+ LEYLH+  +P +VH DLK SNILLDS+ N KL D+G              
Sbjct  259  MKIAVDVARGLEYLHEHRNPPVVHRDLKSSNILLDSDFNAKLSDFG--------------  304

Query  249  STATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSS  79
             T    A+N+  + + G+ GY  P YL  G  T KSD+Y+ GV+LLEL+TG   +E +  
Sbjct  305  LTVNLGAQNKN-IKLSGTLGYVAPEYLLDGKLTDKSDVYAFGVVLLELLTGKMPVEKMGP  363

Query  78   DSNVRLISKAGPMLKDESKVAGMVD  4
              +  L+S A P L D SK+  +VD
Sbjct  364  TQSQSLVSWAIPQLSDRSKLPKIVD  388



>ref|XP_002285386.2| PREDICTED: probable receptor-like protein kinase At1g80640 [Vitis 
vinifera]
 emb|CBI21096.3| unnamed protein product [Vitis vinifera]
Length=455

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 101/265 (38%), Positives = 149/265 (56%), Gaps = 19/265 (7%)
 Frame = -2

Query  789  KESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMY  610
            K S   +  K ++  T +F  S ++  GGF  VY  +  D+S  A+K ID   +     +
Sbjct  137  KGSVSCIDYKVLETATNNFQESNILGEGGFGCVYKARLDDNSHVAVKKIDGRGQDAEREF  196

Query  609  KQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNR  430
            + E+++L +I+H NI+ +LGYS  E  E   LV+E + NG+L+ +LHG   GS L W  R
Sbjct  197  ENEVDLLTKIQHPNIISLLGYSSHE--ESKFLVYELMQNGSLETELHGPSHGSSLTWHIR  254

Query  429  MGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPS  250
            M IA   A+ LEYLH+ C+P ++H DLK SNILLDS  N KL D+G A +          
Sbjct  255  MKIALDAARGLEYLHEHCNPPVIHRDLKSSNILLDSNFNAKLSDFGLAVID---------  305

Query  249  STATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSS  79
                   +N+  + + G+ GY  P YL  G  T KSD+Y+ GV+LLEL+ G   +E ++ 
Sbjct  306  -----GPQNKNNLKLSGTLGYLAPEYLLDGKLTDKSDVYAFGVVLLELLLGRKPVEKLAP  360

Query  78   DSNVRLISKAGPMLKDESKVAGMVD  4
                 +++ A P L D SK+ G+VD
Sbjct  361  AQCQSIVTWAMPQLTDRSKLPGIVD  385



>gb|KGN55454.1| hypothetical protein Csa_4G652670 [Cucumis sativus]
Length=368

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 154/285 (54%), Gaps = 28/285 (10%)
 Frame = -2

Query  822  KSRRRKAEKDT---------KESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPD  670
            KS+R+ AEK           K     +  K ++K T +F  S V+  GGF  VY     D
Sbjct  41   KSKRKDAEKGIGLAPFVTGKKGCVSVIDFKVLEKATGNFGESNVLGEGGFGRVYKALLDD  100

Query  669  SSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNG  490
            + + A+K +D S  +  T ++ E+ IL  I H NI+  LG S  EG +  ++V+E + NG
Sbjct  101  NLVVAVKKLDCSGFQADTEFENEVNILSGIHHPNIICQLGCSS-EG-DSKLIVYELMENG  158

Query  489  TLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNC  310
            +L+ +LHG   GS L W  RM IA  +A+ LEYLH+ C P ++H DLK SNILLD+  N 
Sbjct  159  SLETQLHGPSRGSALNWHMRMKIALDVARGLEYLHEHCHPAVIHRDLKTSNILLDANFNA  218

Query  309  KLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYS  130
            KL D+G A               T   +N   + + G+ GY  P YL  G  T+KSD+Y+
Sbjct  219  KLADFGIA--------------ITDGTQNNNKIKLSGTLGYVAPEYLLHGKLTEKSDVYA  264

Query  129  LGVILLELITG---LEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
             G+++LEL+ G   +E   +  +  +++ A P L D SK+  +VD
Sbjct  265  YGIVVLELLLGRRPVEKRPTPQSHSIVTWAMPQLTDRSKLPNIVD  309



>emb|CAC01703.1| receptor protein kinase-like protein [Arabidopsis thaliana]
Length=851

 Score =   174 bits (440),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 147/268 (55%), Gaps = 16/268 (6%)
 Frame = -2

Query  807  KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSK  628
            +A    +   RR+T  E+  +T +F R  VI  GGF  VY G   DS   A+K++  SS 
Sbjct  536  RANLSLENKKRRITYSEILLMTNNFER--VIGEGGFGVVYHGYLNDSEQVAVKVLSPSSS  593

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV  448
            + +  +K E+E+L R+ H N+V ++GY D++      L++EY+ NG L+  L G  G  V
Sbjct  594  QGYKEFKAEVELLLRVHHINLVSLVGYCDEQA--HLALIYEYMANGDLKSHLSGKHGDCV  651

Query  447  LPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSS  268
            L W NR+ IA + A  LEYLH  C P +VH D+K  NILLD     KL D+G ++   S 
Sbjct  652  LKWENRLSIAVETALGLEYLHSGCKPLMVHRDVKSMNILLDEHFQAKLADFGLSR---SF  708

Query  267  TVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEA  88
            +V   S  +T            G+PGY DP Y RT   T+KSD+YS G++LLE+IT    
Sbjct  709  SVGEESHVSTGVV---------GTPGYLDPEYYRTYRLTEKSDVYSFGIVLLEIITNQPV  759

Query  87   VSSDSNVRLISKAGPMLKDESKVAGMVD  4
            +   +  R I++    +   S ++ +VD
Sbjct  760  LEQANENRHIAERVRTMLTRSDISTIVD  787



>gb|KFK35821.1| hypothetical protein AALP_AA4G041600 [Arabis alpina]
Length=623

 Score =   172 bits (436),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 140/238 (59%), Gaps = 18/238 (8%)
 Frame = -2

Query  810  RKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSS  631
            R+A + +K+  +R T +EV ++T +F R  ++  GGF  VY G    +   A+KI+  +S
Sbjct  295  REAPRTSKK--KRFTYEEVTEMTNNFER--ILGKGGFGMVYHGYVNGTEPVAVKIVSQAS  350

Query  630  KRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGS  451
               H  +K E+++L R+ H N+V ++GY D    +E  LV+EY+ NG LQE L G  G S
Sbjct  351  VHGHKQFKAEVDLLLRVHHKNLVSLVGYCDKG--KELALVYEYMANGDLQELLSGKRGSS  408

Query  450  VLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFS  271
            VL W  R+ IA + AQ LEYLH  C P IVH D+K +NILLD     KL D+G ++   S
Sbjct  409  VLRWGTRLKIAIEAAQGLEYLHKGCRPPIVHRDVKTANILLDENFQAKLADFGLSR---S  465

Query  270  STVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG  97
             T +  S  +T  A         G+ GY DP Y RT   T+KSD+YS GV+LLE+IT 
Sbjct  466  FTNEGESHVSTVVA---------GTLGYLDPEYYRTNWLTEKSDVYSFGVVLLEIITN  514



>ref|NP_566630.1| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAB02454.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94380.1| At3g19300 [Arabidopsis thaliana]
 gb|AAV59270.1| At3g19300 [Arabidopsis thaliana]
 gb|AEE76221.1| protein kinase family protein [Arabidopsis thaliana]
Length=663

 Score =   172 bits (436),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 101/259 (39%), Positives = 150/259 (58%), Gaps = 19/259 (7%)
 Frame = -2

Query  777  RRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQEL  598
            R+ + KE++K T DF+   VI  GGF TVY  +F +  + A+K ++ SS++    + +E+
Sbjct  314  RKFSYKEIRKATEDFNA--VIGRGGFGTVYKAEFSNGLVAAVKKMNKSSEQAEDEFCREI  371

Query  597  EILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIA  418
            E+L R+ H ++V + G+ + +   E  LV+EY+ NG+L++ LH     S L W +RM IA
Sbjct  372  ELLARLHHRHLVALKGFCNKKN--ERFLVYEYMENGSLKDHLHSTEK-SPLSWESRMKIA  428

Query  417  FQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQ-PPSSTA  241
              +A  LEYLH  CDP + H D+K SNILLD     KL D+G A      ++   P +T 
Sbjct  429  IDVANALEYLHFYCDPPLCHRDIKSSNILLDEHFVAKLADFGLAHASRDGSICFEPVNT-  487

Query  240  TATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRL  61
                       + G+PGY DP Y+ T   T+KSD+YS GV+LLE+ITG  AV    N  L
Sbjct  488  ----------DIRGTPGYVDPEYVVTHELTEKSDVYSYGVVLLEIITGKRAVDEGRN--L  535

Query  60   ISKAGPMLKDESKVAGMVD  4
            +  + P+L  ES+   +VD
Sbjct  536  VELSQPLLVSESRRIDLVD  554



>ref|NP_175598.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
 sp|C0LGG4.2|Y1518_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At1g51860; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE32726.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
Length=890

 Score =   174 bits (441),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 142/242 (59%), Gaps = 17/242 (7%)
 Frame = -2

Query  822  KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
            KS  R +        R++T  EV K+T +F R  V+  GGF TVY G   D +  A+K++
Sbjct  557  KSETRSSNPSIITRERKITYPEVLKMTNNFER--VLGKGGFGTVYHGNL-DGAEVAVKML  613

Query  642  DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
              SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  614  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLRENMSGK  671

Query  462  GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G ++
Sbjct  672  RGGNVLTWENRMQIAVEAAQGLEYLHNGCRPPMVHRDVKTTNILLNERCGAKLADFGLSR  731

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
               S  +      +T  A         G+PGY DP Y RT   ++KSD+YS GV+LLE++
Sbjct  732  ---SFPIDGECHVSTVVA---------GTPGYLDPEYYRTNWLSEKSDVYSFGVVLLEIV  779

Query  102  TG  97
            T 
Sbjct  780  TN  781



>ref|XP_010500779.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51880 [Camelina sativa]
Length=611

 Score =   172 bits (435),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 102/255 (40%), Positives = 149/255 (58%), Gaps = 20/255 (8%)
 Frame = -2

Query  792  TKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTM  613
            TKE  RR+T  EV  +T +F R  V+  GGF TVY G F D+ + A+K++  SS + +  
Sbjct  290  TKE--RRITYPEVLNMTNNFER--VLGKGGFGTVYHGNFDDAQV-AVKMLSHSSAQGYKE  344

Query  612  YKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRN  433
            +K E+E+L R+ H  +V ++GY DD   +   L++EY+ NG L+E + G  GG VL W N
Sbjct  345  FKAEVELLLRVHHRYLVGLVGYCDDG--DNLALIYEYMANGDLRENMLGKRGGRVLTWGN  402

Query  432  RMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPP  253
            RM IA + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G ++   S  +   
Sbjct  403  RMKIAVEAAQGLEYLHNGCRPLMVHRDVKSTNILLNEHSGAKLADFGLSR---SFPIDGE  459

Query  252  SSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDS  73
               +T  A         G+PGY DP Y +T   ++KSD+YS GV+LLE++T    +    
Sbjct  460  CHVSTVVA---------GTPGYLDPEYYKTNWLSEKSDVYSFGVVLLEIVTNQPVIDKTR  510

Query  72   NVRLISK-AGPMLKD  31
             +  IS+  G ML +
Sbjct  511  EIPHISEWVGFMLTN  525



>emb|CDY45650.1| BnaA05g15170D [Brassica napus]
Length=891

 Score =   174 bits (440),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 150/257 (58%), Gaps = 17/257 (7%)
 Frame = -2

Query  774  RLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELE  595
            R+T  EV K+T +F R  V+  GGF TVY G   D+ + A+K++  SS + +  +  E+E
Sbjct  574  RVTYPEVLKMTNNFQR--VLGKGGFGTVYHGNLDDAQV-AVKMLSHSSAQGYKEFNAEVE  630

Query  594  ILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAF  415
            +L R+ H ++V+++GY DD   +   L++EY+ NG L+E + G  GG+VL W NRM IA 
Sbjct  631  LLSRVHHRHLVRLVGYCDDG--DNLALIYEYMANGDLKEHMSGKRGGNVLTWENRMQIAV  688

Query  414  QLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATA  235
            + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G ++   S  +      +TA
Sbjct  689  EAAQGLEYLHNGCQPPMVHRDVKTTNILLNERYGAKLADFGLSR---SFPIDGAYHVSTA  745

Query  234  TAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLIS  55
             A         G+PGY DP Y RT   ++KSD+YS G++LLE+IT    +        I+
Sbjct  746  VA---------GTPGYLDPEYHRTNSLSEKSDVYSFGIVLLEIITNQPVIDKTRERTHIN  796

Query  54   KAGPMLKDESKVAGMVD  4
            +   ++  +  +  ++D
Sbjct  797  EWAVLMLTKGDIRNLID  813



>gb|AAF99856.1|AC015448_6 Putative protein kinase [Arabidopsis thaliana]
Length=869

 Score =   174 bits (440),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 142/242 (59%), Gaps = 17/242 (7%)
 Frame = -2

Query  822  KSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKII  643
            KS  R +        R++T  EV K+T +F R  V+  GGF TVY G   D +  A+K++
Sbjct  536  KSETRSSNPSIITRERKITYPEVLKMTNNFER--VLGKGGFGTVYHGNL-DGAEVAVKML  592

Query  642  DTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN  463
              SS + +  +K E+E+L R+ H ++V ++GY DD   +   L++EY+ NG L+E + G 
Sbjct  593  SHSSAQGYKEFKAEVELLLRVHHRHLVGLVGYCDDG--DNLALIYEYMANGDLRENMSGK  650

Query  462  GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAK  283
             GG+VL W NRM IA + AQ LEYLH+ C P +VH D+K +NILL+     KL D+G ++
Sbjct  651  RGGNVLTWENRMQIAVEAAQGLEYLHNGCRPPMVHRDVKTTNILLNERCGAKLADFGLSR  710

Query  282  MGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELI  103
               S  +      +T  A         G+PGY DP Y RT   ++KSD+YS GV+LLE++
Sbjct  711  ---SFPIDGECHVSTVVA---------GTPGYLDPEYYRTNWLSEKSDVYSFGVVLLEIV  758

Query  102  TG  97
            T 
Sbjct  759  TN  760



>gb|KDP42003.1| hypothetical protein JCGZ_27021 [Jatropha curcas]
Length=456

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 96/265 (36%), Positives = 149/265 (56%), Gaps = 20/265 (8%)
 Frame = -2

Query  789  KESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMY  610
            K S   +  K ++  T +F  + ++  GG   VY   F D  L A+K ++   + +   +
Sbjct  143  KGSITWVEYKLLEAATNNFRENSLLGEGGHGRVYKAHFDDKVLAAVKKLEGGGQDIQREF  202

Query  609  KQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNR  430
            + E++ L +I+H NI+ +LGY      +   LV+E + NG+L+ +LHG   GS L W+ R
Sbjct  203  QNEMKWLTKIQHQNIISLLGYCIHGDTK--FLVYEMMQNGSLESQLHGPTHGSALTWQLR  260

Query  429  MGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPS  250
            + IA  +A+ LEYLH+ C+P +VH D+K SNILLDS  N KL D+G A            
Sbjct  261  LKIAVDIARGLEYLHEHCNPPVVHRDIKSSNILLDSNFNAKLSDFGLA------------  308

Query  249  STATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSS  79
               T+  +N+  + + G+ GY  P YL  G  T KSD+Y+ G++LLEL+ G   +E +S 
Sbjct  309  --VTSGVENKN-IKLSGTLGYVAPEYLLEGKLTDKSDVYAFGIVLLELLMGRRPVEKLSE  365

Query  78   DSNVRLISKAGPMLKDESKVAGMVD  4
            D +  ++S A P L D SK+  +VD
Sbjct  366  DQHQSIVSWAMPQLTDRSKLPNIVD  390



>ref|XP_002515904.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF46324.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=886

 Score =   174 bits (440),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 110/295 (37%), Positives = 162/295 (55%), Gaps = 30/295 (10%)
 Frame = -2

Query  855  VSVMAFGCLGRKSRR---RKAEKDTKES-------ARRLTRKEVQKLTVDFSRSRVIAFG  706
            V+ +   C  R+ ++   R  E DTKE+        RR T  EV KLT +F    V+  G
Sbjct  530  VAALTIICCCRRRKQQVARNEEADTKETYEPREMRNRRFTYSEVLKLTKNFES--VLGRG  587

Query  705  GFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVE  526
            GF TVY G   D  + A+K++ TSS + +  ++ E+++L R+ H N+  ++GY D+ G  
Sbjct  588  GFGTVYYGYLGDIEV-AVKVLSTSSVQGYKEFEAEVKLLLRVHHKNLTTLVGYCDEGG--  644

Query  525  EGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLK  346
              +L++EY+ NG L++ L G     +L W  R+ IA + AQ LEYLH+ C P IVH D+K
Sbjct  645  NMILIYEYMANGNLRQHLSGEHP-DILSWEGRLKIALETAQGLEYLHNGCKPPIVHRDVK  703

Query  345  GSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLR  166
             +NILLD +   KL D+G ++M F +      ST  A           G+PGY DP Y  
Sbjct  704  TANILLDDKFQAKLADFGLSRM-FPAEGGTHVSTIVA-----------GTPGYLDPEYYV  751

Query  165  TGIATKKSDIYSLGVILLELITGLEAVSSDSNVRLISK-AGPMLKDESKVAGMVD  4
                T+KSD+YS GV+LLE+IT    +S  S    +S+   PML +   +  +VD
Sbjct  752  RNWLTEKSDVYSFGVVLLEIITSRSVISQTSEKTHVSQWVKPML-ERGDIKNIVD  805



>ref|XP_006427538.1| hypothetical protein CICLE_v10025618mg [Citrus clementina]
 gb|ESR40778.1| hypothetical protein CICLE_v10025618mg [Citrus clementina]
Length=334

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 101/265 (38%), Positives = 145/265 (55%), Gaps = 20/265 (8%)
 Frame = -2

Query  789  KESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMY  610
            K++   +  + ++  T +F  S VI  GG   VY  +F +  L A+K ID +       +
Sbjct  32   KDTVSVIEYELLEAATNNFQESNVIGEGGRGHVYKARFNEKLLAAVKRIDDAGHDAEREF  91

Query  609  KQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNR  430
              E+  L +IRH NI+ +LGY      E   LV+E + NG+L+++LHG   GS L W  R
Sbjct  92   NNEVNWLTKIRHQNIISLLGYCIH--AETRFLVYEMMQNGSLEKQLHGPTHGSNLTWHLR  149

Query  429  MGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPS  250
            M IA  +A+ LEYLH+ C+  +VH DLK SNILLDS  N KL D+G             S
Sbjct  150  MKIAVDVARGLEYLHEHCNHPVVHRDLKSSNILLDSSFNAKLSDFGL------------S  197

Query  249  STATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSS  79
             TA   ++N   + + G+ GY  P YL  G  T KSD+Y+ GV+LLEL+ G   +E +S 
Sbjct  198  VTAGTQSRN---VKISGTLGYVAPEYLLEGKLTDKSDVYAFGVVLLELLMGRRPVEKMSP  254

Query  78   DSNVRLISKAGPMLKDESKVAGMVD  4
                 +++ A P L D SK+  +VD
Sbjct  255  TQCQSMVTWAMPQLTDRSKLPNIVD  279



>ref|NP_197192.2| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
 sp|C0LGT5.1|Y5169_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At5g16900; Flags: Precursor [Arabidopsis thaliana]
 gb|ACN59370.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED92356.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
Length=866

 Score =   173 bits (439),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 147/268 (55%), Gaps = 16/268 (6%)
 Frame = -2

Query  807  KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSK  628
            +A    +   RR+T  E+  +T +F R  VI  GGF  VY G   DS   A+K++  SS 
Sbjct  551  RANLSLENKKRRITYSEILLMTNNFER--VIGEGGFGVVYHGYLNDSEQVAVKVLSPSSS  608

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSV  448
            + +  +K E+E+L R+ H N+V ++GY D++      L++EY+ NG L+  L G  G  V
Sbjct  609  QGYKEFKAEVELLLRVHHINLVSLVGYCDEQA--HLALIYEYMANGDLKSHLSGKHGDCV  666

Query  447  LPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSS  268
            L W NR+ IA + A  LEYLH  C P +VH D+K  NILLD     KL D+G ++   S 
Sbjct  667  LKWENRLSIAVETALGLEYLHSGCKPLMVHRDVKSMNILLDEHFQAKLADFGLSR---SF  723

Query  267  TVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITGLEA  88
            +V   S  +T            G+PGY DP Y RT   T+KSD+YS G++LLE+IT    
Sbjct  724  SVGEESHVSTGVV---------GTPGYLDPEYYRTYRLTEKSDVYSFGIVLLEIITNQPV  774

Query  87   VSSDSNVRLISKAGPMLKDESKVAGMVD  4
            +   +  R I++    +   S ++ +VD
Sbjct  775  LEQANENRHIAERVRTMLTRSDISTIVD  802



>ref|XP_010239937.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Brachypodium 
distachyon]
Length=461

 Score =   169 bits (429),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 139/254 (55%), Gaps = 19/254 (7%)
 Frame = -2

Query  756  VQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIR  577
            ++  T  F  S V+  GGF  VY   F   +  A+K ++         ++ EL++L RIR
Sbjct  155  LEAATGKFGESNVLGVGGFGCVYKAAFDGGATAAVKRLEGGGPDCEKEFENELDLLGRIR  214

Query  576  HDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVL  397
            H NIV +LG+    G     +V+E +  G+L+ +LHG+  GS L W  RM IA   A+ L
Sbjct  215  HPNIVSLLGFCVHGG--NHYIVYELMEKGSLETQLHGSSHGSALSWHVRMKIALDTARGL  272

Query  396  EYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPSSTATATAKNRT  217
            EYLH+ C+P ++H DLK SNILLDS+ N K+ D+G A               T    N+ 
Sbjct  273  EYLHEHCNPPVIHRDLKPSNILLDSDFNAKIADFGLA--------------VTGGNLNKG  318

Query  216  MMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSSDSNVRLISKAG  46
             + + G+ GY  P YL  G  T+KSD+Y+ GV+LLEL+ G   +E +S      ++S A 
Sbjct  319  NLKLSGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVSWAM  378

Query  45   PMLKDESKVAGMVD  4
            P L D SK+  ++D
Sbjct  379  PQLTDRSKLPNIID  392



>ref|XP_004145589.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Cucumis sativus]
Length=367

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 154/285 (54%), Gaps = 28/285 (10%)
 Frame = -2

Query  822  KSRRRKAEKDT---------KESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPD  670
            KS+R+ AEK           K     +  K ++K T +F  S V+  GGF  VY     D
Sbjct  40   KSKRKDAEKGIGLAPFVTGKKGCVSVIDFKVLEKATGNFGESNVLGEGGFGRVYKALLDD  99

Query  669  SSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNG  490
            + + A+K +D S  +  T ++ E+ IL  I H NI+  LG S  EG +  ++V+E + NG
Sbjct  100  NLVVAVKKLDCSGFQADTEFENEVNILSGIHHPNIICQLGCSS-EG-DSKLIVYELMENG  157

Query  489  TLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNC  310
            +L+ +LHG   GS L W  RM IA  +A+ LEYLH+ C P ++H DLK SNILLD+  N 
Sbjct  158  SLETQLHGPSRGSALNWHMRMKIALDVARGLEYLHEHCHPAVIHRDLKTSNILLDANFNA  217

Query  309  KLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYS  130
            KL D+G A               T   +N   + + G+ GY  P YL  G  T+KSD+Y+
Sbjct  218  KLADFGIA--------------ITDGTQNNNKIKLSGTLGYVAPEYLLHGKLTEKSDVYA  263

Query  129  LGVILLELITG---LEAVSSDSNVRLISKAGPMLKDESKVAGMVD  4
             G+++LEL+ G   +E   +  +  +++ A P L D SK+  +VD
Sbjct  264  YGIVVLELLLGRRPVEKRPTPQSHSIVTWAMPQLTDRSKLPNIVD  308



>ref|XP_006290410.1| hypothetical protein CARUB_v10019082mg [Capsella rubella]
 gb|EOA23308.1| hypothetical protein CARUB_v10019082mg [Capsella rubella]
Length=884

 Score =   173 bits (439),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 101/271 (37%), Positives = 150/271 (55%), Gaps = 37/271 (14%)
 Frame = -2

Query  855  VSVMAFGCLGRKSRRRK---------------AEKDTKESARRLTRKEVQKLTVDFSRSR  721
            + V+ F C+ +K +R                 +E+  K   RR T  EV ++T +F ++ 
Sbjct  524  IVVLTFICVFKKKKRSVQMEVMPTMDTASKSISEQLIKTKRRRFTYSEVVEMTQNFRKA-  582

Query  720  VIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSD  541
             +  GGF  VY G    S   A+K++  SS + +  +K E+E+L R+ H N+V ++GY D
Sbjct  583  -LGEGGFGIVYHGYLKKSDQVAVKVLSQSSSQGYKHFKAEVELLLRVHHINLVNLVGYCD  641

Query  540  DEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIV  361
            ++  +   L++EY+PNG L++ L G  GGSVL W  R+ IA  +A  LEYLH  C P +V
Sbjct  642  EK--DHLALIYEYMPNGDLKDHLSGKQGGSVLEWTTRLRIAIDIALGLEYLHYGCQPPMV  699

Query  360  HGDLKGSNILLDSELNCKLCDYG---SAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPG  190
            H D+K +NILLD +   K+ D+G   S ++G  S +    STA A           G+PG
Sbjct  700  HRDVKSTNILLDDQFMAKIADFGLSRSFQLGDESQI----STAVA-----------GTPG  744

Query  189  YTDPHYLRTGIATKKSDIYSLGVILLELITG  97
            Y DP Y RT    + SD+YS G++LLELIT 
Sbjct  745  YLDPEYYRTSRLAEMSDVYSFGIVLLELITN  775



>ref|XP_002984292.1| hypothetical protein SELMODRAFT_119669 [Selaginella moellendorffii]
 gb|EFJ14802.1| hypothetical protein SELMODRAFT_119669 [Selaginella moellendorffii]
Length=356

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 104/282 (37%), Positives = 148/282 (52%), Gaps = 29/282 (10%)
 Frame = -2

Query  807  KAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSK  628
            ++E++    A+  T K++Q  T +FS    I  GGF  VY G  PD  L A+K++D   K
Sbjct  6    RSEREEVSKAQVFTYKQLQSATNNFSPLNKIGHGGFGLVYRGVLPDGRLAAVKLMDRQGK  65

Query  627  RLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGN-----  463
            +    ++ E+++L R+    ++ ++GY  D+     +LV+ Y+ NG+LQE LH       
Sbjct  66   QGEREFRVEVDMLTRLHSPYLLDLIGYCADKDYR--LLVYSYMANGSLQEHLHSKVLSSL  123

Query  462  -----GGGSVLPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCD  298
                  G S L W  R+ +AF  A+ LEYLH+   P I+H D K SNILLD   +  L D
Sbjct  124  TCRTLKGKSTLDWGTRILVAFDAAKGLEYLHEYVIPPIIHRDFKSSNILLDEHNDVVLAD  183

Query  297  YGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVI  118
            +G AK G       PS+             + G+ GY  P Y  TG  T KSD+YS G++
Sbjct  184  FGLAKTGADKIAGQPST------------RVLGTQGYLAPEYAMTGHLTTKSDVYSYGIV  231

Query  117  LLELITGLEAVSSD----SNVRLISKAGPMLKDESKVAGMVD  4
            LLELITG   V +      NV L++ A P L D  K+A MVD
Sbjct  232  LLELITGRLPVDAKRPPGQNV-LVNWALPRLTDREKLAQMVD  272



>ref|XP_008461169.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Cucumis 
melo]
Length=455

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/265 (39%), Positives = 146/265 (55%), Gaps = 20/265 (8%)
 Frame = -2

Query  789  KESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHTMY  610
            K S   +  K ++  T +FS+S V+  GG   VY   F D  L A+K ID         +
Sbjct  141  KGSVSTIDYKLLEAATDNFSKSNVLGEGGSGHVYKACFNDKLLAAVKRIDNGGLDAEREF  200

Query  609  KQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWRNR  430
            + E+  L +IRH N++K+LG+      E   LV+E + NG+L+ +LHG   GS L W  R
Sbjct  201  ENEVNWLCKIRHQNVIKLLGHCIHG--ETRFLVYEMMQNGSLESQLHGPSHGSALTWHIR  258

Query  429  MGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQPPS  250
            M IA  +A+ LEYLH+  +P +VH DLK SNILLDS+ N KL D+G              
Sbjct  259  MKIAVDVARGLEYLHEHRNPPVVHRDLKSSNILLDSDFNAKLSDFG--------------  304

Query  249  STATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAVSS  79
             T    A+N+  + + G+ GY  P YL  G  T KSD+Y+ GV+LLEL+TG   +E +  
Sbjct  305  LTVNLGAQNKN-IKLSGTLGYVAPEYLLDGKLTDKSDVYAFGVVLLELLTGKMPVEKMGP  363

Query  78   DSNVRLISKAGPMLKDESKVAGMVD  4
              +  L+S A P L D SK+  +VD
Sbjct  364  TQSQSLVSWAIPQLSDRSKLPKIVD  388



>emb|CDY49244.1| BnaA09g55230D [Brassica napus]
Length=397

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 151/286 (53%), Gaps = 22/286 (8%)
 Frame = -2

Query  840  FGCLGRKSRRRKAEKDTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSL  661
            F C   K   +  ++ T  + +  T K++   T  FS+S V+  GGF  VY G   D   
Sbjct  54   FNC-EEKGDCQNQQEVTDNALQIFTFKQLHSATGGFSKSNVVGHGGFGLVYRGVLNDGRK  112

Query  660  GAIKIIDTSSKRLHTMYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQ  481
             AIK +D + K+    +K E+E+L R+R   ++ +LGY  D      +LV+E++ NG LQ
Sbjct  113  VAIKFMDNAGKQGEDEFKMEVELLSRLRSPYLLALLGYCSDN--SHKLLVYEFMANGGLQ  170

Query  480  EKLHGNG-GGSV---LPWRNRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELN  313
            E L+ N   GSV   L W  RM IA + A+ LEYLH++  P ++H D K SNILLD   +
Sbjct  171  EHLYPNNRSGSVPLRLDWETRMRIALEAAKGLEYLHEQVSPPVIHRDFKSSNILLDRNFH  230

Query  312  CKLCDYGSAKMGFSSTVQPPSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIY  133
             K+ D+G AK+G        S  A      R +    G+ GY  P Y  TG  T KSD+Y
Sbjct  231  AKVSDFGLAKVG--------SDKAGGHVSTRVL----GTQGYVAPEYALTGHLTTKSDVY  278

Query  132  SLGVILLELITGLEAVSSDSNV---RLISKAGPMLKDESKVAGMVD  4
            S G++LLEL+TG   V    +     L+S A P L D  KV  ++D
Sbjct  279  SYGIVLLELLTGRVPVDMKRDAGEGVLVSWALPQLADREKVVDIMD  324



>ref|XP_004486625.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Cicer arietinum]
Length=420

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/267 (37%), Positives = 147/267 (55%), Gaps = 23/267 (9%)
 Frame = -2

Query  795  DTKESARRLTRKEVQKLTVDFSRSRVIAFGGFSTVYLGKFPDSSLGAIKIIDTSSKRLHT  616
            D K +      + ++  T +FS + ++   G   VY  +F +    A+K  D+ + R   
Sbjct  110  DKKSAIAIFDFQLLEAATNNFSTNNIMGESGSRIVYRARFDEHFQAAVKKADSDADR---  166

Query  615  MYKQELEILQRIRHDNIVKVLGYSDDEGVEEGVLVFEYVPNGTLQEKLHGNGGGSVLPWR  436
             ++ E+ +L +IRH NI+K+LGY      E   LV+E++  G+L+ +LHG   GS L W 
Sbjct  167  EFENEVSMLSKIRHQNIIKLLGYCIHG--ESRFLVYEFMECGSLETQLHGPTHGSSLTWY  224

Query  435  NRMGIAFQLAQVLEYLHDKCDPQIVHGDLKGSNILLDSELNCKLCDYGSAKMGFSSTVQP  256
             R+ IA  +A+ LEYLH+  +P +VH DLK SN+LLDS+ N KL ++G            
Sbjct  225  IRLRIAIDVARALEYLHEHSNPPVVHRDLKSSNVLLDSDFNVKLSNFG------------  272

Query  255  PSSTATATAKNRTMMTMFGSPGYTDPHYLRTGIATKKSDIYSLGVILLELITG---LEAV  85
                A A+      M M G+ GY  P Y+  G  T KSD+Y+ GV+LLEL+TG   +E +
Sbjct  273  ---LAVASGVQHKNMKMSGTLGYVAPEYISHGKLTDKSDVYAFGVVLLELLTGRKPMENM  329

Query  84   SSDSNVRLISKAGPMLKDESKVAGMVD  4
            SSD    L+S A P L D SK+  ++D
Sbjct  330  SSDQYQSLVSWAMPQLTDRSKLPSILD  356



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2084674577848