BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24036_g2_i5 len=2614 path=[3209:0-1495 4705:1496-1681
4891:1682-1720 4930:1721-2102 5312:2103-2213 5423:2214-2333
5641:2334-2360 5668:2361-2416 9280:2417-2452 5733:2453-2613]

Length=2614
                                                                      Score     E

ref|XP_009791289.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    541   1e-177   
ref|XP_009617367.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    539   3e-177   
ref|XP_009619343.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    526   1e-171   
ref|XP_009765253.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    526   1e-171   
ref|XP_006352858.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    518   2e-168   
ref|XP_009765254.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    517   3e-168   
ref|XP_004245897.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    512   5e-166   
ref|XP_011082363.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    481   4e-155   
emb|CDP13031.1|  unnamed protein product                                476   1e-152   
ref|XP_010663507.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    463   3e-146   
ref|XP_010275207.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    450   9e-143   
gb|KDO40679.1|  hypothetical protein CISIN_1g005687mg                   446   1e-140   
ref|XP_006428428.1|  hypothetical protein CICLE_v10013784mg             445   1e-140   
ref|XP_006491731.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    445   1e-140   
ref|XP_008238245.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    438   3e-137   
ref|XP_007209082.1|  hypothetical protein PRUPE_ppa003467mg             426   8e-135   
ref|XP_004301683.1|  PREDICTED: uncharacterized protein LOC101303715    426   4e-133   
emb|CBI33881.3|  unnamed protein product                                419   2e-132   
ref|XP_008373576.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    418   1e-129   
ref|XP_009346483.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    414   7e-128   
gb|EYU24854.1|  hypothetical protein MIMGU_mgv1a022891mg                403   2e-126   
ref|XP_011028176.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    412   7e-126   
ref|XP_006385660.1|  UBIQUITIN-SPECIFIC PROTEASE 21 family protein      407   9e-125   
ref|XP_009347906.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    404   5e-124   
ref|XP_006368396.1|  UBIQUITIN-SPECIFIC PROTEASE 21 family protein      405   2e-123   
ref|XP_010053613.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    398   2e-122   
gb|KDP34308.1|  hypothetical protein JCGZ_12656                         401   2e-121   
ref|XP_007158301.1|  hypothetical protein PHAVU_002G141300g             394   2e-121   
ref|XP_007158302.1|  hypothetical protein PHAVU_002G141300g             395   4e-121   
ref|XP_011018566.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    398   4e-121   
ref|XP_011018565.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    398   5e-121   
gb|KHG24059.1|  Ubiquitin carboxyl-terminal hydrolase 20 -like pr...    390   8e-119   
ref|XP_007039489.1|  Ubiquitin-specific protease 20, putative           389   2e-118   
ref|XP_002527676.1|  conserved hypothetical protein                     387   1e-117   Ricinus communis
ref|XP_008448681.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    382   1e-116   
gb|KGN55756.1|  hypothetical protein Csa_3G011100                       380   3e-116   
ref|XP_003533435.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...    380   4e-115   
gb|KHN38924.1|  Ubiquitin carboxyl-terminal hydrolase 20                379   3e-114   
gb|KHN04879.1|  Ubiquitin carboxyl-terminal hydrolase 20                373   6e-114   
gb|EPS64352.1|  hypothetical protein M569_10430                         362   2e-113   
gb|KEH25395.1|  ubiquitin carboxyl-terminal hydrolase-like protein      370   2e-113   
ref|XP_003517073.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...    374   3e-113   
ref|XP_010104298.1|  Ubiquitin carboxyl-terminal hydrolase 21           370   3e-112   
ref|XP_004512524.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    371   9e-112   
gb|KEH25397.1|  ubiquitin carboxyl-terminal hydrolase-like protein      358   1e-107   
ref|XP_010530035.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    360   1e-107   
gb|KEH25396.1|  ubiquitin carboxyl-terminal hydrolase-like protein      356   2e-107   
ref|XP_006398369.1|  hypothetical protein EUTSA_v10000790mg             358   6e-107   
ref|XP_010919955.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    350   2e-105   
ref|XP_010677233.1|  PREDICTED: uncharacterized protein LOC104892907    359   2e-105   
ref|XP_010449544.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    352   7e-105   
ref|XP_010449543.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    352   7e-105   
ref|XP_010439928.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    350   3e-104   
ref|XP_010439929.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    350   3e-104   
ref|XP_008796260.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    347   4e-104   
ref|XP_010434606.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    350   5e-104   
ref|XP_010434607.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    350   5e-104   
ref|XP_006838591.1|  hypothetical protein AMTR_s00002p00220330          350   4e-103   
gb|AES95862.2|  ubiquitin carboxyl-terminal hydrolase-like protein      346   2e-102   
ref|XP_003612904.1|  Ubiquitin carboxyl-terminal hydrolase              345   2e-102   
ref|XP_010495772.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    338   4e-100   
gb|KEH27708.1|  ubiquitin carboxyl-terminal hydrolase-like protein      334   5e-100   
ref|XP_010441553.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    338   2e-99    
ref|XP_002870079.1|  hypothetical protein ARALYDRAFT_329738             344   6e-99    
ref|XP_006282214.1|  hypothetical protein CARUB_v10028485mg             336   8e-99    
ref|XP_010481420.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    336   9e-99    
ref|XP_002863392.1|  ubiquitin-specific protease 21                     335   2e-98    
ref|XP_009136881.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    332   4e-98    
ref|NP_567544.1|  ubiquitin-specific protease 20                        333   7e-98    Arabidopsis thaliana [mouse-ear cress]
gb|KFK31437.1|  hypothetical protein AALP_AA6G111700                    334   8e-98    
gb|KFK31436.1|  hypothetical protein AALP_AA6G111700                    334   8e-98    
ref|XP_003612905.1|  Ubiquitin carboxyl-terminal hydrolase              333   8e-98    
ref|XP_004509729.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    330   2e-97    
ref|XP_004165982.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    327   1e-96    
ref|XP_006285397.1|  hypothetical protein CARUB_v10006802mg             328   1e-96    
ref|XP_004148760.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    328   3e-96    
ref|XP_010559301.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    328   4e-96    
emb|CAA17132.1|  putative protein                                       337   4e-96    Arabidopsis thaliana [mouse-ear cress]
ref|NP_568667.1|  ubiquitin-specific protease 21                        328   7e-96    Arabidopsis thaliana [mouse-ear cress]
gb|AAG42759.1|AF302669_1  ubiquitin-specific protease 21                328   9e-96    Arabidopsis thaliana [mouse-ear cress]
emb|CDX87681.1|  BnaC02g32680D                                          325   1e-95    
ref|XP_010474480.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    322   9e-95    
ref|XP_009400755.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    320   1e-94    
ref|XP_006283229.1|  hypothetical protein CARUB_v10004260mg             322   1e-93    
gb|KFK28475.1|  hypothetical protein AALP_AA7G001000                    325   4e-93    
ref|XP_009397150.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    313   5e-93    
emb|CDY37145.1|  BnaA02g24640D                                          316   6e-92    
ref|XP_009101495.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    318   6e-92    
ref|XP_009128893.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    315   8e-92    
ref|XP_008678969.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    311   5e-91    
ref|XP_006414176.1|  hypothetical protein EUTSA_v10024586mg             314   5e-91    
emb|CDY58499.1|  BnaA06g40310D                                          313   1e-90    
ref|XP_004953520.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    314   2e-90    
emb|CDX77686.1|  BnaC07g19400D                                          310   4e-89    
ref|XP_006359794.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    302   4e-89    
ref|XP_010235841.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    309   8e-89    
ref|XP_010235840.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    309   8e-89    
gb|AET03287.2|  ubiquitin carboxyl-terminal hydrolase                   304   1e-88    
gb|KEH20084.1|  ubiquitin carboxyl-terminal hydrolase                   304   1e-88    
emb|CDX76553.1|  BnaA08g08470D                                          303   1e-87    
ref|XP_009108344.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    303   2e-87    
ref|XP_003628811.1|  Ubiquitin carboxyl-terminal hydrolase              304   7e-87    
ref|XP_008678970.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    298   2e-86    
ref|XP_006647718.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    301   3e-86    
gb|AFW72896.1|  putative ubiquitin carboxyl-terminal hydrolase su...    287   1e-83    
ref|XP_008646102.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    288   3e-83    
gb|EEE57611.1|  hypothetical protein OsJ_08002                          285   1e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010935024.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    281   3e-80    
ref|XP_010935023.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    282   4e-80    
gb|EEC73821.1|  hypothetical protein OsI_08545                          284   5e-80    Oryza sativa Indica Group [Indian rice]
ref|XP_010935022.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    282   5e-80    
ref|XP_010315548.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    273   3e-79    
ref|XP_008788657.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    272   5e-77    
gb|EMT33462.1|  Ubiquitin carboxyl-terminal hydrolase 21                272   2e-75    
ref|XP_006418757.1|  hypothetical protein EUTSA_v10002775mg             261   3e-72    
ref|XP_001760410.1|  predicted protein                                  249   2e-71    
ref|XP_002467449.1|  hypothetical protein SORBIDRAFT_01g028253          245   4e-70    Sorghum bicolor [broomcorn]
gb|KEH20037.1|  ubiquitin carboxyl-terminal hydrolase                   247   2e-69    
ref|XP_010327622.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    241   6e-69    
gb|EMS51605.1|  Ubiquitin carboxyl-terminal hydrolase 21                250   5e-68    
emb|CBI38293.3|  unnamed protein product                                241   2e-66    
ref|XP_004986779.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    247   5e-66    
ref|XP_010929151.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    246   5e-65    
ref|XP_009120313.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   1e-64    
ref|XP_008659903.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   1e-64    
ref|XP_008659901.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   1e-64    
ref|XP_008659902.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   1e-64    
ref|XP_008794344.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   1e-64    
ref|XP_008659900.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   1e-64    
ref|XP_003634989.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   1e-64    
ref|XP_010086853.1|  Ubiquitin carboxyl-terminal hydrolase 23           244   2e-64    
ref|XP_008794345.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   2e-64    
gb|AFW87760.1|  putative ubiquitin carboxyl-terminal hydrolase su...    242   2e-64    
ref|XP_010644060.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   3e-64    
emb|CBI20097.3|  unnamed protein product                                243   3e-64    
ref|XP_010684486.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   3e-64    
emb|CDY32735.1|  BnaA02g07970D                                          241   4e-64    
ref|XP_002283705.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   4e-64    Vitis vinifera
emb|CDY55010.1|  BnaA10g29360D                                          242   4e-64    
ref|XP_010265603.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    242   6e-64    
ref|XP_010265604.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    242   7e-64    
gb|KHG09713.1|  Ubiquitin carboxyl-terminal hydrolase 23 -like pr...    242   7e-64    
ref|XP_009366168.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    242   8e-64    
ref|XP_002454445.1|  hypothetical protein SORBIDRAFT_04g031200          239   8e-64    Sorghum bicolor [broomcorn]
ref|XP_010536980.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    241   9e-64    
ref|XP_009391112.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    241   2e-63    
ref|XP_009358449.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    241   2e-63    
ref|XP_009358448.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    241   2e-63    
emb|CDY02782.1|  BnaC02g11070D                                          239   2e-63    
ref|NP_001048381.1|  Os02g0795000                                       242   2e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002437970.1|  hypothetical protein SORBIDRAFT_10g005680          240   3e-63    Sorghum bicolor [broomcorn]
emb|CDY57464.1|  BnaC09g33510D                                          239   3e-63    
ref|XP_010235918.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    240   4e-63    
ref|XP_003572898.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    240   4e-63    
ref|XP_010545453.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    239   4e-63    
ref|XP_008384418.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    239   5e-63    
ref|XP_002989234.1|  hypothetical protein SELMODRAFT_1651               226   5e-63    
ref|XP_007011945.1|  Ubiquitin carboxyl-terminal hydrolase, putative    239   5e-63    
ref|XP_002965992.1|  hypothetical protein SELMODRAFT_1903               225   6e-63    
gb|KDO59444.1|  hypothetical protein CISIN_1g036257mg                   229   6e-63    
ref|XP_008394326.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    239   7e-63    
gb|AAO72607.1|  putative ubiquitin-specific protease                    238   7e-63    Oryza sativa Japonica Group [Japonica rice]
gb|EEC74168.1|  hypothetical protein OsI_09271                          240   9e-63    Oryza sativa Indica Group [Indian rice]
ref|XP_009394939.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    238   1e-62    
ref|XP_009394938.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    238   1e-62    
ref|XP_009132092.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    236   3e-62    
ref|NP_001056992.1|  Os06g0184300                                       237   3e-62    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD72518.1|  putative ubiquitin-specific protease 23                236   3e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006857223.1|  hypothetical protein AMTR_s00065p00205690          238   3e-62    
gb|EEE65221.1|  hypothetical protein OsJ_20367                          236   4e-62    Oryza sativa Japonica Group [Japonica rice]
gb|EEC80142.1|  hypothetical protein OsI_21934                          236   4e-62    Oryza sativa Indica Group [Indian rice]
ref|XP_006655855.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    236   6e-62    
ref|XP_008799648.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    236   1e-61    
ref|XP_008799649.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    235   1e-61    
gb|KEH32626.1|  ubiquitin carboxyl-terminal hydrolase                   233   3e-61    
ref|XP_008659199.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    234   3e-61    
ref|XP_006473993.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    233   4e-61    
ref|XP_006453628.1|  hypothetical protein CICLE_v10007375mg             233   4e-61    
ref|XP_003610327.1|  Ubiquitin carboxyl-terminal hydrolase              233   4e-61    
ref|XP_010227945.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    233   5e-61    
ref|XP_006600544.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    232   8e-61    
ref|XP_004964661.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    232   8e-61    
ref|XP_003550687.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    232   1e-60    
gb|KHN17486.1|  Ubiquitin carboxyl-terminal hydrolase 23                232   1e-60    
ref|XP_006279994.1|  hypothetical protein CARUB_v10025864mg             232   1e-60    
ref|XP_004954214.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    233   2e-60    
ref|XP_010942106.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    232   2e-60    
ref|XP_004288715.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    231   2e-60    
emb|CDY11838.1|  BnaC03g12640D                                          230   3e-60    
ref|XP_004507732.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    231   3e-60    
gb|KFK40800.1|  hypothetical protein AALP_AA2G042900                    230   3e-60    
ref|XP_006343657.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    230   4e-60    
ref|XP_002866243.1|  ubiquitin-specific protease 23                     229   5e-60    
ref|XP_002110073.1|  hypothetical protein TRIADDRAFT_53651              229   6e-60    Trichoplax adhaerens
gb|KHN42818.1|  Ubiquitin carboxyl-terminal hydrolase 23                229   6e-60    
gb|EYU34351.1|  hypothetical protein MIMGU_mgv1a000974mg                230   6e-60    
ref|XP_643982.1|  peptidase C19 family protein                          229   7e-60    Dictyostelium discoideum AX4
ref|XP_009763327.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    230   7e-60    
ref|XP_009763328.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    229   8e-60    
ref|XP_009403134.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    230   9e-60    
ref|XP_007154887.1|  hypothetical protein PHAVU_003G156400g             229   1e-59    
ref|XP_010235035.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    221   1e-59    
gb|KHG21280.1|  Ubiquitin carboxyl-terminal hydrolase 23 -like pr...    229   1e-59    
gb|AAG42761.1|AF302671_1  ubiquitin-specific protease 23                228   2e-59    Arabidopsis thaliana [mouse-ear cress]
ref|NP_568873.1|  ubiquitin carboxyl-terminal hydrolase 23              228   2e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004242587.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    228   2e-59    
ref|XP_011018026.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    228   2e-59    
ref|XP_002325138.2|  hypothetical protein POPTR_0018s11680g             228   3e-59    Populus trichocarpa [western balsam poplar]
ref|XP_011079415.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    228   3e-59    
ref|XP_009623302.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    227   4e-59    
ref|XP_009623303.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    227   6e-59    
ref|XP_002532957.1|  conserved hypothetical protein                     226   7e-59    Ricinus communis
ref|XP_010443509.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    226   7e-59    
ref|XP_008242981.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    226   8e-59    
ref|XP_010453037.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    225   1e-58    
ref|XP_010047114.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    226   1e-58    
ref|XP_010047113.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    225   2e-58    
ref|XP_010483358.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    224   2e-58    
gb|KDP38672.1|  hypothetical protein JCGZ_04025                         224   4e-58    
ref|XP_008794346.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    224   6e-58    
ref|XP_007203993.1|  hypothetical protein PRUPE_ppa000932mg             223   1e-57    
ref|XP_007338261.1|  cysteine proteinase                                219   2e-57    
ref|XP_009874773.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   5e-57    
ref|XP_011033415.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    220   9e-57    
ref|XP_011033416.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    220   9e-57    
ref|XP_008452958.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    220   1e-56    
emb|CDS05885.1|  hypothetical protein LRAMOSA08413                      215   1e-56    
gb|KFP92299.1|  Ubiquitin carboxyl-terminal hydrolase 36                207   2e-56    
ref|XP_004144731.1|  PREDICTED: uncharacterized protein LOC101219654    219   2e-56    
emb|CDP07922.1|  unnamed protein product                                218   5e-56    
gb|EPB89438.1|  hypothetical protein HMPREF1544_03807                   212   6e-56    
ref|XP_002308397.2|  hypothetical protein POPTR_0006s19890g             218   7e-56    Populus trichocarpa [western balsam poplar]
gb|EPZ36416.1|  Peptidase C19, ubiquitin carboxyl-terminal hydrol...    212   1e-55    
ref|XP_004158744.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    217   1e-55    
ref|XP_003289130.1|  hypothetical protein DICPUDRAFT_15497              216   1e-55    
ref|XP_003227691.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...    219   1e-55    
ref|XP_007425215.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    219   2e-55    
ref|XP_008436360.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    218   2e-55    
ref|XP_006401143.1|  hypothetical protein EUTSA_v10012558mg             216   2e-55    
emb|CAG04440.1|  unnamed protein product                                209   4e-55    Tetraodon nigroviridis
ref|XP_004080264.1|  PREDICTED: uncharacterized protein LOC101169567    216   5e-55    
ref|XP_008301976.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    217   6e-55    
ref|XP_008301971.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    217   6e-55    
gb|KFM56762.1|  Ubiquitin carboxyl-terminal hydrolase 42                216   7e-55    
gb|EMP34977.1|  Ubiquitin carboxyl-terminal hydrolase 42                214   7e-55    
ref|XP_007558965.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    216   8e-55    
ref|XP_005811757.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    216   1e-54    
gb|EKC38387.1|  Ubiquitin carboxyl-terminal hydrolase 36                214   1e-54    
ref|XP_004666304.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    216   1e-54    
ref|XP_008035028.1|  cysteine proteinase                                210   2e-54    
ref|XP_003291691.1|  hypothetical protein DICPUDRAFT_156310             207   2e-54    
ref|XP_003382872.1|  PREDICTED: hypothetical protein LOC100636480       214   2e-54    
ref|XP_010904199.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    215   2e-54    
gb|KFQ13271.1|  Ubiquitin carboxyl-terminal hydrolase 42                201   2e-54    
ref|XP_010326112.1|  PREDICTED: uncharacterized protein LOC104649112    207   2e-54    
ref|XP_009952194.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    201   2e-54    
ref|XP_001778273.1|  predicted protein                                  203   3e-54    
ref|XP_005998431.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    215   3e-54    
ref|XP_010728009.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    215   3e-54    
gb|KFQ07629.1|  Ubiquitin carboxyl-terminal hydrolase 42                201   3e-54    
ref|XP_005982188.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    214   3e-54    
ref|XP_007060712.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    215   3e-54    
gb|KFP83397.1|  Ubiquitin carboxyl-terminal hydrolase 36                201   4e-54    
ref|XP_005903007.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    214   4e-54    
ref|XP_005304763.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    214   4e-54    
sp|E1B9W9.1|UBP42_BOVIN  RecName: Full=Ubiquitin carboxyl-termina...    214   4e-54    
ref|XP_006765537.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    214   4e-54    
ref|XP_005879483.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    214   4e-54    
ref|XP_005249940.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    210   4e-54    
ref|XP_010844060.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    214   5e-54    
gb|ELR51150.1|  Ubiquitin carboxyl-terminal hydrolase 42                214   5e-54    
ref|NP_001193568.1|  ubiquitin carboxyl-terminal hydrolase 42           214   5e-54    
ref|XP_006097760.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    214   5e-54    
ref|XP_006097758.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    214   5e-54    
gb|ELK28954.1|  Ubiquitin carboxyl-terminal hydrolase 42                214   5e-54    
ref|XP_006906664.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    214   5e-54    
ref|XP_006044362.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    214   5e-54    
gb|ELU08703.1|  hypothetical protein CAPTEDRAFT_136598                  204   6e-54    
gb|KGL90287.1|  Ubiquitin carboxyl-terminal hydrolase 36                200   7e-54    
gb|EGU13414.1|  Ubiquitin carboxyl-terminal hydrolase                   208   7e-54    
gb|ELK17417.1|  Ubiquitin carboxyl-terminal hydrolase 42                213   8e-54    
ref|XP_007131125.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin sp...    213   9e-54    
ref|XP_001877033.1|  predicted protein                                  199   9e-54    
ref|XP_007251226.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    213   1e-53    
ref|XP_006637415.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    213   1e-53    
ref|XP_007251225.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    213   1e-53    
gb|AAR01977.1|  DUB1                                                    209   1e-53    
ref|XP_007187097.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    213   1e-53    
ref|XP_005448194.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    213   1e-53    
gb|EMS22013.1|  ubiquitin carboxyl-terminal hydrolase 36/42             207   1e-53    
ref|XP_007391868.1|  hypothetical protein PHACADRAFT_88204              207   1e-53    
ref|XP_008249445.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    213   1e-53    
ref|XP_009076149.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   1e-53    
ref|XP_005448198.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    212   1e-53    
ref|XP_005003767.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    212   2e-53    
ref|XP_005398030.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   2e-53    
ref|XP_006150254.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    212   2e-53    
ref|XP_005429889.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    209   2e-53    
ref|XP_004021348.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    212   2e-53    
dbj|GAM28335.1|  hypothetical protein SAMD00019534_115110               209   2e-53    
ref|XP_005698158.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    212   2e-53    
ref|XP_003469939.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    212   2e-53    
ref|XP_008154255.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    212   3e-53    
ref|XP_001493909.3|  PREDICTED: ubiquitin carboxyl-terminal hydro...    212   3e-53    
dbj|BAB14232.1|  unnamed protein product                                211   3e-53    
gb|KFU83943.1|  Ubiquitin carboxyl-terminal hydrolase 42                198   3e-53    
ref|XP_004617286.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   3e-53    
ref|XP_006941993.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    212   3e-53    
ref|XP_007081191.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    211   3e-53    
ref|XP_006265346.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    209   3e-53    
ref|XP_008525763.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    211   3e-53    
gb|KFO52947.1|  Ubiquitin carboxyl-terminal hydrolase 36                198   3e-53    
ref|XP_010964397.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   3e-53    
gb|EAW55047.1|  ubiquitin specific peptidase 42, isoform CRA_a          211   3e-53    
ref|XP_008696557.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   3e-53    
ref|XP_009450879.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   3e-53    
gb|AAH60846.2|  USP42 protein                                           211   4e-53    
ref|XP_004459757.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   4e-53    
ref|XP_003281959.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   4e-53    
ref|XP_009450882.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   4e-53    
emb|CAE53097.1|  ubiquitin-specific protease 42                         211   4e-53    
ref|XP_005495728.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   4e-53    
ref|XP_010366041.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   4e-53    
ref|XP_003895748.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   4e-53    
ref|XP_006715853.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   4e-53    
ref|XP_010990511.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    211   4e-53    
ref|XP_006210481.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    211   4e-53    
ref|XP_005249939.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   4e-53    
ref|XP_008016913.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   4e-53    
gb|AAT67238.1|  ubiquitin specific protease 42                          211   4e-53    
ref|XP_005621177.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   4e-53    
ref|XP_004691712.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   4e-53    
ref|XP_004459756.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   4e-53    
gb|EAL23715.1|  ubiquitin specific protease 42                          211   5e-53    
ref|XP_008313326.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   5e-53    
ref|XP_527662.2|  PREDICTED: ubiquitin carboxyl-terminal hydrolas...    211   5e-53    
ref|XP_006889821.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   5e-53    
ref|XP_004775041.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   5e-53    
ref|XP_003832997.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   5e-53    
emb|CDQ72554.1|  unnamed protein product                                211   5e-53    
ref|XP_004775033.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   5e-53    
ref|XP_008956648.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   5e-53    
ref|XP_006195948.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin sp...    211   5e-53    
ref|XP_008313328.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   5e-53    
ref|XP_009092775.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    209   5e-53    
ref|NP_115548.1|  ubiquitin carboxyl-terminal hydrolase 42              211   6e-53    
ref|XP_006112997.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   6e-53    
ref|XP_004268984.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   6e-53    
ref|XP_003798945.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   6e-53    
ref|XP_003761533.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   6e-53    
ref|XP_005621173.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   6e-53    
ref|XP_007940891.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   6e-53    
ref|XP_005549141.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   7e-53    
ref|XP_005339771.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   7e-53    
ref|XP_004394221.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   7e-53    
ref|XP_004440967.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   7e-53    
ref|XP_010641064.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    210   7e-53    
ref|XP_007448960.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    210   7e-53    
ref|XP_004380920.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   7e-53    
gb|EPH52982.1|  hypothetical protein CAOG_09153                         210   7e-53    
ref|XP_009495525.1|  hypothetical protein H696_03384                    207   7e-53    
ref|XP_004629760.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    210   7e-53    
ref|XP_007498323.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    211   7e-53    
ref|XP_010594578.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    210   7e-53    
ref|XP_007667480.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    210   8e-53    
ref|XP_005549142.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    210   8e-53    
ref|XP_001090104.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    210   8e-53    
ref|XP_003934290.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    210   9e-53    
ref|XP_001377522.3|  PREDICTED: ubiquitin carboxyl-terminal hydro...    210   9e-53    
gb|KFP76104.1|  Ubiquitin carboxyl-terminal hydrolase 42                197   9e-53    
gb|KFH66508.1|  ubiquitin carboxyl-terminal hydrolase 22/27/51          204   1e-52    
ref|XP_010343105.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    210   1e-52    
ref|XP_004705969.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    210   1e-52    
gb|KFO76299.1|  Ubiquitin carboxyl-terminal hydrolase 36                199   1e-52    
ref|XP_003961535.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    209   1e-52    
ref|XP_004840503.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    210   1e-52    
gb|EHB07899.1|  Ubiquitin carboxyl-terminal hydrolase 42                209   1e-52    
ref|XP_006859921.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    210   1e-52    
ref|XP_006031528.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    209   1e-52    
ref|XP_007525142.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    209   1e-52    
gb|AAH57482.1|  Usp42 protein                                           208   1e-52    
ref|XP_004918037.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    209   2e-52    
gb|KFW79216.1|  Ubiquitin carboxyl-terminal hydrolase 36                196   2e-52    
ref|XP_009867504.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    200   2e-52    
gb|AAH47168.1|  Usp42 protein                                           208   2e-52    
gb|KFR04670.1|  Ubiquitin carboxyl-terminal hydrolase 36                199   2e-52    
ref|XP_007958027.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    208   2e-52    
ref|NP_084025.2|  ubiquitin carboxyl-terminal hydrolase 42              209   2e-52    
gb|KFQ11814.1|  Ubiquitin carboxyl-terminal hydrolase 42                209   2e-52    
ref|XP_009949882.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    209   2e-52    
gb|KFQ76633.1|  Ubiquitin carboxyl-terminal hydrolase 36                196   2e-52    
ref|XP_010570639.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    197   2e-52    
ref|XP_002744123.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...    209   2e-52    
ref|XP_009304954.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    208   3e-52    
ref|XP_006801012.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    208   3e-52    
ref|NP_001099379.1|  ubiquitin carboxyl-terminal hydrolase 42           208   3e-52    
ref|XP_004892426.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    209   3e-52    
ref|XP_005169520.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    208   3e-52    
ref|XP_007615073.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    208   4e-52    
ref|XP_003786132.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   4e-52    
ref|XP_008071103.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    208   4e-52    
ref|XP_007647189.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    208   4e-52    
emb|CAN82847.1|  hypothetical protein VITISV_000504                     207   4e-52    
gb|ERE76345.1|  ubiquitin carboxyl-terminal hydrolase 42-like pro...    208   4e-52    
ref|XP_009559430.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   4e-52    
gb|EMC84050.1|  Ubiquitin carboxyl-terminal hydrolase 36                196   5e-52    
gb|KFP10024.1|  Ubiquitin carboxyl-terminal hydrolase 36                195   5e-52    
ref|XP_005368085.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    208   5e-52    
ref|XP_005080080.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    208   5e-52    
gb|KFV61597.1|  Ubiquitin carboxyl-terminal hydrolase 42                207   5e-52    
ref|XP_008102394.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   5e-52    
ref|XP_009351059.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    203   5e-52    
ref|XP_008102396.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   5e-52    
ref|XP_009898172.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   5e-52    
ref|XP_006982712.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   6e-52    
gb|KFZ49525.1|  Ubiquitin carboxyl-terminal hydrolase 42                207   6e-52    
gb|KFQ30817.1|  Ubiquitin carboxyl-terminal hydrolase 36                194   6e-52    
gb|KFW07284.1|  Ubiquitin carboxyl-terminal hydrolase 42                207   6e-52    
ref|XP_004460502.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    203   6e-52    
ref|XP_007431029.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   7e-52    
ref|XP_005530762.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   8e-52    
gb|KFQ86914.1|  Ubiquitin carboxyl-terminal hydrolase 42                207   8e-52    
gb|KFP11711.1|  Ubiquitin carboxyl-terminal hydrolase 42                207   8e-52    
ref|XP_009647797.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   8e-52    
ref|XP_010152054.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   8e-52    
ref|XP_005514962.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    207   8e-52    
gb|KFO13344.1|  Ubiquitin carboxyl-terminal hydrolase 42                207   9e-52    
ref|XP_002187464.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   9e-52    
ref|XP_009925717.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   9e-52    
gb|KFU93877.1|  Ubiquitin carboxyl-terminal hydrolase 42                207   9e-52    
ref|XP_009706972.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   9e-52    
gb|KFQ56476.1|  Ubiquitin carboxyl-terminal hydrolase 42                207   9e-52    
gb|KFM12330.1|  Ubiquitin carboxyl-terminal hydrolase 42                207   1e-51    
ref|XP_009491280.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   1e-51    
gb|KFQ76526.1|  Ubiquitin carboxyl-terminal hydrolase 42                207   1e-51    
gb|KFQ99801.1|  Ubiquitin carboxyl-terminal hydrolase 42                207   1e-51    
gb|KFV39952.1|  Ubiquitin carboxyl-terminal hydrolase 42                207   1e-51    
gb|KFQ10831.1|  Ubiquitin carboxyl-terminal hydrolase 42                206   1e-51    
gb|KFV50736.1|  Ubiquitin carboxyl-terminal hydrolase 42                206   1e-51    
ref|XP_010286949.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   1e-51    
ref|XP_010568519.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   1e-51    
gb|KFW88827.1|  Ubiquitin carboxyl-terminal hydrolase 42                206   1e-51    
ref|XP_009965094.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   1e-51    
ref|XP_009466032.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   1e-51    
ref|XP_010001626.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   1e-51    
ref|XP_008629607.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   1e-51    
gb|KFV96360.1|  Ubiquitin carboxyl-terminal hydrolase 42                206   1e-51    
gb|KFP50831.1|  Ubiquitin carboxyl-terminal hydrolase 42                206   1e-51    
ref|XP_010305723.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   1e-51    
ref|XP_009572127.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   1e-51    
gb|KFP69189.1|  Ubiquitin carboxyl-terminal hydrolase 42                206   1e-51    
ref|XP_009564354.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   1e-51    
ref|XP_002509376.1|  predicted protein                                  196   1e-51    
ref|XP_009925713.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   1e-51    
gb|KFV09210.1|  Ubiquitin carboxyl-terminal hydrolase 42                193   1e-51    
ref|XP_009814714.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   1e-51    
gb|KFW64315.1|  Ubiquitin carboxyl-terminal hydrolase 42                206   1e-51    
ref|XP_009318267.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   1e-51    
ref|XP_009284634.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   1e-51    
gb|KFO79945.1|  Ubiquitin carboxyl-terminal hydrolase 42                206   1e-51    
gb|KFP01515.1|  Ubiquitin carboxyl-terminal hydrolase 36                194   1e-51    
ref|XP_006886405.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   1e-51    
ref|XP_009090106.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   1e-51    
ref|XP_008822230.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   1e-51    
gb|EMP32431.1|  Ubiquitin carboxyl-terminal hydrolase 36                204   1e-51    
ref|NP_001100539.1|  ubiquitin carboxyl-terminal hydrolase 36           205   1e-51    
ref|XP_005523020.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   1e-51    
ref|XP_005420431.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   2e-51    
ref|XP_009499357.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   2e-51    
ref|XP_010085813.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    195   2e-51    
gb|KFP24115.1|  Ubiquitin carboxyl-terminal hydrolase 42                206   2e-51    
ref|XP_008631719.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   2e-51    
gb|AAH57470.1|  Usp36 protein                                           202   2e-51    
ref|XP_005054587.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   2e-51    
gb|KFW84394.1|  Ubiquitin carboxyl-terminal hydrolase 42                206   2e-51    
ref|XP_009879603.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    205   2e-51    
gb|EDL34654.1|  mCG13907, isoform CRA_a                                 205   2e-51    
ref|XP_005487410.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   2e-51    
ref|XP_009884579.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   2e-51    
gb|KFO59080.1|  Ubiquitin carboxyl-terminal hydrolase 42                206   2e-51    
ref|XP_002192172.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   2e-51    
gb|KGL86614.1|  Ubiquitin carboxyl-terminal hydrolase 42                206   2e-51    
dbj|BAC98173.1|  mKIAA1453 protein                                      205   2e-51    
ref|XP_010128225.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   2e-51    
gb|KFP39032.1|  Ubiquitin carboxyl-terminal hydrolase 42                206   2e-51    
ref|XP_010390753.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   2e-51    
ref|XP_010209012.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   2e-51    
ref|XP_004071701.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    205   2e-51    
gb|EDL34655.1|  mCG13907, isoform CRA_b                                 205   2e-51    
ref|XP_009298102.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    202   2e-51    
ref|XP_008153226.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    205   2e-51    
ref|XP_008926265.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   2e-51    
ref|NP_001028700.1|  ubiquitin carboxyl-terminal hydrolase 36           205   2e-51    
emb|CAG00219.1|  unnamed protein product                                205   2e-51    
ref|XP_004918308.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    197   2e-51    
ref|XP_008920085.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    205   2e-51    
ref|XP_005801572.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    205   2e-51    
gb|KFV11844.1|  Ubiquitin carboxyl-terminal hydrolase 42                206   3e-51    
ref|XP_009978781.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    206   3e-51    
ref|XP_002127053.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    202   3e-51    



>ref|XP_009791289.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Nicotiana 
sylvestris]
Length=699

 Score =   541 bits (1395),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 275/523 (53%), Positives = 369/523 (71%), Gaps = 26/523 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+VLQ FMH VPL+Q + + DH SPC++   GFCVLCA++EL+++SLAS G  + P
Sbjct  153   TCFLNAVLQSFMHTVPLLQHLTSNDHVSPCDSYLRGFCVLCAIRELVDLSLASGGDVVSP  212

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
              K+VNNL++FSS+F RFQQ DAHEFLQCFL+RLESCCN      +   + +N+VKQ FGG
Sbjct  213   WKLVNNLNHFSSSFHRFQQEDAHEFLQCFLDRLESCCNDSGPKDRAPSESDNIVKQAFGG  272

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+SKL+CCNCGH SDTYEPL+DLSLEI+DVDSL  AL+SFTKVE+I+DPE KF+CEKCK
Sbjct  273   RLVSKLRCCNCGHCSDTYEPLIDLSLEIKDVDSLPEALESFTKVEKIDDPEIKFSCEKCK  332

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              QVSIEKQL+LD+AP VA FHLKRF+NDGS VEK+ KHV+FP ELDLLPY + N+    E
Sbjct  333   EQVSIEKQLVLDKAPSVAAFHLKRFENDGSFVEKVDKHVSFPLELDLLPYTDNNQINNGE  392

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY+L+AV+VH G S  SGHYY F+ ++P EWYKFDDS+V RVQE++V+ +EAYI+FY K
Sbjct  393   MKYDLYAVIVHSGFSSCSGHYYSFIRSAPDEWYKFDDSEVFRVQEDLVLEEEAYIMFYAK  452

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAADE  1229
             +GTPWFS+ +E ++  +D SI N+SP+ VL +VD I    P+M  D  C+V+E++NAADE
Sbjct  453   RGTPWFSDFVEMKKSFIDPSIFNTSPKSVLDNVDAISIASPRMPNDLACNVSESNNAADE  512

Query  1228  ASSNVDGPKDNGIDRSDGKENSNVVSALIHEGMNNSSDICSAEAEKTPPPSVLKEKNCKQ  1049
             AS   D  K   I+ S+ K      +     G++ +     +  ++   PS   E+NC +
Sbjct  513   ASPKPDLEK---IEDSESKYTEQTSTP----GLSGAMKSLYSHVDEVFLPST-HEENCTR  564

Query  1048  EFRISKRFADLTTETPSISPSLEIYREDTADNAYSPPRALLRPADEVN------------  905
             +  ++KR   LT +T S SPS EIYR+D  +N Y+ PR  L  AD V+            
Sbjct  565   DIGVTKRSVTLTPKTLSRSPSPEIYRDDPPENTYAIPRGHLALADPVSFKNQSQKDHEQD  624

Query  904   --HPEGEKLVKKKMPSTRG----SALKGSHNESCMKKRRRRVE  794
                 +   L+KK++P +RG    +A++GS +E  + K+RR++E
Sbjct  625   LERKQACSLIKKRIPGSRGQQLMAAMRGSRSEGSVNKKRRKLE  667



>ref|XP_009617367.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Nicotiana 
tomentosiformis]
Length=663

 Score =   539 bits (1389),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 271/524 (52%), Positives = 371/524 (71%), Gaps = 27/524 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+VLQ F+H VPL+Q + + DH SPC++   GFCV  A +EL+++SLAS G  + P
Sbjct  146   TCFLNAVLQSFIHTVPLLQLLTSNDHTSPCDSYLRGFCVFYAFRELIDLSLASGGGVVSP  205

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP-KHENVVKQTFG  1952
              K+V+NL++FSS+F RFQQ DAHEFLQCFL+RLESCCN      + +P + +N+VKQ FG
Sbjct  206   WKLVDNLNHFSSSFHRFQQEDAHEFLQCFLDRLESCCNDSGPKDRAAPSESDNIVKQAFG  265

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CCNCGH SDTYEPL+DLSLEI+DVDSL  AL+SFTK+E+I+DPE KF+CEKC
Sbjct  266   GRLVSKLRCCNCGHCSDTYEPLIDLSLEIKDVDSLPEALESFTKIEKIDDPEIKFSCEKC  325

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K QV IEKQL+LD+AP VA FHLKRF+NDGS VEK+ KHV+FP ELDLLPY + N+   E
Sbjct  326   KEQVPIEKQLVLDKAPSVAAFHLKRFENDGSFVEKVDKHVSFPLELDLLPYTDSNQIANE  385

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             E KY+L+AV+VH G S  SGHYY F+ ++P EWYKFDDS+V RVQE++V+ +EAYI+FY 
Sbjct  386   EMKYDLYAVIVHSGFSSCSGHYYSFIRSAPDEWYKFDDSEVFRVQEDLVLEEEAYIMFYA  445

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAAD  1232
             K+GTPWFS+ +E ++  +D SI N+SP+ VL +VD I    P+M     CDV+E++NAAD
Sbjct  446   KRGTPWFSDFVEMKKPFIDPSIFNTSPKSVLDNVDAISIASPRMPNSLTCDVSESNNAAD  505

Query  1231  EASSNVDGPKDNGIDRSDGKENSNVVSALIHEGMNNSSDICSAEAEKTPPPSVLKEKNCK  1052
             EAS   D  K   I+ S+ K+     +     G+  +     +  ++   PS + E+N  
Sbjct  506   EASPKPDLEK---IEDSESKDTEQTSTP----GLAGARKSLDSHVDEVFLPS-MHEENYT  557

Query  1051  QEFRISKRFADLTTETPSISPSLEIYREDTADNAYSPPRALLRPADEVN-----------  905
             +E  ++KR A LT +TPS SPS EIYR+D ++N Y+ PR  L  AD+++           
Sbjct  558   REVGVTKRSATLTPKTPSRSPSPEIYRDDPSENTYAIPRGHLALADQISCKHQSQKDQER  617

Query  904   ---HPEGEKLVKKKMPSTRG----SALKGSHNESCMKKRRRRVE  794
                  +   L+KK++P +RG    +A++GS +E  + K+RR+++
Sbjct  618   DLERKQAFSLIKKRIPGSRGQQLMAAMRGSRSEGSVNKKRRKLQ  661



>ref|XP_009619343.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Nicotiana 
tomentosiformis]
Length=694

 Score =   526 bits (1356),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 279/523 (53%), Positives = 354/523 (68%), Gaps = 22/523 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQ F+H VPLIQ ++  DH +PC++  +GFCV+CALKEL++  L S+   + P
Sbjct  145   TCFLNSVLQSFIHTVPLIQGLKLNDHATPCDSYLKGFCVICALKELIDALLVSETGVVSP  204

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
              K VNNLSYFSSTF RFQQ DAHEFLQCFL++LE CC+  +     + + EN VKQ FGG
Sbjct  205   WKFVNNLSYFSSTFHRFQQEDAHEFLQCFLDKLEQCCDVSRPKDSPTLETENFVKQAFGG  264

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+SKL+CCNCGH SDTYE L+DLSLEIEDVDSL+ AL+SFTKVE+IED ETKFTCEKCK
Sbjct  265   RLVSKLRCCNCGHCSDTYETLIDLSLEIEDVDSLATALESFTKVEKIEDSETKFTCEKCK  324

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              QVSIEKQL+LD+AP VA  HLKRFK DGSLVEKI K+V+FP ELDL  Y + N+   EE
Sbjct  325   EQVSIEKQLVLDKAPSVAALHLKRFKTDGSLVEKIDKYVSFPLELDLHAYADNNQSDNEE  384

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY+L+AV+ H+G S SSGHYY F+ ++P+EWYKFDDSKV +V E+ ++SQEAY+LFY K
Sbjct  385   MKYDLYAVIRHVGFSYSSGHYYSFIRSAPNEWYKFDDSKVIQVGEDFILSQEAYVLFYAK  444

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAADE  1229
             +GTPWFS+ IE Q+  +D SI N+SP+ VL + + +    P++   R   V  + +AA E
Sbjct  445   RGTPWFSDFIEVQKPFIDPSILNTSPKSVLDNTNAVCVTSPRLPNPRALCVKGSHDAASE  504

Query  1228  ASSNVDGPKDNGIDRSDGKENSNVVSALIHEGMNNSSDICSAEAEKTPPPSVLKEKNCKQ  1049
             +S N      N +  SDGKEN    SA    G +N     S E +K   PS+LKE     
Sbjct  505   SSPN----SLNKVQDSDGKENVQTRSAPGPHGASNILHPKSPEVDKVSFPSILKEDCSTL  560

Query  1048  EFRISKRFADLTTETPSISPSLEIYREDTADNAYSPPRALLRPADEVN------------  905
             +     R   +T +TPS SPS EIYRED  +N Y  PR  LR AD V+            
Sbjct  561   DPGAPSRPIFITPKTPSRSPSPEIYREDPPENDYHIPRPHLRTADRVSCKKQLQKELEQN  620

Query  904   --HPEGEKLVKKKMPSTRG----SALKGSHNESCMKKRRRRVE  794
                 +   L+KK M  +R     +A+ GS +ES + K+RRRV+
Sbjct  621   MERKQACTLIKKSMRGSRAQQLLAAMAGSQSESSVNKKRRRVD  663



>ref|XP_009765253.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like isoform 
X1 [Nicotiana sylvestris]
Length=694

 Score =   526 bits (1355),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 280/526 (53%), Positives = 355/526 (67%), Gaps = 22/526 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQ FMH V LIQ ++  DH +PC++  +GFCV+CALKEL++  L S+   + P
Sbjct  145   TCFLNSVLQSFMHTVSLIQGLKLNDHATPCDSYLKGFCVICALKELIDALLVSETGVVSP  204

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
              K VNNLSYFSSTF RFQQ DAHEFLQCFL++LE CC+  +  G  + + EN VKQ FGG
Sbjct  205   WKFVNNLSYFSSTFHRFQQEDAHEFLQCFLDKLEQCCDVSRPKGSPTLETENFVKQAFGG  264

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+SKL+CCNCGH SDTYE L+DLSLEIEDVDSL+ AL+SFTKVE+IED E KFTCEKCK
Sbjct  265   RLVSKLRCCNCGHCSDTYETLIDLSLEIEDVDSLATALESFTKVEKIEDSEIKFTCEKCK  324

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              QVSIEKQL+LD+AP VA  HLKRFK DGSLVEKI K+V+FP ELDL  Y + N+   EE
Sbjct  325   EQVSIEKQLVLDKAPSVAALHLKRFKTDGSLVEKIDKYVSFPLELDLHAYADNNQSDNEE  384

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY+L+AV+ H+G S +SGHYY F+ ++P+EWYKFDDSKV +V E+ V+SQEAY+LFY K
Sbjct  385   MKYDLYAVIRHVGFSYTSGHYYSFIRSAPNEWYKFDDSKVIQVGEDFVLSQEAYVLFYAK  444

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAADE  1229
             +GTPWFS+ IE Q+  +D SI N+SP+ VL + D +    P+    R   V  +++AA+E
Sbjct  445   RGTPWFSDFIEVQKPFIDPSILNTSPKSVLDNTDVVCVTSPRPPNPRALCVKGSNDAANE  504

Query  1228  ASSNVDGPKDNGIDRSDGKENSNVVSALIHEGMNNSSDICSAEAEKTPPPSVLKEKNCKQ  1049
              S N      N +  SDGKEN    SA    G +N     S E +K   PS+LKE     
Sbjct  505   LSPN----SLNKVQDSDGKENVQTRSAPGPHGASNILHPKSPEVDKVSFPSILKENCSTL  560

Query  1048  EFRISKRFADLTTETPSISPSLEIYREDTADNAYSPPRALLRPADEVN------------  905
             +     R   +T +TPS SPS EIY+ED  +N Y  PR  LR AD V+            
Sbjct  561   DPGAPSRTIYITPKTPSRSPSPEIYQEDPPENDYHIPRPHLRTADWVSCKKQLPKELEQN  620

Query  904   --HPEGEKLVKKKMPSTRG----SALKGSHNESCMKKRRRRVEGSP  785
                 +   L+KK M  +R     +A+ GSH+ S + K+RRR++ SP
Sbjct  621   MERKQACTLIKKSMRGSRAQQLLAAMGGSHSGSSVNKKRRRMDVSP  666



>ref|XP_006352858.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Solanum 
tuberosum]
Length=712

 Score =   518 bits (1335),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 280/540 (52%), Positives = 362/540 (67%), Gaps = 37/540 (7%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+VLQ FMH VPLIQ +++ DH +PC +  +GFCV+CAL++L++ SL S+   + P
Sbjct  150   TCFLNAVLQSFMHTVPLIQGLQSIDHATPCTSYLKGFCVICALRKLIDASLFSEAGVVSP  209

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
              K VNNL+YFSSTF RFQQ DAHEFLQCFL++LE CC+  +     + + +N+VKQ FGG
Sbjct  210   WKFVNNLNYFSSTFHRFQQEDAHEFLQCFLDKLERCCDDSRPKDCQTLETDNIVKQAFGG  269

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+SKL+CCNCGH SDTYE L+DLSLEIEDVDS+  AL+SFTKVE+IED ETKFTCEKCK
Sbjct  270   RLVSKLRCCNCGHCSDTYETLIDLSLEIEDVDSVDTALESFTKVEKIEDSETKFTCEKCK  329

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              QVSIEKQL+LD+AP VA  HLKRFK DGSLVEKI K+V+FP ELDL  Y + N+   EE
Sbjct  330   EQVSIEKQLVLDKAPSVAALHLKRFKTDGSLVEKIDKYVSFPLELDLHAYAD-NQTDNEE  388

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY+L+AV+VHIG S  SGHYY F+ ++P+EWYKFDDSKV RV+E+ V+SQEAY+LFY K
Sbjct  389   MKYDLYAVIVHIGFSYCSGHYYSFIRSAPNEWYKFDDSKVVRVREDYVLSQEAYVLFYAK  448

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAADE  1229
             +GTPWFS+ IE Q+  +D SI ++SP+ VL + D +  P P +   +   V E+++AA+E
Sbjct  449   RGTPWFSDFIEGQKPFIDPSIRSTSPKSVLENTDAVCVPSPLLPNAQAFCVKESNDAANE  508

Query  1228  ASSNVDGPKDNGIDRSDGKENSNVVSALIHE-GMNNSSDICSAEAEKTPPPSVLKE----  1064
             +S +      N +  SDGKEN  ++S      G +N  D  S E +K   PSVLK+    
Sbjct  509   SSPS----SLNKVHDSDGKENVQMMSTPRPPLGASNILDSKSREVDKVSSPSVLKDLSKS  564

Query  1063  --------KNCKQEFRIS-KRFADLTTETPSISPSLEIYREDTADNAYSPPRALLRPADE  911
                     +NC      S  R   +T +TP  SPS EIYRED  DN Y  P   LR   +
Sbjct  565   VSSVSVLKENCSTLTPGSTSRTLYITPDTPPRSPSPEIYREDPPDNDYHIPHGHLRTVGQ  624

Query  910   VN--------------HPEGEKLVKKKMPSTRG----SALKGSHNESCMKKRRRRVEGSP  785
             V+                +   L+KK MP +R     +A++GS +E    KRRR +E SP
Sbjct  625   VSCKKQLQKDLEQDMERKQACSLIKKNMPGSRAQQLLAAMQGSRSEGSANKRRRGMEVSP  684



>ref|XP_009765254.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like isoform 
X2 [Nicotiana sylvestris]
Length=681

 Score =   517 bits (1331),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 273/513 (53%), Positives = 352/513 (69%), Gaps = 9/513 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQ FMH V LIQ ++  DH +PC++  +GFCV+CALKEL++  L S+   + P
Sbjct  145   TCFLNSVLQSFMHTVSLIQGLKLNDHATPCDSYLKGFCVICALKELIDALLVSETGVVSP  204

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
              K VNNLSYFSSTF RFQQ DAHEFLQCFL++LE CC+  +  G  + + EN VKQ FGG
Sbjct  205   WKFVNNLSYFSSTFHRFQQEDAHEFLQCFLDKLEQCCDVSRPKGSPTLETENFVKQAFGG  264

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+SKL+CCNCGH SDTYE L+DLSLEIEDVDSL+ AL+SFTKVE+IED E KFTCEKCK
Sbjct  265   RLVSKLRCCNCGHCSDTYETLIDLSLEIEDVDSLATALESFTKVEKIEDSEIKFTCEKCK  324

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              QVSIEKQL+LD+AP VA  HLKRFK DGSLVEKI K+V+FP ELDL  Y + N+   EE
Sbjct  325   EQVSIEKQLVLDKAPSVAALHLKRFKTDGSLVEKIDKYVSFPLELDLHAYADNNQSDNEE  384

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY+L+AV+ H+G S +SGHYY F+ ++P+EWYKFDDSKV +V E+ V+SQEAY+LFY K
Sbjct  385   MKYDLYAVIRHVGFSYTSGHYYSFIRSAPNEWYKFDDSKVIQVGEDFVLSQEAYVLFYAK  444

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAADE  1229
             +GTPWFS+ IE Q+  +D SI N+SP+ VL + D +    P+    R   V  +++AA+E
Sbjct  445   RGTPWFSDFIEVQKPFIDPSILNTSPKSVLDNTDVVCVTSPRPPNPRALCVKGSNDAANE  504

Query  1228  ASSNVDGPKDNGIDRSDGKENSNVVSALIHEGMNNSSDICSAEAEKTPPPSVLKEKNCKQ  1049
              S N      N +  SDGKEN    SA    G +N     S E +K   PS+LKE     
Sbjct  505   LSPN----SLNKVQDSDGKENVQTRSAPGPHGASNILHPKSPEVDKVSFPSILKENCSTL  560

Query  1048  EFRISKRFADLTTETPSISPSLEIYREDTADNAYSPPRALLRPADE-VNHPEGEKLVKKK  872
             +     R   +T +TPS SPS EIY+ED   +  S  + L +  ++ +   +   L+KK 
Sbjct  561   DPGAPSRTIYITPKTPSRSPSPEIYQEDPPADWVSCKKQLPKELEQNMERKQACTLIKKS  620

Query  871   MPSTRG----SALKGSHNESCMKKRRRRVEGSP  785
             M  +R     +A+ GSH+ S + K+RRR++ SP
Sbjct  621   MRGSRAQQLLAAMGGSHSGSSVNKKRRRMDVSP  653



>ref|XP_004245897.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Solanum 
lycopersicum]
Length=714

 Score =   512 bits (1319),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 279/541 (52%), Positives = 355/541 (66%), Gaps = 37/541 (7%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+VLQ FMH VPLIQ +++ DH +PC     GFCV+CAL++L++ SL S+   + P
Sbjct  150   TCFLNAVLQSFMHTVPLIQGLKSIDHATPCNGYLNGFCVICALRKLIDASLFSEAGVVSP  209

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
              K VNNL+YFSSTF RFQQ DAHEFLQCFL++LE C +  K     + + +N+VKQ FGG
Sbjct  210   WKFVNNLNYFSSTFHRFQQEDAHEFLQCFLDKLERCYDDSKSKDCQTLETDNIVKQAFGG  269

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+SKL+CCNCGH SDTYE L+DLSLEIEDVDS+  AL+SFTKVE+IED ETKFTCEKCK
Sbjct  270   RLVSKLRCCNCGHCSDTYETLIDLSLEIEDVDSVDTALESFTKVEKIEDSETKFTCEKCK  329

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              QVSIEKQL+LD+AP VA  HLKRFK DGSLVEKI K+V+FP ELDL  Y + ++    E
Sbjct  330   EQVSIEKQLVLDKAPTVAALHLKRFKTDGSLVEKIDKYVSFPLELDLHAYADNSQTDNVE  389

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY+L+AV+VHIG S  SGHYY F+ ++P+EWYKFDDSKV RV+E+ V+SQEAY+LFY K
Sbjct  390   MKYDLYAVIVHIGFSYCSGHYYSFIRSAPNEWYKFDDSKVVRVREDYVLSQEAYVLFYAK  449

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAADE  1229
             +GT WFS+ IE Q+  +D SI ++SP+ VL + D +  P P +   +   V E++ AA+E
Sbjct  450   RGTAWFSDFIEGQKPFIDPSILSTSPKSVLENTDAVCVPSPLLPNAQAFGVKESNGAANE  509

Query  1228  ASSNVDGPKDNGIDRSDGKENSNVVSALIHE-GMNNSSDICSAEAEKTPPP---------  1079
             +S +      N +  SDGKEN  ++S      G +N     S E  K   P         
Sbjct  510   SSPS----SLNKVHDSDGKENVQMMSTPTPPLGASNILVSKSREVGKVSSPSVLKDLSKP  565

Query  1078  ----SVLKEKNCKQEFRISKRFADLTTETPSISPSLEIYREDTADNAYSPPRALLR----  923
                 SVLKE +       + R   +T +TP  SPS EIYRED  DN Y  PR  LR    
Sbjct  566   VSSVSVLKENSSTLTPGSTSRTLYITPDTPPRSPSPEIYREDPPDNDYHIPRGHLRMVGQ  625

Query  922   -------PADEVNHPEGEK----LVKKKMPSTRG----SALKGSHNESCMKKRRRRVEGS  788
                      D+V      K    L+KK MP +RG    +A++G  +E   KKRRRR+E S
Sbjct  626   VSCKKQLQKDDVEQDMERKQACFLIKKNMPGSRGQQLLAAMQGLRSEGSAKKRRRRMEVS  685

Query  787   P  785
             P
Sbjct  686   P  686



>ref|XP_011082363.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Sesamum 
indicum]
Length=644

 Score =   481 bits (1239),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 269/530 (51%), Positives = 348/530 (66%), Gaps = 26/530 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNE-GFCVLCALKELMNISLASKGSTIR  2132
             TCFLNSVLQCF+H+VPL+  I +  H     +CNE GFC+LCAL++L+ +SLAS    + 
Sbjct  91    TCFLNSVLQCFIHMVPLLHGILSDMHLGN-SSCNEDGFCILCALRQLVELSLASTNRVVS  149

Query  2131  PKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFG  1952
             P  +VNNLSYFSS FQRFQQ DAHEFLQCFL+RLESC +  K    +S + +N+VKQ FG
Sbjct  150   PWNLVNNLSYFSSNFQRFQQEDAHEFLQCFLDRLESCHD-SKREDCLSSQSDNLVKQVFG  208

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G ++SKL+CC+CGH SDTYEP +DLSLEIED D L  AL SFTKVE+IEDPETKFTCEKC
Sbjct  209   GRVVSKLKCCSCGHFSDTYEPSIDLSLEIEDADDLLTALQSFTKVEKIEDPETKFTCEKC  268

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K QVSIEKQL  D+AP VATFHLKRFKNDG LV+KI KHV FP ELDL+P+    EK   
Sbjct  269   KEQVSIEKQLSFDQAPYVATFHLKRFKNDGCLVQKIDKHVAFPLELDLVPFTGGGEKNDA  328

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             E KY L+AVVVHIG++ +SGHYYCF+  SP+ W KFDD+KV  V E+ V+SQEAYILFY 
Sbjct  329   ELKYVLYAVVVHIGMTSTSGHYYCFIRLSPNMWCKFDDAKVVLVHEDFVLSQEAYILFYA  388

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCD---VNETDN  1241
             K+GT WFS  I+TQ+L +D++  ++SP+ VL +VD   +  P  +    CD   VN+T +
Sbjct  389   KKGTAWFSSFIQTQKLCVDSTAWDTSPKSVLDNVD-TSSVSPTFQNKFNCDSDGVNDTGS  447

Query  1240  AADEASSNVDGPKDNGIDRSDGKENSNVVSALIHEGMNNSSDICSAEAEKTPPPSVLKEK  1061
                E  +N         + S+     N+    +     ++ D+   EA K     +L+  
Sbjct  448   EHKELENNEIKDSRPMHNESEKGSEYNLHRMSVSVAPADAPDVSLPEAHKEVSTILLETV  507

Query  1060  NCKQEFRISKRFADLTTETPSISPSLEIYREDTADNAYSPPRALLRPADEVN--------  905
             N  QE R ++  +   T+TP+ SPS EIYRED  + A+S PR  LR  D V+        
Sbjct  508   NQGQEVRAAEN-SQTITQTPTRSPSPEIYREDPPEAAFSIPRHHLRLVDHVSCKRRLDKD  566

Query  904   -----HPEGEKLVKKKMPSTRG----SALKGSHNESCM-KKRRRRVEGSP  785
                    +   L+KK +P +RG    SAL+GS  ++ + +K+ RR E  P
Sbjct  567   MDDLETRQACSLIKKSIPGSRGQQLLSALRGSKTDASVNRKKSRRSEFPP  616



>emb|CDP13031.1| unnamed protein product [Coffea canephora]
Length=662

 Score =   476 bits (1225),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 284/612 (46%), Positives = 367/612 (60%), Gaps = 96/612 (16%)
 Frame = -1

Query  2371  NSFFWDDKSllvggglanlgNTCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCV  2192
             +S+  ++KS +VG GLANLGNTCFLN++LQCF H VPL+Q + + +H  PC++ +EGFCV
Sbjct  30    SSWLSENKSPVVGAGLANLGNTCFLNAILQCFTHTVPLLQGLLSSNHKVPCDSNSEGFCV  89

Query  2191  LCALKELMNISLASKGSTIRPKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNY  2012
              C+L E +  SL S G  I P K VNNL+YFSS+F+RFQQ DAHEFLQCFL++LESCC+ 
Sbjct  90    FCSLYEHIQFSLISTGKIISPWKFVNNLNYFSSSFRRFQQEDAHEFLQCFLDKLESCCSG  149

Query  2011  PKLNGQVSPKHENVVKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALD  1832
              + N  +    +N+VKQ FGG LIS L CCNCGH SDT+EP +DLSLEIE+   L  AL+
Sbjct  150   FECNNTLHSGSDNMVKQVFGGRLISMLGCCNCGHWSDTFEPSIDLSLEIENASDLHTALE  209

Query  1831  SFTKVERIEDPETKFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHV  1652
             SFTK+E++EDPETKFTCE CK QVS+EKQL+LD+ P VA FHLKRFKNDGS VEKI K+V
Sbjct  210   SFTKLEKLEDPETKFTCEHCKEQVSVEKQLMLDQVPSVAAFHLKRFKNDGSFVEKIDKYV  269

Query  1651  TFPPELDLLPYV--ERNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDD  1478
              FP ELDL PY   ++NE   EE KY+LFAVVVH G S +SGHYYC++  +P EWY+FDD
Sbjct  270   KFPLELDLQPYTICDQNE---EELKYDLFAVVVHTGFSSTSGHYYCYIRVAPDEWYRFDD  326

Query  1477  SKVTRVQENVVMSQEAYILFYVKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIF  1298
             SKV  VQE  V+ QEAYILFY KQG P FS  I+TQ+  +D S+ N+SP+ VL  VD   
Sbjct  327   SKVRWVQEEYVLMQEAYILFYAKQGIPSFSSFIQTQKQWMDLSLLNTSPKSVLDMVDVST  386

Query  1297  NPYPKM-----ETDRPCDVNETDNAADEASSNVDGPKDNGIDRSDGKENS----------  1163
                  +     + D P DV ET  A      N+ G +D+ ++  + KENS          
Sbjct  387   GSSSLLLNHCSDVDEPSDVAETICA-----ENLSGTRDSRVNDGEIKENSISSMLCVANN  441

Query  1162  --NVVSALIHEG----MNNSSDICSAE---------------------------------  1100
               NV  +  H+     +NNS+D+ S E                                 
Sbjct  442   SCNVAKSEDHQSTSPVLNNSTDVPSCEADKSASISSDGPSCEADKSASSSYVPSCEANKS  501

Query  1099  ----------------AEKTPPPSVLKEKNCKQEFRISKRFADLTTETPSISPSLEIYRE  968
                             A+KT P   L+E N  QE    +  A +   TPS S S EIYRE
Sbjct  502   ACLSVLNSSDDVPPCKADKTTPRPALQENNSNQEHGEFRNIAGVMPATPSRSASPEIYRE  561

Query  967   DTADNAYSPPRALLRPADEVN-----HPEGEKL-------VKKKMPSTRG----SALKGS  836
             D  D  +S  R  LR  ++V+     + + E L       + KKMP +RG    +A++GS
Sbjct  562   DPPDTTFSISRGHLRSMEQVSCKRQLNKDLENLERKQAYTLAKKMPGSRGQQLMAAMRGS  621

Query  835   HNESCMKKRRRR  800
              +   + K+R R
Sbjct  622   LSAGSLNKKRSR  633



>ref|XP_010663507.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21 [Vitis vinifera]
Length=766

 Score =   463 bits (1191),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 252/534 (47%), Positives = 342/534 (64%), Gaps = 37/534 (7%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+VLQCF H VPL+Q + +C+H  PC +  EGFCVLC L++ + +SLAS G  I P
Sbjct  215   TCFLNAVLQCFTHTVPLVQGLRSCNHAMPCHSFYEGFCVLCTLRDHIELSLASSGRAIMP  274

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
              K+V+NL+  SS+ QR+QQ DAHEFLQC L+RL+S     +  G  SP  +N+VK  FGG
Sbjct  275   LKLVDNLNNISSSLQRYQQEDAHEFLQCLLDRLDSFYLMNQDKGSHSPD-DNLVKHVFGG  333

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
             +LISKL+CCNCGH SDTYEPL+DLSLEIEDVD+L  AL+SFTKVE+IEDPE KFTC+ CK
Sbjct  334   YLISKLRCCNCGHISDTYEPLIDLSLEIEDVDTLPCALESFTKVEKIEDPEMKFTCDNCK  393

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              +VS+EKQLLLD+ PLVA FHLKRFK DG+ VEKI KHV FP ELDLLPY +  E    E
Sbjct  394   EEVSVEKQLLLDQVPLVAAFHLKRFKTDGTYVEKIDKHVEFPLELDLLPYTKEREDDNVE  453

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY L+A+V H G S +SGHY+ ++ +SP  W++ DDSKVT V E+ V+ QEAYILFY +
Sbjct  454   LKYELYAIVEHTGFSSTSGHYFSYIRSSPDTWHRLDDSKVTSVPEDYVLHQEAYILFYAR  513

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAADE  1229
             QGTPWFS +++TQ+  LD + S +SP+ VL +VD I    P +      + +ET +AADE
Sbjct  514   QGTPWFSSLMQTQKPCLDPNTSGNSPKSVLDNVDSISTSLPTLANVYSHEASETVDAADE  573

Query  1228  ASSNVDGPKDNGIDR--SDGKENSNV-------VSALIHEGMNNSSDICSAEAEKTPPPS  1076
              S+ + G     + +   DG     V       V++     ++++ +I +    +    +
Sbjct  574   ISTCLSGGGRGDVVQVHEDGDVPHRVDTPMPLGVTSCFDGTLDHTQNISTTSPCRDHDGN  633

Query  1075  VLKEKNCKQEFRISKRFADLTTETPSISPSLEIYREDTADNAYSPPRALLRPADEV--NH  902
                 +NCK +            +TP  SPS +IY E+  + +Y+ PR  LR  ++V    
Sbjct  634   QHINENCKSKIH---------PQTPPRSPSPDIYAEEPPEVSYNIPRGHLRQKNQVACKK  684

Query  901   PEGEKL----------VKKKMPSTRG----SALKGSHNESCM--KKRRRRVEGS  788
             P  + L          + K MP++R     +A+KGS +E  +  KK +RR+E S
Sbjct  685   PLNKALEDSRKREACKLCKNMPASRSMRLMAAMKGSQSEGSLGKKKSKRRMESS  738



>ref|XP_010275207.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21 [Nelumbo 
nucifera]
Length=651

 Score =   450 bits (1157),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 247/522 (47%), Positives = 337/522 (65%), Gaps = 44/522 (8%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN++LQCF H VPL+Q + +C+H +PCE  ++ FCVLCAL++ + +SLAS G  I P
Sbjct  121   TCFLNAILQCFTHTVPLVQGLRSCNHATPCERGSKEFCVLCALRDHVELSLASSGRIISP  180

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQ-VSPKHENVVKQTFG  1952
              K+V+NLSY SS+F+RF+Q DAHEFLQC L+RL+SCC  P L  Q +S +    VKQ FG
Sbjct  181   SKLVDNLSYLSSSFRRFEQEDAHEFLQCLLDRLDSCCLDPTLQNQNLSSQEVTFVKQIFG  240

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+L+CCNC HRSDT+EPL+DLSLEI+DVD+L  AL SFTKVE IEDPET+FTCE C
Sbjct  241   GRLKSQLRCCNCSHRSDTFEPLIDLSLEIDDVDTLPNALQSFTKVENIEDPETRFTCENC  300

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +VS+EKQL LD+APLVA FHLKRFKNDGS VEKI KHV +P ELDL PY   ++K   
Sbjct  301   KQKVSVEKQLTLDQAPLVAAFHLKRFKNDGSYVEKIDKHVEYPLELDLHPYTGCDQKNNV  360

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY L+AVVVHIG +  SGHYYCF+ +SP  W++ DDSKV RV +  V++QEAYILFY 
Sbjct  361   NLKYELYAVVVHIGFTPWSGHYYCFIRSSPHTWHRLDDSKVMRVTQEFVLAQEAYILFYA  420

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAAD  1232
             + G+PWFS ++ET +  ++ +  ++SP+ VL  V+++  P P  E           N+  
Sbjct  421   RHGSPWFSSLMETLKPCMNTNSPSTSPKSVL-DVERVCIPLPLKE-----------NSCR  468

Query  1231  EASSNVDGPKDNGIDRSDGKENSNVVSALIHEGMNNSSDICSAEAEKTPPPSVLKEKNCK  1052
             EA         NG     GK     VS  +  G ++ +   +A  ++       ++ NC 
Sbjct  469   EA---------NGARDDVGK-----VSNTLPPGASSFTVFDAANDDEERXSYPCQDHNCC  514

Query  1051  QEFRISKRFADLTTET-PSISPSLEIYREDTADNAYSPPRALLRPADEV--NHP------  899
              +   S+    +  +T P  SPS +IY +  ++ +YS PRA LR  + +    P      
Sbjct  515   SKPEESRNNVGVCPQTPPPRSPSPDIYSDGPSEKSYSIPRAHLRSEERLPCTRPGNNALE  574

Query  898   --EGEKLVK--KKMPSTRG----SALKGSHNESCMKKRRRRV  797
               + ++LVK  K MPS+R     +AL+ S ++  + ++RRR 
Sbjct  575   EFKKKQLVKLTKTMPSSRRNGLMAALQTSRSDGSLDRKRRRT  616



>gb|KDO40679.1| hypothetical protein CISIN_1g005687mg [Citrus sinensis]
Length=683

 Score =   446 bits (1146),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 245/549 (45%), Positives = 337/549 (61%), Gaps = 46/549 (8%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N++LQCF H +PL+Q++ + DHP PC+   EGFCV+CAL++ + +SLAS G  + P
Sbjct  116   TCFINAILQCFTHTLPLVQALRSFDHPRPCDGATEGFCVICALRDHIELSLASSGKVLSP  175

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQ-VSPKHENVVKQTFG  1952
             +K+V+NL+Y SS FQR+QQ DAHEFLQC L+RLESCC   K   + +S + +N+V++ FG
Sbjct  176   RKLVDNLNYISSFFQRYQQEDAHEFLQCLLDRLESCCLDSKTKDESLSSQGDNIVQRVFG  235

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G LISKLQCCNCG  SDTYEPL+DLSLEIEDV SL  AL+SFTK+E+IEDPETKFTCEKC
Sbjct  236   GCLISKLQCCNCGSCSDTYEPLIDLSLEIEDVGSLGSALESFTKLEKIEDPETKFTCEKC  295

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K QVS+EKQL+LD+ P VA FHLKRFK DGS V KI KHV FP ELDL PY    +    
Sbjct  296   KEQVSVEKQLMLDKVPSVAAFHLKRFKTDGSYVVKIDKHVEFPLELDLKPYTSGGQNSDV  355

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             E KY+L+A+V H+G S + GHY+ ++ +SP  W++ +DS+VTRV+E  V+SQ+AYILFY 
Sbjct  356   ELKYHLYAIVEHMGSSPTCGHYFSYIRSSPDTWHRLNDSRVTRVEEEFVLSQDAYILFYA  415

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAAD  1232
             KQGT W S ++E + + ++A ISNSSP+ VL +V+  +     +     C  NE   +A 
Sbjct  416   KQGTEWVSSLLEAESIGMNADISNSSPKSVLDNVENDYTSRSGVANAESCKANEPSASAG  475

Query  1231  EASSN-----------VDGPKDNGIDRSDGKENSNVVSALIHEGMNNSSDICSAEA----  1097
             ++S+            V+  +D     S     ++  +A  HE  +N+  I  A      
Sbjct  476   DSSTKFSCQLRSIDLEVNETRDTVKGMSACFTLASCRNAAEHETRDNTPMIDDASRPLSA  535

Query  1096  ---------EKTPPPSVLKEKNCK---QEFRISKRFADLTTETPSISPSLEIYREDTADN  953
                      EK    + L+E NC    ++ +I   F  L   TP  SPS +I+     + 
Sbjct  536   SDFYGVFCNEKVNKLTSLEEDNCNPGVEKVKIVDGFHPL---TPPRSPSPDIHSGKPRE-  591

Query  952   AYSPPRALL-------------RPADEVNHPEGEKLVKKKMPSTRGSALKGSHNESCMKK  812
              Y  PR  L             R   ++   E  + +KK M   R   L  + N+  +  
Sbjct  592   TYQVPREHLKLESKGACKTQLERNGKDLERQEAVRCIKKTMTGERYMKLMAAVNDVSL-N  650

Query  811   RRRRVEGSP  785
             R+RR++ SP
Sbjct  651   RKRRLKSSP  659



>ref|XP_006428428.1| hypothetical protein CICLE_v10013784mg [Citrus clementina]
 ref|XP_006491730.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like isoform 
X1 [Citrus sinensis]
 gb|ESR41668.1| hypothetical protein CICLE_v10013784mg [Citrus clementina]
Length=683

 Score =   445 bits (1145),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 245/549 (45%), Positives = 337/549 (61%), Gaps = 46/549 (8%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N++LQCF H +PL+Q++ + DHP PC+   EGFCV+CAL++ + +SLAS G  + P
Sbjct  116   TCFINAILQCFTHTLPLVQALRSFDHPRPCDGATEGFCVICALRDHIELSLASSGKVLSP  175

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQ-VSPKHENVVKQTFG  1952
             +K+V+NL+Y SS FQR+QQ DAHEFLQC L+RLESCC   K   + +S + +N+V++ FG
Sbjct  176   RKLVDNLNYISSFFQRYQQEDAHEFLQCLLDRLESCCLDSKTKDESLSSQGDNIVQRVFG  235

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G LISKLQCCNCG  SDTYEPL+DLSLEIEDV SL  AL+SFTK+E+IEDPETKFTCEKC
Sbjct  236   GCLISKLQCCNCGSCSDTYEPLIDLSLEIEDVGSLGSALESFTKLEKIEDPETKFTCEKC  295

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K QVS+EKQL+LD+ P VA FHLKRFK DGS V KI KHV FP ELDL PY    +    
Sbjct  296   KEQVSVEKQLMLDKVPSVAAFHLKRFKTDGSYVVKIDKHVEFPLELDLKPYTSGGQNSDV  355

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             E KY+L+A+V H+G S + GHY+ ++ +SP  W++ +DS+VTRV+E  V+SQ+AYILFY 
Sbjct  356   ELKYHLYAIVEHMGSSPTCGHYFSYIRSSPDTWHRLNDSRVTRVEEEFVLSQDAYILFYA  415

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAAD  1232
             KQGT W S ++E + + ++A ISNSSP+ VL +V+  +     +     C  NE   +A 
Sbjct  416   KQGTEWVSSLLEAESIGMNADISNSSPKSVLDNVENDYTSRSGVANAESCKANEPSASAG  475

Query  1231  EASSN-----------VDGPKDNGIDRSDGKENSNVVSALIHEGMNNSSDICSAEA----  1097
             ++S+            V+  +D     S     ++  +A  HE  +N+  I  A      
Sbjct  476   DSSTKFSCQLRSIDLEVNETRDTVKGMSACFTLASYRNAAEHETRDNTPMIDDASRPLSA  535

Query  1096  ---------EKTPPPSVLKEKNCK---QEFRISKRFADLTTETPSISPSLEIYREDTADN  953
                      EK    + L+E NC    ++ +I   F  L   TP  SPS +I+     + 
Sbjct  536   SDFYGVFCNEKVNKLTSLEEDNCNPGVEKVKIVDGFHPL---TPPRSPSPDIHSGKPRE-  591

Query  952   AYSPPRALL-------------RPADEVNHPEGEKLVKKKMPSTRGSALKGSHNESCMKK  812
              Y  PR  L             R   ++   E  + +KK M   R   L  + N+  +  
Sbjct  592   TYQVPREHLKLESKGACKTQLERNGKDLERQEAVRCIKKTMTGERYMKLMAAVNDVSL-N  650

Query  811   RRRRVEGSP  785
             R+RR++ SP
Sbjct  651   RKRRLKSSP  659



>ref|XP_006491731.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like isoform 
X2 [Citrus sinensis]
Length=682

 Score =   445 bits (1145),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 245/549 (45%), Positives = 337/549 (61%), Gaps = 46/549 (8%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N++LQCF H +PL+Q++ + DHP PC+   EGFCV+CAL++ + +SLAS G  + P
Sbjct  115   TCFINAILQCFTHTLPLVQALRSFDHPRPCDGATEGFCVICALRDHIELSLASSGKVLSP  174

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQ-VSPKHENVVKQTFG  1952
             +K+V+NL+Y SS FQR+QQ DAHEFLQC L+RLESCC   K   + +S + +N+V++ FG
Sbjct  175   RKLVDNLNYISSFFQRYQQEDAHEFLQCLLDRLESCCLDSKTKDESLSSQGDNIVQRVFG  234

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G LISKLQCCNCG  SDTYEPL+DLSLEIEDV SL  AL+SFTK+E+IEDPETKFTCEKC
Sbjct  235   GCLISKLQCCNCGSCSDTYEPLIDLSLEIEDVGSLGSALESFTKLEKIEDPETKFTCEKC  294

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K QVS+EKQL+LD+ P VA FHLKRFK DGS V KI KHV FP ELDL PY    +    
Sbjct  295   KEQVSVEKQLMLDKVPSVAAFHLKRFKTDGSYVVKIDKHVEFPLELDLKPYTSGGQNSDV  354

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             E KY+L+A+V H+G S + GHY+ ++ +SP  W++ +DS+VTRV+E  V+SQ+AYILFY 
Sbjct  355   ELKYHLYAIVEHMGSSPTCGHYFSYIRSSPDTWHRLNDSRVTRVEEEFVLSQDAYILFYA  414

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAAD  1232
             KQGT W S ++E + + ++A ISNSSP+ VL +V+  +     +     C  NE   +A 
Sbjct  415   KQGTEWVSSLLEAESIGMNADISNSSPKSVLDNVENDYTSRSGVANAESCKANEPSASAG  474

Query  1231  EASSN-----------VDGPKDNGIDRSDGKENSNVVSALIHEGMNNSSDICSAEA----  1097
             ++S+            V+  +D     S     ++  +A  HE  +N+  I  A      
Sbjct  475   DSSTKFSCQLRSIDLEVNETRDTVKGMSACFTLASYRNAAEHETRDNTPMIDDASRPLSA  534

Query  1096  ---------EKTPPPSVLKEKNCK---QEFRISKRFADLTTETPSISPSLEIYREDTADN  953
                      EK    + L+E NC    ++ +I   F  L   TP  SPS +I+     + 
Sbjct  535   SDFYGVFCNEKVNKLTSLEEDNCNPGVEKVKIVDGFHPL---TPPRSPSPDIHSGKPRE-  590

Query  952   AYSPPRALL-------------RPADEVNHPEGEKLVKKKMPSTRGSALKGSHNESCMKK  812
              Y  PR  L             R   ++   E  + +KK M   R   L  + N+  +  
Sbjct  591   TYQVPREHLKLESKGACKTQLERNGKDLERQEAVRCIKKTMTGERYMKLMAAVNDVSL-N  649

Query  811   RRRRVEGSP  785
             R+RR++ SP
Sbjct  650   RKRRLKSSP  658



>ref|XP_008238245.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Prunus 
mume]
Length=722

 Score =   438 bits (1126),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 248/558 (44%), Positives = 338/558 (61%), Gaps = 55/558 (10%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N++LQCF H VPL++ + +C+H  PC+  +EGFCVLCAL + +++S+AS G  I P
Sbjct  148   TCFMNAILQCFTHTVPLVEGLRSCNHSMPCDRGSEGFCVLCALHDHVDLSVASSGRVISP  207

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
              K+VNNL++FSS FQR+QQ DAHEFLQCFL++LE  C        +S + +N+V++ FGG
Sbjct  208   WKLVNNLNHFSSFFQRYQQEDAHEFLQCFLDKLEKSCLDSLEKESLSAQDQNLVERVFGG  267

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+SKL+CCNCGH SDTYEPL+DLSLEIED  +L  AL+SFTK+E I D ETKFTCE CK
Sbjct  268   RLLSKLRCCNCGHCSDTYEPLIDLSLEIEDAVTLPRALESFTKIETINDLETKFTCENCK  327

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              +VS+EKQL++D+APLVA FHLKRFK DGS VEKI KHV FP ELDL PY   ++  + E
Sbjct  328   EEVSVEKQLVVDQAPLVAAFHLKRFKTDGSHVEKIEKHVEFPLELDLKPYTSGSDNNV-E  386

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY L+A+V H+G S +SGHY+CF+ +SP  W++ DDSKVTRVQE  V+SQEAYILFY +
Sbjct  387   LKYELYAIVEHVGFSSTSGHYFCFIRSSPDTWHRLDDSKVTRVQEEFVLSQEAYILFYAR  446

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAADE  1229
             QGTPWFS I+E+ +  LD +++N+SP+ VL +V+ +    P +     C  NE  +A + 
Sbjct  447   QGTPWFSSIVESLKPCLDPAMTNTSPKSVLENVESVSILSPSVNNVDCCVANEPGDAHER  506

Query  1228  ASSNVDGPKDNGI------DRSDG-----KENSNVVSALIHEGMNNSSDICSAEAEKTPP  1082
              + ++   +   +      D +DG     K+++ V+ A      +NS D  S   E    
Sbjct  507   ITLSLPRARCEEVEVIDTRDAADGCSKETKDSAAVIDASTPGRASNSFDGKSHNNENICS  566

Query  1081  PSVLKEKNCKQEFRISKRFADLTTETPSISPSLEIYREDTADNAYSPPRALLRPADEV--  908
              S L    C +  R  K +  L   TP  SPS ++   ++ +  Y  PR   +  D V  
Sbjct  567   TSSLGGNRCHK--RSPKVY--LHPMTPPRSPSPDLPSFESPEPIYCLPRDHSKSVDSVAC  622

Query  907   --------------------------NHPEGEK-------LVKKKMPSTRGSALKGS---  836
                                       N  +  K       L KK +   RGS L  +   
Sbjct  623   KRSLNNIVRSDHLKSADNALCKRPSNNDVDDSKRIEAFRYLSKKSLTRDRGSQLLAAMVR  682

Query  835   -HNESCMKKRRRRVEGSP  785
               +E    KRR+RV  SP
Sbjct  683   PQSEGSSNKRRKRVGSSP  700



>ref|XP_007209082.1| hypothetical protein PRUPE_ppa003467mg [Prunus persica]
 gb|EMJ10281.1| hypothetical protein PRUPE_ppa003467mg [Prunus persica]
Length=572

 Score =   426 bits (1096),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 244/555 (44%), Positives = 333/555 (60%), Gaps = 55/555 (10%)
 Frame = -1

Query  2299  LNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRPKKI  2120
             +N++LQCF H VPL++ + +C H  PC+  +EGFCVLCAL + +++S+AS G  I P K+
Sbjct  1     MNAILQCFTHTVPLVEGLHSCSHSMPCDRGSEGFCVLCALHDHVDLSVASSGRVISPWKL  60

Query  2119  VNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGGHLI  1940
             V+NL++FSS FQR+QQ DAHEFLQCFL++LE  C         S +  N+V++ FGG L+
Sbjct  61    VDNLNHFSSFFQRYQQEDAHEFLQCFLDKLEKSCLDSLEKESPSAQDHNLVERVFGGRLL  120

Query  1939  SKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCKVQV  1760
             SKL+CCNCGH SDTYEPL+DLSLEIED ++L  AL+SFTK+E I D ETKFTCE CK +V
Sbjct  121   SKLRCCNCGHCSDTYEPLIDLSLEIEDAETLQRALESFTKIETINDLETKFTCENCKEEV  180

Query  1759  SIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEESKY  1580
             S+EKQL++D+AP VA FHLKRFK DGS VEKI KHV FP ELDL PY   ++  + E KY
Sbjct  181   SVEKQLVVDQAPPVAAFHLKRFKTDGSHVEKIEKHVEFPLELDLKPYTSGSDNNV-ELKY  239

Query  1579  NLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVKQGT  1400
              L+A+V H+G S +SGHY+CF+ +SP  W++ DDSKVTRVQE  V+SQEAYILFY +QGT
Sbjct  240   ELYAIVEHVGFSSTSGHYFCFIRSSPDTWHRLDDSKVTRVQEEFVLSQEAYILFYARQGT  299

Query  1399  PWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAADEASS  1220
             PWFS I+E+ +  LD +++N+SP+ VL +V+ +    P +     C  NE  +A +  + 
Sbjct  300   PWFSSIVESLKPCLDPAMTNTSPKSVLENVESVSILSPSVNNVDCCVANEPGDAHERITL  359

Query  1219  NVDGPKDNGI------DRSDG-----KENSNVVSALIHEGMNNSSDICSAEAEKTPPPSV  1073
             ++   +   +      D +DG     K+++ V+ A      +NS D  S   E     S 
Sbjct  360   SLPRARCEEVEVIDTRDAADGCSKETKDSAAVIDASTPGRASNSFDGKSHNNENICSTSS  419

Query  1072  LKEKNCKQEFRISKRFADLTTETPSISPSLEIYREDTADNAYSPPRALLRPADEV-----  908
             L    C +  R  K +  L   TP  SPS ++   ++ +  Y  PR   +  D V     
Sbjct  420   LGGNRCHK--RSPKVY--LHPMTPPRSPSPDLPSFESPEPIYCLPRDHSKSVDNVACKRS  475

Query  907   -----------------------NHPEGEK-------LVKKKMPSTRGS----ALKGSHN  830
                                    N  +  K       L KK +   RGS    A+ G  +
Sbjct  476   LNNIIRSDHLKSADNALCKRPSNNDVDDSKRIEAFRYLSKKSLTRDRGSQLLAAMVGPQS  535

Query  829   ESCMKKRRRRVEGSP  785
             E    KRR+RV  SP
Sbjct  536   EGSSNKRRKRVGSSP  550



>ref|XP_004301683.1| PREDICTED: uncharacterized protein LOC101303715 [Fragaria vesca 
subsp. vesca]
Length=701

 Score =   426 bits (1096),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 234/502 (47%), Positives = 315/502 (63%), Gaps = 45/502 (9%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N++LQCF H VPL++ + + +HP PC+  +EGFCVLCAL+E +++S+ S G  + P
Sbjct  147   TCFINAILQCFTHTVPLVEGLRSSNHPLPCDCGSEGFCVLCALREHIDLSIVSSGRALSP  206

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLE-SCCNYPKLNGQVSPKHENVVKQTFG  1952
              K+V+NL++FSS F+R+QQ DAHEFLQCFL++LE S  +  K N   S + +N+V + FG
Sbjct  207   SKLVDNLNHFSSYFRRYQQEDAHEFLQCFLDKLERSWLDSEKNNETSSCEDKNIVNRVFG  266

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CC+CGH SDT EPL+DLSLEIEDVDSL  AL+SFTK+E+I D ETKFTCE C
Sbjct  267   GSLVSKLRCCSCGHCSDTREPLIDLSLEIEDVDSLPRALESFTKIEKINDSETKFTCENC  326

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +VS+EKQL++DEAP VA FHLKRFK DG+ VEKI KHV FP ELDL PY   N   + 
Sbjct  327   KEEVSVEKQLVVDEAPPVAAFHLKRFKTDGNYVEKIDKHVEFPLELDLKPYTSSNNSDV-  385

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             E KY L+A+V H+G S +SGHY+CF+ +SP  W++ DDSKVTRV+E  V+SQEAYILFY 
Sbjct  386   ELKYELYAIVEHVGFSATSGHYFCFIRSSPDTWHRLDDSKVTRVREEFVLSQEAYILFYA  445

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIF--NPYPKMETDRPCDVNE----  1250
             +QGTPWFS + E Q    +  I N+SP+ VL  VD IF  N       + P DV +    
Sbjct  446   RQGTPWFSSLKEGQMSCPELHIMNTSPKSVLDPVDDIFPVNIPEGCTPNAPRDVGQKIST  505

Query  1249  ----------------TDNAADEASSNVDGPKDNGIDRSDGKENSNVVSALIHEGM----  1130
                             T +AAD+    +DG K +     +  +++ +V+A    G     
Sbjct  506   FFRRSKCQEVLVTDTDTRDAADKRCEQIDGSKHDAAGFEETDDSTPMVTASTSVGASKCF  565

Query  1129  -------NNSSDICSAEAEKTPPPSVLKEKNCKQEFRISKRFADLTTETPSISPSLE-IY  974
                    +N+ +ICS  +            +    F    R A    +TP  S S++ + 
Sbjct  566   TGTSHNNDNNENICSISSRGG--------TDVHMTFD-EVRVAGSPPKTPPRSRSVDGMS  616

Query  973   REDTADNAYSPPRALLRPADEV  908
              E T +  Y  PR  L+ AD V
Sbjct  617   FESTPEPKYRIPRDHLKSADNV  638



>emb|CBI33881.3| unnamed protein product [Vitis vinifera]
Length=547

 Score =   419 bits (1078),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 235/506 (46%), Positives = 320/506 (63%), Gaps = 37/506 (7%)
 Frame = -1

Query  2224  PCEACNEGFCVLCALKELMNISLASKGSTIRPKKIVNNLSYFSSTFQRFQQGDAHEFLQC  2045
             PC +  EGFCVLC L++ + +SLAS G  I P K+V+NL+  SS+ QR+QQ DAHEFLQC
Sbjct  2     PCHSFYEGFCVLCTLRDHIELSLASSGRAIMPLKLVDNLNNISSSLQRYQQEDAHEFLQC  61

Query  2044  FLERLESCCNYPKLNGQVSPKHENVVKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEI  1865
              L+RL+S     +  G  SP  +N+VK  FGG+LISKL+CCNCGH SDTYEPL+DLSLEI
Sbjct  62    LLDRLDSFYLMNQDKGSHSPD-DNLVKHVFGGYLISKLRCCNCGHISDTYEPLIDLSLEI  120

Query  1864  EDVDSLSLALDSFTKVERIEDPETKFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKND  1685
             EDVD+L  AL+SFTKVE+IEDPE KFTC+ CK +VS+EKQLLLD+ PLVA FHLKRFK D
Sbjct  121   EDVDTLPCALESFTKVEKIEDPEMKFTCDNCKEEVSVEKQLLLDQVPLVAAFHLKRFKTD  180

Query  1684  GSLVEKIAKHVTFPPELDLLPYVERNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHAS  1505
             G+ VEKI KHV FP ELDLLPY +  E    E KY L+A+V H G S +SGHY+ ++ +S
Sbjct  181   GTYVEKIDKHVEFPLELDLLPYTKEREDDNVELKYELYAIVEHTGFSSTSGHYFSYIRSS  240

Query  1504  PSEWYKFDDSKVTRVQENVVMSQEAYILFYVKQGTPWFSEIIETQQLILDASISNSSPQP  1325
             P  W++ DDSKVT V E+ V+ QEAYILFY +QGTPWFS +++TQ+  LD + S +SP+ 
Sbjct  241   PDTWHRLDDSKVTSVPEDYVLHQEAYILFYARQGTPWFSSLMQTQKPCLDPNTSGNSPKS  300

Query  1324  VLYSVDQIFNPYPKMETDRPCDVNETDNAADEASSNVDGPKDNGIDR--SDGKENSNV--  1157
             VL +VD I    P +      + +ET +AADE S+ + G     + +   DG     V  
Sbjct  301   VLDNVDSISTSLPTLANVYSHEASETVDAADEISTCLSGGGRGDVVQVHEDGDVPHRVDT  360

Query  1156  -----VSALIHEGMNNSSDICSAEAEKTPPPSVLKEKNCKQEFRISKRFADLTTETPSIS  992
                  V++     ++++ +I +    +    +    +NCK +            +TP  S
Sbjct  361   PMPLGVTSCFDGTLDHTQNISTTSPCRDHDGNQHINENCKSKIH---------PQTPPRS  411

Query  991   PSLEIYREDTADNAYSPPRALLRPADEV--NHPEGEKL----------VKKKMPSTRG--  854
             PS +IY E+  + +Y+ PR  LR  ++V    P  + L          + K MP++R   
Sbjct  412   PSPDIYAEEPPEVSYNIPRGHLRQKNQVACKKPLNKALEDSRKREACKLCKNMPASRSMR  471

Query  853   --SALKGSHNESCM--KKRRRRVEGS  788
               +A+KGS +E  +  KK +RR+E S
Sbjct  472   LMAAMKGSQSEGSLGKKKSKRRMESS  497



>ref|XP_008373576.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20 [Malus domestica]
Length=732

 Score =   418 bits (1074),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 221/492 (45%), Positives = 312/492 (63%), Gaps = 31/492 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N++LQCF H VPL++ + + +H  PC+  +E FCVLCAL++ +++S+AS G  + P
Sbjct  142   TCFMNAILQCFTHTVPLLEGLRSSNHSMPCDRGSERFCVLCALRDHIDLSIASSGRVVSP  201

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLE-SCCNYPKLNGQVSPKHENVVKQTFG  1952
              K+V+NL++ SS FQR+QQ DAHEFLQCFL++LE S     K +   S + +N+V++ FG
Sbjct  202   WKLVDNLNHISSYFQRYQQEDAHEFLQCFLDKLERSSMGSMKKDESSSVQDKNLVEKVFG  261

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CCNCGH SDTYEPL+DLSLEIE+ D+L  AL+SFTK+E I D ETKFTCEKC
Sbjct  262   GRLVSKLRCCNCGHCSDTYEPLIDLSLEIEEADTLPRALESFTKIENINDSETKFTCEKC  321

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +VS+EKQL++D+AP  A FHLKRFK DGS V+KI KHV FP ELDL PY   ++ +  
Sbjct  322   KEKVSVEKQLVVDQAPQXAAFHLKRFKTDGSNVQKIEKHVEFPLELDLKPYTGGSD-IDM  380

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             E KY L+A+V H+G S +SGHY+CF+ +SP  W++ DDS+VTRV+E  V+SQEAYILFY 
Sbjct  381   ELKYELYAIVEHVGFSSTSGHYFCFIRSSPDTWHRLDDSRVTRVREEFVLSQEAYILFYA  440

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPC----------  1262
             ++GTPWF  ++E  +  LD ++ ++SP+ VL +V+   N  P +     C          
Sbjct  441   RKGTPWFLSVVEALKPCLDPAVMSTSPKSVLENVESTNNLSPSVNYVDRCAANEPRDACE  500

Query  1261  --------------DVNETDNAADEASSNVDGPKDNGIDRSDGKENSNVVSALIHEGMNN  1124
                           DV++T   A E S  ++GPK +     +  +    + A    G  N
Sbjct  501   TVTLSLHQVRPKEVDVSDTRGEASELSEWINGPKRDAGCSQETTDTGAAIDASTPGGGRN  560

Query  1123  SSDICSAEAEKTPPPSVLKEKNCKQEFRISKRFADLTTETPSISPSLEIYREDTADNAYS  944
             + D      E     S     +C +  R +K    L   TP  SPSL++  E + + ++ 
Sbjct  561   NFDKTLGNTENICSTSTPVANSCHK--RSAK--VXLQPMTPPRSPSLDLVFE-SREPSFH  615

Query  943   PPRALLRPADEV  908
              PR  ++ AD V
Sbjct  616   LPRDHVKSADNV  627



>ref|XP_009346483.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Pyrus 
x bretschneideri]
Length=765

 Score =   414 bits (1065),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 207/410 (50%), Positives = 290/410 (71%), Gaps = 6/410 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N++LQCF H VPL++S+ + +H  PC+  +EGFC+LCAL++ +++S+AS G  I P
Sbjct  173   TCFMNAILQCFTHTVPLLESLHSSNHSMPCDCGSEGFCILCALRDHIDLSIASSGRVISP  232

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLE-SCCNYPKLNGQVSPKHENVVKQTFG  1952
              K+V+NL++ SS FQR+QQ DAHEFLQCFL++LE S  +  K +   S + +N+V++ FG
Sbjct  233   WKLVDNLNHISSYFQRYQQEDAHEFLQCFLDKLERSSLDCMKKDESSSVQDKNLVERVFG  292

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CCNCGH SDTYEPL+DLSLEIE+ D+L  AL+SFTK+E I D ETKFTCEKC
Sbjct  293   GRLLSKLRCCNCGHCSDTYEPLIDLSLEIEEADTLPRALESFTKIENINDSETKFTCEKC  352

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V +EKQL++ +AP VA FHLKRFK DGS V+KI KHV FP ELDL PY   N+   +
Sbjct  353   KEEVLVEKQLVVVQAPQVAAFHLKRFKTDGSNVQKIEKHVEFPLELDLKPYTSGNDIDSD  412

Query  1591  -ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              E KY L+A+V H+G S +SGHY+CF+ +SP  W++ DDS+VTRV+E  V+SQ AYILFY
Sbjct  413   VELKYELYAIVEHVGFSSTSGHYFCFIRSSPDTWHRLDDSRVTRVREEFVLSQGAYILFY  472

Query  1414  VKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDV-NETDNA  1238
              ++GTPWFS ++E  +  LD +I ++SP  VL +V+ I N  P +  D  C   NE  +A
Sbjct  473   ARKGTPWFSSVVEALKPCLDPAIMSTSPVSVLENVENISNLSPSV-NDVHCRAPNEPTDA  531

Query  1237  ADEASSNVDGPKDNGIDRSDGKENSNVVSALIHEGMNNSSDICSAEAEKT  1088
              +  + ++   +  G++ SD +   + +S  I+    ++   CS E   T
Sbjct  532   REMITLSLSPVRPKGVEVSDTRGGDSGLSERINGSRRDAG--CSKETIDT  579



>gb|EYU24854.1| hypothetical protein MIMGU_mgv1a022891mg [Erythranthe guttata]
Length=544

 Score =   403 bits (1036),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 228/465 (49%), Positives = 291/465 (63%), Gaps = 29/465 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQCFMH VPL++SI    H        +GFC LCAL+EL+  SLA++   + P
Sbjct  81    TCFLNSVLQCFMHSVPLLRSILLEPHSLNSYCDEQGFCTLCALRELVKSSLANR--IVSP  138

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
                 NNLSYFSS+F++FQQ DAHEFLQCFL++LESC +  +     SP   N+V+Q FGG
Sbjct  139   SYFTNNLSYFSSSFKKFQQEDAHEFLQCFLDKLESCHDSQRKEYTSSPTG-NLVQQVFGG  197

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+SKL+CCNC H SDTYEPL+D SL IE+ D L  AL SFTKVE+I+DPE K TCE CK
Sbjct  198   RLVSKLKCCNCDHCSDTYEPLIDTSLGIENADDLVTALQSFTKVEKIDDPEDKVTCENCK  257

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
               VS+EKQL  D+AP VA FHLKRF+NDG  V+KI KHV FP ELDLLP+ +  +    +
Sbjct  258   ELVSVEKQLSFDKAPSVAVFHLKRFENDGCWVQKIDKHVAFPLELDLLPFTDSGKSNDAD  317

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY L+AV+VHIG + +SGHYYCF+  SP+ W KFDDS+V  V E+ V+SQEAYILFY K
Sbjct  318   LKYVLYAVIVHIGSTPTSGHYYCFIRLSPNVWCKFDDSRVVLVHEDYVLSQEAYILFYAK  377

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPY--PKMETDR-PCDVNETDN-  1241
             +GTPWFS  +ETQ   + ++IS +SP+ VL   D +  P   P +  ++  CD NE  + 
Sbjct  378   EGTPWFSSFMETQLSCVHSTISKTSPRSVL---DNVETPTVSPLLPNNKFSCDSNEVSHE  434

Query  1240  --AADEASSNVDGPKDNGIDRSDGKENSNVVSALIHEG-----------MNNSSDICSAE  1100
                ++  S +    KD G  R   K  S   +  +H                SSD+   +
Sbjct  435   ITGSERKSIHTSVVKDIG--RIQNKSESIATAENLHRKSATPVVHCPTPTTASSDVSFGQ  492

Query  1099  AEKTPPPSVLKEKNCKQEFRISKRFADLTTETPSISPSLEIYRED  965
             A+K   P VLK     Q   +  ++          SPS EIYRED
Sbjct  493   AQKKISPIVLKNVKKIQNVDVVAKYEKDIQR----SPSPEIYRED  533



>ref|XP_011028176.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 36-like [Populus 
euphratica]
Length=872

 Score =   412 bits (1060),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 225/513 (44%), Positives = 309/513 (60%), Gaps = 30/513 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC++N+VLQCF H VPL+Q++ +C+H  PC    EGFCVLC +++ + +SLAS G  + P
Sbjct  334   TCYINAVLQCFTHTVPLVQALRSCNHAMPCRT--EGFCVLCVIRDHIELSLASSGKILEP  391

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
              K+VNNL   SS F R+QQ DAHEFLQC LERLE CC    L   +S   + N+V++ FG
Sbjct  392   LKLVNNLDSISSFFHRYQQEDAHEFLQCLLERLERCCLDSSLTDDISSSQDKNIVERVFG  451

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CCNCGH SD YEPL+DLSLEIED D+L +AL+SFT VE+IED ETKF CE C
Sbjct  452   GRLVSKLRCCNCGHFSDKYEPLIDLSLEIEDADTLQMALESFTNVEKIEDSETKFMCENC  511

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +VS EKQL+LD+AP +A  HLKRFK DG+ VEKI KHV FP ELDL PY+  N+    
Sbjct  512   KEEVSREKQLMLDKAPSIAALHLKRFKIDGTSVEKIGKHVEFPLELDLKPYINDNDYNDV  571

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY L+AVVVH G +L+SGHY C++ +SP  W+K DD +V++ +E  V+SQ AYILFY 
Sbjct  572   GFKYQLYAVVVHKGYTLTSGHYVCYIRSSPDTWHKLDDPEVSKEREEFVLSQAAYILFYA  631

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAAD  1232
             ++GTPW S +I+ Q+  LD S SN+SP+ VL   D   N    +      + +   +A +
Sbjct  632   REGTPWCSSLIKPQEFCLDRSNSNTSPKSVL---DNANNECISVADKDSLETSVIKDAVE  688

Query  1231  EASSNVDGPK--DNGIDRSDGKENS------NVVSALIHEGMNNSSD-ICSAEAEKTPPP  1079
               S+++   +  +  + R + +  S      N+V   +  G+++  D +   E    PP 
Sbjct  689   ATSTHIPCEREFEEIVSRHETEGISFQISCVNMVDVSLPHGVSDGHDGVLHDEMLCFPPV  748

Query  1078  SVLKEKNCKQEFRISKRFADLTTETPSISPSLEIYREDTADNAYSPPRALLRPADEVNHP  899
                    C ++     R  DL    PS SP+ + Y  +  +     PR  L+  + VN  
Sbjct  749   EEDYSNQCAEKI---GRKGDLRPSAPSRSPTPDTYSGELPEARRCIPREHLKVENHVNCK  805

Query  898   EGEKLVK------------KKMPSTRGSALKGS  836
                K V             K+MP+ RG  L  +
Sbjct  806   RSSKKVTKDSQTAEALRCIKRMPTARGMKLMAA  838



>ref|XP_006385660.1| UBIQUITIN-SPECIFIC PROTEASE 21 family protein [Populus trichocarpa]
 gb|ERP63457.1| UBIQUITIN-SPECIFIC PROTEASE 21 family protein [Populus trichocarpa]
Length=809

 Score =   407 bits (1047),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 222/513 (43%), Positives = 307/513 (60%), Gaps = 30/513 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC++N+VLQCF H VPL+Q++ +C+H  PC    EGFC LC +++ + +SLAS G  + P
Sbjct  271   TCYINAVLQCFTHTVPLVQALRSCNHAMPCRT--EGFCALCVIRDHIELSLASSGKILEP  328

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
              K+VNNL   SS F+R+QQ DAHEFLQC LERLE  C    L   +S   + N+V++ FG
Sbjct  329   LKLVNNLDSISSFFRRYQQEDAHEFLQCLLERLERSCLDSSLTDDISSSQDKNIVERVFG  388

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CCNCGH SD YEPL+DLSLEIED D+L +AL+SFT VE+IED ETKFTCE C
Sbjct  389   GRLVSKLRCCNCGHFSDKYEPLIDLSLEIEDADTLQIALESFTNVEKIEDSETKFTCENC  448

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +VS EKQL+LD+AP +A  HLKRFK DG+ VEKI KHV FP ELDL PY+  N+    
Sbjct  449   KEEVSREKQLMLDKAPSIAALHLKRFKIDGTSVEKIGKHVEFPLELDLKPYINDNDSNDV  508

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY L+AVVVH G SL+SGHY C++ +SP  W+K DD +V++ +E  V+SQ AYILFY 
Sbjct  509   GFKYQLYAVVVHKGYSLTSGHYVCYIRSSPDTWHKLDDPEVSKEREEFVLSQAAYILFYA  568

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAAD  1232
             ++GTPW S +I+ Q+  LD S SN+SP+ VL   D   +    +      + +   +A +
Sbjct  569   REGTPWCSSLIKPQEFCLDRSNSNTSPKSVL---DNANSECISVADKDSLETSVIKDAVE  625

Query  1231  EASSNVDGPKDNGIDRSDGKEN--------SNVVSALIHEGMNNSSD-ICSAEAEKTPPP  1079
               S+++   ++     S G+          +N+V   +  G+++  D +   E    PP 
Sbjct  626   ATSTHIPCEREFEEIVSRGETEGISFQISCANMVDVSLPHGVSDGHDGVLHDEMLCFPPV  685

Query  1078  SVLKEKNCKQEFRISKRFADLTTETPSISPSLEIYREDTADNAYSPPRALLRPADEVNHP  899
                    C ++     R  DL    P  SP+ ++Y  +  +     PR  L+  + VN  
Sbjct  686   EEDYSNQCAEKI---GRKGDLRPSAPPRSPTSDVYSGELPEARRCIPREHLKVENHVNCK  742

Query  898   EGEK------------LVKKKMPSTRGSALKGS  836
                K               K+MP+ RG  L  +
Sbjct  743   RSSKKGTKDSQTAEALRCIKRMPTARGMKLMAA  775



>ref|XP_009347906.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Pyrus 
x bretschneideri]
Length=765

 Score =   404 bits (1039),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 206/409 (50%), Positives = 290/409 (71%), Gaps = 4/409 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N++LQCF H VPL++S+ + +H  PC+  +EGFC+LCAL++ +++S+AS G  I P
Sbjct  173   TCFMNAILQCFTHTVPLLESLRSFNHSMPCDCGSEGFCILCALRDHIDLSIASSGRVISP  232

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLE-SCCNYPKLNGQVSPKHENVVKQTFG  1952
              K+V+NL++ SS FQR+QQ DAHEFLQCFL++LE S  +  K +   S + +N+V++ FG
Sbjct  233   WKLVDNLNHISSYFQRYQQEDAHEFLQCFLDKLERSSLDCMKKDESSSVQDKNLVERVFG  292

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CCNCGH SDTYEPL+DLSLEIE+ D+L  AL+SFTK+E I D ETKFTCEKC
Sbjct  293   GRLLSKLRCCNCGHCSDTYEPLIDLSLEIEEADTLPRALESFTKIENINDSETKFTCEKC  352

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V +EKQL++ +AP VA FHLKRFK DGS V+KI KHV FP ELDL PY   N+   +
Sbjct  353   KEEVVVEKQLVVVQAPQVAAFHLKRFKTDGSNVQKIEKHVEFPLELDLKPYTSGNDIDSD  412

Query  1591  -ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              E KY L+A+V H+G S +SGHY+CF+ +SP  W++ DDS+VTRV+E  V+SQ AYILFY
Sbjct  413   VELKYELYAIVEHVGFSSTSGHYFCFIRSSPDTWHRLDDSRVTRVREEFVLSQGAYILFY  472

Query  1414  VKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAA  1235
              ++GTPWFS ++E  +  LD +I ++SP  VL +V+ I N  P +        NE  +A 
Sbjct  473   ARKGTPWFSSVVEALKPCLDPAIMSTSPVSVLENVENISNLSPSVNDVHCRAANEPTDAR  532

Query  1234  DEASSNVDGPKDNGIDRSDGKENSNVVSALIHEGMNNSSDICSAEAEKT  1088
             +  + ++   +  G++ SD +  ++ +S  I+E   ++   CS E   T
Sbjct  533   EMITLSLSPVRPKGVEVSDTRGAASGLSERINESRRDAG--CSKETIDT  579



>ref|XP_006368396.1| UBIQUITIN-SPECIFIC PROTEASE 21 family protein [Populus trichocarpa]
 gb|ERP64965.1| UBIQUITIN-SPECIFIC PROTEASE 21 family protein [Populus trichocarpa]
Length=835

 Score =   405 bits (1040),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/337 (58%), Positives = 248/337 (74%), Gaps = 4/337 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC++N++LQCF H VPL+Q++ +C+H  PC    EGFCVLC L++ + +SL+S G  + P
Sbjct  283   TCYINAILQCFTHTVPLVQALRSCNHEMPC--ITEGFCVLCVLRDHIELSLSSSGKILEP  340

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
              K+VNNL   SS F+R+QQ DAHEFLQC LERLE  C    L    +  H+ N+V++ FG
Sbjct  341   LKLVNNLENISSVFRRYQQEDAHEFLQCLLERLERHCLDSSLTDDSASSHDKNIVERVFG  400

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CCNCGH SD YEPL+DLSLEIED DSL  AL+SFTKVE+IED ETKFTCE C
Sbjct  401   GRLVSKLRCCNCGHCSDKYEPLIDLSLEIEDADSLQSALESFTKVEKIEDSETKFTCESC  460

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +VS EKQL+LD+AP VA  HLK FK DG+ VEKI KHV FP ELDL PY   NE   E
Sbjct  461   KEEVSREKQLMLDQAPSVAALHLKIFKIDGTSVEKIGKHVQFPLELDLKPYTNDNEDSDE  520

Query  1591  ES-KYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
                KY L+AVVVH G SL SGHY+C++ +SP  W+K DD +V++ QE  V+SQ AYILFY
Sbjct  521   VGFKYQLYAVVVHKGDSLMSGHYFCYIRSSPDTWHKLDDPEVSKEQEEFVLSQAAYILFY  580

Query  1414  VKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQ  1304
              ++GTPW S +I+ Q+L  D S SN+SP+ VL +V++
Sbjct  581   AREGTPWCSSLIKPQELCSDPSNSNTSPKSVLDNVNR  617



>ref|XP_010053613.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Eucalyptus 
grandis]
 gb|KCW77955.1| hypothetical protein EUGRSUZ_D02203 [Eucalyptus grandis]
Length=710

 Score =   398 bits (1023),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 207/434 (48%), Positives = 280/434 (65%), Gaps = 5/434 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+V+QC  H VPL+Q+I   +H   C+   EGFCVLC L+  + + ++S G  + P
Sbjct  140   TCFLNAVMQCLTHTVPLVQAIRGFNHADLCDRGKEGFCVLCVLRNHIELCISSSGRIVSP  199

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
              K+V+NL+  SS FQR+QQ DAHEF Q  L+RLE CC   K   +VS +  N+V Q FGG
Sbjct  200   FKLVHNLNNISSDFQRYQQEDAHEFQQALLDRLERCCLDSKAEDEVSAR-SNIVDQVFGG  258

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+SKLQCC+CGH S TYEPL+DLSLEIE V +LS AL+SFT VE+IEDPETKF C  C 
Sbjct  259   RLVSKLQCCSCGHCSYTYEPLIDLSLEIEHVANLSAALESFTNVEKIEDPETKFRCSNCN  318

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              +VS+EKQLLLDE P VA FHLKRFK+DG  VEKI KHV FP ELDL PY   +      
Sbjct  319   QEVSMEKQLLLDEEPSVAVFHLKRFKSDGFNVEKIDKHVDFPLELDLQPYTGGSRIHNVG  378

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY L+AVVVHIG+S +SGHY+ FV +SP  W++FDD++V +VQE++V++Q+AY+LFY K
Sbjct  379   IKYQLYAVVVHIGISPTSGHYFSFVRSSPGTWHRFDDAEVQKVQEDLVLAQDAYLLFYTK  438

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKM-ETDRPCDVNETDNAAD  1232
             QGTPWFS ++E Q+  L+  +S++SP  VL ++D      P M + D+P     +  + +
Sbjct  439   QGTPWFSSLMEAQKPNLNPDLSDASPTSVLDNLDVPCTSSPGMADIDKPIFCEPSHVSIE  498

Query  1231  EASSNVDGPKDNGIDRSDGKENSNVVSALIHEGMNNSSDICSAEAEKTPPPSVLKEKNCK  1052
              A +    P +   + S G+     + A   +     +++ +   +    P    E+NC 
Sbjct  499   GAPTY---PGNGSGNNSLGEVTGGAIVAKSFDHDLGENEVVNDSRDDIEAPLSSDERNCH  555

Query  1051  QEFRISKRFADLTT  1010
              E   S R    T+
Sbjct  556   GETSFSGRGESTTS  569



>gb|KDP34308.1| hypothetical protein JCGZ_12656 [Jatropha curcas]
Length=891

 Score =   401 bits (1030),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 209/416 (50%), Positives = 282/416 (68%), Gaps = 26/416 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N++LQCF H VPL++++++C+H  PC+    GFCV+CAL + + +SLAS G  I P
Sbjct  278   TCFINAILQCFTHTVPLVKALQSCNHLRPCQRGTGGFCVVCALHDHIKLSLASSGKIISP  337

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVS-PKHENVVKQTFG  1952
              ++V+NL+  SS F+R+QQ DAHEFLQC LE+LE CC    LN ++S P+ +N+V++ FG
Sbjct  338   LEVVDNLNNISSCFRRYQQEDAHEFLQCLLEKLERCC----LNDEISYPQDDNIVERVFG  393

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G LISKL+CCNCG  SD YEPL+DLSLEIEDV++L  AL+SFTKVE+IE+ +TKFTC+KC
Sbjct  394   GRLISKLKCCNCGDCSDKYEPLIDLSLEIEDVETLQNALESFTKVEKIENLDTKFTCDKC  453

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKV--  1598
             + +VS EKQL+LD AP VATFHLKRFK DGS + KI KHV FP ELDL PY   +E    
Sbjct  454   REEVSREKQLMLDRAPSVATFHLKRFKTDGSSIAKINKHVDFPLELDLKPYTNGSEDSNV  513

Query  1597  -IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                + KY L+A+VVH G   +SGHY+ +V +SP  W+K DDS V +V E +V+SQ AYIL
Sbjct  514   NQVDLKYQLYAIVVHNGFLPTSGHYFSYVRSSPDTWHKLDDSMVVKVDEEIVLSQTAYIL  573

Query  1420  FYVKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPC-------  1262
             FY ++GTPWFS +IE+    LD  ISN+SP+ VL  ++   + Y  +E    C       
Sbjct  574   FYAREGTPWFSSLIES----LDPIISNTSPKSVLDRMETECSLYHNLENVDHCKDHGTTS  629

Query  1261  DVNETDNAADEASSNVDGPKDNGIDRSDGKENSNVVSALIHEGMNNSS-DICSAEA  1097
             DV  T       ++ V+   +   + ++G      VSA+I  G   S   ICS E+
Sbjct  630   DVVRTSTHFSMTTAVVEAQMNETGNDAEG------VSAMISNGTGQSGPQICSDES  679



>ref|XP_007158301.1| hypothetical protein PHAVU_002G141300g [Phaseolus vulgaris]
 gb|ESW30295.1| hypothetical protein PHAVU_002G141300g [Phaseolus vulgaris]
Length=674

 Score =   394 bits (1013),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/343 (56%), Positives = 244/343 (71%), Gaps = 4/343 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN++LQCF H VPL+Q I AC H  PC    + FCV+C  ++ +  SLA+ G T+ P
Sbjct  139   TCFLNAILQCFTHTVPLVQGIRACTHNFPCAGHMDRFCVICTFRDQVERSLAASGRTLSP  198

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
              K VNNLSYFSS F+R+QQ DAHEF+QC L++LE C    K    ++ + +N+V++ FGG
Sbjct  199   LKFVNNLSYFSSGFRRYQQEDAHEFMQCALDKLERCFLDLK-KTDLNFEGDNLVQKVFGG  257

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              LISKLQCC+CG  SDTYEPL+D+SLEIE+VDSL  AL+SFTKVE+I+     F C+ CK
Sbjct  258   RLISKLQCCSCGRTSDTYEPLIDMSLEIENVDSLPSALESFTKVEKID---ANFRCDSCK  314

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              +VS+EKQL+LD  P VA FHLKRFK DG LVEKI KH+ FP ELDL PY   N+     
Sbjct  315   EEVSMEKQLMLDMTPSVAAFHLKRFKADGILVEKIDKHIEFPLELDLQPYTISNQNNDVL  374

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY+L+A+VVH G S +SGHY+CFV + P  W+K DD  VT V  + V+SQEAYILFY +
Sbjct  375   VKYDLYAIVVHTGFSSTSGHYFCFVRSGPDTWHKLDDLMVTEVSGDSVLSQEAYILFYAR  434

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKM  1280
             QGTPWFS I+E+Q+  LD +IS++SP  VL   D I    P +
Sbjct  435   QGTPWFSSIMESQKQCLDPNISSTSPTSVLDVGDGISKSNPNL  477



>ref|XP_007158302.1| hypothetical protein PHAVU_002G141300g [Phaseolus vulgaris]
 gb|ESW30296.1| hypothetical protein PHAVU_002G141300g [Phaseolus vulgaris]
Length=699

 Score =   395 bits (1014),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 192/344 (56%), Positives = 246/344 (72%), Gaps = 6/344 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN++LQCF H VPL+Q I AC H  PC    + FCV+C  ++ +  SLA+ G T+ P
Sbjct  139   TCFLNAILQCFTHTVPLVQGIRACTHNFPCAGHMDRFCVICTFRDQVERSLAASGRTLSP  198

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESC-CNYPKLNGQVSPKHENVVKQTFG  1952
              K VNNLSYFSS F+R+QQ DAHEF+QC L++LE C  +  K +  ++ + +N+V++ FG
Sbjct  199   LKFVNNLSYFSSGFRRYQQEDAHEFMQCALDKLERCFLDLKKTD--LNFEGDNLVQKVFG  256

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G LISKLQCC+CG  SDTYEPL+D+SLEIE+VDSL  AL+SFTKVE+I+     F C+ C
Sbjct  257   GRLISKLQCCSCGRTSDTYEPLIDMSLEIENVDSLPSALESFTKVEKID---ANFRCDSC  313

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +VS+EKQL+LD  P VA FHLKRFK DG LVEKI KH+ FP ELDL PY   N+    
Sbjct  314   KEEVSMEKQLMLDMTPSVAAFHLKRFKADGILVEKIDKHIEFPLELDLQPYTISNQNNDV  373

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY+L+A+VVH G S +SGHY+CFV + P  W+K DD  VT V  + V+SQEAYILFY 
Sbjct  374   LVKYDLYAIVVHTGFSSTSGHYFCFVRSGPDTWHKLDDLMVTEVSGDSVLSQEAYILFYA  433

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKM  1280
             +QGTPWFS I+E+Q+  LD +IS++SP  VL   D I    P +
Sbjct  434   RQGTPWFSSIMESQKQCLDPNISSTSPTSVLDVGDGISKSNPNL  477



>ref|XP_011018566.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like isoform 
X2 [Populus euphratica]
Length=805

 Score =   398 bits (1022),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 191/337 (57%), Positives = 247/337 (73%), Gaps = 4/337 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC++N++LQCF H VPL+Q++ + +H +PC    EGFCVLC L++ + +SL+S G  + P
Sbjct  253   TCYINAILQCFTHTVPLVQALRSWNHETPC--ITEGFCVLCVLRDHIELSLSSSGKILEP  310

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
              K+VNNL   SS F+R+QQ DAHEF QC LERLE  C    L    +  H+ N+V++ FG
Sbjct  311   LKLVNNLENISSVFRRYQQEDAHEFFQCLLERLERHCLDSSLTDDSASSHDKNIVERVFG  370

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CCNCGH SD YEPL+DLSLEIED +SL  AL+SFTKVE+IED  TKFTCE C
Sbjct  371   GRLVSKLRCCNCGHCSDKYEPLIDLSLEIEDANSLQSALESFTKVEKIEDSGTKFTCESC  430

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +VS EKQL+LD+AP VA  HLKRFK DG+ +EKI KHV FP ELDL PY   NE   E
Sbjct  431   KKEVSREKQLMLDQAPSVAALHLKRFKIDGTSIEKIGKHVQFPLELDLKPYTNDNEDSDE  490

Query  1591  ES-KYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
                KY L+AVVVH G SL SGHY+C++ +SP  W+K DD +V++ QE  V+SQ AYILFY
Sbjct  491   VGFKYQLYAVVVHKGDSLMSGHYFCYIRSSPDTWHKLDDPEVSKEQEEFVLSQAAYILFY  550

Query  1414  VKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQ  1304
              ++GTPW S +I+ Q+L  D + SN+SP+ VL +V++
Sbjct  551   AREGTPWCSSLIKPQELCSDPNNSNTSPKSVLDNVNR  587



>ref|XP_011018565.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like isoform 
X1 [Populus euphratica]
Length=834

 Score =   398 bits (1023),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 191/337 (57%), Positives = 247/337 (73%), Gaps = 4/337 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC++N++LQCF H VPL+Q++ + +H +PC    EGFCVLC L++ + +SL+S G  + P
Sbjct  282   TCYINAILQCFTHTVPLVQALRSWNHETPC--ITEGFCVLCVLRDHIELSLSSSGKILEP  339

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
              K+VNNL   SS F+R+QQ DAHEF QC LERLE  C    L    +  H+ N+V++ FG
Sbjct  340   LKLVNNLENISSVFRRYQQEDAHEFFQCLLERLERHCLDSSLTDDSASSHDKNIVERVFG  399

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CCNCGH SD YEPL+DLSLEIED +SL  AL+SFTKVE+IED  TKFTCE C
Sbjct  400   GRLVSKLRCCNCGHCSDKYEPLIDLSLEIEDANSLQSALESFTKVEKIEDSGTKFTCESC  459

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +VS EKQL+LD+AP VA  HLKRFK DG+ +EKI KHV FP ELDL PY   NE   E
Sbjct  460   KKEVSREKQLMLDQAPSVAALHLKRFKIDGTSIEKIGKHVQFPLELDLKPYTNDNEDSDE  519

Query  1591  ES-KYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
                KY L+AVVVH G SL SGHY+C++ +SP  W+K DD +V++ QE  V+SQ AYILFY
Sbjct  520   VGFKYQLYAVVVHKGDSLMSGHYFCYIRSSPDTWHKLDDPEVSKEQEEFVLSQAAYILFY  579

Query  1414  VKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQ  1304
              ++GTPW S +I+ Q+L  D + SN+SP+ VL +V++
Sbjct  580   AREGTPWCSSLIKPQELCSDPNNSNTSPKSVLDNVNR  616



>gb|KHG24059.1| Ubiquitin carboxyl-terminal hydrolase 20 -like protein [Gossypium 
arboreum]
Length=741

 Score =   390 bits (1001),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 203/406 (50%), Positives = 258/406 (64%), Gaps = 47/406 (12%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDH-PSPCEACNEGFCVLCALKELMNISLASKGSTIR  2132
             TCF+N+VLQCF H VP +  + + +H   PC+   E FC+LC +++ + +SL S G  + 
Sbjct  163   TCFINAVLQCFTHTVPFVLGLRSLNHHEKPCDRDMESFCLLCVVRDHIELSLHSSGGVVS  222

Query  2131  PKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFG  1952
             P KI +NL+YFSS FQR+QQ DAHEFLQC L+RLESCC+  KL   +S   + +VK+ FG
Sbjct  223   PTKIFDNLNYFSSFFQRYQQEDAHEFLQCLLDRLESCCS--KLKNDLSSIDDCLVKKVFG  280

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+S+L CCNCGH S TYEPL DLSLEIED DSL  AL+SFTKVE+IED +  + CE C
Sbjct  281   GRLVSRLCCCNCGHVSSTYEPLNDLSLEIEDADSLLTALESFTKVEKIEDLQLNYRCENC  340

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K QVS+EKQL+LD+AP VATFHLKRFK +G+ +EKI KHV FP ELDL PY   NE+  E
Sbjct  341   KEQVSVEKQLMLDQAPSVATFHLKRFKTEGTYIEKIDKHVDFPLELDLQPYAVGNERNNE  400

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSK--------------------  1472
             E +Y LFAVV H G   +SGHY C++ +SP+ W+K +DS+                    
Sbjct  401   ELRYQLFAVVKHSGFRPTSGHYVCYIRSSPNMWHKMNDSRVSVDEFVHILMIPDKGFCFP  460

Query  1471  ----------------------VTRVQENVVMSQEAYILFYVKQGTPWFSEIIETQQLIL  1358
                                   VT V+E  V+SQEAYIL Y KQG PWFS  IE Q+   
Sbjct  461   TALNILLVLQAFGSDNFTDIAIVTCVEEEAVLSQEAYILLYAKQGIPWFSTAIEVQKPSA  520

Query  1357  DASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAADEASS  1220
             D  IS+SSP+ VL  +D  F    ++E    C  NET + AD AS+
Sbjct  521   DPGISDSSPKSVLDDID--FASNLEVEKSANCSANETKDVADRAST  564



>ref|XP_007039489.1| Ubiquitin-specific protease 20, putative [Theobroma cacao]
 gb|EOY23990.1| Ubiquitin-specific protease 20, putative [Theobroma cacao]
Length=760

 Score =   389 bits (1000),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 192/368 (52%), Positives = 253/368 (69%), Gaps = 1/368 (0%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N+VLQCF H VP +  + + +H  PC    E FC+LCAL + + +SL S G  + P
Sbjct  200   TCFINAVLQCFTHTVPFVLGLRSLNHEKPCARSVESFCLLCALHDHIELSLNSSGGIVSP  259

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPK-LNGQVSPKHENVVKQTFG  1952
              KI +NL+Y SS   R++Q DAHEFLQC L+RL SCC+  K  N  +S   + +VK+ FG
Sbjct  260   SKIFDNLNYISSFLYRYEQEDAHEFLQCLLDRLGSCCSDSKPKNNCLSSSDDCLVKKVFG  319

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+S+L CCNCG+ S +YEPL DLSLEIE+VD+L  AL+SFTKVE+IED   KF CE C
Sbjct  320   GRLVSQLCCCNCGYISYSYEPLNDLSLEIENVDTLPSALESFTKVEKIEDQGAKFRCENC  379

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V++EKQL+LD+AP VATFHLKRFK +   VEKI KHV FP ELDL PY   N+   E
Sbjct  380   KEEVAVEKQLMLDQAPSVATFHLKRFKTESGYVEKIDKHVFFPLELDLQPYTIVNQSSNE  439

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             E KY L+AVV H G + +SGHY  ++ +SP+ W+K +DS+VTRV+E VV+SQEAYILFY 
Sbjct  440   ELKYQLYAVVKHSGFTPTSGHYVSYIRSSPNTWHKLNDSRVTRVEEEVVLSQEAYILFYA  499

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAAD  1232
             +QG PWFS  IE Q+   D  IS+SSP+ VL +++      P +++   C  NE+ +   
Sbjct  500   RQGIPWFSTAIEVQKPCADPGISDSSPKSVLDNMEMECPSDPHVKSRADCGANESKDIPA  559

Query  1231  EASSNVDG  1208
               S+   G
Sbjct  560   RTSTQFSG  567



>ref|XP_002527676.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34747.1| conserved hypothetical protein [Ricinus communis]
Length=753

 Score =   387 bits (993),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 249/334 (75%), Gaps = 4/334 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N+VLQ F H VPL++++ +C+H  PC+   EGFC +CAL++ + +SL S G  + P
Sbjct  188   TCFINAVLQSFTHTVPLVKALRSCNHVMPCQRGVEGFCAVCALRDHIELSLTSSGKAVSP  247

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHEN-VVKQTFG  1952
              KIV+NL   SS F+++QQ DAHEFLQC L++LE CC  P L+ + S   EN +V++ FG
Sbjct  248   SKIVDNLKQISSCFEKYQQEDAHEFLQCLLDKLERCCLDPGLSDEASSSPENNIVERVFG  307

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CCNCGH SD YEPL+DLSLEIEDV +L  AL+SFTKVE+IED ++KF C  C
Sbjct  308   GRLVSKLRCCNCGHCSDKYEPLIDLSLEIEDVGNLQSALESFTKVEKIEDVDSKFICNHC  367

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNE---K  1601
             K + S EKQL+LD+AP V+  HLKRFK DGS +EKI KHV FP EL+L PY + ++   K
Sbjct  368   KEEGSREKQLMLDQAPSVSALHLKRFKTDGSFIEKIDKHVEFPLELNLKPYTKSSQDCNK  427

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                + KY L+A+VVH G+S +SGHY+CFV +SPS W+K DD +V +V+E  V+SQ AYIL
Sbjct  428   NQVDLKYQLYAIVVHNGLSPTSGHYFCFVRSSPSTWHKLDDCRVVKVEEEEVLSQAAYIL  487

Query  1420  FYVKQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             FYV+ GTPWFS +IE ++   D SISN+SP+ VL
Sbjct  488   FYVRDGTPWFSSLIELEKDSSDPSISNTSPKSVL  521



>ref|XP_008448681.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Cucumis 
melo]
Length=655

 Score =   382 bits (980),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 218/525 (42%), Positives = 308/525 (59%), Gaps = 35/525 (7%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N++LQC  H  P ++ I + +H  PC +  E FCVLCA+++ + +SL S G  I P
Sbjct  132   TCFINAILQCLTHTAPFVEGIRSANHYMPCNS--EDFCVLCAIRDHIELSLTSLGGIISP  189

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
              K+V+NL+YFSS F+R+QQ DAHEF+QCFL++LE C    +    VS + +++V + FGG
Sbjct  190   VKLVDNLNYFSSFFRRYQQEDAHEFMQCFLDKLERCM-VSEAKDWVSSEDDDLVNKVFGG  248

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              LIS L CCNCGH S+T+EPLVDLSLEIE+VDSLS AL+SFTKVERI DPETKF CE CK
Sbjct  249   RLISNLCCCNCGHCSETHEPLVDLSLEIENVDSLSSALESFTKVERIGDPETKFKCENCK  308

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              +V +EKQL L++ PLV TFHLKRFK D S VEKI KH+ FP ELDL PY    +    E
Sbjct  309   EEVWVEKQLKLEKLPLVTTFHLKRFKADSSFVEKIEKHLEFPLELDLQPYTLGGQDAEVE  368

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY L+A+V H G S +SGHY+ FV +SP  W++ DDS VT V E  V+S+EAYIL Y +
Sbjct  369   LKYELYAIVEHTGFSSTSGHYFSFVRSSPDTWHRMDDSLVTPVTEEYVLSREAYILLYKR  428

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAADE  1229
             +GT WFS +I+     L++  SN SP  VL ++D + + +           N   +    
Sbjct  429   KGTSWFSSLIQQSDPCLNSDSSNPSPNLVLQNIDTVCSSFAAESNVNHEPANAPADTLQP  488

Query  1228  ASSNVD---GPKDNGIDRSDGKENSNVVSALIHEGMNNSS------DICSAEAEKT----  1088
             + +      G +D G+   +  EN+  V+  I E     S      ++C  + +++    
Sbjct  489   SPARFSCEMGNQDTGV---NDLENATSVNLNIVESATTKSSPIVTKNLCLNDDDESIDGF  545

Query  1087  PPPSVLKEKNCKQEFRISKRFADLTTETPSISPSLEIYREDTADNAYSPPRALLRPADEV  908
              P S ++  +    FR         T  P     ++  + +    + SP   L +  ++ 
Sbjct  546   HPLSPMRSPSPDNIFR---------TPEPQYRIPVDHLKTEKCSTSGSP---LDKGVEDS  593

Query  907   NHPEGEKLVKKKMPSTRGS----ALKGSHNESCMKKRRRRVEGSP  785
                   + VKK MP +RGS    A+ GS +E     +++R+   P
Sbjct  594   ERKAAMRYVKKNMPGSRGSKMIAAILGSQSEGSSLNKKKRLRSLP  638



>gb|KGN55756.1| hypothetical protein Csa_3G011100 [Cucumis sativus]
Length=655

 Score =   380 bits (976),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 217/522 (42%), Positives = 308/522 (59%), Gaps = 29/522 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N++LQC  H  P ++ + + +H  PC +  EGFCV CA+++ + +SL S G  I P
Sbjct  132   TCFINAILQCLTHTAPFVEGLRSANHDMPCNS--EGFCVFCAIRDHIELSLTSLGGIISP  189

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
              K+V+NL+YFSS F R+QQ DAHEF+QCFL++LE C    +   +VS + +++V + FGG
Sbjct  190   VKLVDNLNYFSSFFWRYQQEDAHEFMQCFLDKLERCM-VSEGKDRVSSEDDDLVNKVFGG  248

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              LIS L CCNCGH S+T+EPLVDLSLEIE+VDSLS AL+SFTKVERI DPETKF CE CK
Sbjct  249   RLISNLCCCNCGHCSETHEPLVDLSLEIENVDSLSSALESFTKVERIGDPETKFKCENCK  308

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              +V +EKQL L++ PLV TFHLKRFK D S VEKI KH+ FP ELDL PY    +    E
Sbjct  309   EEVWVEKQLKLEKIPLVTTFHLKRFKADSSFVEKIEKHLEFPLELDLKPYTLGGKDAEVE  368

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY L+A+V H G S +SGHY+ FV +SP  W++ DDS VT V E  V+S+EAYIL Y +
Sbjct  369   LKYELYAIVEHTGFSSTSGHYFSFVRSSPDTWHRMDDSLVTSVTEEYVLSREAYILLYKR  428

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVD---QIFNPYPKMETDRPCDVNETDNA  1238
             +GT WFS +I+     L++  SN SP+ VL ++      F    K+  +      +T   
Sbjct  429   KGTSWFSSLIQRSDPCLNSDSSNPSPKSVLQNIGTGCSSFAAESKVNHESANAPADTLQP  488

Query  1237  ADEASSNVDGPKDNGIDRSDGKENSN---VVSALIHEGMNNSSDICSAEAEKT----PPP  1079
             +    S     +D G+   +   ++N   V SA +      + D+C  + +++     P 
Sbjct  489   SPARFSCEMENQDTGVSDLENATSANLNIVESATMKSSPIVTKDLCLNDEDESIDGFHPL  548

Query  1078  SVLKEKNCKQEFRISKRFADLTTETPSISPSLEIYREDTADNAYSPPRALLRPADEVNHP  899
             S ++  +    FR         T  P     ++  + +    + SP   L +  ++    
Sbjct  549   SPVRSPSPDNVFR---------TPEPQYRIPVDHLKTEKCSTSGSP---LNKGVEDSERK  596

Query  898   EGEKLVKKKMPSTRGS----ALKGSHNESCMKKRRRRVEGSP  785
                + VKK MP +RGS    A+ GS +E     +++R+   P
Sbjct  597   AAMRYVKKNMPGSRGSKMIAAILGSQSEGSSLNKKKRLRSLP  638



>ref|XP_003533435.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Glycine 
max]
Length=739

 Score =   380 bits (976),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 249/347 (72%), Gaps = 11/347 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN++LQCF H VPL+Q + +  H  PC    +GFCV+CAL+  +  SL + G T+ P
Sbjct  141   TCFLNAILQCFTHTVPLVQGLRSSTHLIPCSGHKDGFCVICALRIHVERSLVAPGGTLSP  200

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESC-CNYPKLNGQVSPKHENVVKQTFG  1952
              K VNNL+YFSS F+R+QQ DAHEF+QC L++LE C  +  K N  ++ + +N+V++ FG
Sbjct  201   LKFVNNLNYFSSDFRRYQQEDAHEFMQCALDKLERCFLDLKKSN--LNFEDDNLVEKVFG  258

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G  ISKLQC  CGH S+T+EPL+D+SLEI++VDSL  AL+SFTKVE I++    F C+ C
Sbjct  259   GRFISKLQCSTCGHTSNTFEPLIDMSLEIDNVDSLPSALESFTKVENIDE---NFRCDNC  315

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPY-VERNEKVI  1595
             K +VS+EKQL+LD+ P VA  HLKRFK +G LVEKI KH+ FP ELDL PY ++  E ++
Sbjct  316   KEEVSMEKQLMLDQTPSVAALHLKRFKTNGILVEKIDKHIDFPLELDLQPYTIKVMEDLV  375

Query  1594  EES----KYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAY  1427
              E+    KY+L+A+VVH G+S +SGHY+CFV ++P  W+K DDS VT+V  + V+SQEAY
Sbjct  376   AENDVPLKYDLYAIVVHTGLSSTSGHYFCFVRSAPDTWHKLDDSMVTKVSVDSVLSQEAY  435

Query  1426  ILFYVKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYP  1286
             ILFY +QGTPWFS I+E +   LD +I  +SP+ VL   D +    P
Sbjct  436   ILFYARQGTPWFSSIMEEKTQCLDPNIMTTSPKSVLDVGDNMSKSNP  482



>gb|KHN38924.1| Ubiquitin carboxyl-terminal hydrolase 20 [Glycine soja]
Length=776

 Score =   379 bits (972),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 249/347 (72%), Gaps = 11/347 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN++LQCF H VPL+Q + +  H  PC    +GFCV+CAL+  +  SL + G T+ P
Sbjct  178   TCFLNAILQCFTHTVPLVQGLRSSTHLIPCSGHKDGFCVICALRIHVERSLVAPGGTLSP  237

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESC-CNYPKLNGQVSPKHENVVKQTFG  1952
              K VNNL+YFSS F+R+QQ DAHEF+QC L++LE C  +  K N  ++ + +N+V++ FG
Sbjct  238   LKFVNNLNYFSSDFRRYQQEDAHEFMQCALDKLERCFLDLKKSN--LNFEDDNLVEKVFG  295

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G  ISKLQC  CGH S+T+EPL+D+SLEI++VDSL  AL+SFTKVE I++    F C+ C
Sbjct  296   GRFISKLQCSTCGHTSNTFEPLIDMSLEIDNVDSLPSALESFTKVENIDE---NFRCDNC  352

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPY-VERNEKVI  1595
             K +VS+EKQL+LD+ P VA  HLKRFK +G LVEKI KH+ FP ELDL PY ++  E ++
Sbjct  353   KEEVSMEKQLMLDQTPSVAALHLKRFKTNGILVEKIDKHIDFPLELDLQPYTIKVMEDLV  412

Query  1594  EES----KYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAY  1427
              E+    KY+L+A+VVH G+S +SGHY+CFV ++P  W+K DDS VT+V  + V+SQEAY
Sbjct  413   AENDVPLKYDLYAIVVHTGLSSTSGHYFCFVRSAPDTWHKLDDSMVTKVSVDSVLSQEAY  472

Query  1426  ILFYVKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYP  1286
             ILFY +QGTPWFS I+E +   LD +I  +SP+ VL   D +    P
Sbjct  473   ILFYARQGTPWFSSIMEEKTQCLDPNIMTTSPKSVLDVGDNMSKSNP  519



>gb|KHN04879.1| Ubiquitin carboxyl-terminal hydrolase 20 [Glycine soja]
Length=611

 Score =   373 bits (957),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 185/349 (53%), Positives = 242/349 (69%), Gaps = 15/349 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN++LQCF H VPL+Q + +  HP PC    +GFCV+CAL+  +  SLA+ G T  P
Sbjct  11    TCFLNAILQCFTHTVPLVQGLRSSTHPIPCSGHKDGFCVICALRIHVERSLAASGGTFSP  70

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
              + VNNL YFSS F+R+QQ DAHEF+QC L++LE C    K    ++ +  N+V++ FGG
Sbjct  71    LEFVNNLKYFSSDFRRYQQEDAHEFMQCTLDKLERCFLGLK-KSNLNFEDVNLVEKVFGG  129

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              LISKLQC  C H S+T+EPL+D+SLEI++VDSL  AL+SFTKVE I+D      C+ CK
Sbjct  130   RLISKLQCSTCDHTSNTFEPLIDMSLEIDNVDSLPSALESFTKVENIDD---NLQCDNCK  186

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              +VS+EKQL+LD+ P VA FHLKRFK DG LVEKI KH+ FP ELDL PY     KV+E+
Sbjct  187   EEVSMEKQLMLDQTPSVAAFHLKRFKTDGILVEKIDKHIDFPLELDLQPYT---IKVMED  243

Query  1588  S--------KYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQE  1433
                      KY+L+A+VVH G+S +SGHY+CFV ++P  W+K DDS VT V    V+SQE
Sbjct  244   PGAENDVPLKYDLYAIVVHTGLSSTSGHYFCFVRSAPDTWHKLDDSMVTEVSVETVLSQE  303

Query  1432  AYILFYVKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYP  1286
             AYILFY +QGTPWF  I+E +   L+ +I ++SP+ VL   D +    P
Sbjct  304   AYILFYARQGTPWFLSIMEEKTQCLNPNIMSTSPKSVLDVGDNMCKSNP  352



>gb|EPS64352.1| hypothetical protein M569_10430, partial [Genlisea aurea]
Length=336

 Score =   362 bits (929),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 233/335 (70%), Gaps = 15/335 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEG-FCVLCALKELMNISLASKGSTIR  2132
             TCFLNSVLQC  H  PL+  + +  H  PC  C +  FC+LC LK L+  SL S+   IR
Sbjct  10    TCFLNSVLQCLAHSFPLLNGVFSFRH-GPCSNCADSEFCLLCELKGLVERSLVSESGVIR  68

Query  2131  PKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFG  1952
             PKK VNNL+YFSS F+ +QQ DAHEFLQCFLE+LE+   + K       + EN+VKQ FG
Sbjct  69    PKKFVNNLNYFSSYFRMYQQEDAHEFLQCFLEKLETF-FHSKAQDSTCSRSENLVKQVFG  127

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G ++SKL+CC+CGH SD+ EP VDLSLEIED  SL +AL SFT +E     + KFTC+KC
Sbjct  128   GSIVSKLRCCSCGHSSDSCEPSVDLSLEIEDAGSLEMALQSFTGLE----TDIKFTCDKC  183

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPY----VERNE  1604
             + +V  EKQL L++ PLVA FHLKRF+NDG   EKI KHVTFP  LDL PY    +  NE
Sbjct  184   REEVCFEKQLCLNKTPLVAVFHLKRFRNDGCFGEKIDKHVTFPTNLDLQPYTSSGINNNE  243

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
             K++    Y+L+A++VH G+S +SGHY+CFV  SP+ W KFDD  V  V E++V+SQEAY+
Sbjct  244   KLV----YDLYAILVHSGISSTSGHYFCFVRVSPNMWCKFDDEMVELVDESIVLSQEAYV  299

Query  1423  LFYVKQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             LFY K+GTPWFS   E  +++ DA   ++SP  VL
Sbjct  300   LFYTKEGTPWFSSFTENHKMVSDAEKFSTSPVSVL  334



>gb|KEH25395.1| ubiquitin carboxyl-terminal hydrolase-like protein [Medicago 
truncatula]
Length=568

 Score =   370 bits (950),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 233/335 (70%), Gaps = 19/335 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS++QCF+H VPL++ +  C H S     + G+CV+C+    M +SL   G  I P
Sbjct  37    TCFLNSIMQCFIHTVPLVEGLFTCSHAS--NDGHNGYCVICSFHYQMQLSLRYTGRVISP  94

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC-----NYPKLNGQVSPKHENVVK  1964
             K IV NL++FSS F+R+QQ DAHEF+QC L++L+SC      N PK  G      +N+VK
Sbjct  95    KIIVENLNHFSSMFRRYQQEDAHEFMQCVLDKLDSCFLDLKKNDPKFEG------DNIVK  148

Query  1963  QTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFT  1784
             + FGG L+S+L+CCNCG  SDT EPL+DLSLEIE+V++LS ALDSFT VE   D + KF 
Sbjct  149   KVFGGSLVSRLRCCNCGRSSDTNEPLIDLSLEIENVETLSSALDSFTTVE---DIDAKFK  205

Query  1783  CEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNE  1604
             CE C  +VS+EKQL+LD+ P +A FHLKRFK DG  VEKI KH+ F  +LD+ PY   N+
Sbjct  206   CEGCNEEVSMEKQLMLDQTPSIAAFHLKRFKTDGVFVEKIDKHIDFQLQLDMQPYTISND  265

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
                  SKY L+AVVVH G+S +SGHY+CFV  +P  W+K DDS VT+V E  V+SQEAYI
Sbjct  266   A---SSKYYLYAVVVHTGISSTSGHYFCFVRTAPGTWHKLDDSMVTKVSEETVLSQEAYI  322

Query  1423  LFYVKQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             LFY +QGTPWFS   E+    L+ S  N+SP+ VL
Sbjct  323   LFYARQGTPWFSNFAESTIPSLNLSRMNTSPKSVL  357



>ref|XP_003517073.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Glycine 
max]
Length=723

 Score =   374 bits (961),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 185/349 (53%), Positives = 242/349 (69%), Gaps = 15/349 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN++LQCF H VPL+Q + +  HP PC    +GFCV+CAL+  +  SLA+ G T  P
Sbjct  123   TCFLNAILQCFTHTVPLVQGLRSSTHPIPCSGHKDGFCVICALRIHVERSLAASGGTFSP  182

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
              + VNNL YFSS F+R+QQ DAHEF+QC L++LE C    K    ++ +  N+V++ FGG
Sbjct  183   LEFVNNLKYFSSDFRRYQQEDAHEFMQCTLDKLERCFLGLK-KSNLNFEDVNLVEKVFGG  241

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              LISKLQC  C H S+T+EPL+D+SLEI++VDSL  AL+SFTKVE I+D      C+ CK
Sbjct  242   RLISKLQCSTCDHTSNTFEPLIDMSLEIDNVDSLPSALESFTKVENIDD---NLQCDNCK  298

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              +VS+EKQL+LD+ P VA FHLKRFK DG LVEKI KH+ FP ELDL PY     KV+E+
Sbjct  299   EEVSMEKQLMLDQTPSVAAFHLKRFKTDGILVEKIDKHIDFPLELDLQPYT---IKVMED  355

Query  1588  S--------KYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQE  1433
                      KY+L+A+VVH G+S +SGHY+CFV ++P  W+K DDS VT V    V+SQE
Sbjct  356   PGAENDVPLKYDLYAIVVHTGLSSTSGHYFCFVRSAPDTWHKLDDSMVTEVSVETVLSQE  415

Query  1432  AYILFYVKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYP  1286
             AYILFY +QGTPWF  I+E +   L+ +I ++SP+ VL   D +    P
Sbjct  416   AYILFYARQGTPWFLSIMEEKTQCLNPNIMSTSPKSVLDVGDNMSKSNP  464



>ref|XP_010104298.1| Ubiquitin carboxyl-terminal hydrolase 21 [Morus notabilis]
 gb|EXB99718.1| Ubiquitin carboxyl-terminal hydrolase 21 [Morus notabilis]
Length=667

 Score =   370 bits (950),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 223/513 (43%), Positives = 302/513 (59%), Gaps = 60/513 (12%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N+VLQCF H VPL+Q + +C+H  PCE   E FCV+CAL + + +SL+S G  I P
Sbjct  173   TCFMNAVLQCFTHTVPLVQGLRSCNHSVPCERGFEEFCVVCALHDHIQLSLSSSGGLISP  232

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVS-PKHENVVKQTFG  1952
              K              ++Q DAHEFLQCFL+RLESC    K N + S P  EN+V+Q FG
Sbjct  233   LK--------------YEQEDAHEFLQCFLDRLESCLLDSKTNEKCSTPPAENLVEQVFG  278

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G LISKLQCCNCG    T+EPL+DLSLEIE VDS+  AL SFTK+E+IED E KFTCE C
Sbjct  279   GRLISKLQCCNCGQVPTTFEPLIDLSLEIESVDSVPSALGSFTKMEKIEDSEIKFTCENC  338

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V++EKQL++D+AP VA FHLKRFK DGS VEKI KHV F  ELDL  Y         
Sbjct  339   KEEVAVEKQLMVDQAPSVAVFHLKRFKADGSFVEKIDKHVDFSLELDLQSYSTSTSGDNA  398

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
                Y+L+ ++VH+G S +SGHY+ F+ +SP  WY+ DDS+VTRV+E  V+SQ AYILFYV
Sbjct  399   GLMYDLYGIIVHVGFSSASGHYFSFIRSSPDTWYRLDDSRVTRVREEYVLSQNAYILFYV  458

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAAD  1232
             K+GTPWFS ++E ++  LD     +SPQ VL +V++   P+    TD    V+  +    
Sbjct  459   KRGTPWFSSLMEAEKQPLDLETRTTSPQSVLDNVEKAC-PF---STDTSASVSSGEGNCF  514

Query  1231  E--ASSNVDGPKDNGIDRSDGKENSNVVSA--LIHEGMNNSSDICSAEAEKTPPPSVLKE  1064
             E  +S NVD      +  +  +++ +  SA  + H                TPP      
Sbjct  515   EKISSINVDACTTTSLGENSCQQDVDDTSADDIFH--------------PLTPP------  554

Query  1063  KNCKQEFRISKRFADL-TTETPSISPSLEIYRED-TADNAYSPPRALLRPADEVNHPEGE  890
                        R  D+ + ETP   PS +I R    +++  +  R L +  D+    E  
Sbjct  555   ---------RARSPDVFSFETP--GPSYQIPRNHLKSEDQPTCKRLLNKRPDDSETKEAV  603

Query  889   KLVKKKMPSTRGSALKGS----HNESCMKKRRR  803
             + + + MPS+RGS L  +     +E   +K+R+
Sbjct  604   RYLTRSMPSSRGSRLLDAMFRPQSEGAARKKRK  636



>ref|XP_004512524.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Cicer 
arietinum]
Length=727

 Score =   371 bits (952),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 186/341 (55%), Positives = 239/341 (70%), Gaps = 6/341 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS++QCF H VPL++ +  C H SP +  N G+CV+CA +  +  SL S G    P
Sbjct  162   TCFLNSIMQCFTHTVPLVEGLLLCSH-SPNDGHN-GYCVICAFRYHVRHSLQSTGRIFSP  219

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
               +V+NL++FSS F+R QQ DAHEF+QC L++LE C    K N   S + +N+V + FGG
Sbjct  220   VILVDNLNHFSSLFRRHQQEDAHEFMQCALDKLERCFLNLKKN-DPSFEDDNIVNKVFGG  278

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+SKL+CCNCG  SDT EPL+DLSLEIE+V++LS AL+SFT VE I+    KF CE CK
Sbjct  279   RLVSKLRCCNCGRSSDTNEPLIDLSLEIENVETLSSALESFTMVEDID---AKFRCEGCK  335

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              +VS+EKQL+LD+ P +ATFHLKRFK DG LVEKI KH+ FP ELDL P+   NE     
Sbjct  336   EEVSMEKQLMLDQTPSIATFHLKRFKTDGILVEKIDKHINFPLELDLQPFTISNENNNVS  395

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY+L+AVVVH G S +SGHY+CFV ++P  W+K DDSKV++V E  V+SQE YILFY +
Sbjct  396   LKYDLYAVVVHSGFSSTSGHYFCFVRSAPDTWHKLDDSKVSKVLEETVLSQEGYILFYAR  455

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYP  1286
             QGTPW S  +E+Q   LD S  N+SP+ VL   D     +P
Sbjct  456   QGTPWISSFMESQIPCLDLSRMNTSPKSVLDITDGQNKSFP  496



>gb|KEH25397.1| ubiquitin carboxyl-terminal hydrolase-like protein [Medicago 
truncatula]
Length=662

 Score =   358 bits (918),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 178/335 (53%), Positives = 227/335 (68%), Gaps = 23/335 (7%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS++QCF H VPL++ + +C H   C   + G+CV+CA +  M  SL   G  I P
Sbjct  135   TCFLNSIMQCFTHTVPLVEGLFSCSHA--CNDGHNGYCVICAFRYQMQRSLRYTGRVISP  192

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC-----NYPKLNGQVSPKHENVVK  1964
               IV NL++FSS F+R++Q DAHEF+QC L++L+SC      N PK  G      +N+VK
Sbjct  193   MIIVENLNHFSSMFRRYRQEDAHEFMQCVLDKLDSCFLELKKNDPKFEG------DNIVK  246

Query  1963  QTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFT  1784
             + FGG L+S+L+CCNCG  SDT EP +DLSLEIE+ D+LS ALDSFT VE   D + KF 
Sbjct  247   KVFGGSLVSRLRCCNCGRSSDTNEPSIDLSLEIENADTLSSALDSFTTVE---DIDAKFK  303

Query  1783  CEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNE  1604
             CE C  +VS+EKQL+LD+ P +A FHLKRFK  G  VEKI KH+ FP ELD+ PY   N+
Sbjct  304   CEGCNEEVSMEKQLMLDQTPSIAAFHLKRFKTYGIFVEKIDKHINFPLELDMQPYTISND  363

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
                  SKY+L+AVVVH G S +SGHY+ FV  +P  W+K DDS VT V E  V+SQEAYI
Sbjct  364   A---SSKYDLYAVVVHTGFSSTSGHYFSFVRTAPDTWHKLDDSMVTMVSEETVLSQEAYI  420

Query  1423  LFYVKQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             LFY +QGT WFS   E+  L    S+ N+SP+ VL
Sbjct  421   LFYARQGTHWFSNFAESTIL----SLMNTSPKSVL  451



>ref|XP_010530035.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Tarenaya 
hassleriana]
 ref|XP_010530036.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Tarenaya 
hassleriana]
Length=737

 Score =   360 bits (923),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 183/361 (51%), Positives = 251/361 (70%), Gaps = 15/361 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N++LQCF H VPLI+S+ +  H  PC   ++ FCV   L++ + ++L S G  + P
Sbjct  210   TCFMNAILQCFTHTVPLIESLFSNKHSRPCNCDSKEFCVTQVLRDHIELALRSSGDHVSP  269

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYP-KLNGQVSPKHENVVKQTFG  1952
              + V+NL+Y SS FQR+ Q DAHEFLQ FL++LE CC  P   +G V+ +  NVV+  FG
Sbjct  270   VRFVDNLNYISSGFQRYHQEDAHEFLQSFLDKLERCCLDPGNKSGYVTSQGVNVVQHVFG  329

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+S+L+CC+C   SDTYE  + LSLEIEDVD+L+ AL+SFT VE++ED   +FTC+ C
Sbjct  330   GRLVSRLRCCSCNSFSDTYENSLCLSLEIEDVDNLASALESFTCVEKLED---QFTCDSC  386

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +VS EKQL+LD+ PLVA FHLKRFKNDG  +EKI KHV FP EL+L PY+   ++   
Sbjct  387   KEKVSKEKQLMLDKLPLVAAFHLKRFKNDGFFMEKIFKHVEFPLELNLQPYMSGGQENEV  446

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              + Y+L+A+V HIG SL+ GHY  +V ++   W+KFDDS+VTR++E  V+SQ+AYILFY 
Sbjct  447   CTTYHLYALVEHIGSSLTYGHYSSYVRSAHETWHKFDDSQVTRIEEGSVLSQDAYILFYA  506

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPV-------LYSVDQIFNPYPKMETDRPCDVN  1253
             ++GTPWFS   E     L+A++SNSSP+ V       L S + I N  P    D+PC++ 
Sbjct  507   REGTPWFSSAFEQIMPYLEANMSNSSPKSVLDPAYRELVSSENINNASP----DKPCNLV  562

Query  1252  E  1250
             E
Sbjct  563   E  563



>gb|KEH25396.1| ubiquitin carboxyl-terminal hydrolase-like protein [Medicago 
truncatula]
Length=632

 Score =   356 bits (914),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 176/335 (53%), Positives = 226/335 (67%), Gaps = 19/335 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS++QCF H VPL++ + +C H   C   + G+CV+CA +  M  SL   G  I P
Sbjct  75    TCFLNSIMQCFNHTVPLVEGLFSCSHA--CNDGHNGYCVICAFRYQMQRSLRYTGRVISP  132

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC-----NYPKLNGQVSPKHENVVK  1964
               IV NL++FSS F+R+ Q DAHEF+QC  ++L+ C      N PK  G      +N+VK
Sbjct  133   MIIVENLNHFSSMFRRYLQEDAHEFMQCVFDKLDLCFLDLKNNDPKFEG------DNIVK  186

Query  1963  QTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFT  1784
             + FGG L+S L+CCNCG  SD  EPL+D SLEIE+VD+LS AL+SFT VE I+    KF 
Sbjct  187   KVFGGSLVSMLRCCNCGCSSDINEPLIDFSLEIENVDTLSSALESFTMVEHID---AKFK  243

Query  1783  CEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNE  1604
             CE C  +VS+EKQL+LD+ P +A FHLKRFK DG  VEKI KH+ F  +LD+ PY   N+
Sbjct  244   CEGCNEEVSMEKQLMLDQTPSIAAFHLKRFKTDGVFVEKIDKHIDFQLQLDMQPYTISND  303

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
                  SKY L+AVVVH G+S +SGHY+CFV  +P  W+K DDS VT+V E  V+SQEAYI
Sbjct  304   A---SSKYYLYAVVVHTGISSTSGHYFCFVRTAPDTWHKLDDSMVTKVSEETVLSQEAYI  360

Query  1423  LFYVKQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             LFY +QGTPWFS   E+    L+ S  N+SP+ VL
Sbjct  361   LFYARQGTPWFSNFAESTIPSLNLSRMNTSPKSVL  395



>ref|XP_006398369.1| hypothetical protein EUTSA_v10000790mg [Eutrema salsugineum]
 gb|ESQ39822.1| hypothetical protein EUTSA_v10000790mg [Eutrema salsugineum]
Length=736

 Score =   358 bits (919),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 229/331 (69%), Gaps = 4/331 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQCF H VPLI+S+ +  H  PC   NE FCVL AL+E + ++L S G ++R 
Sbjct  179   TCFIASVLQCFTHTVPLIESLRSYKHQVPCNCGNEKFCVLQALREHIELALRSSGDSLRI  238

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC-NYPKLNGQVSPKHENVVKQTFG  1952
                 +NL+YFS  FQ   Q DAHEFLQ FL++LE CC +     G VS +  N+V   FG
Sbjct  239   DWFRDNLNYFSPDFQINNQEDAHEFLQSFLDKLERCCLDRRDKPGSVSSQDGNIVDHVFG  298

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL CCNC   SDT+EP +  SLEIEDVD+LS AL+SFT VE++ED   +FTC+ C
Sbjct  299   GRLVSKLHCCNCNSISDTFEPSLGWSLEIEDVDNLSSALESFTHVEKLED---QFTCDNC  355

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +VS EKQL LD+ PLVATFHLKRFKNDG  +EKI KHV FP ELDLLPY+  NE    
Sbjct  356   KEKVSKEKQLKLDKLPLVATFHLKRFKNDGLFMEKIFKHVEFPLELDLLPYMSSNENPEV  415

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY L+A+V H+G  +S GHY  +V ++P  W+ FDDSKV ++ E  V+S+ AY+LFY 
Sbjct  416   STKYLLYAMVEHLGSGVSFGHYSSYVRSAPGTWHHFDDSKVRKISEEYVLSKHAYMLFYA  475

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             ++GTPWFS   E  + + +A+  N SP+ VL
Sbjct  476   REGTPWFSSAFEELKTLFEATPLNFSPKSVL  506



>ref|XP_010919955.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Elaeis 
guineensis]
Length=611

 Score =   350 bits (899),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 177/337 (53%), Positives = 236/337 (70%), Gaps = 4/337 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+VLQC  H VPL+Q +++ DH S C   N  FC  CAL+E +N+S+   G+ I P
Sbjct  47    TCFLNAVLQCLTHTVPLVQKLQSVDHSSTCCGGNGDFCSFCALREHINLSILESGNVISP  106

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP-KHENVVKQTFG  1952
              +I +NL   SS FQR  +GDAHEFL   L+ L SCC  P L    S  + +++VKQ FG
Sbjct  107   TRIADNLDKISSCFQRGSEGDAHEFLHALLDSLHSCCLDPSLKDHPSSLEKDSLVKQVFG  166

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+L+CC+CG  SDT+EPL+DLSLEI DVD+L+ AL SFTKVE+I+DPETKFTCE C
Sbjct  167   GRLRSQLRCCDCGRCSDTFEPLLDLSLEIGDVDTLTDALVSFTKVEKIDDPETKFTCEGC  226

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K QV +EKQL LD+AP V    LKRFK+ G    KI K V +P ELDL P++   E  + 
Sbjct  227   KAQVLVEKQLKLDQAPEVVALQLKRFKSIGFFATKIEKFVDYPLELDLNPFLSCPEDGV-  285

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY+L+AV+VH G S  SGHYYCFV +SP+ WY+ +DS+VTRV E  V+++ A+ILFY+
Sbjct  286   KLKYDLYAVLVHDG-SPYSGHYYCFVRSSPTAWYQMNDSEVTRVSETHVLNESAFILFYI  344

Query  1411  KQG-TPWFSEIIETQQLILDASISNSSPQPVLYSVDQ  1304
             KQG +PWFS +++ Q++      +++SP  VL  +D+
Sbjct  345   KQGSSPWFSTLMDAQKVPHLDDSNDASPVSVLDHIDR  381



>ref|XP_010677233.1| PREDICTED: uncharacterized protein LOC104892907 [Beta vulgaris 
subsp. vulgaris]
Length=929

 Score =   359 bits (921),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 182/366 (50%), Positives = 241/366 (66%), Gaps = 14/366 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEG--FCVLCALKELMNISLASKGSTI  2135
             TCFLN++LQCF H VP ++ + +  H    EA + G  FCV+CA++E +  SLA  G  I
Sbjct  305   TCFLNAILQCFTHTVPFVEGLLSLKH----EASSHGDEFCVICAVREQIEHSLAYSGRVI  360

Query  2134  RPKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERL-------ESCCNYPKLNGQVSPKHE  1976
              P  +V+NLS  SS FQR+QQ DAHEFLQC  ++L       E+  N       +    +
Sbjct  361   SPSNLVDNLSNISSFFQRYQQEDAHEFLQCLSDKLDRSWSKYEASANDASGPNNLPLPDD  420

Query  1975  NVVKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPE  1796
              +V Q FGG L+S+++CC CGH SDTYEPL+DLSLEIE+VDSL  AL SFTKVE IED E
Sbjct  421   PLVNQIFGGRLVSQVRCCKCGHNSDTYEPLIDLSLEIEEVDSLENALKSFTKVESIEDTE  480

Query  1795  TKFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYV  1616
              KFTC+ CK QV +EKQL+L +AP VA FHLKRFK+DG  VEKI K V +P +LDL PY 
Sbjct  481   -KFTCDSCKEQVQVEKQLMLYQAPSVAAFHLKRFKSDGVDVEKIDKTVEYPLDLDLAPYT  539

Query  1615  ERNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQ  1436
             + +    E  KY LFA+VVH+G   +SGHY+C++  SP +WY+FDDSKVTRV E + + Q
Sbjct  540   KGSNDENENLKYELFAIVVHVGHWSTSGHYFCYIRTSPDKWYRFDDSKVTRVYEEIALCQ  599

Query  1435  EAYILFYVKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDV  1256
             +AYILFY ++GTPWF  +IE  +      + ++SP+ VL  +D     YP       C  
Sbjct  600   DAYILFYARKGTPWFGSLIEKWKAECSKKVLSTSPKSVLDDMDLPSTSYPLGTGFHGCKA  659

Query  1255  NETDNA  1238
             +++ +A
Sbjct  660   SDSRDA  665



>ref|XP_010449544.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like isoform 
X2 [Camelina sativa]
Length=716

 Score =   352 bits (903),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 173/336 (51%), Positives = 236/336 (70%), Gaps = 7/336 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQCF H VPLI+ + +  +  PC   NE FCV+  L+  ++ +L  +   + P
Sbjct  196   TCFLNSVLQCFTHTVPLIEGLRSYKYQDPCNCGNEFFCVIRVLRAHIDFALRPERIPMAP  255

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC-NYPKLNGQVSPKHENVVKQTFG  1952
                +++L+YFS  FQR+QQ DAHEFLQ FL++LE CC +       VS +  N V Q FG
Sbjct  256   DYFLHHLNYFSPDFQRYQQEDAHEFLQAFLDKLERCCLDRTSYRSYVSSQETNFVDQVFG  315

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G LIS L+CCNC   SDT+E  V LSLEIED+D+L  AL+SFT+VE++++   + TC+ C
Sbjct  316   GRLISGLRCCNCNSISDTFEKSVGLSLEIEDIDTLESALESFTRVEKLDE---QLTCDNC  372

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               +VS EKQLLLD+ PLV TFHLKRFKN+G  +EKI KHV  P ELDL PY+   E+   
Sbjct  373   NEKVSKEKQLLLDKLPLVVTFHLKRFKNNGFFMEKIFKHVKIPLELDLQPYMRDKEENDV  432

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY+L+A+V H+G S++ GHY  +V ++P  W++FDD+KVTR+ E+ V+SQ++YILFY 
Sbjct  433   PTKYHLYALVEHLGYSVTYGHYSSYVRSAPKIWHQFDDAKVTRIDEDSVLSQDSYILFYA  492

Query  1411  KQGTPWFSEIIETQQ---LILDASISNSSPQPVLYS  1313
             ++GTPWFS I E  Q    +L+AS++NSSP+ VL S
Sbjct  493   REGTPWFSSIAEQMQPLLPLLEASLANSSPKSVLDS  528



>ref|XP_010449543.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like isoform 
X1 [Camelina sativa]
Length=719

 Score =   352 bits (903),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 173/336 (51%), Positives = 236/336 (70%), Gaps = 7/336 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQCF H VPLI+ + +  +  PC   NE FCV+  L+  ++ +L  +   + P
Sbjct  196   TCFLNSVLQCFTHTVPLIEGLRSYKYQDPCNCGNEFFCVIRVLRAHIDFALRPERIPMAP  255

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC-NYPKLNGQVSPKHENVVKQTFG  1952
                +++L+YFS  FQR+QQ DAHEFLQ FL++LE CC +       VS +  N V Q FG
Sbjct  256   DYFLHHLNYFSPDFQRYQQEDAHEFLQAFLDKLERCCLDRTSYRSYVSSQETNFVDQVFG  315

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G LIS L+CCNC   SDT+E  V LSLEIED+D+L  AL+SFT+VE++++   + TC+ C
Sbjct  316   GRLISGLRCCNCNSISDTFEKSVGLSLEIEDIDTLESALESFTRVEKLDE---QLTCDNC  372

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               +VS EKQLLLD+ PLV TFHLKRFKN+G  +EKI KHV  P ELDL PY+   E+   
Sbjct  373   NEKVSKEKQLLLDKLPLVVTFHLKRFKNNGFFMEKIFKHVKIPLELDLQPYMRDKEENDV  432

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY+L+A+V H+G S++ GHY  +V ++P  W++FDD+KVTR+ E+ V+SQ++YILFY 
Sbjct  433   PTKYHLYALVEHLGYSVTYGHYSSYVRSAPKIWHQFDDAKVTRIDEDSVLSQDSYILFYA  492

Query  1411  KQGTPWFSEIIETQQ---LILDASISNSSPQPVLYS  1313
             ++GTPWFS I E  Q    +L+AS++NSSP+ VL S
Sbjct  493   REGTPWFSSIAEQMQPLLPLLEASLANSSPKSVLDS  528



>ref|XP_010439928.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like isoform 
X1 [Camelina sativa]
Length=698

 Score =   350 bits (897),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 174/336 (52%), Positives = 233/336 (69%), Gaps = 7/336 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQCF H VPLI+ + +  +  PC   NE FCV+  L+  ++ +L  +   + P
Sbjct  175   TCFLNSVLQCFTHTVPLIEGLRSYKYQDPCNCGNEFFCVISVLRAHIDCALRPERIPMAP  234

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC-NYPKLNGQVSPKHENVVKQTFG  1952
                +++L+YFS  FQR+QQ DAHEFLQ FL++LE CC +       VS +  N V Q FG
Sbjct  235   DYFLHHLNYFSPDFQRYQQEDAHEFLQAFLDKLERCCLDRTSYRSYVSSQDANFVDQVFG  294

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G LIS L+CCNC   SDT+E  V LSLEIED+D+L  AL SFT+VE++++   + TCE C
Sbjct  295   GRLISGLRCCNCNSISDTFEKSVGLSLEIEDMDTLESALQSFTRVEKLDE---QLTCENC  351

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               +VS EKQLLLD+ PLV TFHLKRFKN+G  +EKI KH   P ELDL PY+  NE+   
Sbjct  352   NEKVSKEKQLLLDKLPLVVTFHLKRFKNNGFYMEKIFKHFKIPLELDLQPYMRDNEENDV  411

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY+L+A+V H+G S++ GHY  +V ++P  W++FDD KVTR+ E+ V+SQ++YILFY 
Sbjct  412   PTKYHLYALVEHLGYSVTYGHYLSYVRSAPKIWHQFDDVKVTRIDEDSVLSQDSYILFYA  471

Query  1411  KQGTPWFSEIIETQQ---LILDASISNSSPQPVLYS  1313
             ++GTPWFS I E  Q    +L+AS+ NSSP+ VL S
Sbjct  472   REGTPWFSSIAEQMQPLLPLLEASLPNSSPKSVLDS  507



>ref|XP_010439929.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like isoform 
X2 [Camelina sativa]
Length=695

 Score =   350 bits (897),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 174/336 (52%), Positives = 233/336 (69%), Gaps = 7/336 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQCF H VPLI+ + +  +  PC   NE FCV+  L+  ++ +L  +   + P
Sbjct  175   TCFLNSVLQCFTHTVPLIEGLRSYKYQDPCNCGNEFFCVISVLRAHIDCALRPERIPMAP  234

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC-NYPKLNGQVSPKHENVVKQTFG  1952
                +++L+YFS  FQR+QQ DAHEFLQ FL++LE CC +       VS +  N V Q FG
Sbjct  235   DYFLHHLNYFSPDFQRYQQEDAHEFLQAFLDKLERCCLDRTSYRSYVSSQDANFVDQVFG  294

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G LIS L+CCNC   SDT+E  V LSLEIED+D+L  AL SFT+VE++++   + TCE C
Sbjct  295   GRLISGLRCCNCNSISDTFEKSVGLSLEIEDMDTLESALQSFTRVEKLDE---QLTCENC  351

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               +VS EKQLLLD+ PLV TFHLKRFKN+G  +EKI KH   P ELDL PY+  NE+   
Sbjct  352   NEKVSKEKQLLLDKLPLVVTFHLKRFKNNGFYMEKIFKHFKIPLELDLQPYMRDNEENDV  411

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY+L+A+V H+G S++ GHY  +V ++P  W++FDD KVTR+ E+ V+SQ++YILFY 
Sbjct  412   PTKYHLYALVEHLGYSVTYGHYLSYVRSAPKIWHQFDDVKVTRIDEDSVLSQDSYILFYA  471

Query  1411  KQGTPWFSEIIETQQ---LILDASISNSSPQPVLYS  1313
             ++GTPWFS I E  Q    +L+AS+ NSSP+ VL S
Sbjct  472   REGTPWFSSIAEQMQPLLPLLEASLPNSSPKSVLDS  507



>ref|XP_008796260.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Phoenix 
dactylifera]
Length=602

 Score =   347 bits (889),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 178/338 (53%), Positives = 235/338 (70%), Gaps = 6/338 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+VLQC  H VPLIQ + + DH S C   N  FC  CAL+E +N+S+   G+ I P
Sbjct  47    TCFLNAVLQCLTHTVPLIQKLRSVDHSSTCCGGNGDFCSFCALREHINLSIVKSGNVISP  106

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP-KHENVVKQTFG  1952
             ++I +N+S  SS FQ   QGDAHEFL   L+ L  CC  P L    S  + +++VKQ FG
Sbjct  107   RRIADNMSKISSCFQLGNQGDAHEFLHALLDSLHGCCLDPSLKDHPSSLEKDSLVKQVFG  166

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+L+CC+CGH SDT+EPL+DLSLEI DVD+L+ AL SFTKVE+++DPE KFTCE C
Sbjct  167   GRLRSQLRCCDCGHCSDTFEPLLDLSLEIGDVDTLTDALVSFTKVEKLDDPEAKFTCEGC  226

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K QV +EKQL LD+AP +    LKRFK+ G    KI K V +P ELDL P++   E    
Sbjct  227   KAQVLVEKQLKLDQAPEIVALQLKRFKSIGFFATKIEKFVEYPLELDLNPFLSCPEDGA-  285

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY+L+AV+VH G S  SGHYYCFV +SP+ W++ +DS+V RV E  V+ + A+ILFY+
Sbjct  286   QLKYDLYAVLVHDG-SPYSGHYYCFVRSSPTAWFQMNDSEVARVSETHVLKESAFILFYI  344

Query  1411  KQG-TPWFSEIIETQQLI-LDASISNSSPQPVLYSVDQ  1304
             KQG +PWFS ++E Q++  LD S +++SP  VL  VD+
Sbjct  345   KQGSSPWFSTLMEAQKVPDLDGS-NDASPVSVLDYVDR  381



>ref|XP_010434606.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like isoform 
X1 [Camelina sativa]
Length=718

 Score =   350 bits (898),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 173/336 (51%), Positives = 235/336 (70%), Gaps = 7/336 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF NSVLQCF H VPLI+ + +  +  PC   NE FCV+ AL+  ++ +L  +   + P
Sbjct  195   TCFFNSVLQCFTHTVPLIEGLRSYKYQDPCNCGNEFFCVIRALRTHIDFALRPERIPMAP  254

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC-NYPKLNGQVSPKHENVVKQTFG  1952
                +++L+YFS  FQR+QQ DAHEFLQ FL++LE CC +       VS +  N V Q FG
Sbjct  255   DYFLHHLNYFSPDFQRYQQEDAHEFLQAFLDKLERCCLDRTSYRSYVSSQDANFVDQVFG  314

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G LIS L+CCNC   SDT+E  V LSLEIED+D+L  AL+SFT+VE++++   + TC+ C
Sbjct  315   GRLISGLRCCNCNSISDTFEKSVGLSLEIEDMDTLESALESFTRVEKLDE---QLTCDNC  371

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               +VS EKQLLLD+ PLV TFHLKRFKN+G  +EKI KHV  P ELDL PY+   E+   
Sbjct  372   NEKVSKEKQLLLDKLPLVVTFHLKRFKNNGFYMEKIFKHVKIPLELDLQPYMRDKEENDV  431

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY+L+A+V H+G S++ GHY  +V ++P  W++FDD KVTR+ E+ V+SQ++YILFY 
Sbjct  432   PTKYHLYALVEHLGYSVTYGHYLSYVRSAPKIWHQFDDVKVTRIDEDSVLSQDSYILFYA  491

Query  1411  KQGTPWFSEIIETQQ---LILDASISNSSPQPVLYS  1313
             ++GTPWFS I E  Q    +L+AS++NSSP+ VL S
Sbjct  492   REGTPWFSSIAEQMQPLLPLLEASLANSSPKSVLDS  527



>ref|XP_010434607.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like isoform 
X2 [Camelina sativa]
Length=715

 Score =   350 bits (897),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 173/336 (51%), Positives = 235/336 (70%), Gaps = 7/336 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF NSVLQCF H VPLI+ + +  +  PC   NE FCV+ AL+  ++ +L  +   + P
Sbjct  195   TCFFNSVLQCFTHTVPLIEGLRSYKYQDPCNCGNEFFCVIRALRTHIDFALRPERIPMAP  254

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC-NYPKLNGQVSPKHENVVKQTFG  1952
                +++L+YFS  FQR+QQ DAHEFLQ FL++LE CC +       VS +  N V Q FG
Sbjct  255   DYFLHHLNYFSPDFQRYQQEDAHEFLQAFLDKLERCCLDRTSYRSYVSSQDANFVDQVFG  314

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G LIS L+CCNC   SDT+E  V LSLEIED+D+L  AL+SFT+VE++++   + TC+ C
Sbjct  315   GRLISGLRCCNCNSISDTFEKSVGLSLEIEDMDTLESALESFTRVEKLDE---QLTCDNC  371

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               +VS EKQLLLD+ PLV TFHLKRFKN+G  +EKI KHV  P ELDL PY+   E+   
Sbjct  372   NEKVSKEKQLLLDKLPLVVTFHLKRFKNNGFYMEKIFKHVKIPLELDLQPYMRDKEENDV  431

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY+L+A+V H+G S++ GHY  +V ++P  W++FDD KVTR+ E+ V+SQ++YILFY 
Sbjct  432   PTKYHLYALVEHLGYSVTYGHYLSYVRSAPKIWHQFDDVKVTRIDEDSVLSQDSYILFYA  491

Query  1411  KQGTPWFSEIIETQQ---LILDASISNSSPQPVLYS  1313
             ++GTPWFS I E  Q    +L+AS++NSSP+ VL S
Sbjct  492   REGTPWFSSIAEQMQPLLPLLEASLANSSPKSVLDS  527



>ref|XP_006838591.1| hypothetical protein AMTR_s00002p00220330 [Amborella trichopoda]
 gb|ERN01160.1| hypothetical protein AMTR_s00002p00220330 [Amborella trichopoda]
Length=833

 Score =   350 bits (899),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 171/368 (46%), Positives = 248/368 (67%), Gaps = 12/368 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N+V+QC  H  PL+ S++ C H  P E+  +GFC LC L+E ++  L+  G  + P
Sbjct  196   TCFMNAVMQCITHTAPLLLSLQTCSHVCPGES--DGFCALCYLREHVDWCLSRSGGCVHP  253

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
             + +V NL+   S+F+ FQQ DAHEFL CFL++L  C   P  N  +S + ++ V Q FGG
Sbjct  254   RYLVENLNKICSSFEVFQQEDAHEFLHCFLDKLHECVKPP--NASLSRQSDSFVTQIFGG  311

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
             H+ S+++C NCGH SDTYE  + LSLEI++ ++L  AL SFTKVE I+DPE KF C+ CK
Sbjct  312   HIRSRVRCHNCGHCSDTYESSLGLSLEIDEAETLYAALKSFTKVETIDDPEVKFGCDGCK  371

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              QVS+EKQL LD+AP VATFHLKRF+NDGS VEK+ K V +P ELDL P++  ++   ++
Sbjct  372   QQVSVEKQLALDQAPAVATFHLKRFQNDGSNVEKVCKFVEYPLELDLQPFICSSQSDTDD  431

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
               Y+L+AV+VH G S + GHY+CF+ +SP  W++ DD++V R     V++QEAYILFY +
Sbjct  432   FLYDLYAVLVHSGNSYNYGHYFCFICSSPDSWHRLDDTQVRRSNAKYVLNQEAYILFYKR  491

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNAADE  1229
             +G PWFS ++ETQ+   + + S+SSP+ VL           K+   RP + + + +  D 
Sbjct  492   RGVPWFSNLMETQRKCEEINHSSSSPKSVLEES--------KVSPPRPEECSSSGSDTDV  543

Query  1228  ASSNVDGP  1205
             A++++  P
Sbjct  544   ATTSISIP  551



>gb|AES95862.2| ubiquitin carboxyl-terminal hydrolase-like protein [Medicago 
truncatula]
Length=715

 Score =   346 bits (887),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 179/336 (53%), Positives = 224/336 (67%), Gaps = 16/336 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS++QCF H VPL++ +    H SP +  N GFCV+CA +  M  SL S G  I P
Sbjct  162   TCFLNSIMQCFTHTVPLVEGLLLSCH-SPNDGHN-GFCVICAFRYQMKQSLESTGRVISP  219

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESC-CNYPKLNGQVSPKHENVVKQTFG  1952
                V+NL  FSS F+R QQ DAHEF+QC L++LE+C  N+         + +N+ K+ FG
Sbjct  220   VVFVDNLKQFSSDFRRHQQEDAHEFMQCALDKLETCFSNF---------EEDNIAKKVFG  270

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CCNC   S T E L+DLSLEIE+VDS+S AL+SFT VE I+    K  CE C
Sbjct  271   GSLVSKLRCCNCSRSSITNEQLIDLSLEIENVDSISSALESFTMVENID---AKLKCEGC  327

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGS-LVEKIAKHVTFPPELDLLPYVERNEKVI  1595
               +VS+EKQL+LD+ P +A FHLKRFK  G+  VEKI KH+ FP ELDL PY   NE   
Sbjct  328   NEEVSVEKQLMLDQTPSIAAFHLKRFKTVGNNAVEKIDKHINFPLELDLQPYTILNESDN  387

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
                KY+L+AVVVH G S  SGHY+CFV  +P  W+K DDS VT+V E  V+SQEAYILFY
Sbjct  388   ASLKYDLYAVVVHNGTSSDSGHYFCFVRTAPDTWHKLDDSMVTKVSEGTVLSQEAYILFY  447

Query  1414  VKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVD  1307
              +QGTPWFS   E+    L+ S  N+SP+ VL   D
Sbjct  448   ARQGTPWFSSFAESTIPCLNLSRMNTSPKSVLDITD  483



>ref|XP_003612904.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=715

 Score =   345 bits (886),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 179/336 (53%), Positives = 224/336 (67%), Gaps = 16/336 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS++QCF H VPL++ +    H SP +  N GFCV+CA +  M  SL S G  I P
Sbjct  162   TCFLNSIMQCFTHTVPLVEGLLLSCH-SPNDGHN-GFCVICAFRYQMKQSLESTGRVISP  219

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESC-CNYPKLNGQVSPKHENVVKQTFG  1952
                V+NL  FSS F+R QQ DAHEF+QC L++LE+C  N+         + +N+ K+ FG
Sbjct  220   VVFVDNLKQFSSDFRRHQQEDAHEFMQCALDKLETCFSNF---------EEDNIAKKVFG  270

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CCNC   S T E L+DLSLEIE+VDS+S AL+SFT VE I+    K  CE C
Sbjct  271   GSLVSKLRCCNCSRSSITNEQLIDLSLEIENVDSISSALESFTMVENID---AKLKCEGC  327

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGS-LVEKIAKHVTFPPELDLLPYVERNEKVI  1595
               +VS+EKQL+LD+ P +A FHLKRFK  G+  VEKI KH+ FP ELDL PY   NE   
Sbjct  328   NEEVSVEKQLMLDQTPSIAAFHLKRFKTVGNNAVEKIDKHINFPLELDLQPYTILNESDN  387

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
                KY+L+AVVVH G S  SGHY+CFV  +P  W+K DDS VT+V E  V+SQEAYILFY
Sbjct  388   ASLKYDLYAVVVHNGTSSDSGHYFCFVRTAPDTWHKLDDSMVTKVSEGTVLSQEAYILFY  447

Query  1414  VKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVD  1307
              +QGTPWFS   E+    L+ S  N+SP+ VL   D
Sbjct  448   ARQGTPWFSSFAESTIPCLNLSRMNTSPKSVLDITD  483



>ref|XP_010495772.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like, partial 
[Camelina sativa]
Length=664

 Score =   338 bits (866),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 169/331 (51%), Positives = 224/331 (68%), Gaps = 4/331 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQCF H VPLI+S+ +  H +PC   N+ FCV+ AL++ + + L S G  +  
Sbjct  169   TCFIASVLQCFTHTVPLIESLRSYVHQTPCNCGNDKFCVMQALRDHIELVLRSSGFALSI  228

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLN-GQVSPKHENVVKQTFG  1952
                 NNL +FSS F    Q DAHEFLQ FL++LE CC  P+   G VS +  N+V   FG
Sbjct  229   DVFRNNLKHFSSDFMINHQEDAHEFLQSFLDKLERCCLDPRNKPGSVSSQDSNIVDNVFG  288

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+S L+C NC H S+T+EP +  SLEI+DVD+L  ALDSFT  E +ED   + TC+ C
Sbjct  289   GSLMSTLRCRNCYHVSNTFEPSLGWSLEIDDVDNLWKALDSFTCKELLED---QLTCDNC  345

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V+ EKQL  D+ P VATFHLKRFKNDG  +EKI +H+ FP ELDLLP++  N+    
Sbjct  346   KEKVTKEKQLKFDKLPPVATFHLKRFKNDGVTMEKIFEHIEFPLELDLLPFMSGNQNPEV  405

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY+L+A V HIGV  + GHY  +V ++P  W+ FDDSKVTR  E+ V+SQ+AYILFY 
Sbjct  406   STKYHLYAFVEHIGVRATFGHYSAYVRSAPETWHNFDDSKVTRFSEDRVLSQDAYILFYA  465

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             ++GTPWFS   E  + + +A+ SN SP+ VL
Sbjct  466   REGTPWFSSTFEQLKAVFEATPSNFSPKSVL  496



>gb|KEH27708.1| ubiquitin carboxyl-terminal hydrolase-like protein [Medicago 
truncatula]
Length=547

 Score =   334 bits (856),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 174/329 (53%), Positives = 218/329 (66%), Gaps = 16/329 (5%)
 Frame = -1

Query  2287  LQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRPKKIVNNL  2108
             +QCF H VPL++ +    H SP +  N GFCV+CA +  M  SL S G  I P   V+NL
Sbjct  1     MQCFTHTVPLVEGLLLSCH-SPNDGHN-GFCVICAFRYQMKQSLESTGRVISPVVFVDNL  58

Query  2107  SYFSSTFQRFQQGDAHEFLQCFLERLESC-CNYPKLNGQVSPKHENVVKQTFGGHLISKL  1931
               FSS F+R QQ DAHEF+QC L++LE+C  N+         + +N+ K+ FGG L+SKL
Sbjct  59    KQFSSDFRRHQQEDAHEFMQCALDKLETCFSNF---------EEDNIAKKVFGGSLVSKL  109

Query  1930  QCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCKVQVSIE  1751
             +CCNC   S T EPL+DLSLEIE+VDS+S AL+SFT VE I+    K  CE C  +VS+E
Sbjct  110   RCCNCSRSSITNEPLIDLSLEIENVDSISSALESFTMVENID---AKLKCEGCNEEVSVE  166

Query  1750  KQLLLDEAPLVATFHLKRFKNDGS-LVEKIAKHVTFPPELDLLPYVERNEKVIEESKYNL  1574
             KQL+LD+ P +A FHLKRFK  G+  VEKI KH+ FP ELDL PY   NE      KY+L
Sbjct  167   KQLMLDQTPSIAAFHLKRFKTVGNNAVEKIDKHINFPLELDLQPYTILNESDNASLKYDL  226

Query  1573  FAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVKQGTPW  1394
             +AVVVH G S  SGHY+CFV  +P  W+K DDS VT+V E  V+SQEAYILFY +QGTPW
Sbjct  227   YAVVVHNGTSSDSGHYFCFVRTAPDTWHKLDDSMVTKVSEGTVLSQEAYILFYARQGTPW  286

Query  1393  FSEIIETQQLILDASISNSSPQPVLYSVD  1307
             FS   E+    L+ S  N+SP+ VL   D
Sbjct  287   FSSFAESTIPCLNLSRMNTSPKSVLDITD  315



>ref|XP_010441553.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Camelina 
sativa]
Length=731

 Score =   338 bits (867),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 169/331 (51%), Positives = 224/331 (68%), Gaps = 4/331 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQCF H VPLI+S+ +  H +PC   N+ FCV+ AL++ + ++L S G  +  
Sbjct  169   TCFIASVLQCFTHTVPLIESLRSYVHQTPCNCGNDKFCVMQALRDHIELALRSSGYALSI  228

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLN-GQVSPKHENVVKQTFG  1952
                 NNL +FSS F    Q DAHEFLQ FL++LE CC  P+   G VS +  N+V   FG
Sbjct  229   DVFRNNLKHFSSDFMINHQEDAHEFLQSFLDKLERCCLDPRNKPGSVSSQDSNIVDNVFG  288

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+S L C NC H S+T+EP +  SLEI+ VD+L  ALDSFT VE +ED   + TC+ C
Sbjct  289   GSLMSTLCCRNCHHVSNTFEPSLGWSLEIDYVDNLWSALDSFTCVELLED---QLTCDNC  345

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V+ EKQL  D+ P VATFHLKRFKNDG  +EKI KH+ FP ELDLLP++  N+    
Sbjct  346   KEKVTKEKQLKFDKLPPVATFHLKRFKNDGVTMEKIFKHIEFPLELDLLPFMSGNQNPEV  405

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY+L+A V HIGV  + GHY  +V ++P  W+ FDDSKVTR  E+ V+SQ+AYILFY 
Sbjct  406   STKYHLYAFVEHIGVRATFGHYSAYVRSAPETWHNFDDSKVTRFSEDRVLSQDAYILFYA  465

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             ++GTPWF+   E  + + +A+ SN SP+ VL
Sbjct  466   REGTPWFASTFEQLKAVFEATPSNFSPKSVL  496



>ref|XP_002870079.1| hypothetical protein ARALYDRAFT_329738 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46338.1| hypothetical protein ARALYDRAFT_329738 [Arabidopsis lyrata subsp. 
lyrata]
Length=1082

 Score =   344 bits (883),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 170/333 (51%), Positives = 230/333 (69%), Gaps = 10/333 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSV QCF H VPLI+S+ A  +  PC   NE FCV+ AL+  +  +L  +   I P
Sbjct  569   TCFLNSVFQCFTHTVPLIESLRAYKYEVPCHCGNEFFCVIRALRYHIEAALRPERCPIAP  628

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESC-CNYPKLNGQVSPKHENVVKQTFG  1952
                +NNL+YFS  FQR+QQ DAHEFLQ FLE+LE C  +    +G +S +        F 
Sbjct  629   YYFLNNLNYFSPDFQRYQQEDAHEFLQAFLEKLERCGSDRRSFHGNISSQ------DVFA  682

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G LIS L+CCNC   S+T+E  V LSLEIED D+L  AL+SFT+VE++++   + TC+ C
Sbjct  683   GRLISGLRCCNCNSVSETFEKSVGLSLEIEDADTLGSALESFTRVEKLDE---QLTCDTC  739

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               +VS EKQ+LLD+ PLVATFHLKRFK +G  +EKI KHV  P E+DL PY+  +++   
Sbjct  740   NEKVSKEKQMLLDKLPLVATFHLKRFKTNGFFMEKIFKHVKIPLEIDLQPYMRNSQENEV  799

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY+L+A+V H+G S++ GHY  +V ++P  W+ FDDSKVTR+ E+ V+SQ++YILFY 
Sbjct  800   STKYHLYALVEHLGYSVAYGHYSSYVRSAPKIWHHFDDSKVTRIDEDRVLSQDSYILFYA  859

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYS  1313
             ++GTPWFS   E  Q +L+AS+ NSSP+ VL S
Sbjct  860   REGTPWFSSAYEELQPLLEASLLNSSPKSVLDS  892



>ref|XP_006282214.1| hypothetical protein CARUB_v10028485mg [Capsella rubella]
 gb|EOA15112.1| hypothetical protein CARUB_v10028485mg [Capsella rubella]
Length=724

 Score =   336 bits (861),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 167/330 (51%), Positives = 224/330 (68%), Gaps = 4/330 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQCF H VPLI+S+ +  H SPC   NE FCV+ AL++ + ++L S G  +  
Sbjct  167   TCFIASVLQCFTHTVPLIESLRSYMHQSPCNCGNEKFCVMQALRDHIELALRSSGHGLSI  226

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
                 +NL+YFSS F   QQ DAHEFLQ FL++LE CC  P+ N   S +  N+V   FGG
Sbjct  227   DGFRDNLNYFSSDFMINQQEDAHEFLQSFLDKLERCCLDPR-NKPDSSQDLNIVDNVFGG  285

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+S L C NC H S+T+EP +  SLEI++V++L  AL+SFT+VE +ED   + TC+ CK
Sbjct  286   RLMSTLCCRNCNHVSNTFEPSLGWSLEIDEVNNLWSALESFTRVESLED---QLTCDNCK  342

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              +V+ EKQL  D+ P VATFHLKRFKNDG  + KI +H+  P ELDLLP++  ++     
Sbjct  343   EKVTKEKQLKFDKLPPVATFHLKRFKNDGVTMNKIFEHIEVPLELDLLPFMSSDQNPEVS  402

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
             +KY L+A V HIGV  + GHY  +V ++P  W+ FDDSKVTR+ E  V+SQ+AYILFY +
Sbjct  403   TKYYLYAFVEHIGVRATFGHYSTYVRSAPDTWHNFDDSKVTRISEERVLSQDAYILFYAR  462

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             +GTPWFS   E  + + DA+ SN SP+ VL
Sbjct  463   EGTPWFSTTFEQLKTVYDATPSNCSPKSVL  492



>ref|XP_010481420.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Camelina 
sativa]
Length=732

 Score =   336 bits (862),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 168/331 (51%), Positives = 221/331 (67%), Gaps = 4/331 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQCF H VPLI+S+ +  H +PC   N+ FCVL AL++ + ++L S G     
Sbjct  170   TCFIASVLQCFTHTVPLIESLRSYVHQTPCNCGNDKFCVLQALRDHIELALRSSGYAFSI  229

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLN-GQVSPKHENVVKQTFG  1952
                 NNL +FSS F    Q DAHEFLQ FL++LE CC  P+   G +S +  N+V   FG
Sbjct  230   DGFRNNLKHFSSDFMINHQEDAHEFLQSFLDKLERCCLDPRNKPGSISSQDSNIVDNVFG  289

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+S L C NC H S+T+EP +  SLEI+DVD+L  AL SFT VE +ED   + TC+ C
Sbjct  290   GSLMSTLCCGNCDHVSNTFEPSLGWSLEIDDVDNLWSALKSFTCVELLED---QLTCDNC  346

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V+ EKQL  D+ P VATFHLKRFKNDG  +EKI KH+ FP ELDLLP++  N+    
Sbjct  347   KEKVTKEKQLKFDKLPPVATFHLKRFKNDGVTMEKIFKHIEFPLELDLLPFMSGNQNSEV  406

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY+L+A V HIG   + GHY  +V ++P  W+ FDDSKVTR  E+ V+SQ+AYILFY 
Sbjct  407   STKYHLYAFVEHIGSRATFGHYSAYVRSAPETWHNFDDSKVTRFGEDRVLSQDAYILFYA  466

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             ++GTPWFS   E  + + +A+  N SP+ VL
Sbjct  467   REGTPWFSSTFEQLKTVFEATPLNFSPKSVL  497



>ref|XP_002863392.1| ubiquitin-specific protease 21 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39651.1| ubiquitin-specific protease 21 [Arabidopsis lyrata subsp. lyrata]
Length=724

 Score =   335 bits (859),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 229/340 (67%), Gaps = 5/340 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQCF H VPLI+S+ +  + +PC   NE FCV+ AL++ + ++L S G  I  
Sbjct  150   TCFIASVLQCFTHTVPLIESLRSYMYQNPCNCGNEKFCVMQALRDHIELALRSSGHGINI  209

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLN-GQVSPKHENVVKQTFG  1952
              +  +NL++FSS F    Q DAHEFLQ FL++LE CC  PK   G +  +  N+V   FG
Sbjct  210   DRFRDNLTHFSSDFMINHQEDAHEFLQSFLDKLERCCLDPKNEPGSILSQDMNIVDNVFG  269

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+S L CCNC   S+T+EP +  SLEIEDVD+L  AL+SFT+VE++ED   + TC+ C
Sbjct  270   GGLMSTLCCCNCNSVSNTFEPSLGWSLEIEDVDNLWSALESFTRVEKLED---QLTCDNC  326

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V+ EKQL  D+ P VATFHLKRFKNDG  +EKI +HV FP ELDLLP++  N+    
Sbjct  327   KEKVTKEKQLKFDQLPPVATFHLKRFKNDGVTMEKIFEHVEFPLELDLLPFMSSNQNPEV  386

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY+L+A V HIG+  + GHY  +V ++P  W+ FDDSKVTR+ E+ V+S+ AYILFY 
Sbjct  387   STKYHLYAFVEHIGIGATFGHYSTYVRSAPETWHNFDDSKVTRISEDRVLSRPAYILFYA  446

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVL-YSVDQIFN  1295
             ++GT WFS   E  + + +A+  + SP  VL  S D + N
Sbjct  447   REGTRWFSSTFEQLKAVFEATPLHFSPNSVLENSYDSVGN  486



>ref|XP_009136881.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20 [Brassica 
rapa]
 ref|XP_009136882.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20 [Brassica 
rapa]
Length=629

 Score =   332 bits (850),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 229/330 (69%), Gaps = 4/330 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             +CF+NSVLQC  H +PLI+S+ + + P PC   NE FCV  A K  +  +L +  S+I P
Sbjct  123   SCFVNSVLQCLTHTLPLIESLCSYEPPEPCNCGNEWFCVRSAFKGHLEAALTTSRSSIAP  182

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
                +NNL+YFS+ F+R+QQ DAHEFLQ FL++LE CC     +  +S +  N+V++ FGG
Sbjct  183   YSFLNNLNYFSADFRRYQQEDAHEFLQAFLDKLERCCLEDPSSDSLSSQDVNLVQRIFGG  242

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+S+L+CC+C   S+T+E  + LSLEIEDVD+L  ALDSFT+VE++++P    TC+ CK
Sbjct  243   RLVSQLRCCDCNSVSETFENSLGLSLEIEDVDNLQSALDSFTRVEKLDEP---MTCDNCK  299

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              +VS EKQLLL + P V TFHLKRFKN+G  +EKI  HV FP E+DL PY+ R++     
Sbjct  300   EKVSKEKQLLLYKLPQVVTFHLKRFKNNGFFMEKIFNHVKFPLEIDLQPYMVRSQNNEVT  359

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
             +KY L+A V H G SL+ GHY  +V ++P  W++FDD +VTR+ E+ V+SQ+AYILFY +
Sbjct  360   AKYRLYAFVEHFG-SLAYGHYSSYVRSAPKIWHQFDDKQVTRIDEDRVLSQDAYILFYAR  418

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             +G P FS   +    +++AS+ N SP  VL
Sbjct  419   EGIPLFSTTFQEVHPLVEASLQNPSPNSVL  448



>ref|NP_567544.1| ubiquitin-specific protease 20 [Arabidopsis thaliana]
 sp|Q9FPS7.1|UBP20_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 20; AltName: 
Full=Deubiquitinating enzyme 20; Short=AtUBP20; AltName: 
Full=Ubiquitin thioesterase 20; AltName: Full=Ubiquitin-specific-processing 
protease 20 [Arabidopsis thaliana]
 gb|AAG42758.1|AF302668_1 ubiquitin-specific protease 20 [Arabidopsis thaliana]
 gb|AEE83963.1| ubiquitin-specific protease 20 [Arabidopsis thaliana]
Length=695

 Score =   333 bits (853),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 166/330 (50%), Positives = 230/330 (70%), Gaps = 8/330 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             +CFLNSV QCF H VPLI+S+ +  +  PC   NE FCV+ A++  +  +L  +   I P
Sbjct  184   SCFLNSVFQCFTHTVPLIESLLSFRYEVPCHCGNEFFCVIRAIRYHIEAALRPERCPIAP  243

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
                 +NL+YFS  FQR+QQ DAHEFLQ FLE+LE C +      + S + +   +  F G
Sbjct  244   YFFFDNLNYFSPDFQRYQQEDAHEFLQAFLEKLEICGS-----DRTSFRGDITSQDVFSG  298

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              LIS L+CCNC + S+TYE  V LSLEIEDVD+L  AL+SFT+VE++++   + TC+ C 
Sbjct  299   RLISGLRCCNCDYVSETYEKSVGLSLEIEDVDTLGSALESFTRVEKLDE---QLTCDNCN  355

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              +VS EKQLLLD+ PLVATFHLKRFKN+G  +EKI KHV  P E+DL PY+   ++    
Sbjct  356   EKVSKEKQLLLDKLPLVATFHLKRFKNNGLYMEKIYKHVKIPLEIDLQPYMRNIQENEVS  415

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
             +KY+L+A+V H G S++ GHY  +V ++P  W+ FDDSKVTR+ E++V+SQ++YILFY +
Sbjct  416   TKYHLYALVEHFGYSVAYGHYSSYVRSAPKIWHHFDDSKVTRIDEDMVLSQDSYILFYAR  475

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             +GT WFS + E  Q +++AS+ NSSP+ VL
Sbjct  476   EGTRWFSSVYEEMQPLVEASLLNSSPKSVL  505



>gb|KFK31437.1| hypothetical protein AALP_AA6G111700 [Arabis alpina]
Length=751

 Score =   334 bits (856),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 167/332 (50%), Positives = 222/332 (67%), Gaps = 6/332 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQC  H VPLI+S+ +   P+PC   N+ FCV+ AL+E + ++L + G  +  
Sbjct  176   TCFIASVLQCLTHCVPLIESLRSYQCPTPCNCGNDMFCVMQALREHIELALRNSGDDLTV  235

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC--NYPKLNGQVSPKHENVVKQTF  1955
                 +NL YFS  FQ   Q DAHEF+Q FL++LE CC     KL    S +  NVV   F
Sbjct  236   YGFRDNLKYFSPDFQINHQEDAHEFMQSFLDKLERCCLDRRNKLES-TSSQDVNVVDNVF  294

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L+S+L CCNC   SD +EP V  SLEIEDVD+L  AL+SFT+VE++ED   +FTC+ 
Sbjct  295   GGRLLSRLHCCNCNAFSDIFEPSVGCSLEIEDVDNLLSALESFTRVEKLED---QFTCDN  351

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +VS EKQL  D+ P+VATFHLKRFKN+G  +EKI K V FP ELDL PY+  N+   
Sbjct  352   CKEKVSKEKQLKFDKLPMVATFHLKRFKNNGVYMEKIFKQVQFPLELDLSPYMSGNQDPE  411

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
               +KY L+A V H+G  +S GHY  +V ++P  W+ FDDSKVT+++E  VM+Q AY+LFY
Sbjct  412   VSTKYRLYAFVEHLGNGVSFGHYSSYVRSAPETWHNFDDSKVTKIREECVMTQNAYLLFY  471

Query  1414  VKQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
              ++GTPWFS   E  + +  A+  N+SP+ VL
Sbjct  472   AREGTPWFSTAYEELKTLFAATPLNTSPKSVL  503



>gb|KFK31436.1| hypothetical protein AALP_AA6G111700 [Arabis alpina]
Length=745

 Score =   334 bits (856),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 167/332 (50%), Positives = 222/332 (67%), Gaps = 6/332 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQC  H VPLI+S+ +   P+PC   N+ FCV+ AL+E + ++L + G  +  
Sbjct  176   TCFIASVLQCLTHCVPLIESLRSYQCPTPCNCGNDMFCVMQALREHIELALRNSGDDLTV  235

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC--NYPKLNGQVSPKHENVVKQTF  1955
                 +NL YFS  FQ   Q DAHEF+Q FL++LE CC     KL    S +  NVV   F
Sbjct  236   YGFRDNLKYFSPDFQINHQEDAHEFMQSFLDKLERCCLDRRNKLES-TSSQDVNVVDNVF  294

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L+S+L CCNC   SD +EP V  SLEIEDVD+L  AL+SFT+VE++ED   +FTC+ 
Sbjct  295   GGRLLSRLHCCNCNAFSDIFEPSVGCSLEIEDVDNLLSALESFTRVEKLED---QFTCDN  351

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +VS EKQL  D+ P+VATFHLKRFKN+G  +EKI K V FP ELDL PY+  N+   
Sbjct  352   CKEKVSKEKQLKFDKLPMVATFHLKRFKNNGVYMEKIFKQVQFPLELDLSPYMSGNQDPE  411

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
               +KY L+A V H+G  +S GHY  +V ++P  W+ FDDSKVT+++E  VM+Q AY+LFY
Sbjct  412   VSTKYRLYAFVEHLGNGVSFGHYSSYVRSAPETWHNFDDSKVTKIREECVMTQNAYLLFY  471

Query  1414  VKQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
              ++GTPWFS   E  + +  A+  N+SP+ VL
Sbjct  472   AREGTPWFSTAYEELKTLFAATPLNTSPKSVL  503



>ref|XP_003612905.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=739

 Score =   333 bits (855),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 180/360 (50%), Positives = 225/360 (63%), Gaps = 40/360 (11%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS++QCF H VPL++ +    H SP +  N GFCV+CA +  M  SL S G  I P
Sbjct  162   TCFLNSIMQCFTHTVPLVEGLLLSCH-SPNDGHN-GFCVICAFRYQMKQSLESTGRVISP  219

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESC-CNYPKLNGQVSPKHENVVKQTFG  1952
                V+NL  FSS F+R QQ DAHEF+QC L++LE+C  N+         + +N+ K+ FG
Sbjct  220   VVFVDNLKQFSSDFRRHQQEDAHEFMQCALDKLETCFSNF---------EEDNIAKKVFG  270

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CCNC   S T E L+DLSLEIE+VDS+S AL+SFT VE I+    K  CE C
Sbjct  271   GSLVSKLRCCNCSRSSITNEQLIDLSLEIENVDSISSALESFTMVENID---AKLKCEGC  327

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGS-LVEKIAKHVTFPPELDLLPYVERNEKVI  1595
               +VS+EKQL+LD+ P +A FHLKRFK  G+  VEKI KH+ FP ELDL PY   NE   
Sbjct  328   NEEVSVEKQLMLDQTPSIAAFHLKRFKTVGNNAVEKIDKHINFPLELDLQPYTILNESDN  387

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDS--------------------  1475
                KY+L+AVVVH G S  SGHY+CFV  +P  W+K DDS                    
Sbjct  388   ASLKYDLYAVVVHNGTSSDSGHYFCFVRTAPDTWHKLDDSMVASAILVPLGRDLIVLQIT  447

Query  1474  ----KVTRVQENVVMSQEAYILFYVKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVD  1307
                 KVT+V E  V+SQEAYILFY +QGTPWFS   E+    L+ S  N+SP+ VL   D
Sbjct  448   CLMIKVTKVSEGTVLSQEAYILFYARQGTPWFSSFAESTIPCLNLSRMNTSPKSVLDITD  507



>ref|XP_004509729.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Cicer 
arietinum]
Length=633

 Score =   330 bits (845),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 219/323 (68%), Gaps = 14/323 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF++++LQCF H V L   +    H SPC     GFC +CA ++ +N SL    + + P
Sbjct  233   TCFMSAILQCFTHTVQLFLGLRYSTHNSPCNVV--GFCAICAFRQHINASLEPSRNPVLP  290

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
               +V NL+ FSS+F++ QQ DAHEF+QC L +L+ C  +P          +N+V Q FGG
Sbjct  291   TMLVENLNQFSSSFRKHQQEDAHEFMQCALNKLQRC--FPI-------GEDNLVDQIFGG  341

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+SKL+CC CGH SDT+EP++DLSLEIEDV ++  AL+SFT VE+++   +KFTC  C 
Sbjct  342   RLVSKLRCCCCGHTSDTFEPIIDLSLEIEDVSTIQCALESFTMVEKMD---SKFTCSSCN  398

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
               V++EKQL+LD+AP VA FHLKRFK DG+ V+K+  HV F  +LDL PY   N   I  
Sbjct  399   EVVTMEKQLMLDKAPSVAAFHLKRFKKDGNTVKKVDSHVYFTKDLDLQPYTSANGSDIVP  458

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
              KY+L+AVV H G S +SGHY+CFV +SP +W+  DDS V+ V E  V++ EAYILFY +
Sbjct  459   LKYDLYAVVEHRGSSPNSGHYFCFVRSSPDKWHLMDDSMVSSVFEEEVLTHEAYILFYAR  518

Query  1408  QGTPWFSEIIETQQLILDASISN  1340
             QGTPWFS ++E ++ + ++S  N
Sbjct  519   QGTPWFSSVVENEEKVPNSSSDN  541



>ref|XP_004165982.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Cucumis 
sativus]
Length=621

 Score =   327 bits (839),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 206/542 (38%), Positives = 295/542 (54%), Gaps = 48/542 (9%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEA----CNEGFCVLCA-----LKELMNISL  2156
             TCF+N++LQC  H  P ++ + + +H  PC +        F +        + E + I +
Sbjct  77    TCFINAILQCLTHTAPFVEGLRSANHDMPCNSKITVTTNTFSLFLGSNDSVVDEELRICI  136

Query  2155  ASKGSTIRPKKIVNNLSY-----------FSSTFQRFQQGDAHEFLQCFLERLESCCNYP  2009
               +      KK+  +LS            FSS F R+QQ DAHEF+QCFL++LE C    
Sbjct  137   -HRNFVFASKKLHLDLSKSEIKITTLALDFSSFFWRYQQEDAHEFMQCFLDKLERCM-VS  194

Query  2008  KLNGQVSPKHENVVKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDS  1829
             +   +VS + +++V + FGG LIS L CCNCGH S+T+EPLVDLSLEIE+VDSLS AL+S
Sbjct  195   EGKDRVSSEDDDLVNKVFGGRLISNLCCCNCGHCSETHEPLVDLSLEIENVDSLSSALES  254

Query  1828  FTKVERIEDPETKFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVT  1649
             FTKVERI DPETKF CE CK +V +EKQL L++ PLV TFHLKRFK D S VEKI KH+ 
Sbjct  255   FTKVERIGDPETKFKCENCKEEVWVEKQLKLEKIPLVTTFHLKRFKADSSFVEKIEKHLE  314

Query  1648  FPPELDLLPYVERNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKV  1469
             FP ELDL PY    +    E KY L+A+V H G S +SGHY+ FV +SP  W++ DDS V
Sbjct  315   FPLELDLKPYTLGGKDAEVELKYELYAIVEHTGFSSTSGHYFSFVRSSPDTWHRMDDSLV  374

Query  1468  TRVQENVVMSQEAYILFYVKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVD---QIF  1298
             T V E  V+S+EAYIL Y ++GT WFS +I+     L++  SN SP+ VL ++      F
Sbjct  375   TSVTEEYVLSREAYILLYKRKGTSWFSSLIQRSDPCLNSDSSNPSPKSVLQNIGTGCSSF  434

Query  1297  NPYPKMETDRPCDVNETDNAADEASSNVDGPKDNGIDRSDGKENSN---VVSALIHEGMN  1127
                 K+  +      +T   +    S     +D G+   +   ++N   V SA       
Sbjct  435   AAESKVNHESANAPADTLQPSPARFSCEMENQDTGVSDLENATSANLNIVESATTKSSPI  494

Query  1126  NSSDICSAEAEKT----PPPSVLKEKNCKQEFRISKRFADLTTETPSISPSLEIYREDTA  959
              + D+C  + +++     P S ++  +    FR         T  P     ++  + +  
Sbjct  495   VTKDLCLNDEDESIDGFHPLSPVRSPSPDNVFR---------TPEPQYRIPVDHLKTEKC  545

Query  958   DNAYSPPRALLRPADEVNHPEGEKLVKKKMPSTRGS----ALKGSHNESCMKKRRRRVEG  791
               + SP   L +  ++       + VKK MP +RGS    A+ GS +E     +++R+  
Sbjct  546   STSGSP---LNKGVEDSERKAAMRYVKKNMPGSRGSKMIAAILGSQSEGSSLNKKKRLRS  602

Query  790   SP  785
              P
Sbjct  603   LP  604



>ref|XP_006285397.1| hypothetical protein CARUB_v10006802mg, partial [Capsella rubella]
 gb|EOA18295.1| hypothetical protein CARUB_v10006802mg, partial [Capsella rubella]
Length=652

 Score =   328 bits (841),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 172/342 (50%), Positives = 237/342 (69%), Gaps = 10/342 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQCF H VPL++S+ +  +  PC   N  FCVL AL+  +  +L  + + + P
Sbjct  179   TCFLNSVLQCFTHTVPLLKSLRSYKYQVPCNCGNPFFCVLRALRTHIEFALRPERTPMAP  238

Query  2128  K---KIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQ-VSPKHENVVKQ  1961
             +     +N+ + FS  FQR+QQ DAHEFLQ FL++LE CC   +   Q VS +  N+V Q
Sbjct  239   ECFLHYLNSATDFSPGFQRYQQEDAHEFLQAFLDKLERCCLDQRSYRQYVSSQDVNIVDQ  298

Query  1960  TFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTC  1781
              FGG LIS L+CCNC   S+T+E  V LSLEIED+D+L  AL+SFT VE++++   + TC
Sbjct  299   VFGGRLISGLRCCNCNFVSETFEKSVGLSLEIEDMDTLEDALESFTCVEKLDE---QLTC  355

Query  1780  EKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEK  1601
             + C  +VS EKQLLLD+ PLV TFHLKRFKN+G  +EKI KH+  P ELDL PY+   ++
Sbjct  356   DNCNEKVSKEKQLLLDQLPLVVTFHLKRFKNNGLFMEKIVKHLKIPLELDLQPYMRNIQE  415

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                 + Y+L+AVV H+G +L+ GHY  +V ++P  W++FDD+KVTRV E+ V+SQ++YIL
Sbjct  416   KDAPTTYHLYAVVEHLGCTLAQGHYSSYVRSAPKIWHQFDDAKVTRVDEDSVLSQDSYIL  475

Query  1420  FYVKQGTPWFSEIIETQQ---LILDASISNSSPQPVLYSVDQ  1304
             FY ++GTPWFS I E  Q    +L+AS+ NSSP+ VL S ++
Sbjct  476   FYAQEGTPWFSSIAEDMQPLLPLLEASLLNSSPKSVLDSTNR  517



>ref|XP_004148760.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Cucumis 
sativus]
Length=676

 Score =   328 bits (841),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 206/542 (38%), Positives = 296/542 (55%), Gaps = 48/542 (9%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEA----CNEGFCVLCA-----LKELMNISL  2156
             TCF+N++LQC  H  P ++ + + +H  PC +        F +        + E + I +
Sbjct  132   TCFINAILQCLTHTAPFVEGLRSANHDMPCNSKITVTTNTFSLFLGSNDSVVDEELRICI  191

Query  2155  ASKGSTIRPKKIVNNLSY-----------FSSTFQRFQQGDAHEFLQCFLERLESCCNYP  2009
               +      KK+  +LS            FSS F R+QQ DAHEF+QCFL++LE C    
Sbjct  192   -HRNFVFASKKLHLDLSKSEIKITTLALDFSSFFWRYQQEDAHEFMQCFLDKLERCM-VS  249

Query  2008  KLNGQVSPKHENVVKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDS  1829
             +   +VS + +++V + FGG LIS L CCNCGH S+T+EPLVDLSLEIE+VDSLS AL+S
Sbjct  250   EGKDRVSSEDDDLVNKVFGGRLISNLCCCNCGHCSETHEPLVDLSLEIENVDSLSSALES  309

Query  1828  FTKVERIEDPETKFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVT  1649
             FTKVERI DPETKF CE CK +V +EKQL L++ PLV TFHLKRFK D S VEKI KH+ 
Sbjct  310   FTKVERIGDPETKFKCENCKEEVWVEKQLKLEKIPLVTTFHLKRFKADSSFVEKIEKHLE  369

Query  1648  FPPELDLLPYVERNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKV  1469
             FP ELDL PY    +    E KY L+A+V H G S +SGHY+ FV +SP  W++ DDS V
Sbjct  370   FPLELDLKPYTLGGKDAEVELKYELYAIVEHTGFSSTSGHYFSFVRSSPDTWHRMDDSLV  429

Query  1468  TRVQENVVMSQEAYILFYVKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVD---QIF  1298
             T V E  V+S+EAYIL Y ++GT WFS +I+     L++  SN SP+ VL ++      F
Sbjct  430   TSVTEEYVLSREAYILLYKRKGTSWFSSLIQRSDPCLNSDSSNPSPKSVLQNIGTGCSSF  489

Query  1297  NPYPKMETDRPCDVNETDNAADEASSNVDGPKDNGIDRSDGKENSN---VVSALIHEGMN  1127
                 K+  +      +T   +    S     +D G+   +   ++N   V SA +     
Sbjct  490   AAESKVNHESANAPADTLQPSPARFSCEMENQDTGVSDLENATSANLNIVESATMKSSPI  549

Query  1126  NSSDICSAEAEKT----PPPSVLKEKNCKQEFRISKRFADLTTETPSISPSLEIYREDTA  959
              + D+C  + +++     P S ++  +    FR         T  P     ++  + +  
Sbjct  550   VTKDLCLNDEDESIDGFHPLSPVRSPSPDNVFR---------TPEPQYRIPVDHLKTEKC  600

Query  958   DNAYSPPRALLRPADEVNHPEGEKLVKKKMPSTRGS----ALKGSHNESCMKKRRRRVEG  791
               + SP   L +  ++       + VKK MP +RGS    A+ GS +E     +++R+  
Sbjct  601   STSGSP---LNKGVEDSERKAAMRYVKKNMPGSRGSKMIAAILGSQSEGSSLNKKKRLRS  657

Query  790   SP  785
              P
Sbjct  658   LP  659



>ref|XP_010559301.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Tarenaya 
hassleriana]
 ref|XP_010559302.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Tarenaya 
hassleriana]
Length=697

 Score =   328 bits (841),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 168/332 (51%), Positives = 229/332 (69%), Gaps = 7/332 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N+VLQCF H VPLI+S+ +  +  PC   NE FC++  L++ + I+L S G  I P
Sbjct  197   TCFMNAVLQCFTHTVPLIESLYSWKYSRPCTCANE-FCLMQVLQDHIEIALRSSGDQISP  255

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNG--QVSPKHENVVKQTF  1955
              +  +NL+  SS FQR+ Q DAHEFLQ FL++LE CC  P LN    VS +  N+V+  F
Sbjct  256   VRFFDNLNQISSAFQRYYQEDAHEFLQSFLDKLERCCLDP-LNRFRYVSSQGVNIVQDVF  314

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L+S+L+CCNC   SDT+E  + LSL I+DVD L  AL+SFT+VE++E+     TC+ 
Sbjct  315   GGRLVSRLRCCNCNSFSDTFETSLCLSLGIDDVDDLPSALESFTRVEKLEN---LLTCDS  371

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +VS EKQL L + PLVATFHLKRFKNDG   EKI KHV  P ELDL PY+  +E+  
Sbjct  372   CKKKVSKEKQLALSKLPLVATFHLKRFKNDGFSTEKILKHVNIPLELDLWPYMSGSEENE  431

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
               + Y+L+A+V H+G SL+ GHY  +V ++   W+KFDDS+VTR++E  V+SQ+AYILFY
Sbjct  432   VSTTYHLYALVEHLGSSLTDGHYVSYVRSAHETWHKFDDSRVTRIEEGCVLSQDAYILFY  491

Query  1414  VKQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
              ++ T WFS + E  + +  A+I +SS + VL
Sbjct  492   ARERTLWFSSVFERIKPLCGANIPSSSRKSVL  523



>emb|CAA17132.1| putative protein [Arabidopsis thaliana]
 emb|CAB78791.1| putative protein [Arabidopsis thaliana]
Length=1082

 Score =   337 bits (863),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 167/332 (50%), Positives = 231/332 (70%), Gaps = 8/332 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             +CFLNSV QCF H VPLI+S+ +  +  PC   NE FCV+ A++  +  +L  +   I P
Sbjct  571   SCFLNSVFQCFTHTVPLIESLLSFRYEVPCHCGNEFFCVIRAIRYHIEAALRPERCPIAP  630

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
                 +NL+YFS  FQR+QQ DAHEFLQ FLE+LE C +      + S + +   +  F G
Sbjct  631   YFFFDNLNYFSPDFQRYQQEDAHEFLQAFLEKLEICGS-----DRTSFRGDITSQDVFSG  685

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              LIS L+CCNC + S+TYE  V LSLEIEDVD+L  AL+SFT+VE++++   + TC+ C 
Sbjct  686   RLISGLRCCNCDYVSETYEKSVGLSLEIEDVDTLGSALESFTRVEKLDE---QLTCDNCN  742

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
              +VS EKQLLLD+ PLVATFHLKRFKN+G  +EKI KHV  P E+DL PY+   ++    
Sbjct  743   EKVSKEKQLLLDKLPLVATFHLKRFKNNGLYMEKIYKHVKIPLEIDLQPYMRNIQENEVS  802

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
             +KY+L+A+V H G S++ GHY  +V ++P  W+ FDDSKVTR+ E++V+SQ++YILFY +
Sbjct  803   TKYHLYALVEHFGYSVAYGHYSSYVRSAPKIWHHFDDSKVTRIDEDMVLSQDSYILFYAR  862

Query  1408  QGTPWFSEIIETQQLILDASISNSSPQPVLYS  1313
             +GT WFS + E  Q +++AS+ NSSP+ VL S
Sbjct  863   EGTRWFSSVYEEMQPLVEASLLNSSPKSVLDS  894



>ref|NP_568667.1| ubiquitin-specific protease 21 [Arabidopsis thaliana]
 sp|Q9FIQ1.1|UBP21_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 21; AltName: 
Full=Deubiquitinating enzyme 21; Short=AtUBP21; AltName: 
Full=Ubiquitin thioesterase 21; AltName: Full=Ubiquitin-specific-processing 
protease 21 [Arabidopsis thaliana]
 dbj|BAB08918.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95420.1| ubiquitin-specific protease 21 [Arabidopsis thaliana]
Length=732

 Score =   328 bits (842),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 220/331 (66%), Gaps = 4/331 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQCF H VPLI S+ +  + +PC   NE FCV+ AL++ + ++L S G  I  
Sbjct  171   TCFIASVLQCFTHTVPLIDSLRSFMYGNPCNCGNEKFCVMQALRDHIELALRSSGYGINI  230

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLN-GQVSPKHENVVKQTFG  1952
              +  +NL+YFSS F    Q DAHEFLQ FL++LE CC  PK   G VS +  N+V   FG
Sbjct  231   DRFRDNLTYFSSDFMINHQEDAHEFLQSFLDKLERCCLDPKNQLGSVSSQDLNIVDNVFG  290

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+S L CCNC   S+T+EP +  SLEIEDV++L  AL+SFT VE++ED   + TC+ C
Sbjct  291   GGLMSTLCCCNCNSVSNTFEPSLGWSLEIEDVNTLWKALESFTCVEKLED---QLTCDNC  347

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V+ EKQL  D+ P VATFHLKRF NDG  +EKI  H+ FP ELDL P++  N     
Sbjct  348   KEKVTKEKQLRFDKLPPVATFHLKRFTNDGVTMEKIFDHIEFPLELDLSPFMSSNHDPEV  407

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              ++Y+L+A V HIG+  + GHY  +V ++P  W+ FDDSKVTR+ E  V+S+ AYILFY 
Sbjct  408   STRYHLYAFVEHIGIRATFGHYSSYVRSAPETWHNFDDSKVTRISEERVLSRPAYILFYA  467

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             ++GTPWFS   E  + + +A+  + SP  VL
Sbjct  468   REGTPWFSSTFEQLKTVFEATPLHFSPVSVL  498



>gb|AAG42759.1|AF302669_1 ubiquitin-specific protease 21 [Arabidopsis thaliana]
Length=737

 Score =   328 bits (841),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 220/331 (66%), Gaps = 4/331 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQCF H VPLI S+ +  + +PC   NE FCV+ AL++ + ++L S G  I  
Sbjct  171   TCFIASVLQCFTHTVPLIDSLRSFMYGNPCNCGNEKFCVMQALRDHIELALRSSGYGINI  230

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLN-GQVSPKHENVVKQTFG  1952
              +  +NL+YFSS F    Q DAHEFLQ FL++LE CC  PK   G VS +  N+V   FG
Sbjct  231   DRFRDNLTYFSSDFMINHQEDAHEFLQSFLDKLERCCLDPKNQLGSVSSQDLNIVDNVFG  290

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+S L CCNC   S+T+EP +  SLEIEDV++L  AL+SFT VE++ED   + TC+ C
Sbjct  291   GGLMSTLCCCNCNSVSNTFEPSLGWSLEIEDVNTLWKALESFTCVEKLED---QLTCDNC  347

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V+ EKQL  D+ P VATFHLKRF NDG  +EKI  H+ FP ELDL P++  N     
Sbjct  348   KEKVTKEKQLRFDKLPPVATFHLKRFTNDGVTMEKIFDHIEFPLELDLSPFMSSNHDPEV  407

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              ++Y+L+A V HIG+  + GHY  +V ++P  W+ FDDSKVTR+ E  V+S+ AYILFY 
Sbjct  408   STRYHLYAFVEHIGIRATFGHYSSYVRSAPETWHNFDDSKVTRISEERVLSRPAYILFYA  467

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             ++GTPWFS   E  + + +A+  + SP  VL
Sbjct  468   REGTPWFSSTFEQLKTVFEATPLHFSPVSVL  498



>emb|CDX87681.1| BnaC02g32680D [Brassica napus]
Length=630

 Score =   325 bits (832),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 164/336 (49%), Positives = 222/336 (66%), Gaps = 11/336 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQCF H VPL+ ++ +  +  PC   NE FCVL +L++ + ++L S G  ++ 
Sbjct  132   TCFIASVLQCFTHTVPLLDALRSYKYQDPCNCGNENFCVLKSLRDHIELALRSSGYDLQI  191

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC------NYPKLNGQVSPKHENVV  1967
              +  +NL+YFSS FQ   Q DAHEFLQ FL++LE C       N P     VS +  N+V
Sbjct  192   HRFRDNLNYFSSDFQINNQEDAHEFLQSFLDKLERCSLDLTSRNTP--GTVVSSQGVNIV  249

Query  1966  KQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKF  1787
                FGG L+SKL+CCNC   S+T+EP V  SLEI+DV+ L  AL+SFT VE++ED   + 
Sbjct  250   DNVFGGRLVSKLRCCNCNSISETFEPSVGWSLEIDDVEDLLSALESFTCVEKLED---QL  306

Query  1786  TCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERN  1607
             TC+ CK +VS EKQL  D+ PLVATFHLKRFKNDG  +EKI K V FP ELD+LPY+  N
Sbjct  307   TCDDCKEKVSKEKQLNFDKLPLVATFHLKRFKNDGVYMEKIFKDVKFPLELDMLPYMSSN  366

Query  1606  EKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAY  1427
             E     +KY L+A+V H G  +  GHY  +V ++P  W+ FDD+KV R+ E  V+S+ AY
Sbjct  367   ENPQVSTKYYLYAMVEHQGSGVHFGHYSSYVRSAPGTWHHFDDAKVRRISEECVLSKNAY  426

Query  1426  ILFYVKQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             +LFY ++GTPWFS   E  + + +A++ + SP  VL
Sbjct  427   MLFYAREGTPWFSSAFEELKTLYEATLISFSPTSVL  462



>ref|XP_010474480.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Camelina 
sativa]
Length=617

 Score =   322 bits (825),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 166/334 (50%), Positives = 227/334 (68%), Gaps = 6/334 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             +CF+ SVLQC  H VPL++S+ +    +PC   +E FCV+ AL++ + ++L S GS I  
Sbjct  53    SCFIASVLQCLTHTVPLLESLPSYKSQNPCNCGSETFCVMQALQDHIKLALKSSGSYITT  112

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLN--GQVSPKHENVVKQTF  1955
              +  +NL++FS  FQ   Q DA+EFLQ FL++LE C   P+ N  G VS +  N+V   F
Sbjct  113   NQFRDNLNHFSPDFQINNQEDAYEFLQSFLDKLERCL-IPRNNSPGSVSSQDVNIVDHVF  171

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L+S+L C NC   SDT E  +  SLEIEDVD+LS AL+SFT+VE++ED   + TC+ 
Sbjct  172   GGRLMSRLHCRNCNSFSDTLETSLGWSLEIEDVDNLSNALESFTRVEQLED---QLTCDN  228

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
              K +VS EKQ  LD+ PLVATFHLKRFKNDG +++KI+KHV FP ELDLLPY+  N+   
Sbjct  229   SKEKVSKEKQFQLDKLPLVATFHLKRFKNDGLMMKKISKHVEFPLELDLLPYMSGNQDSQ  288

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
               +KY+L+A+V H+G   S GHY  +V ++P  W+KFDD+KVTR+ E+  +S  AYILF+
Sbjct  289   VSTKYHLYAIVEHLGYRASFGHYSSYVRSAPETWHKFDDAKVTRISEDDALSTNAYILFF  348

Query  1414  VKQGTPWFSEIIETQQLILDASISNSSPQPVLYS  1313
             V++GTP FS   E  +   +AS   SSP+ VL S
Sbjct  349   VREGTPTFSSAFEVSKPWYEASPLYSSPRSVLES  382



>ref|XP_009400755.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Musa 
acuminata subsp. malaccensis]
Length=550

 Score =   320 bits (819),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 222/332 (67%), Gaps = 4/332 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+VLQC  H VPL+Q I   DH +     + GFC  CALK  +N  L      + P
Sbjct  37    TCFLNAVLQCLTHTVPLVQMIRKTDHSASHHGDDAGFCSFCALKAHINGCLFLSRLVVSP  96

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLES-CCNYPKLNGQVSPKHENVVKQTFG  1952
               +  NLS  S  F+  QQ DAHEFL  FL+ + + C      +   S + +++VKQ FG
Sbjct  97    TYLAQNLSKISPHFRLGQQEDAHEFLHSFLDNMHARCLGRTADDRPASLEEDSIVKQVFG  156

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+L+CC+CGH SDT+EPL+DLSLEI++V S+  AL+SFTK+ERI+DPE +FTC+ C
Sbjct  157   GRLRSQLRCCSCGHCSDTFEPLLDLSLEIDNVRSVGDALESFTKLERIDDPEVRFTCDGC  216

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K QVS+EKQL LD+AP V   HLKRFKNDGS   KI   V +P ELDL P +    K + 
Sbjct  217   KAQVSMEKQLKLDQAPQVLALHLKRFKNDGSYSNKIDDFVEYPLELDLNPCLSCPAKEV-  275

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             +SKY+L+AV+VH+G +L SGHY+C++ +SPS W++ DDS+V  V E+  + Q+AY+ FYV
Sbjct  276   QSKYDLYAVLVHVGSAL-SGHYFCYIRSSPSTWHQIDDSQVVSVSESDALEQQAYVFFYV  334

Query  1411  KQGTP-WFSEIIETQQLILDASISNSSPQPVL  1319
             ++G+  WFS  +E ++ +   + + +SP  VL
Sbjct  335   RRGSSCWFSNFMEEEKALDVQAATGTSPASVL  366



>ref|XP_006283229.1| hypothetical protein CARUB_v10004260mg [Capsella rubella]
 gb|EOA16127.1| hypothetical protein CARUB_v10004260mg [Capsella rubella]
Length=706

 Score =   322 bits (824),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 171/355 (48%), Positives = 239/355 (67%), Gaps = 8/355 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQCF H VPL++S+ +  +  PC   N  FCVL AL+  +  +L  + + I P
Sbjct  190   TCFLNSVLQCFTHTVPLVESLRSYKYQFPCNCGNPFFCVLRALRTHIEFALRPERTPIAP  249

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC-NYPKLNGQVSPKHENVVKQTFG  1952
             +  +  L+YFS  FQR+QQ DAHEFLQ FL++LE CC +       VS +  N+V+Q FG
Sbjct  250   ECFLYYLNYFSPDFQRYQQEDAHEFLQAFLDKLERCCLDRRSYRHFVSSQDVNIVEQVFG  309

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G LIS L+CCNC   S+T+E  V LSLEIE + SL  AL+SFT+VE++++   + TC+ C
Sbjct  310   GRLISGLRCCNCNFVSETFEKSVGLSLEIEGMKSLEDALESFTRVEKLDE---QLTCDNC  366

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               +VS EKQLLLD  PLV TFHLKRFKN+G  +EKI  H+  P ELDL PY+   ++   
Sbjct  367   NEKVSKEKQLLLDTLPLVVTFHLKRFKNNGYYMEKIFDHLKIPLELDLQPYMRNIQENDV  426

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY+L+A V H+G S++ GHY  +V ++P  W++FDD+KVTR++E+ V+SQ++YILFY 
Sbjct  427   PTKYHLYAFVEHLGSSVAHGHYSSYVRSAPKIWHQFDDAKVTRIEEDSVLSQDSYILFYA  486

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVLYSVD----QIFNPYPKMETDRPCD  1259
             ++G PWF  + E  Q +L++S+ NSSP+ VL S +       N     +T +PCD
Sbjct  487   QEGIPWFYSVAEEMQPLLESSLLNSSPKSVLESTNGECLSEINYENVDKTSKPCD  541



>gb|KFK28475.1| hypothetical protein AALP_AA7G001000 [Arabis alpina]
Length=905

 Score =   325 bits (833),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 167/333 (50%), Positives = 227/333 (68%), Gaps = 12/333 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACN--EGFCVLCALKELMNISLASKGSTI  2135
             +CF+NSVLQCF H VPLIQS+ A  +  PC   N    FCVL AL+  + ++L +   +I
Sbjct  315   SCFVNSVLQCFTHTVPLIQSLRAYKYQYPCNCYNMMNRFCVLWALQRHIKLALRTSRCSI  374

Query  2134  RPKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLN-GQVSPKHENVVKQT  1958
              P   ++N++YFS  F+R+QQ DAHEFLQ FL++LE CC   + + G  S +  N V++ 
Sbjct  375   SPSHFLDNINYFSPDFRRYQQEDAHEFLQAFLDKLERCCLERRSDRGDNSSQDGNFVQRI  434

Query  1957  FGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCE  1778
             FGG L+SKL+CC+CG  S+T+E  V LSLEIEDVD+L  AL+SFT VE++ED   + TC+
Sbjct  435   FGGRLVSKLRCCSCGSVSETFENSVGLSLEIEDVDNLYDALESFTSVEKLED---QMTCD  491

Query  1777  KCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKV  1598
             KC+ +VS EKQLLL+  P V TFHLKRFKN+G  +EKI+KHV FP ELDL      +E  
Sbjct  492   KCEEKVSKEKQLLLENLPPVVTFHLKRFKNNGYFMEKISKHVRFPLELDL-----ESENS  546

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
                +KY L+A V H+G SL+ GHY  +V + P  W+KFDD +VT V E  V+S+++YILF
Sbjct  547   EVATKYRLYAFVEHLG-SLAYGHYISYVRSEPKLWHKFDDKQVTMVNEEDVLSRDSYILF  605

Query  1417  YVKQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             Y ++  PWF    +  Q +L AS++N SP+ VL
Sbjct  606   YAREDIPWFFNAFDEMQPLLGASLNNFSPKSVL  638



>ref|XP_009397150.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Musa 
acuminata subsp. malaccensis]
Length=471

 Score =   313 bits (801),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 166/332 (50%), Positives = 216/332 (65%), Gaps = 7/332 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+VLQC  H VPL+Q I   DHP  C     GFC  CALK  +N SL   G  I P
Sbjct  57    TCFLNAVLQCLTHTVPLVQKIRRMDHPCSCCGDIGGFCSFCALKGHINRSLFLSGYVISP  116

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC-NYPKLNGQVSPKHENVVKQTFG  1952
                  NL+  S  FQ  QQ DAHEFL   L+ L +CC  +   +   S   +++VK  FG
Sbjct  117   TDFAKNLNKISPHFQLGQQEDAHEFLHSLLDNLHTCCLGHCTTDQPSSLDEDSLVKHVFG  176

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+L+CCNCGH SDT+EPL+DLSLEI+DVD++  AL SFT+ E+I+DP+  FTCE C
Sbjct  177   GRLRSQLRCCNCGHCSDTFEPLLDLSLEIDDVDNIVDALASFTRSEKIDDPDINFTCEGC  236

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K QVS+EKQL LD  P V T HLKRFKN+G    K+   V +P ELDL P +      + 
Sbjct  237   KAQVSLEKQLKLDHTPQVLTLHLKRFKNNGVFAYKLRNPVEYPLELDLTPCLSCPVDEV-  295

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              SKY+L+AV++HIG SL  GHY+C + +SPS W+  +DSKV RV E  V++Q+AY+LFYV
Sbjct  296   HSKYDLYAVLLHIG-SLEFGHYFCCIRSSPSTWHCINDSKVFRVSETDVLAQDAYLLFYV  354

Query  1411  KQ-GTPWFSEIIETQQLILDASISNSSPQPVL  1319
             KQ  + WFS +++  + ++    ++SSP  VL
Sbjct  355   KQRSSCWFSNLMDEIKTLM---ATDSSPSSVL  383



>emb|CDY37145.1| BnaA02g24640D [Brassica napus]
Length=666

 Score =   316 bits (809),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 162/336 (48%), Positives = 220/336 (65%), Gaps = 11/336 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQCF H VPL+ ++ +  +   C   NE FCVL +L++ + ++L S G  ++ 
Sbjct  116   TCFIASVLQCFTHTVPLLDALRSYKYQDHCNCGNESFCVLKSLRDHIELALRSSGYDLQI  175

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC------NYPKLNGQVSPKHENVV  1967
              +  +NL+YFSS FQ   Q DAHEFLQ FL++LE C       N P     VS +  N+V
Sbjct  176   HQFRDNLNYFSSDFQINNQEDAHEFLQSFLDKLERCSLDLTSRNTP--GTVVSSQGVNIV  233

Query  1966  KQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKF  1787
                FGG L+SKL+CCNC   S+T+EP V  SLEI+DV+ LS AL+SFT VE++ED   + 
Sbjct  234   DNVFGGRLVSKLRCCNCNSISETFEPSVGWSLEIDDVEDLSSALESFTCVEKLED---QL  290

Query  1786  TCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERN  1607
             TC++CK +V  EKQL  D+ PLVATFHLKRFKNDG  +EKI K V FP ELD+LPY+  N
Sbjct  291   TCDECKEKVLKEKQLKFDKLPLVATFHLKRFKNDGVYMEKIFKDVKFPLELDMLPYMSSN  350

Query  1606  EKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAY  1427
             E     +KY L+A+V H G  +  GHY  +V ++P  W+ FDD+KV R+ E  V+S+ AY
Sbjct  351   ENPQVSTKYYLYAMVEHQGSGVHFGHYSSYVRSAPGTWHHFDDAKVRRISEECVLSKNAY  410

Query  1426  ILFYVKQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             +LFY ++GT WFS   E  + + +A+  + SP  VL
Sbjct  411   MLFYAREGTSWFSSAFEELKTLYEATPISFSPTSVL  446



>ref|XP_009101495.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21 [Brassica 
rapa]
Length=729

 Score =   318 bits (814),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 218/333 (65%), Gaps = 6/333 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQC  H VPL+ S+ +  +  PC   NE FCVL  L+  +  +L S G  I  
Sbjct  170   TCFIASVLQCLTHTVPLLHSLRSYKYHCPCNCGNESFCVLRTLRYHIEHALRSSGCDIMI  229

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC---NYPKLNGQVSPKHENVVKQT  1958
              +  +NL+YFSS FQ   Q DAHEFLQ FL++LE CC   ++      VS +  N+V   
Sbjct  230   DRFRDNLNYFSSDFQINHQEDAHEFLQSFLDKLEKCCLDRSHRDNPPSVSSQDVNIVDHV  289

Query  1957  FGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCE  1778
             FGG L+SKL+CCNC   S+T+E     SLEIEDV+ LS AL+SFT VE++ED   +FTC+
Sbjct  290   FGGRLVSKLRCCNCNSVSETFETSPGWSLEIEDVEDLSSALESFTCVEKLED---QFTCD  346

Query  1777  KCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKV  1598
              CK +VS EKQL  D+ PLVATFHLKRFKN+G  ++KI K+V FP ELDLLPY+  NE  
Sbjct  347   DCKEKVSKEKQLKFDKLPLVATFHLKRFKNNGVYMQKINKNVKFPLELDLLPYMSSNENP  406

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
                +KY+L+A++ H+G     GHY  +V ++P  W+ FDD KV R+ E  V+S+ AY+LF
Sbjct  407   EVSTKYHLYAMMEHLGSGTYFGHYSAYVRSAPETWHHFDDEKVRRISEECVLSKSAYMLF  466

Query  1417  YVKQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             Y ++GTP F+   E  + + DA+  N SP+ VL
Sbjct  467   YAREGTPCFASAFEELKTLFDATPMNFSPKSVL  499



>ref|XP_009128893.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Brassica 
rapa]
Length=665

 Score =   315 bits (808),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 162/336 (48%), Positives = 218/336 (65%), Gaps = 11/336 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQCF H VPL+ ++    +   C   NE FCVL +L++ + ++L S G  ++ 
Sbjct  116   TCFIASVLQCFTHTVPLLDALRYYKYQDTCNCGNESFCVLKSLRDHIELALRSSGYDLQI  175

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC------NYPKLNGQVSPKHENVV  1967
              +  +NL+YFSS FQ   Q DAHEFLQ FL++LE C       N P     VS +  N+V
Sbjct  176   HRFRDNLNYFSSDFQINNQEDAHEFLQSFLDKLERCSLDLTSRNTP--GTVVSSQGVNIV  233

Query  1966  KQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKF  1787
                FGG L+SKL CCNC   S+ +EP V  SLEI+DV+ LS AL+SFT VE++ED   + 
Sbjct  234   DNVFGGRLVSKLHCCNCNSISEIFEPSVGWSLEIDDVEDLSSALESFTCVEKLED---QL  290

Query  1786  TCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERN  1607
             TC++CK +VS EKQL  D+ PLVATFHLKRFKNDG  +EKI K V FP ELD+LPY+  N
Sbjct  291   TCDECKEKVSKEKQLKFDKLPLVATFHLKRFKNDGVYMEKIFKDVRFPLELDMLPYMSSN  350

Query  1606  EKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAY  1427
             E     +KY L+A+V H G  +  GHY  +V ++P  W+ FDD+KV R+ E  V+S+ AY
Sbjct  351   ENPEVSTKYYLYAMVEHQGSGVHYGHYSSYVRSAPGTWHHFDDAKVRRISEECVLSKNAY  410

Query  1426  ILFYVKQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             +LFY ++GT WFS   E  + + +A+  + SP  VL
Sbjct  411   MLFYAREGTSWFSSAFEELKTLYEATPISFSPTSVL  446



>ref|XP_008678969.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like isoform 
X1 [Zea mays]
 gb|AFW63451.1| putative ubiquitin carboxyl-terminal hydrolase superfamily protein 
[Zea mays]
Length=591

 Score =   311 bits (797),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 207/336 (62%), Gaps = 4/336 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+ LQC  H VPL   + + DH +PC    +GFC  CALKE ++ S+   GS I P
Sbjct  52    TCFLNATLQCITHTVPLFLKLRSTDHSTPCSYNKDGFCSFCALKEHVDESIQRSGSVIAP  111

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP-KHENVVKQTFG  1952
              K  +NL   SS F   QQ DAHEFL+C L+ L  C   P   G+ S    E++V + FG
Sbjct  112   AKFRDNLRKLSSDFWPGQQEDAHEFLRCLLDNLHKCTLDPMSKGKGSSFDEESIVNEIFG  171

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S L CC CGH S+T+EP +DLSLEI+ VD L  AL SFTKVE+I D E K TCE C
Sbjct  172   GQLKSHLSCCECGHSSETFEPFLDLSLEIDQVDHLVDALQSFTKVEQIGDSENKLTCESC  231

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               QVS  KQL L  AP V  FHLKRF    + VEKI KHV +P E+DL P+   N   + 
Sbjct  232   NAQVSKNKQLTLHRAPDVIAFHLKRFTTLDNSVEKIDKHVVYPLEVDLKPF-HSNPDTVG  290

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY+L+ VV H G+  + GHY C + +SPS WY  +DSKV    ++  ++QEAYILFYV
Sbjct  291   GLKYDLYGVVEHSGLP-NYGHYTCTIRSSPSTWYFMNDSKVDSCTDSSALNQEAYILFYV  349

Query  1411  KQGT-PWFSEIIETQQLILDASISNSSPQPVLYSVD  1307
             +QG  PWFS ++E +  +   +   SSP  VL ++D
Sbjct  350   RQGKFPWFSSLLEGKDALQAENTCGSSPVSVLENID  385



>ref|XP_006414176.1| hypothetical protein EUTSA_v10024586mg [Eutrema salsugineum]
 gb|ESQ55629.1| hypothetical protein EUTSA_v10024586mg [Eutrema salsugineum]
Length=683

 Score =   314 bits (804),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 180/401 (45%), Positives = 247/401 (62%), Gaps = 25/401 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             +CF+NSVLQC  H VPLI+S+       PC  C   FCV   L+  +  +L +   +I P
Sbjct  193   SCFVNSVLQCLTHTVPLIESLCLSKSQDPCN-CGNVFCVRKTLRGHIIGALTTSEYSISP  251

Query  2128  KKIVNNL-------SYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLN-GQVSPKHEN  1973
                +NNL       + FS  F+R+QQ DAHEFLQ FL++L+ CC  P+ + G  S +  N
Sbjct  252   LLFLNNLCCILHTTTDFSPDFRRYQQEDAHEFLQAFLDKLDRCCFDPRSDRGDASSQDAN  311

Query  1972  VVKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPET  1793
             +V+  FGG L+S L+CC+C   S+T+E  + LSLEIEDVD LS AL+SFT+VE++E+   
Sbjct  312   IVQHVFGGRLVSGLRCCSCNSVSETFEESLGLSLEIEDVDDLSSALNSFTRVEKLEE---  368

Query  1792  KFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVE  1613
             + TC+ C  QVS EKQLLLD+ PLVATFHLKRFKN+G  +EKI   V  P E+DL PY+ 
Sbjct  369   QLTCDNCNEQVSKEKQLLLDKLPLVATFHLKRFKNNGYFMEKIFNDVRVPLEIDLQPYMS  428

Query  1612  RNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQE  1433
              N++    +KY L+A+V H G SL  GHY  +V ++P+ W++FDD +VTR++E+ V++ +
Sbjct  429   SNQENEVATKYYLYALVKHYG-SLVYGHYVSYVRSAPTIWHRFDDKQVTRIEEDSVLADD  487

Query  1432  AYILFYVKQGTPWFSEIIETQQLILDASISNSSPQPVL-------YSVDQIFNPYPKMET  1274
             +YILFY ++GTP FS   E  Q +L+AS+  SSP+ VL        S     N Y   + 
Sbjct  488   SYILFYAREGTPCFSTAYEEVQPLLEASLQYSSPKSVLDPTNGECLSEISYENVYQSKKQ  547

Query  1273  DRPCDVN--ETDNAADE---ASSNVDGPKDNGIDRSDGKEN  1166
             D   D N     N ADE    SS  D P +  +D SD   N
Sbjct  548   DVKTDENPVSVSNEADEDVYLSSGEDFPMEELLDMSDDSYN  588



>emb|CDY58499.1| BnaA06g40310D [Brassica napus]
Length=721

 Score =   313 bits (803),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 164/334 (49%), Positives = 214/334 (64%), Gaps = 14/334 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQC  H VPL+ S+ +  +  PC   NE FCVL  L+  +  +L S G  I  
Sbjct  174   TCFIASVLQCLTHTVPLLHSLRSYKYHCPCNCGNESFCVLRTLRYHIEHALRSSGCDIMI  233

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC-------NYPKLNGQVSPKHENV  1970
              +  +NL+YFSS FQ   Q DAHEFLQ FL++LE CC       N P     VS +  N+
Sbjct  234   DRFRDNLNYFSSDFQINHQEDAHEFLQSFLDKLEKCCLDRSRRDNPP----SVSSQDVNI  289

Query  1969  VKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETK  1790
             V   FGG L+SKL+CCNC   S+T+E     SLEIEDV+ LS AL+SFT VE +ED   +
Sbjct  290   VDNIFGGRLVSKLRCCNCNSVSETFETSPGWSLEIEDVEDLSSALESFTCVENLED---Q  346

Query  1789  FTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVER  1610
             FTC+ CK +VS EKQL  D+ PLVATFHLKRFKN+G  ++KI K V FP ELDLLPY+  
Sbjct  347   FTCDDCKEKVSKEKQLKFDKLPLVATFHLKRFKNNGVYMQKINKDVKFPLELDLLPYMSS  406

Query  1609  NEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEA  1430
             NE     +KY+L+A+V H+G     GHY  +V ++P  W+ FDD KV R+ E  V+S+ A
Sbjct  407   NENPEVSTKYHLYAMVEHLGSGTYFGHYSAYVRSAPETWHHFDDEKVRRISEECVLSKSA  466

Query  1429  YILFYVKQGTPWFSEIIETQQLILDASISNSSPQ  1328
             Y+LFY ++GTP F+   E  + + DA+  N SP+
Sbjct  467   YMLFYAREGTPCFASAFEELKTLFDATPMNFSPK  500



>ref|XP_004953520.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Setaria 
italica]
Length=746

 Score =   314 bits (804),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 171/362 (47%), Positives = 224/362 (62%), Gaps = 4/362 (1%)
 Frame = -1

Query  2386  DNIFANSFFWDDKSllvggglanlgNTCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACN  2207
             D  F  SF +  +   VG GL+N+GNTCFLN+ LQC  H VPL   + + DH +PC    
Sbjct  184   DKQFPLSFSYRRQPQSVGAGLSNMGNTCFLNATLQCITHTVPLFLKLRSTDHSTPCSYDK  243

Query  2206  EGFCVLCALKELMNISLASKGSTIRPKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLE  2027
             +GFC  CALKE ++ S+   GS I P K  +NL   SS F+  QQ DAHEFL+C L+ L 
Sbjct  244   DGFCSFCALKEHVDESIRRSGSVIMPAKFRDNLRKLSSDFRPGQQEDAHEFLRCLLDNLH  303

Query  2026  SCCNYPKLNGQVSP-KHENVVKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDS  1850
              C   P   G+ S    E++VK  FGG L S+L CC CGH S+T+EP +DLSLEI+ VD 
Sbjct  304   KCTLDPMSKGKGSSFDEESIVKDIFGGQLKSQLSCCECGHSSETFEPFLDLSLEIDQVDH  363

Query  1849  LSLALDSFTKVERIEDPETKFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVE  1670
             L  A++SFTKVE+I D E K TCE+C  QV   KQL L  AP V  FHLKRF    + VE
Sbjct  364   LVDAMESFTKVEQIGDSEDKLTCERCNAQVCKNKQLTLHRAPDVIAFHLKRFTTLDNSVE  423

Query  1669  KIAKHVTFPPELDLLPYVERNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWY  1490
             KI KHV +P E+DL P+   N   + E KY+L+ VV H G+  + GHY C + +SPS WY
Sbjct  424   KIDKHVVYPSEVDLKPF-HSNPDTVGELKYDLYGVVEHSGLP-NYGHYVCSIRSSPSTWY  481

Query  1489  KFDDSKVTRVQENVVMSQEAYILFYVKQGT-PWFSEIIETQQLILDASISNSSPQPVLYS  1313
               +DS V  + +   +++EAYILFYV+QG  PWFS ++E +  +       +SP  VL +
Sbjct  482   LMNDSHVDSITDASALNKEAYILFYVRQGKFPWFSSLLEVKDALHAEDARGASPVSVLEN  541

Query  1312  VD  1307
             +D
Sbjct  542   ID  543



>emb|CDX77686.1| BnaC07g19400D [Brassica napus]
Length=755

 Score =   310 bits (795),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 162/334 (49%), Positives = 214/334 (64%), Gaps = 14/334 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+ SVLQC  H VPL+ S+ +  +  PC   NE FCVL +L+  +  +L S G  I  
Sbjct  204   TCFIASVLQCLTHTVPLLASLRSYKYHCPCNCGNESFCVLRSLRYHIEHALRSSGFDIMI  263

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC-------NYPKLNGQVSPKHENV  1970
              +  +NL YFSS FQ   Q DAHEFLQ FL++LE CC       N P     VS +  N+
Sbjct  264   DRFRDNLYYFSSDFQINHQEDAHEFLQSFLDKLEKCCLDRSRRDNPP----SVSSQDVNI  319

Query  1969  VKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETK  1790
             V   FGG L+SKL+CCNC   S+T+E     SLEIED + LS AL+SFT VE++ED   +
Sbjct  320   VDHVFGGRLVSKLRCCNCNSVSETFETSPGWSLEIEDAEDLSSALESFTCVEKLED---Q  376

Query  1789  FTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVER  1610
             FTC+ CK +VS EKQL  D+ PLVATFHLKRFKN+G  ++KI K V FP ELDLLPY+  
Sbjct  377   FTCDDCKEKVSKEKQLKFDQLPLVATFHLKRFKNNGVYMQKINKDVKFPLELDLLPYMSS  436

Query  1609  NEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEA  1430
             NE     +KY+L+A+V H+G     GHY  +V ++P  W+ FDD KV R+ E  V+S+ A
Sbjct  437   NENPEVSTKYHLYAMVEHLGSGTYFGHYSAYVRSAPETWHHFDDEKVRRISEEWVLSKSA  496

Query  1429  YILFYVKQGTPWFSEIIETQQLILDASISNSSPQ  1328
             Y+LFY ++GTP F+   E  + + +A+  N SP+
Sbjct  497   YMLFYAREGTPCFASAFEELKTLFEATPINFSPK  530



>ref|XP_006359794.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Solanum 
tuberosum]
Length=464

 Score =   302 bits (773),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 165/367 (45%), Positives = 225/367 (61%), Gaps = 55/367 (15%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASK----GS  2141
             TCFLN+V+QCFMH V L+Q + + DH SPC+    GFCV+C +++++++S++ K      
Sbjct  135   TCFLNAVMQCFMHNVVLLQLLASFDHVSPCDTHLTGFCVVCMIRQIVDLSMSEKLIKDNC  194

Query  2140  TIRPKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQ  1961
              I      +++ YFS TF+  QQ DAHEFLQCFL +LE CC        + P+ +N+VK+
Sbjct  195   KINDTFFYSSIDYFSPTFRLNQQEDAHEFLQCFLNKLEICC------YNLEPR-DNIVKE  247

Query  1960  TFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTC  1781
              FGG L+S L+C NC H S TYEPL+DLSLEI DVDS                       
Sbjct  248   AFGGRLVSMLRCFNCCHLSITYEPLIDLSLEIVDVDS-----------------------  284

Query  1780  EKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEK  1601
               CK Q   EKQLL+D AP VAT  LKRF NDG +V+K+ KHV+FP ELD+L Y  +   
Sbjct  285   --CKTQGPFEKQLLIDRAPSVATLCLKRFNNDGFVVQKVDKHVSFPLELDMLHYTNKINN  342

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
               EE KY+L+AV+VH+G S+SSGHYY F+  +P+EWYKF+D  V  V E+ V++++AYIL
Sbjct  343   --EEMKYDLYAVIVHLGFSISSGHYYSFIRCNPNEWYKFNDEHVHWVHEDHVLAEQAYIL  400

Query  1420  FYVKQGTPWFSEIIETQQLILDASI-SNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETD  1244
             FY K+GT WFS+  +  Q  ++  I S SS  P                 +   DV E++
Sbjct  401   FYAKRGTLWFSDYRQIHQPFVNLVIPSTSSCIP----------------NNHASDVGESN  444

Query  1243  NAADEAS  1223
             +AAD+ S
Sbjct  445   HAADDTS  451



>ref|XP_010235841.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21 isoform X2 
[Brachypodium distachyon]
Length=733

 Score =   309 bits (792),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 210/336 (63%), Gaps = 6/336 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+ LQC  H VPL + + + DHP+PC    +GFC  CALKE +  S+   GS + P
Sbjct  213   TCFLNATLQCITHTVPLFKKLRSTDHPTPCSYDEDGFCSFCALKEHIEESIRRSGSVLMP  272

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP-KHENVVKQTFG  1952
              +  +NL   SS F+  QQ DAHEFL+C L+ L  C   PK  G+ S    E++VK+ FG
Sbjct  273   ARFKDNLRKLSSDFRPGQQEDAHEFLRCLLDNLHKCTLDPKSKGKPSSFDEESIVKRVFG  332

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+L C  CGH S+T EP +DLSLEI+ VD L  AL+SFTKVE I D E K TCE C
Sbjct  333   GQLKSQLTCRECGHCSETSEPFLDLSLEIDQVDDLVAALESFTKVEEIGDAENKLTCESC  392

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
              VQV   K+LLLD+ P V  F LKRF      +EKI KHV +P ELDL P+   N    E
Sbjct  393   NVQVCKGKRLLLDKTPDVIAFQLKRFTTLDHSIEKIDKHVAYPSELDLKPF-HSNPVSEE  451

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             E KY+L+ VV H G+  + GHY C + +SPS W+  +DS+V  + E   + QEAYILFYV
Sbjct  452   ELKYDLYGVVEHSGLP-NYGHYVCAIRSSPSTWHLMNDSQVDSITETSALHQEAYILFYV  510

Query  1411  KQGT-PWFSEIIETQQLILDASISNSSPQPVLYSVD  1307
             +QG  PWFS ++E  + +   + S +SP  VL  +D
Sbjct  511   RQGIFPWFSSLLE--EALHTETTSGASPVSVLEDID  544



>ref|XP_010235840.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21 isoform X1 
[Brachypodium distachyon]
Length=734

 Score =   309 bits (792),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 210/336 (63%), Gaps = 6/336 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+ LQC  H VPL + + + DHP+PC    +GFC  CALKE +  S+   GS + P
Sbjct  214   TCFLNATLQCITHTVPLFKKLRSTDHPTPCSYDEDGFCSFCALKEHIEESIRRSGSVLMP  273

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP-KHENVVKQTFG  1952
              +  +NL   SS F+  QQ DAHEFL+C L+ L  C   PK  G+ S    E++VK+ FG
Sbjct  274   ARFKDNLRKLSSDFRPGQQEDAHEFLRCLLDNLHKCTLDPKSKGKPSSFDEESIVKRVFG  333

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+L C  CGH S+T EP +DLSLEI+ VD L  AL+SFTKVE I D E K TCE C
Sbjct  334   GQLKSQLTCRECGHCSETSEPFLDLSLEIDQVDDLVAALESFTKVEEIGDAENKLTCESC  393

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
              VQV   K+LLLD+ P V  F LKRF      +EKI KHV +P ELDL P+   N    E
Sbjct  394   NVQVCKGKRLLLDKTPDVIAFQLKRFTTLDHSIEKIDKHVAYPSELDLKPF-HSNPVSEE  452

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             E KY+L+ VV H G+  + GHY C + +SPS W+  +DS+V  + E   + QEAYILFYV
Sbjct  453   ELKYDLYGVVEHSGLP-NYGHYVCAIRSSPSTWHLMNDSQVDSITETSALHQEAYILFYV  511

Query  1411  KQGT-PWFSEIIETQQLILDASISNSSPQPVLYSVD  1307
             +QG  PWFS ++E  + +   + S +SP  VL  +D
Sbjct  512   RQGIFPWFSSLLE--EALHTETTSGASPVSVLEDID  545



>gb|AET03287.2| ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=563

 Score =   304 bits (779),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/317 (48%), Positives = 211/317 (67%), Gaps = 19/317 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF++++LQCF H V +   +  C H S C+   EGFCV+CA ++ ++ +L    S I P
Sbjct  211   TCFMSAILQCFTHTVQMFLGLRYCTHASSCDV--EGFCVICAFRDHLDDALERSRSPIVP  268

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
             +++V NL+YFS+ F    Q DAHEF+Q  L +L+    +P          EN++ Q FGG
Sbjct  269   RELVKNLNYFSAGFVIGNQEDAHEFMQYALNKLKR--GFPV-------GEENLIDQIFGG  319

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+SKL+CC CGH SD +EPL+D+SLEIE V ++  AL+SFTKVE+++    KF C  C 
Sbjct  320   RLVSKLRCCCCGHSSDKFEPLIDMSLEIEHVSTIQQALESFTKVEKMD---GKFICSDCN  376

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYV---ERNEKV  1598
              +V++EKQL+LD+AP VA FHLKRF  DG  V+KI K+V F  ELDL PY       + V
Sbjct  377   QEVTMEKQLMLDKAPSVAAFHLKRFLKDGDSVKKIDKYVDFSKELDLKPYTCGSSSGDNV  436

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
             +   KY L+AVV H G S +SGHY+ FV ++P +WY  DD KV+ V E  V++++AYILF
Sbjct  437   L--LKYELYAVVEHRGPSPNSGHYFSFVRSAPDKWYLMDDDKVSSVSEEEVLNRKAYILF  494

Query  1417  YVKQGTPWFSEIIETQQ  1367
             Y +QGTPWFS I+E ++
Sbjct  495   YAQQGTPWFSSIVENEE  511



>gb|KEH20084.1| ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=572

 Score =   304 bits (779),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/317 (48%), Positives = 211/317 (67%), Gaps = 19/317 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF++++LQCF H V +   +  C H S C+   EGFCV+CA ++ ++ +L    S I P
Sbjct  220   TCFMSAILQCFTHTVQMFLGLRYCTHASSCDV--EGFCVICAFRDHLDDALERSRSPIVP  277

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
             +++V NL+YFS+ F    Q DAHEF+Q  L +L+    +P          EN++ Q FGG
Sbjct  278   RELVKNLNYFSAGFVIGNQEDAHEFMQYALNKLKR--GFPV-------GEENLIDQIFGG  328

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+SKL+CC CGH SD +EPL+D+SLEIE V ++  AL+SFTKVE+++    KF C  C 
Sbjct  329   RLVSKLRCCCCGHSSDKFEPLIDMSLEIEHVSTIQQALESFTKVEKMD---GKFICSDCN  385

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYV---ERNEKV  1598
              +V++EKQL+LD+AP VA FHLKRF  DG  V+KI K+V F  ELDL PY       + V
Sbjct  386   QEVTMEKQLMLDKAPSVAAFHLKRFLKDGDSVKKIDKYVDFSKELDLKPYTCGSSSGDNV  445

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
             +   KY L+AVV H G S +SGHY+ FV ++P +WY  DD KV+ V E  V++++AYILF
Sbjct  446   L--LKYELYAVVEHRGPSPNSGHYFSFVRSAPDKWYLMDDDKVSSVSEEEVLNRKAYILF  503

Query  1417  YVKQGTPWFSEIIETQQ  1367
             Y +QGTPWFS I+E ++
Sbjct  504   YAQQGTPWFSSIVENEE  520



>emb|CDX76553.1| BnaA08g08470D [Brassica napus]
Length=642

 Score =   303 bits (777),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 219/329 (67%), Gaps = 16/329 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGS-TIR  2132
             +CF+NSVLQCF H VPLI+S+ A  +  PC  CN+ FCV+ AL+  + ++L +    +I 
Sbjct  153   SCFINSVLQCFTHTVPLIESLYAYQYEDPCN-CNQRFCVIRALRYHIGVALETTSVFSIS  211

Query  2131  PKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFG  1952
             P    NNL  FS  F+R+QQ DAHEFL  FL +LE CC    LN +      N V+  FG
Sbjct  212   PVYFFNNLRCFSPDFRRYQQEDAHEFLHAFLNKLEICC----LNRR---NDVNFVQHIFG  264

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+S+L+CCNC + S+T+E  + LSLEIEDVD+L  ALDSFT+VE++E+   +  C+ C
Sbjct  265   GRLVSELRCCNCNYVSETFEDSLGLSLEIEDVDNLQSALDSFTRVEKLEE---QMKCDNC  321

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               +VS EK+LLL   P V TFHLKRFKN+G  + K   +V FP ELDL PY+  N++V  
Sbjct  322   DEKVSKEKRLLLQNLPQVITFHLKRFKNNGYFMLKNCNYVEFPLELDLQPYMS-NDQVA-  379

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY L+A+V H G SL+ GHY  FV ++PS W+KF+D +VTRV E+ V+SQ +YILFY 
Sbjct  380   -AKYYLYALVKHYG-SLAYGHYSSFVRSAPSIWHKFNDKQVTRVDEDCVLSQNSYILFYA  437

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQP  1325
             ++GTPWFS  IE    + +   S+  P P
Sbjct  438   REGTPWFSTAIEELHPMTEEDTSSEYPSP  466



>ref|XP_009108344.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Brassica 
rapa]
Length=642

 Score =   303 bits (776),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 219/329 (67%), Gaps = 16/329 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGS-TIR  2132
             +CF+NSVLQCF H VPLI+S+ A  +  PC  CN+ FCV+ AL+  + ++L +    +I 
Sbjct  153   SCFINSVLQCFTHTVPLIESLYAYQYEDPCN-CNQRFCVIRALRYHIGVALETTSVFSIS  211

Query  2131  PKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFG  1952
             P    NNL  FS  F+R+QQ DAHEFL  FL +LE CC    LN +      N V+  FG
Sbjct  212   PVYFFNNLRCFSPDFRRYQQEDAHEFLHAFLNKLEICC----LNRR---NDVNFVQHIFG  264

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+S+L+CCNC + S+T+E  + LSLEIEDVD+L  ALDSFT+VE++E+   +  C+ C
Sbjct  265   GRLVSELRCCNCNYVSETFEDSLGLSLEIEDVDNLQSALDSFTRVEKLEE---QMKCDNC  321

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               +VS EK+LLL   P V TFHLKRFKN+G  + K   +V FP ELDL PY+  N++V  
Sbjct  322   DEKVSKEKRLLLQNLPQVITFHLKRFKNNGYFMLKNCNYVEFPLELDLQPYMS-NDQVA-  379

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              +KY L+A+V H G SL+ GHY  FV ++PS W+KF+D +VTRV E+ V+SQ +YILFY 
Sbjct  380   -AKYYLYALVKHYG-SLAYGHYSSFVRSAPSIWHKFNDKQVTRVDEDCVLSQNSYILFYA  437

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQP  1325
             ++GTPWFS  IE    + +   S+  P P
Sbjct  438   REGTPWFSTAIEELHPMTEEDTSSEYPSP  466



>ref|XP_003628811.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=737

 Score =   304 bits (778),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 165/376 (44%), Positives = 232/376 (62%), Gaps = 31/376 (8%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF++++LQCF H V +   +  C H S C+   EGFCV+CA ++ ++ +L    S I P
Sbjct  220   TCFMSAILQCFTHTVQMFLGLRYCTHASSCDV--EGFCVICAFRDHLDDALERSRSPIVP  277

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
             +++V NL+YFS+ F    Q DAHEF+Q  L +L+    +P          EN++ Q FGG
Sbjct  278   RELVKNLNYFSAGFVIGNQEDAHEFMQYALNKLKR--GFP-------VGEENLIDQIFGG  328

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L+SKL+CC CGH SD +EPL+D+SLEIE V ++  AL+SFTKVE+++    KF C  C 
Sbjct  329   RLVSKLRCCCCGHSSDKFEPLIDMSLEIEHVSTIQQALESFTKVEKMDG---KFICSDCN  385

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYV---ERNEKV  1598
              +V++EKQL+LD+AP VA FHLKRF  DG  V+KI K+V F  ELDL PY       + V
Sbjct  386   QEVTMEKQLMLDKAPSVAAFHLKRFLKDGDSVKKIDKYVDFSKELDLKPYTCGSSSGDNV  445

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
             +   KY L+AVV H G S +SGHY+ FV ++P +WY  DD KV+ V E  V++++AYILF
Sbjct  446   L--LKYELYAVVEHRGPSPNSGHYFSFVRSAPDKWYLMDDDKVSSVSEEEVLNRKAYILF  503

Query  1417  YVKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRPCDVNETDNA  1238
             Y +QGTPWFS I+E ++         ++P+         F+     E D   D + TD  
Sbjct  504   YAQQGTPWFSSIVENEE---------TAPKSKYLHNKYGFDCDNNGEKD---DNDSTDAN  551

Query  1237  ADEASSNVDGPKDNGI  1190
              D   S++D   D+GI
Sbjct  552   YDNCVSDMDEECDSGI  567



>ref|XP_008678970.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like isoform 
X2 [Zea mays]
Length=560

 Score =   298 bits (763),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/308 (50%), Positives = 192/308 (62%), Gaps = 4/308 (1%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+ LQC  H VPL   + + DH +PC    +GFC  CALKE ++ S+   GS I P
Sbjct  52    TCFLNATLQCITHTVPLFLKLRSTDHSTPCSYNKDGFCSFCALKEHVDESIQRSGSVIAP  111

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP-KHENVVKQTFG  1952
              K  +NL   SS F   QQ DAHEFL+C L+ L  C   P   G+ S    E++V + FG
Sbjct  112   AKFRDNLRKLSSDFWPGQQEDAHEFLRCLLDNLHKCTLDPMSKGKGSSFDEESIVNEIFG  171

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S L CC CGH S+T+EP +DLSLEI+ VD L  AL SFTKVE+I D E K TCE C
Sbjct  172   GQLKSHLSCCECGHSSETFEPFLDLSLEIDQVDHLVDALQSFTKVEQIGDSENKLTCESC  231

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               QVS  KQL L  AP V  FHLKRF    + VEKI KHV +P E+DL P+   N   + 
Sbjct  232   NAQVSKNKQLTLHRAPDVIAFHLKRFTTLDNSVEKIDKHVVYPLEVDLKPF-HSNPDTVG  290

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY+L+ VV H G+  + GHY C + +SPS WY  +DSKV    ++  ++QEAYILFYV
Sbjct  291   GLKYDLYGVVEHSGLP-NYGHYTCTIRSSPSTWYFMNDSKVDSCTDSSALNQEAYILFYV  349

Query  1411  KQGT-PWF  1391
             +QG  PWF
Sbjct  350   RQGKFPWF  357



>ref|XP_006647718.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Oryza 
brachyantha]
Length=705

 Score =   301 bits (772),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 162/338 (48%), Positives = 209/338 (62%), Gaps = 8/338 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS+LQC  H VPL   + +  H +PC    +GFC  CALKE ++ S+   GS IRP
Sbjct  172   TCFLNSILQCVTHTVPLFLRLRSTGHYAPCSYDKDGFCSFCALKEHIDESIRRSGSVIRP  231

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK---HENVVKQT  1958
              +  +NL   SS F+  QQ DAHEFL+C L+ L+ C +   LN +  P     +++VKQ 
Sbjct  232   IRFRDNLKKLSSDFRPGQQEDAHEFLRCLLDNLDKCTS--DLNSKDKPSSFDEQSIVKQV  289

Query  1957  FGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCE  1778
             FGG L S+L CC CGH S+TYEP +DLSLEI   D L  AL SFTK+E+I D E K TCE
Sbjct  290   FGGRLKSQLICCECGHCSETYEPFLDLSLEINHADHLVDALKSFTKLEQIGDAEEKLTCE  349

Query  1777  KCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKV  1598
              C  +V   KQL+LD +P V  FHLKRF    S +EKI KHV +P ELDL P+   +   
Sbjct  350   HCNAKVCKNKQLMLDRSPDVIAFHLKRFTTLDSSIEKIDKHVVYPLELDLKPF-HSDPDA  408

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
               E KY+L+ VV H G S S GHY C V +SPS W+  +DS V  + E   ++QE YILF
Sbjct  409   DMELKYDLYGVVEHSG-SPSYGHYVCSVRSSPSTWHLMNDSHVDLISEASALNQEGYILF  467

Query  1417  YVKQGT-PWFSEIIETQQLILDASISNSSPQPVLYSVD  1307
             YV+QG   WFS ++E +      + S +SP  VL ++D
Sbjct  468   YVRQGKFQWFSSLLEQKDEQHPENTSGASPVSVLENMD  505



>gb|AFW72896.1| putative ubiquitin carboxyl-terminal hydrolase superfamily protein 
[Zea mays]
Length=463

 Score =   287 bits (735),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 152/332 (46%), Positives = 206/332 (62%), Gaps = 4/332 (1%)
 Frame = -1

Query  2296  NSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRPKKIV  2117
             N+ LQC  H VPL   + + DH +PC    +GFC  CALKE ++ S+   GS I P K  
Sbjct  5     NATLQCITHTVPLFLKLCSNDHFTPCSYNEDGFCSFCALKEHVDESIRRSGSVIAPTKFR  64

Query  2116  NNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP-KHENVVKQTFGGHLI  1940
             ++L   S  F   QQ DAHEFL+C L+ L  C   PK   + S  + E++VK+ FGG L 
Sbjct  65    DSLRKLSLDFTPGQQEDAHEFLRCLLDNLHECTLDPKSKSKGSSFEEESIVKEIFGGQLK  124

Query  1939  SKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCKVQV  1760
             S L CC CGH S+T+EP +DLSLEI+ VD L  AL SFTKVE++ D E K TCE C  +V
Sbjct  125   SHLSCCECGHSSETFEPFLDLSLEIDQVDHLVDALQSFTKVEQVGDSENKLTCESCNARV  184

Query  1759  SIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEESKY  1580
                KQL L  AP V  FHLKRF    + V+KI K+V +P E+DL P+   N + + E KY
Sbjct  185   CKNKQLTLYRAPDVIAFHLKRFTTLDNSVKKIDKYVAYPLEVDLKPF-HSNPETVGELKY  243

Query  1579  NLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVKQGT  1400
             +L+ VV H G+  + GHY C + +SPS WY  +DS V  + ++  ++QEAYILFYV+QG 
Sbjct  244   DLYGVVEHSGLP-NYGHYVCTIRSSPSTWYLMNDSNVDSITDSSALNQEAYILFYVRQGK  302

Query  1399  -PWFSEIIETQQLILDASISNSSPQPVLYSVD  1307
              PWFS ++E + ++   +   +SP  VL ++D
Sbjct  303   FPWFSSLLEGKVVLQAENTCGTSPVSVLENID  334



>ref|XP_008646102.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Zea 
mays]
 gb|AFW72897.1| putative ubiquitin carboxyl-terminal hydrolase superfamily protein 
[Zea mays]
Length=531

 Score =   288 bits (738),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 152/332 (46%), Positives = 206/332 (62%), Gaps = 4/332 (1%)
 Frame = -1

Query  2296  NSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRPKKIV  2117
             N+ LQC  H VPL   + + DH +PC    +GFC  CALKE ++ S+   GS I P K  
Sbjct  5     NATLQCITHTVPLFLKLCSNDHFTPCSYNEDGFCSFCALKEHVDESIRRSGSVIAPTKFR  64

Query  2116  NNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP-KHENVVKQTFGGHLI  1940
             ++L   S  F   QQ DAHEFL+C L+ L  C   PK   + S  + E++VK+ FGG L 
Sbjct  65    DSLRKLSLDFTPGQQEDAHEFLRCLLDNLHECTLDPKSKSKGSSFEEESIVKEIFGGQLK  124

Query  1939  SKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCKVQV  1760
             S L CC CGH S+T+EP +DLSLEI+ VD L  AL SFTKVE++ D E K TCE C  +V
Sbjct  125   SHLSCCECGHSSETFEPFLDLSLEIDQVDHLVDALQSFTKVEQVGDSENKLTCESCNARV  184

Query  1759  SIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEESKY  1580
                KQL L  AP V  FHLKRF    + V+KI K+V +P E+DL P+   N + + E KY
Sbjct  185   CKNKQLTLYRAPDVIAFHLKRFTTLDNSVKKIDKYVAYPLEVDLKPF-HSNPETVGELKY  243

Query  1579  NLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVKQGT  1400
             +L+ VV H G+  + GHY C + +SPS WY  +DS V  + ++  ++QEAYILFYV+QG 
Sbjct  244   DLYGVVEHSGLP-NYGHYVCTIRSSPSTWYLMNDSNVDSITDSSALNQEAYILFYVRQGK  302

Query  1399  -PWFSEIIETQQLILDASISNSSPQPVLYSVD  1307
              PWFS ++E + ++   +   +SP  VL ++D
Sbjct  303   FPWFSSLLEGKVVLQAENTCGTSPVSVLENID  334



>gb|EEE57611.1| hypothetical protein OsJ_08002 [Oryza sativa Japonica Group]
Length=672

 Score =   285 bits (730),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 183/444 (41%), Positives = 251/444 (57%), Gaps = 35/444 (8%)
 Frame = -1

Query  2377  FANSFFWDDKSllvggglanlgNTCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGF  2198
             F+ SF  + +S LVG GL N+GNTCFLNS+LQC  H VPL   + + DH +PC    +GF
Sbjct  144   FSLSFSRNTQSQLVGSGLGNMGNTCFLNSILQCVTHTVPLFLRLRSTDHCAPCSYDKDGF  203

Query  2197  CVLCALKELMNISLASKGSTIRPKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC  2018
             C  CALKE ++ S+   G                      QQ DAHEFL+C L+ L+ C 
Sbjct  204   CSFCALKEHIDESIRRPG----------------------QQEDAHEFLRCLLDNLDKCT  241

Query  2017  NYPKLNGQVSP-KHENVVKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSL  1841
               PK   + S    E++VKQ FGG L SKL CC CGH S+TYEP +DLSLEI+  D+L  
Sbjct  242   TDPKPKDKPSSFDEESIVKQVFGGRLKSKLTCCECGHCSETYEPFLDLSLEIDQADNLID  301

Query  1840  ALDSFTKVERIEDPETKFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIA  1661
             AL+SFTK+ERI D E K  CE C  +V   KQL+LD +P V   HLKRF +    VEKI 
Sbjct  302   ALESFTKLERIGDAEDKLNCEHCNAKVCKNKQLMLDRSPDVVAIHLKRFTSLDRSVEKID  361

Query  1660  KHVTFPPELDLLPYVERNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFD  1481
             KHV +P ELDL P+   +  + +E KY+L+ VV H G S S GHY C V +SPS W+  +
Sbjct  362   KHVVYPLELDLKPF-HCDPDINKELKYDLYGVVEHSG-SPSYGHYVCSVRSSPSTWHLMN  419

Query  1480  DSKVTRVQENVVMSQEAYILFYVKQGT-PWFSEIIETQQLILDASISNSSPQPVLYSVDQ  1304
             DS V  + E   ++QE YILFY++QG   WFS ++E +  +   + S +SP  VL ++D 
Sbjct  420   DSHVDLISEASALNQEGYILFYIRQGKFQWFSSLLEQKDDLHPENTSGASPVSVLENIDV  479

Query  1303  IFNPYPKMETDRPCDVNETDNAADEASSNVDGPKD----NGIDRSDGKENSNVVSALIHE  1136
                      T+   D  E D  +   +S ++ P      +GI+++D K+      +  H+
Sbjct  480   DCPTSSGEATNSSGDKLEKDETSQCKTSFLEEPAKGCPIDGINKADLKDEIVPCISSHHD  539

Query  1135  GMNN-----SSDICSAEAEKTPPP  1079
              + N     ++DI + +   TP P
Sbjct  540   CVANRCPGSAADITNLDRPSTPSP  563



>ref|XP_010935024.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like isoform 
X3 [Elaeis guineensis]
Length=563

 Score =   281 bits (719),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 200/317 (63%), Gaps = 10/317 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+VLQC  H VPL++ + A DH S C A    FC LCAL++ +   +   G  I P
Sbjct  83    TCFLNAVLQCLTHTVPLVEKLWASDHYSTCSAGPGEFCALCALRDHIGRCVDFSGYVITP  142

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHEN---VVKQT  1958
              +I  NLS  SS F+   Q DAHEFLQC L R+ SCC  P    Q  P  ++   +++Q 
Sbjct  143   IRIAINLSKISSDFELGSQEDAHEFLQCLLYRVHSCCISPVHGNQPPPVGDDTDTLIQQV  202

Query  1957  FGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCE  1778
             FGG   S+L+C +CGH SDT+EPL+DLSL I+ + SL+ AL+S+TKVE +E  +    C 
Sbjct  203   FGGRARSRLRCSDCGHVSDTFEPLLDLSLGIDGMASLTEALESYTKVEMLEPSK----CV  258

Query  1777  KCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKV  1598
              C  +V  EKQL LD+AP VA FHLKRFK DG+ V KI   V FP ELDL P++   +  
Sbjct  259   GCHAKVPKEKQLKLDQAPQVALFHLKRFKIDGADVCKINNFVEFPLELDLRPFISSPQDE  318

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
              E+  Y+L+AVVVH+G +L  GHY+  + +S S W+  DD+ V R      +  +AY+LF
Sbjct  319   -EQLNYDLYAVVVHVG-NLDRGHYFSIIRSSQSSWHLMDDANVDRCSRMEALDAQAYMLF  376

Query  1417  YVKQG-TPWFSEIIETQ  1370
             Y+K+G +PWFS  IE Q
Sbjct  377   YIKEGSSPWFSSFIERQ  393



>ref|XP_010935023.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like isoform 
X2 [Elaeis guineensis]
Length=616

 Score =   282 bits (722),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 200/317 (63%), Gaps = 12/317 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+VLQC  H VPL++ + A DH S C A    FC LCAL++ +   +   G  I P
Sbjct  83    TCFLNAVLQCLTHTVPLVEKLWASDHYSTCSAGPGEFCALCALRDHIGRCVDFSGYVITP  142

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHEN---VVKQT  1958
              +I  NLS  SS F+   Q DAHEFLQC L R+ SCC  P    Q  P  ++   +++Q 
Sbjct  143   IRIAINLSKISSDFELGSQEDAHEFLQCLLYRVHSCCISPVHGNQPPPVGDDTDTLIQQV  202

Query  1957  FGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCE  1778
             FGG   S+L+C +CGH SDT+EPL+DLSL I+ + SL+ AL+S+TKVE +E  +    C 
Sbjct  203   FGGRARSRLRCSDCGHVSDTFEPLLDLSLGIDGMASLTEALESYTKVEMLEPSK----CV  258

Query  1777  KCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKV  1598
              C  +V  EKQL LD+AP VA FHLKRFK DG+ V KI   V FP ELDL P++   +  
Sbjct  259   GCHAKVPKEKQLKLDQAPQVALFHLKRFKIDGADVCKINNFVEFPLELDLRPFISSPQ--  316

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
              +E  Y+L+AVVVH+G +L  GHY+  + +S S W+  DD+ V R      +  +AY+LF
Sbjct  317   -DELNYDLYAVVVHVG-NLDRGHYFSIIRSSQSSWHLMDDANVDRCSRMEALDAQAYMLF  374

Query  1417  YVKQG-TPWFSEIIETQ  1370
             Y+K+G +PWFS  IE Q
Sbjct  375   YIKEGSSPWFSSFIERQ  391



>gb|EEC73821.1| hypothetical protein OsI_08545 [Oryza sativa Indica Group]
Length=672

 Score =   284 bits (726),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 166/359 (46%), Positives = 217/359 (60%), Gaps = 26/359 (7%)
 Frame = -1

Query  2377  FANSFFWDDKSllvggglanlgNTCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGF  2198
             F+ SF  + +S LVG GL N+GNTCFLNS+LQC  H VPL   + + DH +PC    +GF
Sbjct  144   FSLSFSRNTQSQLVGSGLGNMGNTCFLNSILQCVTHTVPLFLRLRSTDHCAPCSYDKDGF  203

Query  2197  CVLCALKELMNISLASKGSTIRPKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC  2018
             C  CALKE ++ S+   G                      QQ DAHEFL+C L+ L+ C 
Sbjct  204   CSFCALKEHIDESIRRPG----------------------QQEDAHEFLRCLLDNLDKCT  241

Query  2017  NYPKLNGQVSP-KHENVVKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSL  1841
               PK   + S    E++VKQ FGG L SKL CC CGH S+TYEP +DLSLEI+  D+L  
Sbjct  242   TDPKPKDKPSSFDEESIVKQVFGGRLKSKLTCCECGHCSETYEPFLDLSLEIDQADNLID  301

Query  1840  ALDSFTKVERIEDPETKFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIA  1661
             AL+SFTK+ERI D E K  CE C  +V   KQL+LD +P V   HLKRF +    VEKI 
Sbjct  302   ALESFTKLERIGDAEDKLNCEHCNAKVCKNKQLMLDRSPDVVAIHLKRFTSLDRSVEKID  361

Query  1660  KHVTFPPELDLLPYVERNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFD  1481
             KHV +P ELDL P+   +  + +E KY+L+ VV H G S S GHY C V +SPS W+  +
Sbjct  362   KHVVYPLELDLKPF-HCDPDINKELKYDLYGVVEHSG-SPSYGHYVCSVRSSPSTWHLMN  419

Query  1480  DSKVTRVQENVVMSQEAYILFYVKQGT-PWFSEIIETQQLILDASISNSSPQPVLYSVD  1307
             DS V  + E   ++QE YILFY++QG   WFS ++E +  +   + S +SP  VL ++D
Sbjct  420   DSHVDLISEASALNQEGYILFYIRQGKFQWFSSLLEQKDDLHPENTSGASPVSVLENID  478



>ref|XP_010935022.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like isoform 
X1 [Elaeis guineensis]
Length=618

 Score =   282 bits (721),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 200/317 (63%), Gaps = 10/317 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+VLQC  H VPL++ + A DH S C A    FC LCAL++ +   +   G  I P
Sbjct  83    TCFLNAVLQCLTHTVPLVEKLWASDHYSTCSAGPGEFCALCALRDHIGRCVDFSGYVITP  142

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHEN---VVKQT  1958
              +I  NLS  SS F+   Q DAHEFLQC L R+ SCC  P    Q  P  ++   +++Q 
Sbjct  143   IRIAINLSKISSDFELGSQEDAHEFLQCLLYRVHSCCISPVHGNQPPPVGDDTDTLIQQV  202

Query  1957  FGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCE  1778
             FGG   S+L+C +CGH SDT+EPL+DLSL I+ + SL+ AL+S+TKVE +E  +    C 
Sbjct  203   FGGRARSRLRCSDCGHVSDTFEPLLDLSLGIDGMASLTEALESYTKVEMLEPSK----CV  258

Query  1777  KCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKV  1598
              C  +V  EKQL LD+AP VA FHLKRFK DG+ V KI   V FP ELDL P++   +  
Sbjct  259   GCHAKVPKEKQLKLDQAPQVALFHLKRFKIDGADVCKINNFVEFPLELDLRPFISSPQDE  318

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
              E+  Y+L+AVVVH+G +L  GHY+  + +S S W+  DD+ V R      +  +AY+LF
Sbjct  319   -EQLNYDLYAVVVHVG-NLDRGHYFSIIRSSQSSWHLMDDANVDRCSRMEALDAQAYMLF  376

Query  1417  YVKQG-TPWFSEIIETQ  1370
             Y+K+G +PWFS  IE Q
Sbjct  377   YIKEGSSPWFSSFIERQ  393



>ref|XP_010315548.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Solanum 
lycopersicum]
Length=384

 Score =   273 bits (698),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 178/256 (70%), Gaps = 16/256 (6%)
 Frame = -1

Query  2101  FSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGGHLISKLQCC  1922
             FS  F   QQ DAHEFLQCFL +LE+CC Y +         +NVVK+ FGG  +SKL+CC
Sbjct  96    FSCYFNFNQQQDAHEFLQCFLNQLETCCYYLE-------TKDNVVKEAFGGRFMSKLRCC  148

Query  1921  NCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCKVQVSIEKQL  1742
             NCGH S T EPL+D+SLEIE +DS+  A +SFTK+E+IE     F C++CK     EKQL
Sbjct  149   NCGHSSITREPLIDISLEIEGIDSVPAAFESFTKIEKIE-----FYCKRCKTYGPFEKQL  203

Query  1741  LLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEESKYNLFAVV  1562
             L+D+AP VA  HLKRFKN+G + +K+  HV+FP ELD+L Y       I   KY+L+AV+
Sbjct  204   LVDQAPTVAALHLKRFKNNGLVSQKVENHVSFPLELDILLYTNN----INNIKYDLYAVI  259

Query  1561  VHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVKQGTPWFSEI  1382
             VH G S+SSGHYY F+  +P+EWYKF+D KV  VQE++V+++ AYIL Y K+GT WF++ 
Sbjct  260   VHSGPSISSGHYYIFIRCAPNEWYKFNDEKVDYVQEDLVLAENAYILLYTKKGTLWFADY  319

Query  1381  IETQQLILDASISNSS  1334
             +E  +  +D  ++ +S
Sbjct  320   VEIHRPFVDLIMATTS  335



>ref|XP_008788657.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21-like [Phoenix 
dactylifera]
Length=558

 Score =   272 bits (696),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 195/314 (62%), Gaps = 10/314 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+VLQC  H VPL++ + A DH S C A    FC LCAL+  ++  L   G    P
Sbjct  35    TCFLNAVLQCLTHTVPLVEKLRASDHYSTCSAGPGEFCALCALRHHIDNCLYLSGYVFTP  94

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQ---VSPKHENVVKQT  1958
             K   +NLS   S F+   Q DAHEFLQC L R+  CC       Q   V    ++++KQ 
Sbjct  95    KHFASNLSKILSEFELGSQEDAHEFLQCLLIRVHDCCIGLVSGNQLLSVGDDTDSLIKQV  154

Query  1957  FGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCE  1778
             FGG  IS+L+C +CGH SDT+E L+DLSL I+ + SL+ AL+S+TKVE +E  E    C+
Sbjct  155   FGGRAISRLRCSDCGHVSDTFESLLDLSLGIDGMASLTEALESYTKVEMLEPSE----CD  210

Query  1777  KCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKV  1598
              C  +V  EKQL LD+AP VA FHLKRFK DG+ V KI   V FP +LDL P++   +  
Sbjct  211   GCHAKVPKEKQLKLDQAPQVALFHLKRFKMDGAGVCKINNLVEFPLDLDLQPFLSSPQDE  270

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
              E+  Y+L+AVVVH G +L  GHY+ F+ +S S W+  DD+ V R     V++  AY+LF
Sbjct  271   -EQLNYDLYAVVVHHG-NLDRGHYFSFIRSSQSSWHLMDDADVARCSAMQVLNMPAYMLF  328

Query  1417  YVKQG-TPWFSEII  1379
             Y+KQG +PW S  I
Sbjct  329   YIKQGSSPWISSFI  342



>gb|EMT33462.1| Ubiquitin carboxyl-terminal hydrolase 21 [Aegilops tauschii]
Length=722

 Score =   272 bits (695),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 201/336 (60%), Gaps = 29/336 (9%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN+ LQC  H VPL + +   DH +PC     G  V+  +  L              
Sbjct  214   TCFLNATLQCITHTVPLFKKLRCTDHSTPCSLFPFGDNVMNFVGFL--------------  259

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP-KHENVVKQTFG  1952
                  +L   SS F+  QQ DAHEFL+C L+ L  C   PK  G+ S    E++VKQ FG
Sbjct  260   ---DEDLPELSSDFRPGQQEDAHEFLRCLLDNLHKCTLDPKSKGKPSSFDEESIVKQVFG  316

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+L C +CGH S+T+EP +DLSLEI+ VD L  AL+SFTKVE++ D E K TCE C
Sbjct  317   GRLKSQLTCRDCGHCSETFEPFLDLSLEIDQVDDLVAALESFTKVEQVGDDENKLTCESC  376

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             KVQV  +K+L+LD+AP V  F LKRF    + +EKI KHV +P ELDL P+    +K  E
Sbjct  377   KVQVCKDKRLVLDKAPDVIAFQLKRFTTLDNSIEKIDKHVAYPSELDLKPFHNNPDK--E  434

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             E  Y+L+ VV H G+  + GHY C + +SPS W+  +DS V  + E   ++QEAYILFYV
Sbjct  435   ELMYDLYGVVEHSGLP-NYGHYVCTIRSSPSTWHLMNDSNVDSITETCALNQEAYILFYV  493

Query  1411  KQGT-PWFSEIIETQQLILDASISNSSPQPVLYSVD  1307
             +QG  PWFS ++E  +       S +SP  VL ++D
Sbjct  494   RQGMFPWFSSLLEEAR-------SGASPVSVLDNID  522



>ref|XP_006418757.1| hypothetical protein EUTSA_v10002775mg, partial [Eutrema salsugineum]
 gb|ESQ37193.1| hypothetical protein EUTSA_v10002775mg, partial [Eutrema salsugineum]
Length=662

 Score =   261 bits (668),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 139/331 (42%), Positives = 197/331 (60%), Gaps = 26/331 (8%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIR-  2132
             TCF+ SVLQC  H VPL+Q + +  H  PC   NE FCVL ALK+ M ++L + G ++  
Sbjct  144   TCFIASVLQCLTHTVPLLQRLLSYKHQDPCNCGNEKFCVLRALKQHMELALFASGKSLSI  203

Query  2131  PKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFG  1952
               +   NL   SS FQ  +Q DA EFL+  L +L++C +    +G VS +  N+ +  F 
Sbjct  204   VDRFRQNLQDVSSVFQINRQEDATEFLESLLGKLQTCLDRQNKSGSVSSQDGNIAEHVFV  263

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L+SKL+CCNC   SD +EP    SL IED D+L  AL+SF                  
Sbjct  264   GRLLSKLRCCNCNFVSDKFEPSRGWSLAIEDGDTLVSALESFI-----------------  306

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
                   EKQL LD+ PLVA FHLKRFK      EKI+K++ FP +LDLLPY+  NE    
Sbjct  307   -----CEKQLKLDKVPLVAAFHLKRFKIHE---EKISKYIEFPLDLDLLPYMSSNEDPEV  358

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
              + Y+ +A+V HIG  LSSGHY  +V ++   W++FDDS+V ++ E  V+S++AY+LFY 
Sbjct  359   PTIYHQYAMVEHIGTGLSSGHYVAYVRSARGTWHRFDDSEVKKISEESVLSKQAYMLFYA  418

Query  1411  KQGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             +Q TPWF++  E  +++ +A+    S + +L
Sbjct  419   RQETPWFNKFFEKLKILSEATTLYVSRKSLL  449



>ref|XP_001760410.1| predicted protein [Physcomitrella patens]
 gb|EDQ74801.1| predicted protein [Physcomitrella patens]
Length=312

 Score =   249 bits (636),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 133/304 (44%), Positives = 188/304 (62%), Gaps = 9/304 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C A   GFC +CAL+E +  +LAS G  + P
Sbjct  8     TCFLNSVLQCLTYTPPLAGYLDSGQHKATCRA--AGFCAMCALQEHVRQALASSGGAVSP  65

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYP--KLNGQVSPKHENVVKQTF  1955
               +V NL   S +F+ ++Q DAHE+L+C +E L +CC  P  K N  VS +  +++ + F
Sbjct  66    STLVKNLRCISKSFRMWRQEDAHEYLRCLIEGLHNCCLPPGVKSNSAVS-QERSLIHKIF  124

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C   S+TY+PL+DLSLEI   DSL+ AL+ FT VE +E  + K+ C  
Sbjct  125   GGRLRSQVKCTVCLTCSNTYDPLLDLSLEIVRADSLTKALNRFTAVEALEG-DNKYHCSH  183

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             C  +V   KQ  +D+ P + T   KRF + GS   KI K + F   LDL PY+  N +V 
Sbjct  184   CNKKVRALKQFTIDKPPNILTIQFKRFSSTGSSGGKIDKKIEFGRTLDLKPYIS-NPQVC  242

Query  1594  E--ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                ++KY+L+AV+VH G S  SGHYYCFV      W+  DDS+V +V E  V+ Q+AYIL
Sbjct  243   SATDAKYSLYAVLVHAGWSTHSGHYYCFVRTKGDMWHALDDSRVKQVSEKSVLDQKAYIL  302

Query  1420  FYVK  1409
             FY++
Sbjct  303   FYIR  306



>ref|XP_002467449.1| hypothetical protein SORBIDRAFT_01g028253 [Sorghum bicolor]
 gb|EER94447.1| hypothetical protein SORBIDRAFT_01g028253 [Sorghum bicolor]
Length=306

 Score =   245 bits (626),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 192/313 (61%), Gaps = 10/313 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN +LQC +H VPL+  +   DHP PC   + GFC  C+LK+ +N S+   GS+  P
Sbjct  1     TCFLNCILQCMVHTVPLVLKLRKTDHPDPCPRASIGFCCYCSLKQHVNESIRLSGSSFYP  60

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             +  +N L   SS F+   Q DA EFL+C L++L+     P+ + + S   E +VVK+ F 
Sbjct  61    EIFINRLKSISSDFKSGVQQDAQEFLRCLLDKLDEDSIAPRSSEESSTTKEGSVVKEIFR  120

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+L+C  C   SD  EP +DLSL++  V++L  AL SFT  E I+D    F C+ C
Sbjct  121   GCLKSQLRCPECDRCSDKSEPFLDLSLDLNMVETLMDALQSFTNTELIKD----FMCDGC  176

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +VS+EK   +++AP V   HLKRF N  S   KI   V +P ELD+  ++  ++ V  
Sbjct  177   KSRVSMEKHFKIEQAPEVLVIHLKRFTNSES---KIWDKVKYPLELDINSFMSSSDDVSC  233

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY+L+ VV H+G +  SGHY C++ +S ++WYKF+D KV +   +  +   AY+LFYV
Sbjct  234   SFKYDLYGVVEHLG-AYGSGHYVCYIRSSEADWYKFNDDKVYQCSVDSALENAAYLLFYV  292

Query  1411  KQG-TPWFSEIIE  1376
             KQG +PWFS ++E
Sbjct  293   KQGSSPWFSTLLE  305



>gb|KEH20037.1| ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=419

 Score =   247 bits (631),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/318 (41%), Positives = 191/318 (60%), Gaps = 21/318 (7%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             T FL+++LQCF H VP+ + + +C H SPC+   + FC +CA +   + +L   G  + P
Sbjct  62    TSFLSAILQCFTHTVPMFRGLRSCTHASPCDV--KSFCFICAFRNHFDNALEPSGVPVVP  119

Query  2128  KKIVNNLSYFSSTFQRF-QQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFG  1952
             ++I  NL    + + R  Q+ DAHEF+Q  L+ L+   ++P          EN++ Q FG
Sbjct  120   REITENLHSLIAGYVRGKQEEDAHEFMQSALKELQK--SFP-------VGEENLIDQVFG  170

Query  1951  GHLISKLQCCNC-GHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             G L+   +CC C G+ S T+ P  D+SLEIE   S+  AL S T+VE++     KF C  
Sbjct  171   GRLVDTFRCCCCRGYSSATFVPFKDMSLEIELAASIPHALKSITRVEQLAG---KFRCSN  227

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             C  +V++EKQL+LD+AP +A FHLKRF  DG  ++KI + +    +L+L PY   +    
Sbjct  228   CNQEVTMEKQLMLDKAPSIAVFHLKRFLKDGDSLKKIERSLWLHKKLNLNPYTSGSSSDN  287

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMS-----QEA  1430
                 Y ++AVV+H G S +SGHY+CFV ++P +WY  DD KV+ V E   ++      +A
Sbjct  288   VVLNYEVYAVVMHRGPSPNSGHYFCFVRSAPDKWYLMDDDKVSSVSEEEALNHRAADHKA  347

Query  1429  YILFYVKQGTPWFSEIIE  1376
             YILFY K+GTPWFS I+E
Sbjct  348   YILFYAKEGTPWFSTIVE  365



>ref|XP_010327622.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Solanum 
lycopersicum]
Length=274

 Score =   241 bits (614),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 185/313 (59%), Gaps = 53/313 (17%)
 Frame = -1

Query  2158  LASKGSTIRPKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKH  1979
             ++S    +   KI ++L+ FS TF   QQ DAHEFLQCFL +LESCC        + P+ 
Sbjct  1     MSSGSDNVISNKIFSHLNDFSPTFHPNQQEDAHEFLQCFLNKLESCC------YNLDPR-  53

Query  1978  ENVVKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDP  1799
             +N+VK+ FGGHL+S L+C NC H S T EPL+DLSLEI DVD +  AL+SFTK+E IE  
Sbjct  54    DNIVKKAFGGHLVSMLRCFNCCHLSITPEPLIDLSLEIVDVDCVPKALESFTKIENIE--  111

Query  1798  ETKFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPY  1619
                F CEKCK Q   EKQLL+D AP +AT  LKRF NDG  ++K                
Sbjct  112   ---FFCEKCKTQGPFEKQLLIDHAPSIATLCLKRFVNDGFDIQK----------------  152

Query  1618  VERNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMS  1439
                     EE KY+L+AV+VH G S+SSGHYY F+  +P+EWYKFDD +V  V E+ V+ 
Sbjct  153   --------EEMKYDLYAVIVHSGFSISSGHYYSFIRCNPNEWYKFDDEQVHWVHEDHVLE  204

Query  1438  QEAYILFYVKQGTPWFSEIIETQQLILDASI-SNSSPQPVLYSVDQIFNPYPKMETDRPC  1262
             ++AYILFY K+ T WF++  +  +  ++  I S SS  P                 +   
Sbjct  205   EQAYILFYTKRHTLWFTDYTQIHKPFVNLVIPSTSSCIP----------------NNHAS  248

Query  1261  DVNETDNAADEAS  1223
             DV E+++ AD+ S
Sbjct  249   DVGESNHVADDTS  261



>gb|EMS51605.1| Ubiquitin carboxyl-terminal hydrolase 21 [Triticum urartu]
Length=678

 Score =   250 bits (639),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 134/274 (49%), Positives = 176/274 (64%), Gaps = 12/274 (4%)
 Frame = -1

Query  2122  IVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP-KHENVVKQTFGGH  1946
             + N     SS F+  QQ DAHEFL+C L+ L  C   PK  G+ S    E++VKQ FGG 
Sbjct  220   LKNQFEELSSDFRPGQQEDAHEFLRCLLDNLHKCTLDPKSKGKPSSFDEESIVKQVFGGR  279

Query  1945  LISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCKV  1766
             L S L C +CGH S+T+EP +DLSLEI+ VD L  AL+SFTKVE++ D E K TCE CKV
Sbjct  280   LKSLLTCRDCGHCSETFEPFLDLSLEIDQVDDLVAALESFTKVEQVGDDENKLTCESCKV  339

Query  1765  QVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEES  1586
             QV  +K+L+LD+AP V  F LKRF    + +EKI KHV +PPELDL P+    +K  EE 
Sbjct  340   QVCKDKRLVLDKAPDVIAFQLKRFTTLDNSIEKIDKHVAYPPELDLKPFHNNPDK--EEL  397

Query  1585  KYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVKQ  1406
              Y+L+ VV H G+  + GHY C + +SPS W+  +DS V  + E   ++QEAYILFYV+Q
Sbjct  398   MYDLYGVVEHSGLP-NYGHYVCTIRSSPSTWHLMNDSNVDSITETCALNQEAYILFYVRQ  456

Query  1405  GT-PWFSEIIETQQLILDASISNSSPQPVLYSVD  1307
             G  PWFS ++E  +       S +SP  VL ++D
Sbjct  457   GMFPWFSSLLEEAR-------SGASPVSVLDNID  483



>emb|CBI38293.3| unnamed protein product [Vitis vinifera]
Length=520

 Score =   241 bits (616),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 131/324 (40%), Positives = 192/324 (59%), Gaps = 10/324 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G  + P
Sbjct  115   TCFLNSVLQCLTYTEPLAAYLQSGKHQNSCHIA--GFCALCAIQKHVSRALQSTGRILAP  172

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    +  +    +E ++V + FG
Sbjct  173   KDLVSNLRCISRNFRNARQEDAHEYMVNLLETMHKCCLPSGVPSESPSAYEKSLVHKIFG  232

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   DSL  AL  FT  E+++  E ++ C++C
Sbjct  233   GLLRSQVKCMQCSYCSNKFDPFLDLSLEIFKADSLHKALMHFTATEQLDGGERQYQCQRC  292

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQL + +AP V T HLKRF       +KI K V F P +DL P+V  + +  E
Sbjct  293   KQKVKALKQLTVHKAPYVLTIHLKRFGAHDP-GQKIDKKVHFGPTMDLKPFVSGSYE--E  349

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+LFYV
Sbjct  350   NLKYTLYGVLVHAGWSTHSGHYYCFVRTSTGMWYSLDDNRVVQVSERTVLDQKAYMLFYV  409

Query  1411  ---KQGTPWFS-EIIETQQLILDA  1352
                K  TP  S ++++ Q L+  A
Sbjct  410   RDRKNFTPKKSIDVVQKQNLVASA  433



>ref|XP_004986779.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 20-like [Setaria 
italica]
Length=828

 Score =   247 bits (631),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 138/325 (42%), Positives = 192/325 (59%), Gaps = 13/325 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN +LQC +H VPL+  +   DHP PC   + GFC  C+LK   + S+   GS   P
Sbjct  71    TCFLNCILQCMVHTVPLVLKLRKADHPDPCPRASIGFCCFCSLKLHADESIRLSGSAFYP  130

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             ++ VN+L   SS F+   Q DA EF    LE+L+     P+ + + S   E  + KQ FG
Sbjct  131   ERFVNHLKSISSNFESGVQQDAQEFFFDLLEKLDEAYVAPRSSEEPSSTEEGGIAKQIFG  190

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+L+C  C   SD  EP +DLSLE+  V+SL  AL SFTKVE IED    F C+ C
Sbjct  191   GRLKSQLRCPECKRCSDKSEPFIDLSLEVTMVESLMDALHSFTKVELIED----FMCDGC  246

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               +V++EK   +++AP V   HLKRF N      KI   V +P ELD+  ++  ++   +
Sbjct  247   NSRVNMEKHFKVEQAPEVLVIHLKRFTNSRG---KIWDKVKYPLELDINSFMSSSDDTPQ  303

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY+L+ VVVH G+    GHY C++ +S  +WY+F+D KV R  E  V+   AY+LFYV
Sbjct  304   --KYDLYGVVVHHGI-YGRGHYVCYIRSSVDDWYEFNDDKVCRCFEASVLDSAAYLLFYV  360

Query  1411  KQG-TPWFSEIIETQ-QLILDASIS  1343
             KQG +PWFS ++E + +   D S+S
Sbjct  361   KQGSSPWFSTLLEKEDKFPQDGSVS  385



>ref|XP_010929151.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
23-like [Elaeis guineensis]
Length=968

 Score =   246 bits (627),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 186/302 (62%), Gaps = 12/302 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  P    +++  H S C     GFC +CAL+  + ++L S G  + P
Sbjct  104   TCFLNSVLQCLTYTEPFAAYLQSGKHKSSCHTT--GFCAMCALQNHVMVALQSTGKILSP  161

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
               IV NL   S  F+ ++Q DAHE++   LE +  CC    +  +    +E ++V + FG
Sbjct  162   SHIVKNLRCISRNFRNYRQEDAHEYMVNLLESMHKCCLPSGVPSESRSAYEKSLVHKIFG  221

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   DSL  AL  FT VE+++  E ++ C++C
Sbjct  222   GRLRSQVKCMQCSYCSNKFDPFLDLSLEIVKADSLCKALAHFTAVEQLDGGERQYQCQRC  281

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYV-ERNEK  1601
             K +V   KQL +D+AP V T HLKRF   GS +  +KI + V F P LDL P++ + +E 
Sbjct  282   KEKVRALKQLTIDKAPYVLTIHLKRF---GSHIPGQKINRQVEFEPTLDLKPFISDAHEG  338

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
              +   KY L+ V+VH+G S+ SGHYYC+V  S   W+  DD++V++V E  V++Q+AY+L
Sbjct  339   NL---KYTLYGVLVHVGWSIHSGHYYCYVRTSSGMWHSLDDNQVSQVSEKTVLAQKAYML  395

Query  1420  FY  1415
             FY
Sbjct  396   FY  397



>ref|XP_009120313.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Brassica 
rapa]
Length=982

 Score =   244 bits (624),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 181/305 (59%), Gaps = 15/305 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL   ++   H   C     GFC LCA++  + I+L S G ++ P
Sbjct  98    TCYLNSVLQCLTYTEPLAAYLQDVAHEQRCRVA--GFCALCAMQRHVRIALQSTGRSLAP  155

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHEN-VVKQTFG  1952
             K +V+NL   S  F++ +Q DAHE++   LE +  CC    +  + S  + + +V + FG
Sbjct  156   KYLVSNLRCVSQNFRKCRQEDAHEYMINLLECMHKCCLASGVPSESSDAYRSSLVHKIFG  215

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H SD ++P +DLSL+I   DSL  AL  FT VE +++    + CE+C
Sbjct  216   GSLRSQVKCAQCSHCSDKFDPFLDLSLDISRADSLQRALLRFTAVELLDNGSKVYQCERC  275

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYV----ERNE  1604
             K +V   KQL + +AP V T HLKRF+   S  EKI K V FPP +D+ P+V    E N 
Sbjct  276   KQKVKAVKQLTVFKAPSVLTVHLKRFEAYRS--EKIDKKVEFPPAIDMKPFVSGPYEGN-  332

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
                   KY L+ V+VH G S+ SGHYYCFV  S   WY  DD++V +  E  V +Q+AY+
Sbjct  333   -----LKYTLYGVLVHCGGSIHSGHYYCFVRTSSGMWYSLDDNEVIQASEKTVFNQKAYM  387

Query  1423  LFYVK  1409
             LFYV+
Sbjct  388   LFYVR  392



>ref|XP_008659903.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 25-like isoform 
X4 [Zea mays]
Length=884

 Score =   244 bits (622),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/321 (41%), Positives = 190/321 (59%), Gaps = 18/321 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN VLQC +H VPL+  +   DHP PC   + GFC  C+LK  ++  +   GS+  P
Sbjct  251   TCFLNCVLQCMVHTVPLLLKLRKADHPDPCPRVSIGFCCYCSLKHHVDECMRLSGSSFYP  310

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKL-------NGQVSPKHENV  1970
             +  VN+L   SS F+   Q DA EFL+C L++L+     P+            S +  +V
Sbjct  311   EIFVNHLKSISSNFRSGVQQDAQEFLRCLLDKLDEDSIAPRFSEESSSSEESSSTEEGSV  370

Query  1969  VKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETK  1790
             VK+ F G L S+L+C  C H SD  EP +DLSL++  V++L  AL SFT  E I+D    
Sbjct  371   VKEIFSGCLKSQLRCPECNHYSDKSEPFLDLSLDLNMVETLMDALQSFTNTELIKD----  426

Query  1789  FTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVER  1610
             F C+ CK +V++EK   +++AP V   HLKRF N      KI   V FP ELD+  ++  
Sbjct  427   FMCDGCKSRVNLEKHFKIEQAPEVLVIHLKRFTN---FESKIRDKVKFPIELDINSFMSS  483

Query  1609  NEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEA  1430
             ++  ++  KY+L+ VV H+G +  SGHY C++ +S ++WYKF+D KV +      +   A
Sbjct  484   SDDTLQ--KYDLYGVVEHLG-AYGSGHYVCYIRSSEADWYKFNDDKVCKCSVASALDSAA  540

Query  1429  YILFYVKQG-TPWFSEIIETQ  1370
             Y+LFYVKQG +PWFS ++E +
Sbjct  541   YLLFYVKQGSSPWFSTLLEKE  561



>ref|XP_008659901.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 25-like isoform 
X2 [Zea mays]
Length=922

 Score =   244 bits (623),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/321 (41%), Positives = 190/321 (59%), Gaps = 18/321 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN VLQC +H VPL+  +   DHP PC   + GFC  C+LK  ++  +   GS+  P
Sbjct  251   TCFLNCVLQCMVHTVPLLLKLRKADHPDPCPRVSIGFCCYCSLKHHVDECMRLSGSSFYP  310

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKL-------NGQVSPKHENV  1970
             +  VN+L   SS F+   Q DA EFL+C L++L+     P+            S +  +V
Sbjct  311   EIFVNHLKSISSNFRSGVQQDAQEFLRCLLDKLDEDSIAPRFSEESSSSEESSSTEEGSV  370

Query  1969  VKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETK  1790
             VK+ F G L S+L+C  C H SD  EP +DLSL++  V++L  AL SFT  E I+D    
Sbjct  371   VKEIFSGCLKSQLRCPECNHYSDKSEPFLDLSLDLNMVETLMDALQSFTNTELIKD----  426

Query  1789  FTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVER  1610
             F C+ CK +V++EK   +++AP V   HLKRF N      KI   V FP ELD+  ++  
Sbjct  427   FMCDGCKSRVNLEKHFKIEQAPEVLVIHLKRFTN---FESKIRDKVKFPIELDINSFMSS  483

Query  1609  NEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEA  1430
             ++  ++  KY+L+ VV H+G +  SGHY C++ +S ++WYKF+D KV +      +   A
Sbjct  484   SDDTLQ--KYDLYGVVEHLG-AYGSGHYVCYIRSSEADWYKFNDDKVCKCSVASALDSAA  540

Query  1429  YILFYVKQG-TPWFSEIIETQ  1370
             Y+LFYVKQG +PWFS ++E +
Sbjct  541   YLLFYVKQGSSPWFSTLLEKE  561



>ref|XP_008659902.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 25-like isoform 
X3 [Zea mays]
Length=912

 Score =   244 bits (623),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/321 (41%), Positives = 190/321 (59%), Gaps = 18/321 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN VLQC +H VPL+  +   DHP PC   + GFC  C+LK  ++  +   GS+  P
Sbjct  240   TCFLNCVLQCMVHTVPLLLKLRKADHPDPCPRVSIGFCCYCSLKHHVDECMRLSGSSFYP  299

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKL-------NGQVSPKHENV  1970
             +  VN+L   SS F+   Q DA EFL+C L++L+     P+            S +  +V
Sbjct  300   EIFVNHLKSISSNFRSGVQQDAQEFLRCLLDKLDEDSIAPRFSEESSSSEESSSTEEGSV  359

Query  1969  VKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETK  1790
             VK+ F G L S+L+C  C H SD  EP +DLSL++  V++L  AL SFT  E I+D    
Sbjct  360   VKEIFSGCLKSQLRCPECNHYSDKSEPFLDLSLDLNMVETLMDALQSFTNTELIKD----  415

Query  1789  FTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVER  1610
             F C+ CK +V++EK   +++AP V   HLKRF N      KI   V FP ELD+  ++  
Sbjct  416   FMCDGCKSRVNLEKHFKIEQAPEVLVIHLKRFTN---FESKIRDKVKFPIELDINSFMSS  472

Query  1609  NEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEA  1430
             ++  ++  KY+L+ VV H+G +  SGHY C++ +S ++WYKF+D KV +      +   A
Sbjct  473   SDDTLQ--KYDLYGVVEHLG-AYGSGHYVCYIRSSEADWYKFNDDKVCKCSVASALDSAA  529

Query  1429  YILFYVKQG-TPWFSEIIETQ  1370
             Y+LFYVKQG +PWFS ++E +
Sbjct  530   YLLFYVKQGSSPWFSTLLEKE  550



>ref|XP_008794344.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like isoform 
X1 [Phoenix dactylifera]
Length=976

 Score =   244 bits (624),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 185/305 (61%), Gaps = 14/305 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  P    +++  H S C     GFC +CAL+  + ++L S G  + P
Sbjct  105   TCFLNSVLQCLTYTEPFAAYLQSGKHKSSCHTT--GFCAMCALQNHVMVALQSTGKILSP  162

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP--KHENVVKQTF  1955
               IV NL   S  F+ ++Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  163   SHIVKNLRCISRNFRNYRQEDAHEYMVNLLESMHKCC-LPSGVPSESPCAYEKSLVHKIF  221

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI   DSL  AL  FT+VE+++    ++ C++
Sbjct  222   GGRLRSQVKCMQCSYCSNKFDPFLDLSLEIVKADSLRKALAHFTEVEQLDGGGRQYQCQR  281

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYV-ERNE  1604
             CK +V   KQL +D+AP V T HLKRF   GS +  +KI K V F P LDL P+V + +E
Sbjct  282   CKEKVRALKQLTIDKAPCVLTIHLKRF---GSHIPGQKINKRVEFEPTLDLKPFVSDAHE  338

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
               +   KY L+ V+VH G S  SGHYYC+V  S   W+  DD++V +V E  V++Q+AY+
Sbjct  339   GNL---KYTLYGVLVHAGWSTHSGHYYCYVRTSSGTWHSLDDNQVRQVSEKTVLAQKAYM  395

Query  1423  LFYVK  1409
             LFYV+
Sbjct  396   LFYVR  400



>ref|XP_008659900.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 25-like isoform 
X1 [Zea mays]
Length=923

 Score =   244 bits (622),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/321 (41%), Positives = 190/321 (59%), Gaps = 18/321 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN VLQC +H VPL+  +   DHP PC   + GFC  C+LK  ++  +   GS+  P
Sbjct  251   TCFLNCVLQCMVHTVPLLLKLRKADHPDPCPRVSIGFCCYCSLKHHVDECMRLSGSSFYP  310

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKL-------NGQVSPKHENV  1970
             +  VN+L   SS F+   Q DA EFL+C L++L+     P+            S +  +V
Sbjct  311   EIFVNHLKSISSNFRSGVQQDAQEFLRCLLDKLDEDSIAPRFSEESSSSEESSSTEEGSV  370

Query  1969  VKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETK  1790
             VK+ F G L S+L+C  C H SD  EP +DLSL++  V++L  AL SFT  E I+D    
Sbjct  371   VKEIFSGCLKSQLRCPECNHYSDKSEPFLDLSLDLNMVETLMDALQSFTNTELIKD----  426

Query  1789  FTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVER  1610
             F C+ CK +V++EK   +++AP V   HLKRF N      KI   V FP ELD+  ++  
Sbjct  427   FMCDGCKSRVNLEKHFKIEQAPEVLVIHLKRFTN---FESKIRDKVKFPIELDINSFMSS  483

Query  1609  NEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEA  1430
             ++  ++  KY+L+ VV H+G +  SGHY C++ +S ++WYKF+D KV +      +   A
Sbjct  484   SDDTLQ--KYDLYGVVEHLG-AYGSGHYVCYIRSSEADWYKFNDDKVCKCSVASALDSAA  540

Query  1429  YILFYVKQG-TPWFSEIIETQ  1370
             Y+LFYVKQG +PWFS ++E +
Sbjct  541   YLLFYVKQGSSPWFSTLLEKE  561



>ref|XP_003634989.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like isoform 
X2 [Vitis vinifera]
 ref|XP_010646085.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like isoform 
X1 [Vitis vinifera]
Length=997

 Score =   244 bits (623),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 133/325 (41%), Positives = 192/325 (59%), Gaps = 12/325 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G  + P
Sbjct  115   TCFLNSVLQCLTYTEPLAAYLQSGKHQNSCHIA--GFCALCAIQKHVSRALQSTGRILAP  172

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  173   KDLVSNLRCISRNFRNARQEDAHEYMVNLLETMHKCC-LPSGVPSESPSAYEKSLVHKIF  231

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI   DSL  AL  FT  E+++  E ++ C++
Sbjct  232   GGLLRSQVKCMQCSYCSNKFDPFLDLSLEIFKADSLHKALMHFTATEQLDGGERQYQCQR  291

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +V   KQL + +AP V T HLKRF       +KI K V F P +DL P+V  + +  
Sbjct  292   CKQKVKALKQLTVHKAPYVLTIHLKRFGAHDP-GQKIDKKVHFGPTMDLKPFVSGSYE--  348

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
             E  KY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+LFY
Sbjct  349   ENLKYTLYGVLVHAGWSTHSGHYYCFVRTSTGMWYSLDDNRVVQVSERTVLDQKAYMLFY  408

Query  1414  V---KQGTPWFS-EIIETQQLILDA  1352
             V   K  TP  S ++++ Q L+  A
Sbjct  409   VRDRKNFTPKKSIDVVQKQNLVASA  433



>ref|XP_010086853.1| Ubiquitin carboxyl-terminal hydrolase 23 [Morus notabilis]
 gb|EXB24277.1| Ubiquitin carboxyl-terminal hydrolase 23 [Morus notabilis]
Length=931

 Score =   244 bits (622),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 135/346 (39%), Positives = 201/346 (58%), Gaps = 23/346 (7%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G ++ P
Sbjct  115   TCFLNSVLQCLTYTEPLAAYLQSGKHQNSCHVA--GFCALCAIQKHVSRALQSTGRSLAP  172

Query  2128  KKIVNNLSYF---------SSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--  1982
             K +V+NL YF         S  F+  +Q DAHE++   LE +  CC  P      SP   
Sbjct  173   KDLVSNLRYFVHLTAQTGISRNFRNARQEDAHEYMVNLLESMHKCC-LPSGVPSESPSAY  231

Query  1981  HENVVKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIED  1802
              +++V + FGG L S+++C  C   S+ ++P +DLSLEI   DSL  AL +FT  E ++ 
Sbjct  232   EKSLVHKIFGGSLRSQVKCLQCSFCSNKFDPFLDLSLEIIKADSLHKALLNFTAAELLDG  291

Query  1801  PETKFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLP  1622
              E ++ C++CK +V   KQL + +AP V T HLKRF+      +KI K VTF P LDL P
Sbjct  292   GERQYQCQRCKQKVRARKQLTVHKAPYVLTIHLKRFRAHDP-GQKIDKKVTFGPTLDLGP  350

Query  1621  YVERNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVM  1442
             +V  ++    + KY L+ V+VH G S  SGHYYC+V  S   WY  DDS+V +V E  V+
Sbjct  351   FV--SDSHAGDLKYTLYGVLVHYGWSTHSGHYYCYVRTSSGMWYSLDDSRVVQVSEKTVL  408

Query  1441  SQEAYILFYVKQGTPWFSE----IIETQQLILDASISNSSP--QPV  1322
              Q+AY+LFYV+  +   S+    + + + + ++    N+SP  QP+
Sbjct  409   EQKAYMLFYVRDRSNIASKKPLNVFQKESIKVNECGKNTSPYNQPL  454



>ref|XP_008794345.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like isoform 
X2 [Phoenix dactylifera]
Length=966

 Score =   244 bits (623),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 185/305 (61%), Gaps = 14/305 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  P    +++  H S C     GFC +CAL+  + ++L S G  + P
Sbjct  105   TCFLNSVLQCLTYTEPFAAYLQSGKHKSSCHTT--GFCAMCALQNHVMVALQSTGKILSP  162

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP--KHENVVKQTF  1955
               IV NL   S  F+ ++Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  163   SHIVKNLRCISRNFRNYRQEDAHEYMVNLLESMHKCC-LPSGVPSESPCAYEKSLVHKIF  221

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI   DSL  AL  FT+VE+++    ++ C++
Sbjct  222   GGRLRSQVKCMQCSYCSNKFDPFLDLSLEIVKADSLRKALAHFTEVEQLDGGGRQYQCQR  281

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYV-ERNE  1604
             CK +V   KQL +D+AP V T HLKRF   GS +  +KI K V F P LDL P+V + +E
Sbjct  282   CKEKVRALKQLTIDKAPCVLTIHLKRF---GSHIPGQKINKRVEFEPTLDLKPFVSDAHE  338

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
               +   KY L+ V+VH G S  SGHYYC+V  S   W+  DD++V +V E  V++Q+AY+
Sbjct  339   GNL---KYTLYGVLVHAGWSTHSGHYYCYVRTSSGTWHSLDDNQVRQVSEKTVLAQKAYM  395

Query  1423  LFYVK  1409
             LFYV+
Sbjct  396   LFYVR  400



>gb|AFW87760.1| putative ubiquitin carboxyl-terminal hydrolase superfamily protein 
[Zea mays]
Length=813

 Score =   242 bits (618),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 131/321 (41%), Positives = 190/321 (59%), Gaps = 18/321 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLN VLQC +H VPL+  +   DHP PC   + GFC  C+LK  ++  +   GS+  P
Sbjct  141   TCFLNCVLQCMVHTVPLLLKLRKADHPDPCPRVSIGFCCYCSLKHHVDECMRLSGSSFYP  200

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKL-------NGQVSPKHENV  1970
             +  VN+L   SS F+   Q DA EFL+C L++L+     P+            S +  +V
Sbjct  201   EIFVNHLKSISSNFRSGVQQDAQEFLRCLLDKLDEDSIAPRFSEESSSSEESSSTEEGSV  260

Query  1969  VKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETK  1790
             VK+ F G L S+L+C  C H SD  EP +DLSL++  V++L  AL SFT  E I+D    
Sbjct  261   VKEIFSGCLKSQLRCPECNHYSDKSEPFLDLSLDLNMVETLMDALQSFTNTELIKD----  316

Query  1789  FTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVER  1610
             F C+ CK +V++EK   +++AP V   HLKRF N      KI   V FP ELD+  ++  
Sbjct  317   FMCDGCKSRVNLEKHFKIEQAPEVLVIHLKRFTN---FESKIRDKVKFPIELDINSFMSS  373

Query  1609  NEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEA  1430
             ++  ++  KY+L+ VV H+G +  SGHY C++ +S ++WYKF+D KV +      +   A
Sbjct  374   SDDTLQ--KYDLYGVVEHLG-AYGSGHYVCYIRSSEADWYKFNDDKVCKCSVASALDSAA  430

Query  1429  YILFYVKQG-TPWFSEIIETQ  1370
             Y+LFYVKQG +PWFS ++E +
Sbjct  431   YLLFYVKQGSSPWFSTLLEKE  451



>ref|XP_010644060.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like isoform 
X2 [Vitis vinifera]
Length=946

 Score =   243 bits (621),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/325 (41%), Positives = 193/325 (59%), Gaps = 12/325 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G  + P
Sbjct  116   TCYLNSVLQCLTYTEPLAAYLQSGKHQNSCRIA--GFCALCAIQKHVSRALQSTGRILVP  173

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  174   KDLVSNLRCISRNFRNARQEDAHEYMVHLLETMHKCC-LPSGVPSESPSAYEKSLVHKIF  232

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI   DSL  AL  FT  E+++  E ++ C++
Sbjct  233   GGLLRSQVKCMQCSYCSNKFDPFLDLSLEIFKADSLHKALVHFTATEQLDGGERQYQCQR  292

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +V   KQL + +AP V T HLKRF       +KI K V F P +DL P+V  + +  
Sbjct  293   CKQKVKALKQLTVHKAPYVLTIHLKRFGAHDP-GQKIDKKVHFGPTMDLKPFVSGSYE--  349

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
             E  KY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+LFY
Sbjct  350   ENLKYTLYGVLVHAGWSTHSGHYYCFVRTSTGMWYSLDDNRVVQVSERTVLDQKAYMLFY  409

Query  1414  V---KQGTPWFS-EIIETQQLILDA  1352
             V   K  TP  S ++++ Q L++ A
Sbjct  410   VRDRKNFTPKKSIDVVQKQNLVVSA  434



>emb|CBI20097.3| unnamed protein product [Vitis vinifera]
Length=915

 Score =   243 bits (620),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/325 (41%), Positives = 193/325 (59%), Gaps = 12/325 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G  + P
Sbjct  116   TCYLNSVLQCLTYTEPLAAYLQSGKHQNSCRIA--GFCALCAIQKHVSRALQSTGRILVP  173

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  174   KDLVSNLRCISRNFRNARQEDAHEYMVHLLETMHKCC-LPSGVPSESPSAYEKSLVHKIF  232

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI   DSL  AL  FT  E+++  E ++ C++
Sbjct  233   GGLLRSQVKCMQCSYCSNKFDPFLDLSLEIFKADSLHKALVHFTATEQLDGGERQYQCQR  292

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +V   KQL + +AP V T HLKRF       +KI K V F P +DL P+V  + +  
Sbjct  293   CKQKVKALKQLTVHKAPYVLTIHLKRFGAHDP-GQKIDKKVHFGPTMDLKPFVSGSYE--  349

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
             E  KY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+LFY
Sbjct  350   ENLKYTLYGVLVHAGWSTHSGHYYCFVRTSTGMWYSLDDNRVVQVSERTVLDQKAYMLFY  409

Query  1414  V---KQGTPWFS-EIIETQQLILDA  1352
             V   K  TP  S ++++ Q L++ A
Sbjct  410   VRDRKNFTPKKSIDVVQKQNLVVSA  434



>ref|XP_010684486.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 [Beta vulgaris 
subsp. vulgaris]
Length=897

 Score =   243 bits (619),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 131/330 (40%), Positives = 193/330 (58%), Gaps = 11/330 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSV+QC  +  PL+  +++  H + C     GFC LCA+++ +N +L S G  + P
Sbjct  107   TCFLNSVIQCLTYTEPLVAYLQSGKHQNTCHVA--GFCALCAIQKHVNRALQSTGRILAP  164

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    +  + +  +E ++V + FG
Sbjct  165   KDLVSNLRCISRNFRNARQEDAHEYMIHLLESMHKCCLPSGVPVESAGAYEKSLVHKIFG  224

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H SDT++P +DLSLEI   DS+  AL  FT  E+++  E ++ CE+C
Sbjct  225   GRLRSQVKCMQCSHCSDTFDPFLDLSLEIMKADSVYKALMHFTAAEQLDGGEKQYKCERC  284

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQL + +AP V T HLKRF++     +KI K V F   L+L P+V    +   
Sbjct  285   KQKVRALKQLTVYKAPYVLTVHLKRFRHFAG--QKIDKKVHFGSGLNLKPFVSGAYE--G  340

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             E  Y L+ V+VH G S  SGHYY FV  S   WY  DD+KV +V E  VM Q+AY+LFYV
Sbjct  341   ELTYTLYGVLVHAGWSTHSGHYYSFVRTSSGLWYSLDDNKVIQVSEKTVMEQKAYMLFYV  400

Query  1411  KQ----GTPWFSEIIETQQLILDASISNSS  1334
             +     G     +++  + LI     ++SS
Sbjct  401   RDRKNIGPKKAMDVVHKENLITTMRNASSS  430



>emb|CDY32735.1| BnaA02g07970D [Brassica napus]
Length=801

 Score =   241 bits (616),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/301 (41%), Positives = 178/301 (59%), Gaps = 7/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSV+QC  +  PL   ++   H   C     GFC LCA+++ + ++L + G  + P
Sbjct  55    TCFLNSVVQCLTYTEPLAAYLQDVGHGRRCHMA--GFCALCAMQKHVRLALQASGKIVAP  112

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHEN-VVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    +  + S  + + +V + FG
Sbjct  113   KYLVSNLRCVSRNFRNCRQEDAHEYMINLLECMHRCCLPSGVPSESSDAYRSSLVHKIFG  172

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H SD ++P +DLSL+I   DSL  AL  FT VE ++D    + CE+C
Sbjct  173   GSLRSRVKCAQCSHCSDKFDPFLDLSLDISKADSLQRALSRFTAVELLDDGAKIYQCERC  232

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V  EKQ+ + +AP V T HLKRF+   S  EKI K V F   +D+ P+V  +     
Sbjct  233   KQKVRAEKQMTVSKAPYVLTVHLKRFEAHRS--EKIDKKVQFASAVDMKPFV--SGPYAG  288

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY L+ V+VH G S  SGHY CFV  S   WY  DD++V++V E  V +Q+AY+LFYV
Sbjct  289   NLKYTLYGVLVHYGRSSHSGHYACFVRTSSGMWYSLDDNRVSKVSEKTVFNQKAYMLFYV  348

Query  1411  K  1409
             +
Sbjct  349   R  349



>ref|XP_002283705.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like isoform 
X1 [Vitis vinifera]
Length=955

 Score =   243 bits (620),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 132/325 (41%), Positives = 193/325 (59%), Gaps = 12/325 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G  + P
Sbjct  116   TCYLNSVLQCLTYTEPLAAYLQSGKHQNSCRIA--GFCALCAIQKHVSRALQSTGRILVP  173

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  174   KDLVSNLRCISRNFRNARQEDAHEYMVHLLETMHKCC-LPSGVPSESPSAYEKSLVHKIF  232

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI   DSL  AL  FT  E+++  E ++ C++
Sbjct  233   GGLLRSQVKCMQCSYCSNKFDPFLDLSLEIFKADSLHKALVHFTATEQLDGGERQYQCQR  292

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +V   KQL + +AP V T HLKRF       +KI K V F P +DL P+V  + +  
Sbjct  293   CKQKVKALKQLTVHKAPYVLTIHLKRFGAHDP-GQKIDKKVHFGPTMDLKPFVSGSYE--  349

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
             E  KY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+LFY
Sbjct  350   ENLKYTLYGVLVHAGWSTHSGHYYCFVRTSTGMWYSLDDNRVVQVSERTVLDQKAYMLFY  409

Query  1414  V---KQGTPWFS-EIIETQQLILDA  1352
             V   K  TP  S ++++ Q L++ A
Sbjct  410   VRDRKNFTPKKSIDVVQKQNLVVSA  434



>emb|CDY55010.1| BnaA10g29360D [Brassica napus]
Length=850

 Score =   242 bits (617),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 127/305 (42%), Positives = 180/305 (59%), Gaps = 15/305 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL   ++   H   C     GFC LCA++  +  +L S G ++ P
Sbjct  98    TCYLNSVLQCLTYTEPLAAYLQDVAHEQRCRVA--GFCALCAMQRHVRTALQSTGRSVAP  155

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHEN-VVKQTFG  1952
             K +V+NL   S  F++ +Q DAHE++   LE +  CC    +  + S  + + +V + FG
Sbjct  156   KYLVSNLRCVSQNFRKCRQEDAHEYMINLLECMHKCCLASGVPSESSDAYRSSLVHKIFG  215

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H SD ++P +DLSL+I   DSL  AL  FT VE +++    + CE+C
Sbjct  216   GSLRSQVKCTQCSHCSDKFDPFLDLSLDISRADSLQRALLRFTAVELLDNGSKVYQCERC  275

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYV----ERNE  1604
             K +V   KQL + +AP V T HLKRF+   S  EKI K V FPP +D+ P+V    E N 
Sbjct  276   KQKVKAVKQLTVFKAPSVLTVHLKRFEAYRS--EKIDKKVEFPPAIDMKPFVSGPYEGN-  332

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
                   KY L+ V+VH G S+ SGHYYCFV  S   WY  DD++V +  E  V +Q+AY+
Sbjct  333   -----LKYTLYGVLVHCGGSIHSGHYYCFVRTSSGMWYSLDDNEVIQASEKTVFNQKAYM  387

Query  1423  LFYVK  1409
             LFYV+
Sbjct  388   LFYVR  392



>ref|XP_010265603.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X1 
[Nelumbo nucifera]
Length=971

 Score =   242 bits (618),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 127/304 (42%), Positives = 181/304 (60%), Gaps = 12/304 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  P    +++  H + C     GFC +CA++  +  +L S G  + P
Sbjct  117   TCFLNSVLQCLTYTEPFAAYLQSGKHQTSCRTA--GFCAMCAIQNHVRRALQSTGRILAP  174

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  175   KDLVMNLRCISRNFRNARQEDAHEYMVNLLESMHKCC-LPSGVPSESPSAYEKSLVHKIF  233

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI   DSL  AL  FT VE+++  E ++ C++
Sbjct  234   GGSLRSQVKCMQCSYCSNKFDPFLDLSLEINKADSLRKALTHFTAVEQLDGGEKQYQCQR  293

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEK  1601
             CK +V   KQL + +AP V T HLKRF   GS V  +KI K V F P LDL P+V  + +
Sbjct  294   CKQKVRALKQLTVHKAPYVLTIHLKRF---GSHVPGQKIDKRVEFGPSLDLKPFVSGSYE  350

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                + KY L+ V+VH G S  SGHYYCFV  S   W+  DD++V +V E  V+ Q+AY+L
Sbjct  351   --GDLKYTLYGVLVHAGWSTHSGHYYCFVRTSSGMWHSLDDNRVVQVSERTVLEQKAYML  408

Query  1420  FYVK  1409
             FYV+
Sbjct  409   FYVR  412



>ref|XP_010265604.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X2 
[Nelumbo nucifera]
Length=966

 Score =   242 bits (618),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 127/304 (42%), Positives = 181/304 (60%), Gaps = 12/304 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  P    +++  H + C     GFC +CA++  +  +L S G  + P
Sbjct  117   TCFLNSVLQCLTYTEPFAAYLQSGKHQTSCRTA--GFCAMCAIQNHVRRALQSTGRILAP  174

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  175   KDLVMNLRCISRNFRNARQEDAHEYMVNLLESMHKCC-LPSGVPSESPSAYEKSLVHKIF  233

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI   DSL  AL  FT VE+++  E ++ C++
Sbjct  234   GGSLRSQVKCMQCSYCSNKFDPFLDLSLEINKADSLRKALTHFTAVEQLDGGEKQYQCQR  293

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEK  1601
             CK +V   KQL + +AP V T HLKRF   GS V  +KI K V F P LDL P+V  + +
Sbjct  294   CKQKVRALKQLTVHKAPYVLTIHLKRF---GSHVPGQKIDKRVEFGPSLDLKPFVSGSYE  350

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                + KY L+ V+VH G S  SGHYYCFV  S   W+  DD++V +V E  V+ Q+AY+L
Sbjct  351   --GDLKYTLYGVLVHAGWSTHSGHYYCFVRTSSGMWHSLDDNRVVQVSERTVLEQKAYML  408

Query  1420  FYVK  1409
             FYV+
Sbjct  409   FYVR  412



>gb|KHG09713.1| Ubiquitin carboxyl-terminal hydrolase 23 -like protein [Gossypium 
arboreum]
Length=939

 Score =   242 bits (617),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 126/303 (42%), Positives = 185/303 (61%), Gaps = 10/303 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL+  +++  H + C     GFC LCA+++ ++ +L S G  + P
Sbjct  124   TCFLNSVLQCLTYTEPLVAYLQSGKHQNSCHIA--GFCALCAIQKHVSRALKSTGRILAP  181

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
               +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP+   +++V + F
Sbjct  182   NDLVSNLRCISRNFRNSRQEDAHEYMVNLLESMHKCC-LPSGVPSESPRAYEKSLVHKIF  240

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+T++P +DLSLEI   DSL  AL +FT  E ++  E ++ C++
Sbjct  241   GGRLRSQVKCLQCSYCSNTFDPFLDLSLEIVKADSLLKALKNFTTAELLDGGERQYQCQR  300

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVE-RNEKV  1598
             CK +V   KQL +  AP V T HLKRF+   +L +KI + V F P +D+ P+V   NE  
Sbjct  301   CKQKVRAIKQLTVYNAPHVLTIHLKRFQAH-NLGQKIERKVEFGPTIDMKPFVSGSNEGY  359

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
             +   KY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+LF
Sbjct  360   L---KYTLYGVLVHRGWSTHSGHYYCFVRTSSGMWYTLDDNRVFQVSEKTVLEQKAYMLF  416

Query  1417  YVK  1409
             YV+
Sbjct  417   YVR  419



>ref|XP_009366168.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Pyrus 
x bretschneideri]
Length=992

 Score =   242 bits (618),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 183/302 (61%), Gaps = 8/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++++L S G  + P
Sbjct  115   TCYLNSVLQCLTYTEPLAAYLQSGKHRNSCHIA--GFCALCAIQKHVSLALQSTGRILVP  172

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V NL   S TF + +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  173   KDLVINLRCISRTFTKSRQEDAHEYMVNLLESMHKCC-LPSGVPSESPSAYEKSLVHKIF  231

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI + DSL  AL +FT  E+++  E ++ C++
Sbjct  232   GGRLRSQVKCMQCSYCSNKFDPFLDLSLEIFNADSLQKALGNFTAAEQLDGGERQYQCQR  291

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             C  +V   KQ+ + + P V T HLKRF+       KI +HV F P LDL P+V  + +  
Sbjct  292   CNQKVRALKQMTVQKPPYVLTIHLKRFRAH-DPGRKIDRHVKFGPTLDLKPFVSGSYE--  348

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              E KY L+ V+VH G +  SGHYYC+V  S   WY  DD++V +V E  V+ Q+AY+LFY
Sbjct  349   GELKYTLYGVLVHCGATTYSGHYYCYVRTSSGMWYSLDDNQVYQVSERTVLEQKAYMLFY  408

Query  1414  VK  1409
             V+
Sbjct  409   VR  410



>ref|XP_002454445.1| hypothetical protein SORBIDRAFT_04g031200 [Sorghum bicolor]
 gb|EES07421.1| hypothetical protein SORBIDRAFT_04g031200 [Sorghum bicolor]
Length=697

 Score =   239 bits (609),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 133/288 (46%), Positives = 172/288 (60%), Gaps = 6/288 (2%)
 Frame = -1

Query  2164  ISLASKGSTIRPKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP  1985
             I + S  S      ++N     SS F+  QQ DAHEFL+C L+ L  C   PK  G+ S 
Sbjct  202   IRMGSVLSVPLKNMLMNQFEELSSDFRPGQQEDAHEFLRCLLDNLHKCTLDPKSKGKDSS  261

Query  1984  -KHENVVKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERI  1808
                E++VK+ FGG L S L CC CGH S+T+EP +DLSLEI+ VD L  AL SFTKVE I
Sbjct  262   FDEESIVKEIFGGQLRSHLSCCECGHSSETFEPFLDLSLEIDQVDHLVDALQSFTKVEHI  321

Query  1807  EDPETKFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDL  1628
              D E K TCE C  QV   KQL L  AP V  FHLKRF    + VEKI KHV +P E+DL
Sbjct  322   GDSENKLTCESCNAQVCKNKQLTLHRAPDVIAFHLKRFTTLDNSVEKIDKHVVYPLEVDL  381

Query  1627  LPYVERNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENV  1448
              P+   N     E KY+L+ VV H G+  + GHY C + +SPS W   D  +V  + ++ 
Sbjct  382   KPFYS-NPDAAGELKYDLYGVVEHSGLP-NYGHYVCAIRSSPSTWQ--DILQVDSITDSS  437

Query  1447  VMSQEAYILFYVKQGT-PWFSEIIETQQLILDASISNSSPQPVLYSVD  1307
              ++QEAYILFYV+QG  PWFS ++E +  +   +   +SP  VL ++D
Sbjct  438   ALNQEAYILFYVRQGKFPWFSSLLEGKDALQVENTRGTSPVSVLENID  485



>ref|XP_010536980.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 [Tarenaya 
hassleriana]
Length=925

 Score =   241 bits (616),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 122/301 (41%), Positives = 178/301 (59%), Gaps = 7/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H   C     GFC LCA+++ +  +L + G  + P
Sbjct  114   TCFLNSVLQCLTYTEPLAAYLQSAAHQKSCHVA--GFCALCAIQKHVRTALQATGRILAP  171

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQ-VSPKHENVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    +  + +     ++V + FG
Sbjct  172   KDLVSNLRCISRNFRNCRQEDAHEYMINLLECMHKCCLPSGVPSESLDAYKSSLVHKIFG  231

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H SDT++P +DLSL+I   DSL  AL  FT VE ++D    + CE+C
Sbjct  232   GRLRSQVKCTQCSHCSDTFDPFLDLSLDIARADSLQKALSHFTAVELLDDGAKIYQCERC  291

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQL + +AP V T H KRF+   S  EKI K V F P +D+ P+V  + +   
Sbjct  292   KQKVKAVKQLTVSKAPYVLTIHFKRFEAHRS--EKIDKKVQFVPTIDMKPFVSGSYE--G  347

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY L+ V+VH G S+ SGHY CF+  +   WY  DD++V +V E  V  Q+AY+LFYV
Sbjct  348   DLKYTLYGVLVHYGRSIHSGHYSCFIRTASGMWYSLDDNRVKQVAERTVFDQKAYMLFYV  407

Query  1411  K  1409
             +
Sbjct  408   R  408



>ref|XP_009391112.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Musa 
acuminata subsp. malaccensis]
Length=942

 Score =   241 bits (614),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 147/410 (36%), Positives = 220/410 (54%), Gaps = 18/410 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSV+QC  +  P    +++  H S C     GFC +CAL+  +  +L S G  + P
Sbjct  107   TCFLNSVIQCLTYTEPFAAYLQSGKHKSSCHTT--GFCAMCALQNHVITALQSSGKILSP  164

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
               +V NL   S  F+  +Q DAHE++   LE +  CC    +  +    +E ++V + FG
Sbjct  165   SHLVKNLRCISRNFRNSRQEDAHEYMVNLLESMHKCCLPSGVPSESPSAYERSLVHKIFG  224

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S  ++P +DLSLEI   DSL  AL  FT VE+++  + ++ C++C
Sbjct  225   GRLRSQVKCMQCSYSSSKFDPFLDLSLEIVKADSLRKALAHFTAVEQLDGGQRQYQCQRC  284

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEKV  1598
             K +V   KQL + +AP V T HLKRF   GS V  +KI K VTF P LDL P+V  +++ 
Sbjct  285   KEKVRALKQLTIHKAPYVLTIHLKRF---GSHVPGQKIDKKVTFEPTLDLKPFV--SDQH  339

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
               + KY L+ V+VH G S  SGHYYC+V  S   W+  DD++V +V E +V+ Q+AY+LF
Sbjct  340   GGDLKYTLYGVLVHAGWSTHSGHYYCYVRTSSGMWHSLDDNQVRQVSEKIVLVQKAYMLF  399

Query  1417  YVKQ--GTPWFSEIIETQQLILDASISNS----SPQPVLYSVDQIFNPYPKMETDRPCDV  1256
             YV+    TP  S     +  I  ++I       S   V     QI     K+ T     V
Sbjct  400   YVRDRGSTPKGSINTVCKDNISASAIGKKLIPESSSLVSSGAAQISATERKLSTSESISV  459

Query  1255  NETDNAADEASSNVDGPKDNGIDR--SDGKENSNVVSALIHEGMNNSSDI  1112
                 +A +  S  VD    N + +  S  ++N N   + + E  NN+ ++
Sbjct  460   KTRTDATNIQSGLVDASSPNPLHQAASTLRKNDNNALSEVPELHNNTQEV  509



>ref|XP_009358449.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like isoform 
X2 [Pyrus x bretschneideri]
Length=1003

 Score =   241 bits (615),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 183/301 (61%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++++L S G  + P
Sbjct  117   TCYLNSVLQCLTYTEPLAAYLQSGKHQNSCHIA--GFCALCAIQKHVSLALQSTGRILVP  174

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V NL   S TF + +Q DAHE++   LE +  CC    L  +    +E ++V + FG
Sbjct  175   KDLVINLRCISRTFTKSRQEDAHEYMVNLLESMHKCCLPSGLPSESPSAYEKSLVHKIFG  234

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI + DSL  AL  FT  E+++  E ++ C++C
Sbjct  235   GRLRSQVKCLQCSYCSNKFDPFLDLSLEIFNADSLQKALAKFTASEQLDGGERQYQCQRC  294

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               +V   KQ+ + + P V T HLKRF+       KI +HV F P LDL P+V  + +   
Sbjct  295   NQKVQALKQMTVQKPPYVLTIHLKRFRAHDP-GRKIDRHVKFGPTLDLKPFVSGSYE--G  351

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY L+ V+VH G +  SGHYYC+V  S   WY  DD++V +V E +V+ Q+AY+LFYV
Sbjct  352   DLKYTLYGVLVHCGATTYSGHYYCYVRTSSGMWYSLDDNQVYQVSERIVLEQKAYMLFYV  411

Query  1411  K  1409
             +
Sbjct  412   R  412



>ref|XP_009358448.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like isoform 
X1 [Pyrus x bretschneideri]
Length=1004

 Score =   241 bits (615),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 183/301 (61%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++++L S G  + P
Sbjct  117   TCYLNSVLQCLTYTEPLAAYLQSGKHQNSCHIA--GFCALCAIQKHVSLALQSTGRILVP  174

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V NL   S TF + +Q DAHE++   LE +  CC    L  +    +E ++V + FG
Sbjct  175   KDLVINLRCISRTFTKSRQEDAHEYMVNLLESMHKCCLPSGLPSESPSAYEKSLVHKIFG  234

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI + DSL  AL  FT  E+++  E ++ C++C
Sbjct  235   GRLRSQVKCLQCSYCSNKFDPFLDLSLEIFNADSLQKALAKFTASEQLDGGERQYQCQRC  294

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
               +V   KQ+ + + P V T HLKRF+       KI +HV F P LDL P+V  + +   
Sbjct  295   NQKVQALKQMTVQKPPYVLTIHLKRFRAHDP-GRKIDRHVKFGPTLDLKPFVSGSYE--G  351

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY L+ V+VH G +  SGHYYC+V  S   WY  DD++V +V E +V+ Q+AY+LFYV
Sbjct  352   DLKYTLYGVLVHCGATTYSGHYYCYVRTSSGMWYSLDDNQVYQVSERIVLEQKAYMLFYV  411

Query  1411  K  1409
             +
Sbjct  412   R  412



>emb|CDY02782.1| BnaC02g11070D [Brassica napus]
Length=801

 Score =   239 bits (610),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/301 (41%), Positives = 177/301 (59%), Gaps = 7/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSV+QC  +  PL   ++   H   C     GFC LCA+++ + ++L + G  + P
Sbjct  55    TCFLNSVVQCLTYTEPLAAYLQDVGHGRRCHMA--GFCALCAMQKHVRLALQASGKIVAP  112

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHEN-VVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    +  + S  + + +V + FG
Sbjct  113   KYLVSNLRCVSRNFRNCRQEDAHEYMINLLECMHRCCLPSGVPSESSDAYRSSLVHKIFG  172

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H SD ++P +DLSL+I   DSL  AL  FT  E ++D    + CE+C
Sbjct  173   GSLRSRVKCAQCSHCSDKFDPFLDLSLDISKADSLQRALSRFTADELLDDGAKVYQCERC  232

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQL + +AP V T HLKRF+   S  EKI K V F   +D+ P+V  +     
Sbjct  233   KQKVRAVKQLTVSKAPYVLTVHLKRFEAHRS--EKIDKKVQFASAVDMKPFV--SGPCAG  288

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY L+ V+VH G S  SGHY CFV  S   WY  DD++V++V EN V +Q+AY+LFYV
Sbjct  289   NLKYTLYGVLVHYGRSSHSGHYACFVRTSSGMWYSLDDNRVSKVSENTVFNQKAYMLFYV  348

Query  1411  K  1409
             +
Sbjct  349   R  349



>ref|NP_001048381.1| Os02g0795000 [Oryza sativa Japonica Group]
 dbj|BAD19267.1| putative hematopoietic-specific IL-2 deubiquitinating enzyme 
[Oryza sativa Japonica Group]
 dbj|BAF10295.1| Os02g0795000 [Oryza sativa Japonica Group]
Length=1185

 Score =   242 bits (618),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 185/304 (61%), Gaps = 6/304 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P +  +++ +H S C     GFC LCAL+  +N +L S G  +RP
Sbjct  94    TCYLNSVLQCLTYTEPFVAYLQSGEHMSSCRTI--GFCALCALQRHVNSALQSTGKILRP  151

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKL-NGQVSPKHENVVKQTFG  1952
               IV NL   S +F+  +Q DAHE +   LE +  CC    + +G  S   +++V + FG
Sbjct  152   VHIVRNLRCISRSFRISRQEDAHELMVSLLESMHKCCLPSGVPSGSPSAYEKSLVHRIFG  211

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H S+ ++P +DLSLEI +  +L  AL  FT  E ++  E ++ CE C
Sbjct  212   GLLRSQVRCTTCSHCSNKFDPFLDLSLEIANAATLVKALQHFTAEELLDGGEKQYNCEHC  271

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             + +V  +K+ ++++AP V T HLKRF +  +   KI K V F P L+L PYV   E +  
Sbjct  272   RQKVVAKKRFMIEKAPSVLTIHLKRF-SPFNPRHKIDKKVQFQPTLNLKPYVSNPEGM--  328

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             E KY+L+ V+VH G +  SGHYYCFV  S   W+  DD+KV +V+E  V+ Q+AY+LFYV
Sbjct  329   EFKYSLYGVLVHAGWNTQSGHYYCFVRTSSGIWHNLDDNKVYQVREADVLRQKAYMLFYV  388

Query  1411  KQGT  1400
             +  T
Sbjct  389   RDRT  392



>ref|XP_002437970.1| hypothetical protein SORBIDRAFT_10g005680 [Sorghum bicolor]
 gb|EER89337.1| hypothetical protein SORBIDRAFT_10g005680 [Sorghum bicolor]
Length=917

 Score =   240 bits (612),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 184/301 (61%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P    +++  H S C A   GFC LCAL+  +  +L S G  + P
Sbjct  98    TCYLNSVLQCLTYTEPFAAYLQSGKHKSSCRA--SGFCALCALQNHVKTALESTGKIVTP  155

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
              +IV NL   S TF+  +Q DAHE +   LE +  CC    +  +    ++ ++V + FG
Sbjct  156   FRIVKNLRCISRTFRNSRQEDAHELMVNLLESMHKCCLPSGVPSESQSAYDKSLVHKIFG  215

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H S+ ++P +DLSL+I    +L  AL++FT+ E ++  + ++ CE+C
Sbjct  216   GRLRSQVKCTRCSHCSNKFDPFLDLSLDIAKATTLVRALENFTEDELLDGGQKQYQCERC  275

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             + +V  +K+  +D+AP V T HLKRF +  +  EKI K V F P LDL P+V  ++    
Sbjct  276   RQKVVAKKRFTIDKAPNVLTIHLKRF-SPFNPREKIDKKVDFQPSLDLKPFVSDSKGT--  332

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY+L+ V+VH G +  SGHYYCFV  S   W+  DD+KV +V+E  V+ Q+AY+LFYV
Sbjct  333   DFKYSLYGVLVHTGWNTQSGHYYCFVRTSSGMWHNLDDNKVRQVREADVLKQKAYMLFYV  392

Query  1411  K  1409
             +
Sbjct  393   R  393



>emb|CDY57464.1| BnaC09g33510D [Brassica napus]
Length=848

 Score =   239 bits (610),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 179/305 (59%), Gaps = 15/305 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL   ++   H   C     GFC LCA++  +  +L S G ++ P
Sbjct  100   TCYLNSVLQCLTYTEPLAAYLQDVAHEQRCRVA--GFCALCAMQRHVRTALQSTGRSLAP  157

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHEN-VVKQTFG  1952
             K +V+NL   S  F++ +Q DAHE++   LE +  CC    +  + S  + + +V Q FG
Sbjct  158   KYLVSNLRCVSQNFRKCRQEDAHEYMINLLECMHKCCLPSGVPSESSDAYRSSLVHQIFG  217

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H SD ++P +DLSL+I   DSL  AL  FT VE +++    + CE+C
Sbjct  218   GSLRSQVKCAQCSHCSDKFDPFLDLSLDISRADSLQRALLRFTAVELLDNGSKVYQCERC  277

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYV----ERNE  1604
             + +V   KQL + +AP V T HLKRF+   S  EKI K V FP  +D+ P+V    E N 
Sbjct  278   RQKVKAIKQLTVFKAPSVLTVHLKRFEPHRS--EKIDKKVEFPSAIDMKPFVSGPYEGN-  334

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
                   KY L+ V+VH G S+ SGHYYCFV  S   WY  DD++V +  E  V +Q+AY+
Sbjct  335   -----LKYTLYGVLVHYGGSIHSGHYYCFVRTSSGMWYSLDDNEVIQASEKTVFNQKAYM  389

Query  1423  LFYVK  1409
             LFYV+
Sbjct  390   LFYVR  394



>ref|XP_010235918.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like isoform 
X2 [Brachypodium distachyon]
Length=1039

 Score =   240 bits (613),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 185/301 (61%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P +  +++  H S C     GFC LCAL+  +  +L S G  + P
Sbjct  90    TCYLNSVLQCLTYTEPFVAYLQSGKHKSSCRTA--GFCALCALQNHVRCALQSTGKILTP  147

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
              + V NL   S +F+ ++Q DAHE +   LE +  CC    +  Q    +E ++V + FG
Sbjct  148   MQFVKNLRCISRSFRNYRQEDAHELMVNLLESMHKCCLPSGMPSQSPSAYEKSLVHRIFG  207

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C +C H S  ++P +DLSLEI +  +L  AL +FT+ E ++D E ++ C+ C
Sbjct  208   GRLRSQVKCVSCSHCSSKFDPFLDLSLEIANAATLVKALQNFTEEELLDDGEKQYNCQHC  267

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             + +V+ +K+  +D+AP V T HLKRF +  +   KI K V F P LDL P+V  +E +  
Sbjct  268   RQKVAAKKRFTIDKAPDVLTIHLKRF-SPFNPRHKIDKKVDFQPTLDLKPFVSNSEDM--  324

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + +YNL+ V+VH G +  +GHYYCFV  S   W+  DD++V +V+E  V+ Q+AY+LFYV
Sbjct  325   DFRYNLYGVLVHAGWNTQAGHYYCFVRTSSGMWHNLDDNQVHQVREADVLRQKAYMLFYV  384

Query  1411  K  1409
             +
Sbjct  385   R  385



>ref|XP_003572898.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like isoform 
X1 [Brachypodium distachyon]
Length=1051

 Score =   240 bits (613),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 185/301 (61%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P +  +++  H S C     GFC LCAL+  +  +L S G  + P
Sbjct  90    TCYLNSVLQCLTYTEPFVAYLQSGKHKSSCRTA--GFCALCALQNHVRCALQSTGKILTP  147

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
              + V NL   S +F+ ++Q DAHE +   LE +  CC    +  Q    +E ++V + FG
Sbjct  148   MQFVKNLRCISRSFRNYRQEDAHELMVNLLESMHKCCLPSGMPSQSPSAYEKSLVHRIFG  207

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C +C H S  ++P +DLSLEI +  +L  AL +FT+ E ++D E ++ C+ C
Sbjct  208   GRLRSQVKCVSCSHCSSKFDPFLDLSLEIANAATLVKALQNFTEEELLDDGEKQYNCQHC  267

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             + +V+ +K+  +D+AP V T HLKRF +  +   KI K V F P LDL P+V  +E +  
Sbjct  268   RQKVAAKKRFTIDKAPDVLTIHLKRF-SPFNPRHKIDKKVDFQPTLDLKPFVSNSEDM--  324

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + +YNL+ V+VH G +  +GHYYCFV  S   W+  DD++V +V+E  V+ Q+AY+LFYV
Sbjct  325   DFRYNLYGVLVHAGWNTQAGHYYCFVRTSSGMWHNLDDNQVHQVREADVLRQKAYMLFYV  384

Query  1411  K  1409
             +
Sbjct  385   R  385



>ref|XP_010545453.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Tarenaya 
hassleriana]
Length=920

 Score =   239 bits (611),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 177/302 (59%), Gaps = 11/302 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H   C     GFC LCA+++ +  +L + G  + P
Sbjct  113   TCFLNSVLQCLTYTEPLAAYLQSAAHQKSCHVA--GFCALCAIQKHVRTALQANGRILAP  170

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC---NYPKLNGQVSPKHENVVKQT  1958
             K +V+NL   S  F+  +Q DAHE++   LE +  CC     P  +G +     ++V + 
Sbjct  171   KDLVSNLRCISRNFRNCRQEDAHEYMINLLECMHKCCLPSGVP--SGSLDAYKSSLVHKI  228

Query  1957  FGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCE  1778
             FGG L S+++C  C H SDT++P +DLSL+I   DSL  AL  FT VE ++D    + CE
Sbjct  229   FGGRLRSQVKCMQCSHCSDTFDPFLDLSLDIARADSLQKALSHFTAVELLDDGSKIYQCE  288

Query  1777  KCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKV  1598
             +CK +V   KQL + +AP + TFH KRF+   S  EK  K + F   +D+ P+V  + + 
Sbjct  289   RCKQKVKAVKQLTVSKAPNILTFHFKRFEAYHS--EKNDKKIQFGSTIDMKPFVSGSYE-  345

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
               + KYNL+ V+VH G S+ SGHY CF+      WY  DD++V +V E  V  Q+AY+LF
Sbjct  346   -GDLKYNLYGVLVHYGRSVHSGHYACFIRTKSGMWYSLDDNRVKQVAEKTVFDQKAYMLF  404

Query  1417  YV  1412
             YV
Sbjct  405   YV  406



>ref|XP_008384418.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 [Malus domestica]
Length=984

 Score =   239 bits (611),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 182/302 (60%), Gaps = 8/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++++L S G  + P
Sbjct  108   TCYLNSVLQCLTYTEPLAAYLQSGKHRNSCHIA--GFCALCAIQKHVSLALQSTGRILVP  165

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V NL   S TF + +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  166   KDLVINLXCISRTFTKSRQEDAHEYMVNLLESMHKCC-LPSGVPSESPSAYEKSLVHKIF  224

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI + DSL  AL +FT  E+++  E ++ C++
Sbjct  225   GGRLRSQVKCMQCSYCSNKFDPFLDLSLEIFNADSLQKALGNFTAAEQLDGGERQYQCQR  284

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             C  +V   KQ+ + + P V T HLKRF+       KI +HV F P LDL P+V  + +  
Sbjct  285   CNQKVRALKQMTVQKPPYVLTIHLKRFRAHDP-GRKIDRHVKFGPTLDLKPFVSGSYE--  341

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              + KY L+ V+VH G +  SGHYYC+V  S   WY  DD++V +V E  V+ Q AY+LFY
Sbjct  342   GDLKYTLYGVLVHCGATTYSGHYYCYVRTSSGMWYSLDDNQVYQVSERTVLEQXAYMLFY  401

Query  1414  VK  1409
             V+
Sbjct  402   VR  403



>ref|XP_002989234.1| hypothetical protein SELMODRAFT_1651, partial [Selaginella moellendorffii]
 gb|EFJ09672.1| hypothetical protein SELMODRAFT_1651, partial [Selaginella moellendorffii]
Length=309

 Score =   226 bits (575),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 124/306 (41%), Positives = 183/306 (60%), Gaps = 12/306 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL + +++  H   C++   GFC +CAL+  +  +L S G  I P
Sbjct  10    TCFLNSVLQCLTYTQPLAEFLKSGQHKLLCKS--SGFCAMCALEGHVRNALQSWGKVIAP  67

Query  2128  KKIVNNLSY----FSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVK  1964
               +++ ++Y     S  FQ ++Q DAHEFL+  +E L+  C  P      SP+ E  ++ 
Sbjct  68    NHMISRVNYSNAGISRAFQPWRQEDAHEFLRYLMEALQKDC-LPSKTPMNSPEQEKTLLY  126

Query  1963  QTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFT  1784
             + FGG L S+++C NC  RS+T +P +DLSL+I   DSL  AL  FT  E I D + K+ 
Sbjct  127   KIFGGRLRSQVKCSNCLERSETVDPFLDLSLDITRADSLGKALAWFTANE-ILDGDNKYH  185

Query  1783  CEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNE  1604
             CEKCK +V   K+  ++ AP V T   KRF + G   +KI K V F  +LD+ P++    
Sbjct  186   CEKCKKKVRAIKRFTIETAPNVLTVQFKRFSSTGLHGQKIDKKVHFGRKLDITPFMSNAR  245

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
                + + Y+L+ V+VH G S  SGHYYCFV  S   W+  DDS+V ++ E  V++Q+AYI
Sbjct  246   ---DGAVYDLYGVLVHAGWSTRSGHYYCFVRTSSDMWHVLDDSRVQQLSEQTVLNQKAYI  302

Query  1423  LFYVKQ  1406
             LFY+++
Sbjct  303   LFYIRK  308



>ref|XP_007011945.1| Ubiquitin carboxyl-terminal hydrolase, putative [Theobroma cacao]
 gb|EOY29564.1| Ubiquitin carboxyl-terminal hydrolase, putative [Theobroma cacao]
Length=970

 Score =   239 bits (611),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 126/303 (42%), Positives = 181/303 (60%), Gaps = 10/303 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G  + P
Sbjct  125   TCFLNSVLQCLTYTEPLAAYLQSGKHQNSCRIA--GFCALCAIQKHVSRALQSTGRILAP  182

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
               +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  183   NDLVSNLRCISRNFRNSRQEDAHEYMVHLLESMHKCC-LPSGVPSESPSAYEKSLVHKIF  241

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+T++P +DLSLEI   DSL  AL +FT  E ++  E ++ C+ 
Sbjct  242   GGRLRSQVKCMQCAYCSNTFDPFLDLSLEIAKADSLLKALKNFTAAELLDGGEKQYQCQH  301

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVER-NEKV  1598
             CK +V   KQL + +AP V T HLKRF+      +KI + V F P LD+ P+V   NE  
Sbjct  302   CKHKVRAIKQLTVYKAPHVLTIHLKRFRAH-DFGQKIDRKVEFGPTLDMKPFVSGPNEGD  360

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
             +   KY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+LF
Sbjct  361   L---KYTLYGVLVHCGWSTHSGHYYCFVRTSSGMWYSLDDNRVFQVSERTVLEQKAYMLF  417

Query  1417  YVK  1409
             YV+
Sbjct  418   YVR  420



>ref|XP_002965992.1| hypothetical protein SELMODRAFT_1903, partial [Selaginella moellendorffii]
 gb|EFJ33412.1| hypothetical protein SELMODRAFT_1903, partial [Selaginella moellendorffii]
Length=309

 Score =   225 bits (574),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 124/306 (41%), Positives = 183/306 (60%), Gaps = 12/306 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL + +++  H   C++   GFC +CAL+  +  +L S G  I P
Sbjct  10    TCFLNSVLQCLTYTQPLAEFLKSGQHKLLCKS--SGFCAMCALEGHVKNALQSWGKVIAP  67

Query  2128  KKIVNNLSY----FSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVK  1964
               +++ ++Y     S  FQ ++Q DAHEFL+  +E L+  C  P      SP+ E  ++ 
Sbjct  68    NHMISRVNYSNAGISRAFQPWRQEDAHEFLRYLMEALQKDC-LPSKTPMNSPEQEKTLLY  126

Query  1963  QTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFT  1784
             + FGG L S+++C NC  RS+T +P +DLSL+I   DSL  AL  FT  E I D + K+ 
Sbjct  127   KIFGGRLRSQVKCSNCLERSETVDPFLDLSLDITRADSLGKALAWFTANE-ILDGDNKYH  185

Query  1783  CEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNE  1604
             CEKCK +V   K+  ++ AP V T   KRF + G   +KI K V F  +LD+ P++    
Sbjct  186   CEKCKKKVRAIKRFTIETAPNVLTVQFKRFSSTGLHGQKIDKKVHFGRKLDITPFMSNAR  245

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
                + + Y+L+ V+VH G S  SGHYYCFV  S   W+  DDS+V ++ E  V++Q+AYI
Sbjct  246   ---DGAVYDLYGVLVHAGWSTRSGHYYCFVRTSSDMWHVLDDSRVQQLSEQTVLNQKAYI  302

Query  1423  LFYVKQ  1406
             LFY+++
Sbjct  303   LFYIRK  308



>gb|KDO59444.1| hypothetical protein CISIN_1g036257mg [Citrus sinensis]
Length=418

 Score =   229 bits (583),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 182/301 (60%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H S C     GFC LCA+++ ++ +L + G  + P
Sbjct  105   TCFLNSVLQCLTYTEPLAAYLQSGKHQSSCHIA--GFCALCAIQKHVSRALQATGRILAP  162

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    +  + +  +E ++V + FG
Sbjct  163   KDLVSNLRCISRNFRNSRQEDAHEYMVNLLESMHKCCLPSGVPSESANAYEKSLVHKIFG  222

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   DS+  AL++FT  E ++  E ++ C++C
Sbjct  223   GRLRSQVKCTQCSYCSNKFDPFLDLSLEIAKADSVLKALNNFTAAELLDGGEKEYHCQRC  282

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQL + +AP V T HLKRF+      +K  K V F   LD+ P+V  + +   
Sbjct  283   KQKVRALKQLTVYKAPYVLTIHLKRFRAHDP-GQKNDKKVQFGSTLDMKPFVSGSYE--G  339

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+LFYV
Sbjct  340   DLKYTLYGVLVHHGWSTHSGHYYCFVRTSSGMWYSLDDNRVVQVNERSVLEQKAYMLFYV  399

Query  1411  K  1409
             +
Sbjct  400   R  400



>ref|XP_008394326.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 36-like [Malus 
domestica]
Length=1005

 Score =   239 bits (610),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 120/302 (40%), Positives = 183/302 (61%), Gaps = 8/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++++L S G  + P
Sbjct  117   TCYLNSVLQCLTYTEPLAAYLQSGKHRNSCHIA--GFCALCAIQKHVSLALQSTGRILVP  174

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V NL   S TF + +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  175   KDLVINLRCISRTFTKSRQEDAHEYMVNLLESMHKCC-LPSGVPSESPSAYEKSLVHKIF  233

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI + DS+  AL  FT  E+++  E ++ C++
Sbjct  234   GGRLRSQVKCLQCSYCSNKFDPFLDLSLEIFNADSVQKALAKFTASEQLDGGERQYQCQR  293

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             C  +V   KQ+ + + P V T HLKRF+       KI +HV F P LDL P+V  + +  
Sbjct  294   CNQKVRALKQMTVQKPPYVLTIHLKRFRAHDP-GRKIDRHVKFAPTLDLKPFVSGSYE--  350

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              + KY L+ V+VH G +  SGHYYC+V  S   WY  DD++V +V E +V+ Q+AY+LFY
Sbjct  351   GDLKYTLYGVLVHCGATTYSGHYYCYVRTSSGMWYSLDDNQVYQVSERIVLEQKAYMLFY  410

Query  1414  VK  1409
             V+
Sbjct  411   VR  412



>gb|AAO72607.1| putative ubiquitin-specific protease [Oryza sativa Japonica Group]
Length=842

 Score =   238 bits (607),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 181/302 (60%), Gaps = 8/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P    +++  H S C     GFC LCAL+  +  +L S G  + P
Sbjct  10    TCYLNSVLQCLTYTEPFAAYLQSGKHKSSCRTA--GFCALCALQNHVKTALQSTGKIVTP  67

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
              +IV NL   S +F+  +Q DAHE +   LE +  CC  P      SP    +++V + F
Sbjct  68    SQIVKNLRCISRSFRNSRQEDAHELMVNLLESMHKCC-LPSGVPSESPSAYEKSLVHKIF  126

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C H S+ ++P +DLSL+I    SL  AL +FT  E ++  E ++ C++
Sbjct  127   GGRLRSQVKCTQCSHCSNKFDPFLDLSLDIGKATSLVRALQNFTAEELLDGGEKQYQCQR  186

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             C+ +V  +K+  +D+AP V T HLKRF +  +  EKI K V F P LDL P++  ++  +
Sbjct  187   CRKKVVAKKKFTIDKAPYVLTIHLKRF-SPFNPREKIDKKVDFQPMLDLKPFI--SDSKV  243

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
                KY+L+ V+VH G +  SGHYYCFV  S   W+  DD++V +V+E  V+ Q+AY+LFY
Sbjct  244   SNLKYSLYGVLVHAGWNTQSGHYYCFVRTSSGMWHNLDDNQVRQVREADVLRQKAYMLFY  303

Query  1414  VK  1409
             V+
Sbjct  304   VR  305



>gb|EEC74168.1| hypothetical protein OsI_09271 [Oryza sativa Indica Group]
Length=1156

 Score =   240 bits (612),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 125/304 (41%), Positives = 185/304 (61%), Gaps = 6/304 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P +  +++ +H S C     GFC LCAL+  +N +L S G  +RP
Sbjct  93    TCYLNSVLQCLTYTEPFVAYLQSGEHMSSCRTI--GFCALCALQRHVNSALQSTGKILRP  150

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKL-NGQVSPKHENVVKQTFG  1952
               IV NL   S +F+  +Q DAHE +   LE +  CC    + +G  S   +++V + FG
Sbjct  151   VHIVRNLRCISRSFRISRQEDAHELMVRLLESMHKCCLPSGVPSGSPSAYEKSLVHRIFG  210

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H S+ ++P +DLSLEI +  +L  AL  FT  E ++  E ++ CE C
Sbjct  211   GLLRSQVRCTTCSHCSNKFDPFLDLSLEIANAATLVKALQHFTAEELLDGGEKQYNCEHC  270

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             + +V  +K+ ++++AP V T HLKRF +  +   KI K V F P L+L PYV   E +  
Sbjct  271   RQKVVAKKRFMIEKAPSVLTIHLKRF-SPFNPCHKIDKKVQFQPTLNLKPYVSNPEGM--  327

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             E KY+L+ V+VH G +  SGHYYCFV  S   W+  DD++V +V+E  V+ Q+AY+LFYV
Sbjct  328   EFKYSLYGVLVHAGWNTQSGHYYCFVRTSSGIWHNLDDNEVYQVREADVLRQKAYMLFYV  387

Query  1411  KQGT  1400
             +  T
Sbjct  388   RDRT  391



>ref|XP_009394939.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X2 
[Musa acuminata subsp. malaccensis]
Length=940

 Score =   238 bits (608),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 181/307 (59%), Gaps = 12/307 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  P    +++  H S C     GFC +CAL+  +  +L S G  + P
Sbjct  117   TCFLNSVLQCLTYTEPFAAYLQSGKHKSSCHTA--GFCAMCALQNHVITALQSNGKILSP  174

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
               +V NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  175   SHLVKNLRCISRNFRNSRQEDAHEYMVNLLESMHKCC-LPSGVPSESPGAYEKSLVHKIF  233

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GGHL S+++C  C + S  ++P VDLSLEI   DSL  AL  FT VE+++  E ++ C+ 
Sbjct  234   GGHLRSQVKCTQCSYSSSKFDPFVDLSLEIAKADSLWKALTHFTAVEQLDGGERQYQCQH  293

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEK  1601
             CK +V   KQL + +AP V T HLKRF    S V  +KI K V F P LDL P++  +++
Sbjct  294   CKEKVRALKQLTIHKAPYVLTIHLKRF---SSYVPGQKIDKKVDFEPTLDLKPFL--SDQ  348

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                + KY L+ V+VH G S  SGHY+C+V  S   W+  DD++V +V E  V++Q+AY+L
Sbjct  349   HGGDVKYTLYGVLVHAGWSTHSGHYFCYVRTSSGMWHSLDDNQVGQVSEKTVLAQKAYML  408

Query  1420  FYVKQGT  1400
             FYV+  T
Sbjct  409   FYVRDRT  415



>ref|XP_009394938.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=966

 Score =   238 bits (608),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 181/307 (59%), Gaps = 12/307 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  P    +++  H S C     GFC +CAL+  +  +L S G  + P
Sbjct  117   TCFLNSVLQCLTYTEPFAAYLQSGKHKSSCHTA--GFCAMCALQNHVITALQSNGKILSP  174

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
               +V NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  175   SHLVKNLRCISRNFRNSRQEDAHEYMVNLLESMHKCC-LPSGVPSESPGAYEKSLVHKIF  233

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GGHL S+++C  C + S  ++P VDLSLEI   DSL  AL  FT VE+++  E ++ C+ 
Sbjct  234   GGHLRSQVKCTQCSYSSSKFDPFVDLSLEIAKADSLWKALTHFTAVEQLDGGERQYQCQH  293

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEK  1601
             CK +V   KQL + +AP V T HLKRF    S V  +KI K V F P LDL P++  +++
Sbjct  294   CKEKVRALKQLTIHKAPYVLTIHLKRF---SSYVPGQKIDKKVDFEPTLDLKPFL--SDQ  348

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                + KY L+ V+VH G S  SGHY+C+V  S   W+  DD++V +V E  V++Q+AY+L
Sbjct  349   HGGDVKYTLYGVLVHAGWSTHSGHYFCYVRTSSGMWHSLDDNQVGQVSEKTVLAQKAYML  408

Query  1420  FYVKQGT  1400
             FYV+  T
Sbjct  409   FYVRDRT  415



>ref|XP_009132092.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Brassica 
rapa]
 emb|CDX88651.1| BnaA03g09980D [Brassica napus]
Length=824

 Score =   236 bits (602),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/305 (41%), Positives = 177/305 (58%), Gaps = 15/305 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   ++   H   C     GFC LCA+++ +  +L + G  + P
Sbjct  101   TCFLNSVLQCLTYTEPLAAYLQDVGHERRCNVA--GFCALCAMQKHVRTALQATGKIVAP  158

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHEN-VVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  C     ++ + S  + + +V + FG
Sbjct  159   KYLVSNLRCVSRNFRNCRQEDAHEYMINLLECMHKCSLPSGVSSESSDAYRSSLVHKIFG  218

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H SD ++P +DLSL+I   DSL  AL  FT VE ++D    + CE+C
Sbjct  219   GSLRSQVKCAQCSHSSDKFDPFLDLSLDISKADSLQRALTRFTAVELLDDGAKVYQCERC  278

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYV----ERNE  1604
             K +V   K+L + +AP V T HLKRF+   S  EKI K V F   +D+ P+V    E N 
Sbjct  279   KQKVKATKELTVSKAPYVLTVHLKRFEAHRS--EKIDKKVEFASAVDMKPFVSGPYEGN-  335

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
                   KY L+ V+VH G S+ SGHY CFV  S   WY  DD++V +V E  V +Q+AY+
Sbjct  336   -----LKYTLYGVLVHYGRSIHSGHYACFVRTSSGMWYSLDDNRVLQVSEKNVFNQKAYM  390

Query  1423  LFYVK  1409
             LFYV+
Sbjct  391   LFYVR  395



>ref|NP_001056992.1| Os06g0184300 [Oryza sativa Japonica Group]
 dbj|BAD72517.1| putative ubiquitin-specific protease 23 [Oryza sativa Japonica 
Group]
 dbj|BAF18906.1| Os06g0184300 [Oryza sativa Japonica Group]
Length=899

 Score =   237 bits (604),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 181/302 (60%), Gaps = 8/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P    +++  H S C     GFC LCAL+  +  +L S G  + P
Sbjct  67    TCYLNSVLQCLTYTEPFAAYLQSGKHKSSCRTA--GFCALCALQNHVKTALQSTGKIVTP  124

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
              +IV NL   S +F+  +Q DAHE +   LE +  CC  P      SP    +++V + F
Sbjct  125   SQIVKNLRCISRSFRNSRQEDAHELMVNLLESMHKCC-LPSGVPSESPSAYEKSLVHKIF  183

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C H S+ ++P +DLSL+I    SL  AL +FT  E ++  E ++ C++
Sbjct  184   GGRLRSQVKCTQCSHCSNKFDPFLDLSLDIGKATSLVRALQNFTAEELLDGGEKQYQCQR  243

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             C+ +V  +K+  +D+AP V T HLKRF +  +  EKI K V F P LDL P++  ++   
Sbjct  244   CRKKVVAKKKFTIDKAPYVLTIHLKRF-SPFNPREKIDKKVDFQPMLDLKPFISDSKGA-  301

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              + KY+L+ V+VH G +  SGHYYCFV  S   W+  DD++V +V+E  V+ Q+AY+LFY
Sbjct  302   -DFKYSLYGVLVHAGWNTQSGHYYCFVRTSSGMWHNLDDNQVRQVREADVLRQKAYMLFY  360

Query  1414  VK  1409
             V+
Sbjct  361   VR  362



>dbj|BAD72518.1| putative ubiquitin-specific protease 23 [Oryza sativa Japonica 
Group]
Length=874

 Score =   236 bits (603),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 181/302 (60%), Gaps = 8/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P    +++  H S C     GFC LCAL+  +  +L S G  + P
Sbjct  67    TCYLNSVLQCLTYTEPFAAYLQSGKHKSSCRTA--GFCALCALQNHVKTALQSTGKIVTP  124

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
              +IV NL   S +F+  +Q DAHE +   LE +  CC  P      SP    +++V + F
Sbjct  125   SQIVKNLRCISRSFRNSRQEDAHELMVNLLESMHKCC-LPSGVPSESPSAYEKSLVHKIF  183

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C H S+ ++P +DLSL+I    SL  AL +FT  E ++  E ++ C++
Sbjct  184   GGRLRSQVKCTQCSHCSNKFDPFLDLSLDIGKATSLVRALQNFTAEELLDGGEKQYQCQR  243

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             C+ +V  +K+  +D+AP V T HLKRF +  +  EKI K V F P LDL P++  ++   
Sbjct  244   CRKKVVAKKKFTIDKAPYVLTIHLKRF-SPFNPREKIDKKVDFQPMLDLKPFISDSKGA-  301

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              + KY+L+ V+VH G +  SGHYYCFV  S   W+  DD++V +V+E  V+ Q+AY+LFY
Sbjct  302   -DFKYSLYGVLVHAGWNTQSGHYYCFVRTSSGMWHNLDDNQVRQVREADVLRQKAYMLFY  360

Query  1414  VK  1409
             V+
Sbjct  361   VR  362



>ref|XP_006857223.1| hypothetical protein AMTR_s00065p00205690 [Amborella trichopoda]
 gb|ERN18690.1| hypothetical protein AMTR_s00065p00205690 [Amborella trichopoda]
Length=1059

 Score =   238 bits (606),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/301 (41%), Positives = 176/301 (58%), Gaps = 8/301 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H S C     GFC +CA++  +  +L S G  + P
Sbjct  113   TCFLNSVLQCLTYTEPLAAYLQSGKHKSSCHMA--GFCAMCAIQNHVMSALRSSGKILSP  170

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
               +V NL   S  F+  +Q DAHE++   +E +  CC  P      SP    +++V + F
Sbjct  171   NHLVRNLRCISRNFRNSRQEDAHEYMVNLMECMHKCC-LPSGVLSESPGAYEKSLVHKIF  229

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C H S+T++P +DLSLEI   DS+  AL  FT  E+++  E ++ C++
Sbjct  230   GGRLQSQVKCTQCSHESNTFDPFLDLSLEIVKADSVRKALAHFTAREQLDGGEKQYQCDR  289

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             C  +V   KQL + +AP V T HLKRF  DG +  KI K V F   L+L P+V     V 
Sbjct  290   CNKKVRAFKQLTIHKAPYVLTIHLKRFSPDG-MGGKIDKMVQFGSNLELKPFVSGQYDV-  347

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              + +Y L+ V+VH G S  SGHYYCF+  S   W+  DD++V +V E  V+ Q+AY+LFY
Sbjct  348   -DLRYTLYGVLVHAGWSTHSGHYYCFIRTSSGIWHALDDNRVYQVSEKFVLQQKAYMLFY  406

Query  1414  V  1412
             V
Sbjct  407   V  407



>gb|EEE65221.1| hypothetical protein OsJ_20367 [Oryza sativa Japonica Group]
Length=940

 Score =   236 bits (603),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 181/302 (60%), Gaps = 8/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P    +++  H S C     GFC LCAL+  +  +L S G  + P
Sbjct  108   TCYLNSVLQCLTYTEPFAAYLQSGKHKSSCRTA--GFCALCALQNHVKTALQSTGKIVTP  165

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
              +IV NL   S +F+  +Q DAHE +   LE +  CC  P      SP    +++V + F
Sbjct  166   SQIVKNLRCISRSFRNSRQEDAHELMVNLLESMHKCC-LPSGVPSESPSAYEKSLVHKIF  224

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C H S+ ++P +DLSL+I    SL  AL +FT  E ++  E ++ C++
Sbjct  225   GGRLRSQVKCTQCSHCSNKFDPFLDLSLDIGKATSLVRALQNFTAEELLDGGEKQYQCQR  284

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             C+ +V  +K+  +D+AP V T HLKRF +  +  EKI K V F P LDL P++  ++   
Sbjct  285   CRKKVVAKKKFTIDKAPYVLTIHLKRF-SPFNPREKIDKKVDFQPMLDLKPFISDSKGA-  342

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              + KY+L+ V+VH G +  SGHYYCFV  S   W+  DD++V +V+E  V+ Q+AY+LFY
Sbjct  343   -DFKYSLYGVLVHAGWNTQSGHYYCFVRTSSGMWHNLDDNQVRQVREADVLRQKAYMLFY  401

Query  1414  VK  1409
             V+
Sbjct  402   VR  403



>gb|EEC80142.1| hypothetical protein OsI_21934 [Oryza sativa Indica Group]
Length=940

 Score =   236 bits (603),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 181/302 (60%), Gaps = 8/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P    +++  H S C     GFC LCAL+  +  +L S G  + P
Sbjct  108   TCYLNSVLQCLTYTEPFAAYLQSGKHKSSCRTA--GFCALCALQNHVKTALQSTGKIVTP  165

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
              +IV NL   S +F+  +Q DAHE +   LE +  CC  P      SP    +++V + F
Sbjct  166   SQIVKNLRCISRSFRNSRQEDAHELMVNLLESMHKCC-LPSGVPSESPSAYEKSLVHKIF  224

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C H S+ ++P +DLSL+I    SL  AL +FT  E ++  E ++ C++
Sbjct  225   GGRLRSQVKCTQCSHCSNKFDPFLDLSLDIGKATSLVRALQNFTAEELLDGGEKQYQCQR  284

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             C+ +V  +K+  +D+AP V T HLKRF +  +  EKI K V F P LDL P++  ++   
Sbjct  285   CRKKVVAKKKFTIDKAPYVLTIHLKRF-SPFNPREKIDKKVDFQPMLDLKPFISDSKGA-  342

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              + KY+L+ V+VH G +  SGHYYCFV  S   W+  DD++V +V+E  V+ Q+AY+LFY
Sbjct  343   -DFKYSLYGVLVHAGWNTQSGHYYCFVRTSSGMWHNLDDNQVRQVREADVLRQKAYMLFY  401

Query  1414  VK  1409
             V+
Sbjct  402   VR  403



>ref|XP_006655855.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Oryza 
brachyantha]
Length=902

 Score =   236 bits (601),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 119/302 (39%), Positives = 182/302 (60%), Gaps = 8/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P +  +++  H S C     GFC LCAL+  +  +L S G  + P
Sbjct  56    TCYLNSVLQCLTYTEPFVAYLQSGKHKSSCRTA--GFCALCALQNHVKTALQSTGKIVTP  113

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
              +IV NL   S  F+  +Q DAHE +   LE +  CC  P      SP    +++V + F
Sbjct  114   SQIVKNLRCISRGFRNSRQEDAHELMVNLLESMHKCC-LPSGVPSESPSAYEKSLVHKIF  172

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C H S+ ++P +DLSL+I    +L  AL +FT+ E ++  E ++ C++
Sbjct  173   GGRLRSQVKCTQCSHCSNKFDPFLDLSLDIARATTLVRALQNFTEDELLDGGEKQYQCQR  232

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             C+ +V  +K+  +D+AP V T HLKRF +  +  EKI K V F P LDL P++  ++   
Sbjct  233   CRKKVVAKKKFTIDKAPYVLTIHLKRF-SPFNPREKIDKKVDFQPMLDLKPFISDSKGT-  290

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              + KY+L+ V+VH G +  SGHY+CFV  S   W+  DD++V +V+E  V+ Q+AY+LFY
Sbjct  291   -DYKYSLYGVLVHAGWNTQSGHYFCFVRTSSGMWHNLDDNQVRQVREADVLKQKAYMLFY  349

Query  1414  VK  1409
             V+
Sbjct  350   VR  351



>ref|XP_008799648.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X1 
[Phoenix dactylifera]
Length=963

 Score =   236 bits (601),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/303 (41%), Positives = 179/303 (59%), Gaps = 10/303 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  P    +++  H S C     GFC +CAL+  +  +L S G  + P
Sbjct  111   TCFLNSVLQCLTYTEPFAAYLQSGKHKSSCRTA--GFCAMCALQNHVMSALQSTGKILSP  168

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
                V NL   S  F+  +Q DAHE++   LE +  CC    +  + S  +E ++V + FG
Sbjct  169   FHFVKNLRSISRNFRNSRQEDAHEYMVNLLESMHKCCLPSGVPNESSIAYEKSLVHKIFG  228

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   DSL  AL  FT VE+++  E ++ C++C
Sbjct  229   GRLRSQVKCMQCSYCSNKFDPFLDLSLEIVKADSLRKALAQFTAVEQLDGGERQYQCQRC  288

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVE--RNEKV  1598
             K +V   KQL + +AP V T HLKRF +     +KI K V F P LDL P+V       +
Sbjct  289   KEKVRALKQLTVHKAPYVLTIHLKRFSSHIP-GQKIDKRVDFEPTLDLKPFVSDAHEGNL  347

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
             I    Y L+ V+VH+G S  SGHYYC+V  S   W+  DD++V++V E  V++Q+AY+LF
Sbjct  348   I----YTLYGVLVHVGWSTHSGHYYCYVRTSSGMWHSLDDNQVSQVSEKTVLAQKAYMLF  403

Query  1417  YVK  1409
             YV+
Sbjct  404   YVR  406



>ref|XP_008799649.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X2 
[Phoenix dactylifera]
Length=927

 Score =   235 bits (599),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/301 (41%), Positives = 178/301 (59%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  P    +++  H S C     GFC +CAL+  +  +L S G  + P
Sbjct  111   TCFLNSVLQCLTYTEPFAAYLQSGKHKSSCRTA--GFCAMCALQNHVMSALQSTGKILSP  168

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
                V NL   S  F+  +Q DAHE++   LE +  CC    +  + S  +E ++V + FG
Sbjct  169   FHFVKNLRSISRNFRNSRQEDAHEYMVNLLESMHKCCLPSGVPNESSIAYEKSLVHKIFG  228

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   DSL  AL  FT VE+++  E ++ C++C
Sbjct  229   GRLRSQVKCMQCSYCSNKFDPFLDLSLEIVKADSLRKALAQFTAVEQLDGGERQYQCQRC  288

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQL + +AP V T HLKRF +     +KI K V F P LDL P+V    +   
Sbjct  289   KEKVRALKQLTVHKAPYVLTIHLKRFSSHIP-GQKIDKRVDFEPTLDLKPFVSDAHE--G  345

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
                Y L+ V+VH+G S  SGHYYC+V  S   W+  DD++V++V E  V++Q+AY+LFYV
Sbjct  346   NLIYTLYGVLVHVGWSTHSGHYYCYVRTSSGMWHSLDDNQVSQVSEKTVLAQKAYMLFYV  405

Query  1411  K  1409
             +
Sbjct  406   R  406



>gb|KEH32626.1| ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=801

 Score =   233 bits (593),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/303 (40%), Positives = 183/303 (60%), Gaps = 10/303 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H S C     GFC LCA++  ++ +L + G  + P
Sbjct  100   TCFLNSVLQCLTYTEPLAAYLQSGKHKSSCHIA--GFCALCAIQNHVSCALQATGRIVSP  157

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             + +V NL   S  F++ +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  158   QDMVGNLRCISRNFRKARQEDAHEYMVNLLESMHKCC-LPSGVPSESPGAFEKSLVHKIF  216

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI   DSL  AL +FT  E ++  E ++ C++
Sbjct  217   GGRLRSQVKCRQCSYSSNKFDPFLDLSLEILKADSLQKALANFTAAELLDGGEKQYHCQR  276

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRF-KNDGSLVEKIAKHVTFPPELDLLPYVERNEKV  1598
             CK +V   KQL + +AP V   HLKRF  +D ++  KI K V F   L+L P+V  +   
Sbjct  277   CKQKVQAVKQLTIHKAPYVLAIHLKRFYAHDPNI--KIKKKVRFDSALNLKPFVSGSSD-  333

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
               + KY+L+ V+VH G S  SGHYYC+V  S + WY  DD++V+ V E  V++Q+AY+LF
Sbjct  334   -GDVKYSLYGVLVHSGFSTHSGHYYCYVRTSNNMWYTLDDTRVSHVGEQEVLNQQAYMLF  392

Query  1417  YVK  1409
             YV+
Sbjct  393   YVR  395



>ref|XP_008659199.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 [Zea mays]
 gb|AFW85556.1| putative ubiquitin carboxyl-terminal hydrolase superfamily protein 
[Zea mays]
Length=903

 Score =   234 bits (596),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 184/301 (61%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P    +++  H S C     GFC LCAL+  +  +L S G  + P
Sbjct  98    TCYLNSVLQCLTYTEPFAAYLQSGKHTSSCR--TSGFCALCALQIHVKTALESTGKIVTP  155

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
              +IV NL   S TF+  +Q DAHE +   LE +  CC    ++ +    ++ ++V + FG
Sbjct  156   FRIVKNLRCISRTFRNSRQEDAHELMVNLLESMHKCCLPSGVSTESQSAYDKSLVHKIFG  215

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H S+ ++P +DLSLEI    +L  AL++FT+ E +++ + ++ CE+C
Sbjct  216   GRLRSQVKCTRCLHCSNKFDPFLDLSLEIAKATTLVRALENFTEDELLDEGQKEYECERC  275

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             + +V  +K+L +D+AP V T HLKRF +  +  EKI K V F   LDL P+V  ++    
Sbjct  276   RQKVVAKKRLTIDKAPNVLTIHLKRF-SPFNPREKIDKKVDFQSILDLKPFVSDSKGT--  332

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY+L+ V+VH G S  SGHYYC+V  S   W+  DD +V +V+E  V+ Q+AY+LFYV
Sbjct  333   DFKYSLYGVLVHTGWSTQSGHYYCYVRTSSGMWHNLDDKEVRQVREADVLKQKAYMLFYV  392

Query  1411  K  1409
             +
Sbjct  393   R  393



>ref|XP_006473993.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Citrus 
sinensis]
Length=946

 Score =   233 bits (595),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 182/301 (60%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H S C     GFC LCA+++ ++ +L + G  + P
Sbjct  109   TCFLNSVLQCLTYTEPLAAYLQSGKHQSSCHIA--GFCALCAIQKHVSRALQATGRILAP  166

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    +  + +  +E ++V + FG
Sbjct  167   KDLVSNLRCISRNFRNSRQEDAHEYMVNLLESMHKCCLPSGVPSESANAYEKSLVHKIFG  226

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   DS+  AL++FT  E ++  E ++ C++C
Sbjct  227   GRLRSQVKCTQCSYCSNKFDPFLDLSLEIAKADSVLKALNNFTAAELLDGGEKEYHCQRC  286

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQL + +AP V T HLKRF+      +K  K V F   LD+ P+V  + +   
Sbjct  287   KQKVRALKQLTVYKAPYVLTIHLKRFRAHDP-GQKNDKKVQFGSTLDMKPFVSGSYE--G  343

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+LFYV
Sbjct  344   DLKYTLYGVLVHHGWSTHSGHYYCFVRTSSGMWYSLDDNRVVQVNERSVLEQKAYMLFYV  403

Query  1411  K  1409
             +
Sbjct  404   R  404



>ref|XP_006453628.1| hypothetical protein CICLE_v10007375mg [Citrus clementina]
 gb|ESR66868.1| hypothetical protein CICLE_v10007375mg [Citrus clementina]
Length=947

 Score =   233 bits (595),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 182/301 (60%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H S C     GFC LCA+++ ++ +L + G  + P
Sbjct  110   TCFLNSVLQCLTYTEPLAAYLQSGKHQSSCHIA--GFCALCAIQKHVSRALQATGRILAP  167

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    +  + +  +E ++V + FG
Sbjct  168   KDLVSNLRCISRNFRNSRQEDAHEYMVNLLESMHKCCLPSGVPSESANAYEKSLVHKIFG  227

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   DS+  AL++FT  E ++  E ++ C++C
Sbjct  228   GRLRSQVKCTQCSYCSNKFDPFLDLSLEIAKADSVLKALNNFTAAELLDGGEKEYHCQRC  287

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQL + +AP V T HLKRF+      +K  K V F   LD+ P+V  + +   
Sbjct  288   KQKVRALKQLTVYKAPYVLTIHLKRFRAHDP-GQKNDKKVQFGSTLDMKPFVSGSYE--G  344

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+LFYV
Sbjct  345   DLKYTLYGVLVHHGWSTHSGHYYCFVRTSSGMWYSLDDNRVVQVNERSVLEQKAYMLFYV  404

Query  1411  K  1409
             +
Sbjct  405   R  405



>ref|XP_003610327.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
 gb|AES92524.1| ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=855

 Score =   233 bits (593),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 122/303 (40%), Positives = 183/303 (60%), Gaps = 10/303 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H S C     GFC LCA++  ++ +L + G  + P
Sbjct  100   TCFLNSVLQCLTYTEPLAAYLQSGKHKSSCHIA--GFCALCAIQNHVSCALQATGRIVSP  157

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             + +V NL   S  F++ +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  158   QDMVGNLRCISRNFRKARQEDAHEYMVNLLESMHKCC-LPSGVPSESPGAFEKSLVHKIF  216

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI   DSL  AL +FT  E ++  E ++ C++
Sbjct  217   GGRLRSQVKCRQCSYSSNKFDPFLDLSLEILKADSLQKALANFTAAELLDGGEKQYHCQR  276

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRF-KNDGSLVEKIAKHVTFPPELDLLPYVERNEKV  1598
             CK +V   KQL + +AP V   HLKRF  +D ++  KI K V F   L+L P+V  +   
Sbjct  277   CKQKVQAVKQLTIHKAPYVLAIHLKRFYAHDPNI--KIKKKVRFDSALNLKPFVSGSSD-  333

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
               + KY+L+ V+VH G S  SGHYYC+V  S + WY  DD++V+ V E  V++Q+AY+LF
Sbjct  334   -GDVKYSLYGVLVHSGFSTHSGHYYCYVRTSNNMWYTLDDTRVSHVGEQEVLNQQAYMLF  392

Query  1417  YVK  1409
             YV+
Sbjct  393   YVR  395



>ref|XP_010227945.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X1 
[Brachypodium distachyon]
Length=938

 Score =   233 bits (595),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 119/302 (39%), Positives = 181/302 (60%), Gaps = 8/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P    +++  H S C     GFC LCAL+  +  +L S G  + P
Sbjct  102   TCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTA--GFCALCALQNHVKTALQSTGKIVTP  159

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
              +IV NL   S +F+  +Q DAHE +   LE +  CC  P      SP    +++V + F
Sbjct  160   SQIVKNLRCISRSFRNSRQEDAHELMVNLLESMHKCC-LPSGVPSESPSAYEKSLVHRIF  218

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C H S+ ++P +DLSL+I    +L  AL +FT+ E ++  + ++ CE+
Sbjct  219   GGRLRSQVKCTRCSHCSNKFDPFLDLSLDIAKASNLVRALQNFTEDELLDGGQKQYQCER  278

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             C+ +V  +K+  +D AP V T HLKRF +  +  +KI K V F P LDL P+V  ++  +
Sbjct  279   CRQKVVAKKRFTIDRAPNVLTIHLKRF-SPFNPRDKIDKKVDFQPVLDLKPFV--SDSKV  335

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              + KY+L+ V+VH G +   GHYYCFV  S   W+  DD++V +V+E  V+ Q+AY+LFY
Sbjct  336   SDYKYSLYGVLVHAGWNTQCGHYYCFVRTSSGMWHNLDDNQVRQVREADVLKQKAYMLFY  395

Query  1414  VK  1409
             V+
Sbjct  396   VR  397



>ref|XP_006600544.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like isoform 
X2 [Glycine max]
Length=866

 Score =   232 bits (592),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 180/301 (60%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA++  ++ +L S G  + P
Sbjct  106   TCFLNSVLQCLTYTEPLAAYLQSGKHKTSCHVA--GFCALCAIQNHVSRALQSTGRILAP  163

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             + +V NL   S  F+  +Q DAHE++   LE +  CC    +  +    +E + V + FG
Sbjct  164   EDLVGNLRCISRNFRNARQEDAHEYMVNLLECMHKCCLPSGIPSESPGAYEKSFVHKIFG  223

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   DSL  AL +FT  E ++  E ++ C++C
Sbjct  224   GRLRSQVKCHQCSYCSNKFDPFLDLSLEIFKADSLQKALSNFTAAEWLDGGEKEYHCQRC  283

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQL + +AP V T HLKRF    +  +KI K V F   LDL P+V  +     
Sbjct  284   KQKVKALKQLTIHKAPYVLTIHLKRFHAHDT-GQKIKKKVQFGCALDLKPFVSGSND--G  340

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY+L+ V+VH G S  SGHYYC+V  S + WY  DD++V+ V E  V++Q+AY+LFYV
Sbjct  341   DVKYSLYGVLVHAGSSTHSGHYYCYVRTSNNMWYTLDDNRVSHVSEREVLNQQAYMLFYV  400

Query  1411  K  1409
             +
Sbjct  401   R  401



>ref|XP_004964661.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Setaria 
italica]
Length=902

 Score =   232 bits (592),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 117/301 (39%), Positives = 182/301 (60%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P    +++  H S C     GFC LCAL++ +  +L S G  + P
Sbjct  98    TCYLNSVLQCLTYTEPFAAYLQSGKHGSSCRT--SGFCALCALQKHVKTALQSTGKIVTP  155

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
               IV NL   S +F+  +Q DAHE +   LE +  CC    +  +    ++ ++V + FG
Sbjct  156   SLIVKNLRCISRSFRNSRQEDAHELMVNLLESMHKCCLPSGVPSESQSAYDKSLVHKIFG  215

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H S+ ++P +DLSL+I    +L  AL +FT+ E ++  + ++ C++C
Sbjct  216   GRLRSQVKCTRCSHCSNKFDPFLDLSLDIAKATTLVRALQNFTEEELLDGGQKQYQCDRC  275

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             + +V  +K+  +D+AP V T HLKRF +  +  EKI K V F P LDL P+V  ++    
Sbjct  276   RQKVVAKKRFTIDKAPNVLTVHLKRF-SPFNPREKIDKKVDFQPVLDLKPFVSDSKGT--  332

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY+L+ V+VH G +  SGHYYCFV  S   W+  DD++V +V+E  V+ Q+AY+LFYV
Sbjct  333   DFKYSLYGVLVHAGWNTQSGHYYCFVRTSSGMWHNLDDNQVRQVREADVLKQKAYMLFYV  392

Query  1411  K  1409
             +
Sbjct  393   R  393



>ref|XP_003550687.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like isoform 
X1 [Glycine max]
Length=903

 Score =   232 bits (592),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 180/301 (60%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA++  ++ +L S G  + P
Sbjct  106   TCFLNSVLQCLTYTEPLAAYLQSGKHKTSCHVA--GFCALCAIQNHVSRALQSTGRILAP  163

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             + +V NL   S  F+  +Q DAHE++   LE +  CC    +  +    +E + V + FG
Sbjct  164   EDLVGNLRCISRNFRNARQEDAHEYMVNLLECMHKCCLPSGIPSESPGAYEKSFVHKIFG  223

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   DSL  AL +FT  E ++  E ++ C++C
Sbjct  224   GRLRSQVKCHQCSYCSNKFDPFLDLSLEIFKADSLQKALSNFTAAEWLDGGEKEYHCQRC  283

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQL + +AP V T HLKRF    +  +KI K V F   LDL P+V  +     
Sbjct  284   KQKVKALKQLTIHKAPYVLTIHLKRFHAHDT-GQKIKKKVQFGCALDLKPFVSGSND--G  340

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY+L+ V+VH G S  SGHYYC+V  S + WY  DD++V+ V E  V++Q+AY+LFYV
Sbjct  341   DVKYSLYGVLVHAGSSTHSGHYYCYVRTSNNMWYTLDDNRVSHVSEREVLNQQAYMLFYV  400

Query  1411  K  1409
             +
Sbjct  401   R  401



>gb|KHN17486.1| Ubiquitin carboxyl-terminal hydrolase 23 [Glycine soja]
Length=903

 Score =   232 bits (592),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 180/301 (60%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA++  ++ +L S G  + P
Sbjct  106   TCFLNSVLQCLTYTEPLAAYLQSGKHKTSCHVA--GFCALCAIQNHVSRALQSTGRILAP  163

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             + +V NL   S  F+  +Q DAHE++   LE +  CC    +  +    +E + V + FG
Sbjct  164   EDLVGNLRCISRNFRNARQEDAHEYMVNLLECMHKCCLPSGIPSESPGAYEKSFVHKIFG  223

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   DSL  AL +FT  E ++  E ++ C++C
Sbjct  224   GRLRSQVKCHQCSYCSNKFDPFLDLSLEIFKADSLQKALSNFTAAEWLDGGEKEYHCQRC  283

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQL + +AP V T HLKRF    +  +KI K V F   LDL P+V  +     
Sbjct  284   KQKVKALKQLTIHKAPYVLTIHLKRFHAHDT-GQKIKKKVQFGCALDLKPFVSGSND--G  340

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY+L+ V+VH G S  SGHYYC+V  S + WY  DD++V+ V E  V++Q+AY+LFYV
Sbjct  341   DVKYSLYGVLVHAGSSTHSGHYYCYVRTSNNMWYTLDDNRVSHVSEREVLNQQAYMLFYV  400

Query  1411  K  1409
             +
Sbjct  401   R  401



>ref|XP_006279994.1| hypothetical protein CARUB_v10025864mg [Capsella rubella]
 gb|EOA12892.1| hypothetical protein CARUB_v10025864mg [Capsella rubella]
Length=871

 Score =   232 bits (591),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 175/301 (58%), Gaps = 7/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL  +++   H   C     GFC LCA+++ +  +  + G  + P
Sbjct  114   TCFLNSVLQCLTYTEPLAATLQTAAHQRYCNVA--GFCALCAIQKHVRTARQATGRILAP  171

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  C     +  + S  +  ++V + FG
Sbjct  172   KDLVSNLRCISRNFRNCRQEDAHEYMINLLECMHKCSLPSGVPSESSDAYRRSLVHKIFG  231

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H S+ ++P +DLSL+I   DSL  AL  FT VE ++D    + CE+C
Sbjct  232   GSLRSQVKCEQCSHCSNKFDPFLDLSLDISKADSLQRALLRFTAVELLDDGAKVYQCERC  291

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQL + +AP V T HLKRF+   S  EKI + V F   +D+ P+V    +   
Sbjct  292   KHKVKARKQLTVSKAPYVLTVHLKRFEAHRS--EKIDRKVQFTSAIDMKPFVSGPHE--G  347

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY L+ V+VH G S+ SGHY CFV  S   WY  DD++V +V E VV  Q+AY+LFYV
Sbjct  348   NLKYTLYGVLVHYGRSIHSGHYACFVRTSSGMWYSLDDNRVVQVSEKVVFDQKAYMLFYV  407

Query  1411  K  1409
             +
Sbjct  408   R  408



>ref|XP_004954214.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Setaria 
italica]
Length=1085

 Score =   233 bits (593),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 183/301 (61%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  P +  +++  H S C A   GFC LCAL++ +  +L S G  + P
Sbjct  101   TCYLNSVLQCLTYTEPFVAYLQSSKHNSSCRAA--GFCALCALQDHVTSALRSTGKILTP  158

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
                V NL   S +F+  +Q DAHE +   LE +   C    ++ +    +E ++V + FG
Sbjct  159   LLFVKNLRCISRSFRNTRQEDAHELMVSLLESMHKSCLPSGISSESPSAYERSLVHRIFG  218

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H S+ ++P +DLSLEI +  +L  AL +FT+ E ++  E  + C++C
Sbjct  219   GRLRSQVRCTKCSHCSNKFDPFLDLSLEIGNAATLMKALYNFTEEELLDGGEKHYNCQQC  278

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V  +K+ L+D+AP V T HLKRF     L +KI K V F   L+L P+V  +E +  
Sbjct  279   KQKVVAKKRFLIDKAPSVLTIHLKRFSPFNPL-QKIDKKVDFQTTLNLKPFVSNSEGM--  335

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY+L+ V+VH G +  SGHYYCFV  S   W+  DD++V +V+E  V+ Q+AY+LFYV
Sbjct  336   DLKYSLYGVLVHAGWNTQSGHYYCFVRTSSGLWHNLDDNEVRQVREADVLRQKAYMLFYV  395

Query  1411  K  1409
             +
Sbjct  396   R  396



>ref|XP_010942106.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
23 [Elaeis guineensis]
Length=999

 Score =   232 bits (591),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 178/302 (59%), Gaps = 8/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  P    +++  H S C     GFC +CAL+  +  +L S G  + P
Sbjct  112   TCFLNSVLQCLTYTEPFAAYLQSGKHKSSCHTA--GFCAMCALQNHVMTALQSTGKILSP  169

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP--KHENVVKQTF  1955
               +V NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  170   YHLVKNLRSISRNFRNSRQEDAHEYMVNLLESMHKCC-LPSGVPSESPIAYEKSLVHKIF  228

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI   DSL  AL  FT VE+++  E ++ C++
Sbjct  229   GGCLRSQVKCMQCSYCSNKFDPFLDLSLEIVKADSLRKALARFTAVEQLDGGERQYQCQR  288

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +V   KQL + +AP V T HLKRF +     +KI K V F P LDL P+V    +  
Sbjct  289   CKEKVRALKQLTIHKAPYVLTVHLKRFSSHIP-GQKIDKKVEFEPTLDLKPFVSDAHE--  345

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
                +Y L+ V+VH G S  SGHYYC++  S   W+  DD++V++V E  V++Q+AY+LFY
Sbjct  346   GNLRYTLYGVLVHAGWSTHSGHYYCYIRTSSGMWHSLDDNQVSQVSEKTVLAQKAYMLFY  405

Query  1414  VK  1409
             V+
Sbjct  406   VR  407



>ref|XP_004288715.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Fragaria 
vesca subsp. vesca]
Length=946

 Score =   231 bits (589),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 181/302 (60%), Gaps = 7/302 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL   +++  H + C   N GFC LCA++E ++++L S  S I P
Sbjct  116   TCYLNSVLQCLTYTEPLAAYLQSGRHRNSCHIKN-GFCALCAIQEHVSLALQSTKS-ILP  173

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V NL   S  F++ +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  174   KALVFNLQRISRNFRKSRQEDAHEYMVNLLESMHKCC-LPSGVPSESPSAYEKSLVHKIF  232

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + SD  +P +DLSLEI   +SL+ AL +FT  E+++  E ++ C+K
Sbjct  233   GGRLRSRVKCLQCSYCSDKLDPFLDLSLEIVKANSLNKALVNFTSEEQLDGGERQYQCQK  292

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             C  +V   KQ+ + + P V T HLKRF+      +KI K V F P LDL P+V       
Sbjct  293   CNHKVRASKQMTIHKPPSVLTIHLKRFRAHDP-GQKINKEVQFGPTLDLRPFVS-GPYPE  350

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              + KY L+ V+VH G S  SGHYYCFV  S   W+  DD+ V +V+E  V+ Q+AY+LFY
Sbjct  351   GDLKYTLYGVLVHCGASTYSGHYYCFVRTSTGIWHSLDDNNVRQVREMTVLQQKAYMLFY  410

Query  1414  VK  1409
             V+
Sbjct  411   VR  412



>emb|CDY11838.1| BnaC03g12640D [Brassica napus]
Length=819

 Score =   230 bits (586),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 123/305 (40%), Positives = 176/305 (58%), Gaps = 15/305 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +    H   C     GFC LCA+++ +  +L + G  + P
Sbjct  101   TCFLNSVLQCLTYTEPLAAYLHDVGHEKRCHVA--GFCALCAMQKHVRNALQATGKILAP  158

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHEN-VVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  C     ++ + S  + + +V + FG
Sbjct  159   KYLVSNLRCVSRNFRNCRQEDAHEYMINLLECMHKCSLPSGVSSESSDAYRSSLVHKIFG  218

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H SD ++P +DLSL+I   DSL  AL  FT VE +++    + CE+C
Sbjct  219   GSLRSRVKCAQCSHCSDKFDPFLDLSLDISKADSLQRALTRFTAVELLDNGAKVYQCERC  278

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYV----ERNE  1604
             K +V   K+L + +AP V T HLKRF+   S  EKI K V F   +D+ P+V    E N 
Sbjct  279   KQKVKATKELTVSKAPYVLTVHLKRFEAHRS--EKIDKKVDFASAVDMKPFVSGPCEGN-  335

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
                   KY L+ V+VH G S+ SGHY CFV  S   WY  DD++V +V E  V +Q+AY+
Sbjct  336   -----LKYTLYGVLVHYGRSIHSGHYACFVRTSSGMWYSLDDNRVLQVSEKNVFNQKAYM  390

Query  1423  LFYVK  1409
             LFYV+
Sbjct  391   LFYVR  395



>ref|XP_004507732.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Cicer 
arietinum]
Length=914

 Score =   231 bits (588),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 127/303 (42%), Positives = 181/303 (60%), Gaps = 11/303 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H S C     GFC LCA+++ ++ +L S GS + P
Sbjct  100   TCFLNSVLQCLTYTEPLAAYLQSGKHKSSCHV--SGFCALCAIQKHVSCALQSTGSILSP  157

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V NL   S  F + +Q DAHE++   LE +  CC  P      SP     ++V   F
Sbjct  158   KDLVLNLRCISRNFGKSRQEDAHEYMVNLLESMHKCC-LPSGVPSESPGAFERSLVHNIF  216

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI + D+L  AL +FT  E ++  E ++ C++
Sbjct  217   GGRLRSQVKCQQCSYCSNKFDPFLDLSLEI-NADTLPKALANFTTPEWLDGGEKQYHCQR  275

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKN-DGSLVEKIAKHVTFPPELDLLPYVERNEKV  1598
             CK +V   KQL + +AP V T HLKRF   D S  +KI KHV F   LDL P+V  +   
Sbjct  276   CKQKVKALKQLTIHKAPSVLTIHLKRFHALDPS--KKITKHVRFGSALDLKPFVSGSYD-  332

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
               + KY+L+ V+VH G S  SGHYYC+V  S   WY  DD++V  V E  V++Q+AY+LF
Sbjct  333   -GDVKYSLYGVLVHSGYSTRSGHYYCYVRTSNGMWYTLDDNRVNHVSEREVLNQQAYMLF  391

Query  1417  YVK  1409
             Y +
Sbjct  392   YAR  394



>gb|KFK40800.1| hypothetical protein AALP_AA2G042900 [Arabis alpina]
Length=843

 Score =   230 bits (586),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 174/302 (58%), Gaps = 9/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  P    +    H   C     GFC LCA+++ +  +  + G  + P
Sbjct  109   TCFLNSVLQCLTYTEPFAAYLHQAAHQQRCHVA--GFCALCAMQKHVRTARQATGRILAP  166

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  C     +  + S  +  ++V + FG
Sbjct  167   KAMVSNLRCVSRNFRNCRQEDAHEYMINLLECMHKCSLPSGVPTESSDAYRTSLVHRIFG  226

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H SD Y+P +DLSL+I   DSL  AL  FT VE ++D    + CEKC
Sbjct  227   GSLRSQVKCEQCFHCSDKYDPFLDLSLDISKADSLHRALSRFTAVEHLDDGRKVYQCEKC  286

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVE-RNEKVI  1595
             K +V   KQL + +AP V T HLKRF+   S  EKI + V F   +D+ P+V  R E  +
Sbjct  287   KQKVKAIKQLTVFKAPDVLTIHLKRFEAHRS--EKIDRKVQFTSAIDMKPFVSGRYEGNL  344

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
                KY L+ V+VH G S+ SGHY CFV  S   WY  DD++V +V E  V +Q+AY+LFY
Sbjct  345   ---KYTLYGVLVHYGRSMHSGHYACFVRTSTGMWYSLDDNRVLQVSEKTVFNQKAYMLFY  401

Query  1414  VK  1409
             V+
Sbjct  402   VR  403



>ref|XP_006343657.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Solanum 
tuberosum]
Length=931

 Score =   230 bits (587),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 128/303 (42%), Positives = 184/303 (61%), Gaps = 10/303 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +E+  H S C     GFC LCA+++ ++ +L + G  + P
Sbjct  121   TCFLNSVLQCLTYTEPLAAYLESGKHQSSCRMA--GFCALCAIQKHVSRALQATGKILAP  178

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    ++ +    +E ++V + FG
Sbjct  179   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCCLPSGVSSESPSAYEKSLVHKIFG  238

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S++QC  C   SD ++P +DLSLEI   DSL  ALD FT  E ++  + ++ C++C
Sbjct  239   GRLRSQVQCMQCKFCSDKFDPFLDLSLEILRADSLLKALDHFTARELLDGGQKQYQCQQC  298

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEKV  1598
             K +V   K+L +D+AP V T HLKRF   GS V  +KI K + + P LDL  +V  ++  
Sbjct  299   KQKVKATKRLTIDQAPHVLTVHLKRF---GSHVPGQKIDKKIHYGPTLDLKHFV--SDTY  353

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
               E KY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+LF
Sbjct  354   SGELKYTLYGVLVHAGWSTHSGHYYCFVRTSSGNWYSLDDNQVVQVSERKVLEQKAYMLF  413

Query  1417  YVK  1409
             YV+
Sbjct  414   YVR  416



>ref|XP_002866243.1| ubiquitin-specific protease 23 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42502.1| ubiquitin-specific protease 23 [Arabidopsis lyrata subsp. lyrata]
Length=863

 Score =   229 bits (585),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 173/301 (57%), Gaps = 7/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL  +++   H   C     GFC LCA+++ +  +  + G  + P
Sbjct  115   TCFLNSVLQCLTYTEPLAATLQTAAHQKYCHVA--GFCALCAIQKHVRTARQATGRILAP  172

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  C     +  + S  +  ++V   FG
Sbjct  173   KDLVSNLRCISRNFRNCRQEDAHEYMINLLECMHKCSLPSGVPSESSDAYRRSLVHNIFG  232

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H S+ ++P +DLSL+I   DSL  AL  FT VE ++D    + CE+C
Sbjct  233   GSLRSQVKCEQCSHCSNKFDPFLDLSLDISKADSLQRALSRFTAVELLDDGSKVYQCERC  292

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQL + +AP V T HLKRF+   S  EKI + V F   +D+ P+V    +   
Sbjct  293   KQKVKARKQLTVSKAPYVLTIHLKRFEAHRS--EKIDRKVDFASAIDMKPFVSGPHE--G  348

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY L+ V+VH G S  SGHY CFV  S   WY  DD++V +V E  V +Q+AY+LFYV
Sbjct  349   NLKYTLYGVLVHYGRSSHSGHYACFVRTSSGMWYSLDDNRVLQVSEKTVFNQKAYMLFYV  408

Query  1411  K  1409
             +
Sbjct  409   R  409



>ref|XP_002110073.1| hypothetical protein TRIADDRAFT_53651 [Trichoplax adhaerens]
 gb|EDV28239.1| hypothetical protein TRIADDRAFT_53651 [Trichoplax adhaerens]
Length=870

 Score =   229 bits (585),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 176/301 (58%), Gaps = 8/301 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL     A  H   C     GFCVLC L+ LM   L S GS+++P
Sbjct  113   TCYLNSVLQCLCYTPPLANYALAEQHKKDCRKI--GFCVLCELQSLMVRCLKSNGSSVKP  170

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC--NYPKLNGQVSPKHENVVKQTF  1955
               IVN L   +S  Q  +Q DAHEFL+  ++ ++S C   YPK   Q S K   ++ + F
Sbjct  171   WPIVNKLKNIASHIQFGRQEDAHEFLRYLVDGIQSSCLAAYPKNLDQYS-KDTTMIYRIF  229

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG+L S +QC  C ++S  Y+P++DLSL+I D+++LS  L  F + E I      +TC K
Sbjct  230   GGYLRSLVQCAQCKYKSIKYDPMLDLSLDIADLNTLSAMLRKFIEPE-ILSGRDMYTCSK  288

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CKV+V   K+  +  AP+V T  +KRF        K ++ + F   LDL PY+    K  
Sbjct  289   CKVKVKAMKKFTIHRAPVVLTIPIKRFNKFSLFGGKNSRKIKFTETLDLRPYM--TSKTG  346

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
                 YNL+ V+VH G S +SGHYYC+V +S ++WY  +DS VT+   N V+ QEAYILFY
Sbjct  347   SPLLYNLYGVLVHSGGSCNSGHYYCYVKSSNNQWYCMNDSHVTKSNINAVLLQEAYILFY  406

Query  1414  V  1412
             +
Sbjct  407   I  407



>gb|KHN42818.1| Ubiquitin carboxyl-terminal hydrolase 23 [Glycine soja]
Length=877

 Score =   229 bits (585),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 179/301 (59%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA++  ++ +L S G  + P
Sbjct  103   TCFLNSVLQCLTYTEPLAAYLQSGKHKTSCHVA--GFCALCAIQNHVSRALQSTGRILSP  160

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             + +V NL   S  F+  +Q DAHE++   LE +  CC    +  +    +E + V + FG
Sbjct  161   EDLVGNLRCISRNFRNARQEDAHEYMVNLLECMHKCCLPSGIPSESPGAYEKSFVHKIFG  220

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   DSL  AL +FT  E ++  E ++ C++C
Sbjct  221   GRLRSQVKCHQCSYCSNKFDPFLDLSLEIFKADSLQKALSNFTAAEWLDGGEKEYHCQRC  280

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQL + +AP V T HLKRF       +KI K + F   LDL P+V  +     
Sbjct  281   KQKVRALKQLTIHKAPYVLTIHLKRFHAHDP-GQKIKKKIQFGCALDLKPFVSGSYD--G  337

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY+L+ V+VH G S  SGHYYC+V  S + WY  DD++V+ V E  V++Q+AY+LFYV
Sbjct  338   DVKYSLYGVLVHAGSSTHSGHYYCYVRTSNNMWYTLDDNRVSHVSEREVLNQQAYMLFYV  397

Query  1411  K  1409
             +
Sbjct  398   R  398



>gb|EYU34351.1| hypothetical protein MIMGU_mgv1a000974mg [Erythranthe guttata]
Length=925

 Score =   230 bits (586),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 176/305 (58%), Gaps = 14/305 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSV+QC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G  + P
Sbjct  122   TCFLNSVVQCLTYTEPLAAYLQSGKHQNNCRTA--GFCALCAIQKHVSRALQSTGRILEP  179

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHEN-----VVK  1964
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    L   V  + +N     +V 
Sbjct  180   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCC----LPSGVPTESDNAYDKSLVH  235

Query  1963  QTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFT  1784
             + FGG L S+++C  C   S+ +EP +DLSLEI   DS+  AL  FT  E+++    ++ 
Sbjct  236   KIFGGRLRSQVKCMQCSFCSNKFEPFLDLSLEIAKADSVHKALAHFTSKEQLDGGAKEYQ  295

Query  1783  CEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNE  1604
             C++CK +V   KQL + +AP V   HLKRF    S  +KI K + F P LDL P+V    
Sbjct  296   CQQCKQKVKALKQLTVHKAPHVLAVHLKRFSAH-SPGQKIDKKIAFGPTLDLKPFVTGTH  354

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
                 +  Y L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+
Sbjct  355   D--GDLNYTLYGVLVHAGWSTRSGHYYCFVRTSSGMWYNLDDNQVYQVNERKVLEQKAYM  412

Query  1423  LFYVK  1409
             LFYV+
Sbjct  413   LFYVR  417



>ref|XP_643982.1| peptidase C19 family protein [Dictyostelium discoideum AX4]
 gb|EAL70306.1| peptidase C19 family protein [Dictyostelium discoideum AX4]
Length=919

 Score =   229 bits (585),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 120/303 (40%), Positives = 181/303 (60%), Gaps = 8/303 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+NSVLQC  + VPL   + + +H   C+A   GFC+ C+L+  +  S    G +I P
Sbjct  242   TCFMNSVLQCLTYTVPLANFMMSREHSRQCQAS--GFCIFCSLETQVLQSHKCGGKSITP  299

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLE--SCCNYPKLNGQVSPKHENVVKQTF  1955
             K+I +N+   + TF+  +Q D+HEF++  +E L+  S   YPK +         V+   F
Sbjct  300   KEIASNIRKIAPTFRIGRQEDSHEFIRFMIESLQKVSLSKYPKGSINHRDAMTTVIGSIF  359

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG+L S+++C  C + S+TY+P +DL ++I   DSL+  L +F K E + D   K+ C K
Sbjct  360   GGYLRSQVKCSQCQYESNTYDPFMDLCVDINQADSLTKGLTNFVKSELL-DGSNKYKCSK  418

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK  V  +K+L +  AP + T  +KRF   GS   KI + + F   L+L P++ ++    
Sbjct  419   CKKLVKAQKRLQIHIAPPILTCQIKRFSFLGSYGGKINRQIQFDQSLNLSPFMTQSN---  475

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
               S Y+L+AV+VH+G S SSGHYYC+V  S   WY  DDS V++V  N V+SQ+AY+LFY
Sbjct  476   NHSIYDLYAVLVHLGGSTSSGHYYCYVKGSNGIWYNMDDSSVSQVSLNTVLSQKAYMLFY  535

Query  1414  VKQ  1406
              K+
Sbjct  536   SKR  538



>ref|XP_009763327.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X1 
[Nicotiana sylvestris]
Length=941

 Score =   230 bits (586),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 183/304 (60%), Gaps = 12/304 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +E+  H + C     GFC LCA+++ ++ +L + G  + P
Sbjct  119   TCFLNSVLQCLTYTEPLAAYLESGKHQNSCRMA--GFCALCAIQKHVSRALQATGKILAP  176

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  177   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCC-LPSGVPSESPSAYDKSLVHKIF  235

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S++QC  C   SD ++P +DLSLEI   DSL  AL  FT  E ++  + ++ C++
Sbjct  236   GGRLRSQVQCMQCNFCSDKFDPFLDLSLEILKADSLQRALQHFTARELLDGGQRQYQCQQ  295

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEK  1601
             CK +V   K+L +D+AP V T HLKRF   GS V  +KI K + + P LDL  +V  ++ 
Sbjct  296   CKQKVKATKRLTIDKAPHVLTIHLKRF---GSHVPGQKIDKKIHYGPTLDLKHFV--SDT  350

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                ESKY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+L
Sbjct  351   YGGESKYTLYGVLVHAGWSTHSGHYYCFVRTSSGNWYSLDDNQVVQVSERKVLEQKAYML  410

Query  1420  FYVK  1409
             FYV+
Sbjct  411   FYVR  414



>ref|XP_009763328.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X2 
[Nicotiana sylvestris]
Length=921

 Score =   229 bits (585),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 183/304 (60%), Gaps = 12/304 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +E+  H + C     GFC LCA+++ ++ +L + G  + P
Sbjct  119   TCFLNSVLQCLTYTEPLAAYLESGKHQNSCRMA--GFCALCAIQKHVSRALQATGKILAP  176

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  177   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCC-LPSGVPSESPSAYDKSLVHKIF  235

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S++QC  C   SD ++P +DLSLEI   DSL  AL  FT  E ++  + ++ C++
Sbjct  236   GGRLRSQVQCMQCNFCSDKFDPFLDLSLEILKADSLQRALQHFTARELLDGGQRQYQCQQ  295

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEK  1601
             CK +V   K+L +D+AP V T HLKRF   GS V  +KI K + + P LDL  +V  ++ 
Sbjct  296   CKQKVKATKRLTIDKAPHVLTIHLKRF---GSHVPGQKIDKKIHYGPTLDLKHFV--SDT  350

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                ESKY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+L
Sbjct  351   YGGESKYTLYGVLVHAGWSTHSGHYYCFVRTSSGNWYSLDDNQVVQVSERKVLEQKAYML  410

Query  1420  FYVK  1409
             FYV+
Sbjct  411   FYVR  414



>ref|XP_009403134.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 36-like [Musa 
acuminata subsp. malaccensis]
Length=993

 Score =   230 bits (586),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 121/303 (40%), Positives = 178/303 (59%), Gaps = 10/303 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  P    +++  H   C+    GFC +CA++  + I+L S G  + P
Sbjct  108   TCFLNSVLQCLTYTEPFAAYLQSGKHQISCQIA--GFCAMCAIQNHVMIALQSTGKILSP  165

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
               +V NL   S  F+  +Q DAHE++   LE +  CC    +  +    +E ++V + FG
Sbjct  166   STLVKNLRCISRNFRNSRQEDAHEYMVSLLESMHKCCLPSGVPSESPTAYEKSLVHKIFG  225

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI  VDSL  AL  FT VE+++  E ++ C+ C
Sbjct  226   GRLRSQVKCMQCSYSSNKFDPFLDLSLEIAKVDSLWKALKHFTAVEQLDGGERQYQCQNC  285

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEKV  1598
             K +V   KQL + +AP V T HLKRF    SL   +KI   V F   LDL P++    + 
Sbjct  286   KEKVRALKQLTIHKAPYVLTIHLKRFD---SLFPGQKIDTKVDFDLTLDLKPFISDPHE-  341

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
              ++ KY L+ V+VH G S  SGHYYC+V  S   W+  DD++V +V E  V+ Q+AY+LF
Sbjct  342   -DDLKYTLYGVLVHAGWSTESGHYYCYVCTSSGMWHSLDDNQVYQVSEKTVLEQKAYMLF  400

Query  1417  YVK  1409
             YV+
Sbjct  401   YVR  403



>ref|XP_007154887.1| hypothetical protein PHAVU_003G156400g [Phaseolus vulgaris]
 gb|ESW26881.1| hypothetical protein PHAVU_003G156400g [Phaseolus vulgaris]
Length=885

 Score =   229 bits (583),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/302 (41%), Positives = 179/302 (59%), Gaps = 8/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA++  ++ +L S G  + P
Sbjct  99    TCFLNSVLQCLTYTEPLAAYLQSGKHKTSCRVA--GFCALCAIQNHVSRALQSTGRILSP  156

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             + +V NL   S  F+  +Q DAHE++   LE +  CC  P      SP    ++ V + F
Sbjct  157   EDLVGNLRCISRNFRNARQEDAHEYMVNLLECMHKCC-LPSGVPSESPGAYEKSFVHKIF  215

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI   DSL  AL +FT  E ++  E ++ C++
Sbjct  216   GGRLRSQVKCHQCSYCSNKFDPFLDLSLEIFKADSLQKALANFTAAEWLDGGEREYHCQR  275

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +V   KQL + +AP V T HLKRF       +KI K V F   LDL P+V  +    
Sbjct  276   CKQKVRALKQLTIHKAPYVLTIHLKRFHAHDP-GQKIKKKVNFGCALDLKPFVSGSYD--  332

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              + KY+L+ V+VH G S  SGHYYC+V  S + WY  DD++V+ V E  V++Q+AY+LFY
Sbjct  333   GDVKYSLYGVLVHSGSSTHSGHYYCYVRTSNNMWYTLDDNRVSHVSEREVLNQQAYMLFY  392

Query  1414  VK  1409
             V+
Sbjct  393   VR  394



>ref|XP_010235035.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 21 [Brachypodium 
distachyon]
Length=467

 Score =   221 bits (563),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 121/317 (38%), Positives = 188/317 (59%), Gaps = 11/317 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+N +LQC +H  PL+  +   DH   C + ++ FC  C+LK      +   G  + P
Sbjct  74    TCFINCILQCVVHTGPLVSKLLKDDHIDACLSGSDKFCCYCSLKLHAIEVIKLSGLFLYP  133

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHENVVKQTFGG  1949
             +K V  +   S+ F+  +Q DAHEFL+  L +L+   + P  +    P   ++VK+ F G
Sbjct  134   RKFVKVVQLVSANFESERQQDAHEFLRFLLNKLDEA-SVPSSSPSERPI--SIVKEIFRG  190

Query  1948  HLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCK  1769
              L S+L C  C H SD  EP +DLSLE+  +DS+  AL SFTK+E +E+    F C+ CK
Sbjct  191   LLKSQLHCPGCNHCSDKLEPFLDLSLEVNQMDSVMDALHSFTKIEVVEN----FICDGCK  246

Query  1768  VQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEE  1589
               V++EK   +++AP V    LKRF+  G+ + KI   V +  ELDL P++   +   + 
Sbjct  247   SCVNMEKHFEVEQAPKVLVIQLKRFQILGTYISKIESMVKYQLELDLNPFMSSPDS--KP  304

Query  1588  SKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRV-QENVVMSQEAYILFYV  1412
               Y+L+AVV H GV    GHY  ++H+S ++W+ FDD KV ++ +E+ ++   AY+LFYV
Sbjct  305   QNYDLYAVVEHSGVP-CGGHYVSYIHSSQTDWFLFDDDKVMKINEEDKILGSSAYLLFYV  363

Query  1411  KQGTPWFSEIIETQQLI  1361
             KQG+PWFS ++E + ++
Sbjct  364   KQGSPWFSTLLEEKNML  380



>gb|KHG21280.1| Ubiquitin carboxyl-terminal hydrolase 23 -like protein [Gossypium 
arboreum]
Length=977

 Score =   229 bits (584),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 127/343 (37%), Positives = 186/343 (54%), Gaps = 48/343 (14%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL+  +++  H S C     GFC LCA+++ +N +L S G  + P
Sbjct  124   TCFLNSVLQCLTYTEPLVAYLQSGTHQSSCRIA--GFCALCAIQKHVNRALQSTGRILAP  181

Query  2128  KKIVNNL--------------------------------SY----------FSSTFQRFQ  2075
             K +V+NL                                SY           S  F+  +
Sbjct  182   KDLVSNLRCILFVCHVTNYSDIQLRCMKILLVNLYPTEISYRTWDLNSWLGISRNFRNSR  241

Query  2074  QGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFGGHLISKLQCCNCGHRSDT  1898
             Q DAHE++   LE +  CC    ++ +    +E ++V + FGG L S+++C  C + S+T
Sbjct  242   QEDAHEYMVNLLESMHKCCLPLGVSSESPSSYEKSLVHKIFGGRLRSQVKCMQCSYCSNT  301

Query  1897  YEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKCKVQVSIEKQLLLDEAPLV  1718
             ++P +DLSLEI   DSL  AL +FT  E ++  E ++ C++CK +V   KQL +  AP V
Sbjct  302   FDPFLDLSLEIVKADSLHKALKNFTAAELLDGGERQYQCQRCKQKVKAIKQLTVYNAPHV  361

Query  1717  ATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIEESKYNLFAVVVHIGVSLS  1538
              T HLKRF+      +KI + V F P LD+ P+V  + +   + KY L+ V+VH G S  
Sbjct  362   LTIHLKRFRAY-DFGQKIDRKVEFGPTLDMKPFVSGSNE--GDLKYTLYGVLVHCGWSTH  418

Query  1537  SGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYVK  1409
             SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+LFYV+
Sbjct  419   SGHYYCFVRTSSGMWYSLDDNRVVQVSERTVLEQKAYMLFYVR  461



>gb|AAG42761.1|AF302671_1 ubiquitin-specific protease 23 [Arabidopsis thaliana]
Length=859

 Score =   228 bits (581),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/301 (40%), Positives = 175/301 (58%), Gaps = 7/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL  +++   H   C     GFC LCA+++ +  +  + G  + P
Sbjct  115   TCFLNSVLQCLTYTEPLAATLQTAAHQKYCHVA--GFCALCAIQKHVRTARQANGRILAP  172

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  C     +  + S  +  ++V + FG
Sbjct  173   KDLVSNLRCISRNFRNCRQEDAHEYMINLLECMHKCSLPSGVPSESSDAYRRSLVHKIFG  232

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H S+ ++P +DLSL+I   DSL  AL  FT VE +++    + CE+C
Sbjct  233   GSLRSQVKCEQCSHCSNKFDPFLDLSLDISKADSLQRALSRFTAVELLDNGAKVYQCERC  292

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V  +KQL + +AP V T HLKRF+   S  EKI + V F   +D+ P+V    +   
Sbjct  293   KQKVKAKKQLTVSKAPYVLTVHLKRFEAHRS--EKIDRKVDFTSAIDMKPFVSGPHE--G  348

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY L+ V+VH G S  SGHY CFV  S   WY  DD++V +V E  V +Q+AY+LFYV
Sbjct  349   NLKYTLYGVLVHYGRSSHSGHYACFVRTSSGMWYSLDDNRVVQVSEKTVFNQKAYMLFYV  408

Query  1411  K  1409
             +
Sbjct  409   R  409



>ref|NP_568873.1| ubiquitin carboxyl-terminal hydrolase 23 [Arabidopsis thaliana]
 sp|Q9FPS4.2|UBP23_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 23; AltName: 
Full=Deubiquitinating enzyme 23; Short=AtUBP23; AltName: 
Full=Ubiquitin thioesterase 23; AltName: Full=Ubiquitin-specific-processing 
protease 23 [Arabidopsis thaliana]
 gb|AED96982.1| ubiquitin carboxyl-terminal hydrolase 23 [Arabidopsis thaliana]
Length=859

 Score =   228 bits (581),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/301 (40%), Positives = 175/301 (58%), Gaps = 7/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL  +++   H   C     GFC LCA+++ +  +  + G  + P
Sbjct  115   TCFLNSVLQCLTYTEPLAATLQTAAHQKYCHVA--GFCALCAIQKHVRTARQANGRILAP  172

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  C     +  + S  +  ++V + FG
Sbjct  173   KDLVSNLRCISRNFRNCRQEDAHEYMINLLECMHKCSLPSGVPSESSDAYRRSLVHKIFG  232

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H S+ ++P +DLSL+I   DSL  AL  FT VE +++    + CE+C
Sbjct  233   GSLRSQVKCEQCSHCSNKFDPFLDLSLDISKADSLQRALSRFTAVELLDNGAKVYQCERC  292

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V  +KQL + +AP V T HLKRF+   S  EKI + V F   +D+ P+V    +   
Sbjct  293   KQKVKAKKQLTVSKAPYVLTVHLKRFEAHRS--EKIDRKVDFTSAIDMKPFVSGPHE--G  348

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY L+ V+VH G S  SGHY CFV  S   WY  DD++V +V E  V +Q+AY+LFYV
Sbjct  349   NLKYTLYGVLVHYGRSSHSGHYACFVRTSSGMWYSLDDNRVVQVSEKTVFNQKAYMLFYV  408

Query  1411  K  1409
             +
Sbjct  409   R  409



>ref|XP_004242587.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 [Solanum 
lycopersicum]
Length=923

 Score =   228 bits (582),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/304 (43%), Positives = 182/304 (60%), Gaps = 12/304 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +E+  H S C     GFC LCA+++ ++ +L + G  + P
Sbjct  121   TCFLNSVLQCLTYTEPLAAYLESGKHQSSCRMA--GFCALCAIQKHVSRALQATGKILAP  178

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  179   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCC-LPSGVPSESPSAYEKSLVHKIF  237

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S++QC  C   SD ++P +DLSLEI   DSL  ALD FT  E ++  + ++ C++
Sbjct  238   GGRLRSQVQCMQCKFCSDKFDPFLDLSLEILRADSLLKALDHFTARELLDGGQRQYQCQQ  297

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEK  1601
             CK +V   K+L +D AP V T HLKRF   GS V  +KI K + + P LDL  +V  ++ 
Sbjct  298   CKQKVKATKRLTIDRAPHVLTVHLKRF---GSHVPGQKIDKKIHYGPTLDLKHFV--SDT  352

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                E KY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+L
Sbjct  353   YSGELKYTLYGVLVHAGWSTHSGHYYCFVRTSSGNWYSLDDNQVVQVSERKVLEQKAYML  412

Query  1420  FYVK  1409
             FYV+
Sbjct  413   FYVR  416



>ref|XP_011018026.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Populus 
euphratica]
Length=949

 Score =   228 bits (582),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/302 (39%), Positives = 184/302 (61%), Gaps = 8/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSV+QC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G ++ P
Sbjct  111   TCFLNSVVQCLTYTEPLAAYLQSGKHQNSCHVA--GFCALCAIQKHVSCALQSSGRSLVP  168

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  169   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCC-LPSGVPSESPAAYEKSLVHKIF  227

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GGHL S+++C  C + S+ ++P +DLSLEI   D+L +AL +FT  E ++  E ++ C++
Sbjct  228   GGHLRSQVECQQCSYCSNKFDPFLDLSLEIAKADTLPVALRNFTAAEVLDGGEKQYQCQR  287

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +V  +K+L + +AP V T HLKRF        K+ + V F   LD+ P+V  + +  
Sbjct  288   CKQKVRAKKRLTVHKAPHVLTIHLKRFHAHDP-GRKVDRKVIFDRSLDMKPFVSGSYE--  344

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              E KY+L+ V+VH G +  SGHY CFV  S + W+  +D++V +V E  V+ Q+AY+LFY
Sbjct  345   GELKYSLYGVLVHYGHNTHSGHYVCFVRTSSNMWHLLNDNQVRQVSEKTVLEQKAYMLFY  404

Query  1414  VK  1409
             V+
Sbjct  405   VR  406



>ref|XP_002325138.2| hypothetical protein POPTR_0018s11680g [Populus trichocarpa]
 gb|EEF03703.2| hypothetical protein POPTR_0018s11680g [Populus trichocarpa]
Length=949

 Score =   228 bits (581),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 184/302 (61%), Gaps = 8/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSV+QC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G ++ P
Sbjct  111   TCFLNSVVQCLTYTEPLAAYLQSGKHQNSCHVA--GFCALCAIQKHVSRALQSSGRSLVP  168

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  169   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCC-LPSGVPSESPAAYEKSLVHKIF  227

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GGHL S+++C  C + S+ ++P +DLSLEI   D+L +AL +FT  E ++  E ++ C++
Sbjct  228   GGHLRSQVECQQCSYCSNKFDPFLDLSLEIAKADTLPVALRNFTAAEVLDGGEKQYQCQR  287

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +V  +K+L + +AP V T HLKRF        K+ K V F   LD+ P+V  + +  
Sbjct  288   CKQKVRAKKRLTVHKAPHVLTIHLKRFHAHDP-GRKVDKKVIFDRSLDIKPFVSGSYE--  344

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              E KY+L+ V+VH G +  SGHY CFV  S + W+  +D++V +V E  V+ Q+AY+LFY
Sbjct  345   GELKYSLYGVLVHYGHNTHSGHYVCFVRTSSNMWHLLNDNQVRQVSEKTVLEQKAYMLFY  404

Query  1414  VK  1409
             V+
Sbjct  405   VR  406



>ref|XP_011079415.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 [Sesamum 
indicum]
Length=922

 Score =   228 bits (580),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 128/326 (39%), Positives = 192/326 (59%), Gaps = 14/326 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H S C     GFC LCA+++ ++ +L S G  + P
Sbjct  96    TCFLNSVLQCLTYTEPLAAYLQSGKHQSSCRTA--GFCALCAIQKHVSRALQSTGRILEP  153

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    L  +    +E ++V + FG
Sbjct  154   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCCLPSGLPSESPSAYEKSLVHKIFG  213

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C   S+ ++P +DLSLEI   DSL  AL  FT  E+++    ++ C++C
Sbjct  214   GRLRSQVKCMQCSFCSNKFDPFLDLSLEIVKADSLRKALAHFTAKEQLDGGAKQYQCQQC  273

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEKV  1598
             K +V   KQL + +AP V T HLKRF   GS +  +KI K + F P LDL PYV      
Sbjct  274   KQKVKALKQLTVHKAPYVLTVHLKRF---GSHLPGQKIDKKIAFEPTLDLKPYV--TGPY  328

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
               + KY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+LF
Sbjct  329   DGDLKYTLYGVLVHAGWSTHSGHYYCFVRTSSGMWYSLDDNQVIQVNERKVLEQKAYMLF  388

Query  1417  YVKQGTPWFS----EIIETQQLILDA  1352
             YV+    + +    +++  ++++++A
Sbjct  389   YVRDRRSFPTKKPVDVVHKEKIVMNA  414



>ref|XP_009623302.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X1 
[Nicotiana tomentosiformis]
Length=918

 Score =   227 bits (579),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 183/304 (60%), Gaps = 12/304 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +E+  H + C     GFC LCA+++ ++ +L + G  + P
Sbjct  119   TCFLNSVLQCLTYTEPLAAYLESGKHQNSCRMA--GFCALCAIQKHVSRALQATGKILAP  176

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  177   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCC-LPSGVPSESPSAYDKSLVHKIF  235

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S++QC  C   SD ++P +DLSLEI   DSL  AL  FT  E ++  + ++ C++
Sbjct  236   GGRLRSQVQCMQCNFCSDKFDPFLDLSLEILKADSLQRALQHFTARELLDGGQRQYQCQQ  295

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEK  1601
             CK +V   K+L +D+AP V T HLKRF   GS V  +KI K + + P LDL  +V  ++ 
Sbjct  296   CKQKVKATKRLTIDKAPHVLTIHLKRF---GSHVPGQKIDKKIHYGPTLDLKHFV--SDT  350

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                ES+Y L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+L
Sbjct  351   YGGESQYTLYGVLVHAGWSTHSGHYYCFVRTSSGNWYSLDDNQVVQVSERKVLEQKAYML  410

Query  1420  FYVK  1409
             FYV+
Sbjct  411   FYVR  414



>ref|XP_009623303.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X2 
[Nicotiana tomentosiformis]
Length=898

 Score =   227 bits (578),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 183/304 (60%), Gaps = 12/304 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +E+  H + C     GFC LCA+++ ++ +L + G  + P
Sbjct  119   TCFLNSVLQCLTYTEPLAAYLESGKHQNSCRMA--GFCALCAIQKHVSRALQATGKILAP  176

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  177   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCC-LPSGVPSESPSAYDKSLVHKIF  235

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S++QC  C   SD ++P +DLSLEI   DSL  AL  FT  E ++  + ++ C++
Sbjct  236   GGRLRSQVQCMQCNFCSDKFDPFLDLSLEILKADSLQRALQHFTARELLDGGQRQYQCQQ  295

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEK  1601
             CK +V   K+L +D+AP V T HLKRF   GS V  +KI K + + P LDL  +V  ++ 
Sbjct  296   CKQKVKATKRLTIDKAPHVLTIHLKRF---GSHVPGQKIDKKIHYGPTLDLKHFV--SDT  350

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                ES+Y L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+L
Sbjct  351   YGGESQYTLYGVLVHAGWSTHSGHYYCFVRTSSGNWYSLDDNQVVQVSERKVLEQKAYML  410

Query  1420  FYVK  1409
             FYV+
Sbjct  411   FYVR  414



>ref|XP_002532957.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29423.1| conserved hypothetical protein [Ricinus communis]
Length=834

 Score =   226 bits (576),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 127/336 (38%), Positives = 196/336 (58%), Gaps = 14/336 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G ++ P
Sbjct  15    TCFLNSVLQCLTYTEPLAAYLQSGKHQTSCHIA--GFCALCAIQKHVSRALQSTGRSLVP  72

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  73    KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCC-LPSGVPSESPAAYEKSLVHKIF  131

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI   D+L +AL +FT  E ++  E  + C+K
Sbjct  132   GGRLRSQVECQQCSYCSNKFDPFLDLSLEIVKADTLPVALRNFTAAELLDGGEKHYQCQK  191

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +V  +K+L +  AP V T HLKRF        K+ K V F   LD+ P+V  + +  
Sbjct  192   CKQKVRAKKRLTVHNAPNVLTIHLKRFHAHDP-GRKVDKKVLFDHSLDMKPFVSGSYE--  248

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              + KY+L+ V+VH G S  SGHY CF+  S   W+  +D++V  V E VV+ Q+AY+LFY
Sbjct  249   GDLKYSLYGVLVHFGHSTHSGHYVCFIRTSSGIWHLLNDNEVRPVSEKVVLDQKAYMLFY  308

Query  1414  VK----QGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             V+      T   ++++  +   + ASIS++ P  VL
Sbjct  309   VRDRKANATKRPADVVRKEN--VKASISSNLPNLVL  342



>ref|XP_010443509.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Camelina 
sativa]
Length=844

 Score =   226 bits (576),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 119/301 (40%), Positives = 173/301 (57%), Gaps = 7/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL  +++   H   C     GFC LCA+++ +  +  + G  + P
Sbjct  116   TCFLNSVLQCLTYTEPLAATLQTVAHQKYCNVA--GFCALCAIQKHVRTARQATGRILAP  173

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  C     +  + S  +  ++V + FG
Sbjct  174   KDLVSNLRCISRNFRNCRQEDAHEYMINLLECMHKCSLPSGVPSESSDAYRRSLVHKIFG  233

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H S+ ++P +DLSL+I   DSL  AL  FT VE ++D    + CE+C
Sbjct  234   GSLRSQVKCEQCSHCSNKFDPFLDLSLDISKADSLQRALLRFTAVELLDDGAKVYQCERC  293

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             + +V   KQL + +AP V T HLKRF+   S  EKI + V F   +D+ P+V    +   
Sbjct  294   RHKVKARKQLTVSKAPYVLTVHLKRFEAHRS--EKIDRKVQFTSAIDMKPFVSGPHE--G  349

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY L+ V+VH G S  SGHY CFV  S   WY  DD++V +V E  V  Q+AY+LFYV
Sbjct  350   NLKYTLYGVLVHYGRSSHSGHYACFVRTSSGMWYSLDDNRVFQVSEKTVFDQKAYMLFYV  409

Query  1411  K  1409
             +
Sbjct  410   R  410



>ref|XP_008242981.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 [Prunus mume]
Length=954

 Score =   226 bits (577),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 184/301 (61%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++++L S G ++ P
Sbjct  120   TCYLNSVLQCLTYTEPLAAYLQSGKHRNSCHIA--GFCALCAIQKHVSLALQSTGRSLVP  177

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V NL   S  F + +Q DAHE++   LE +  CC    +  + S  +E ++V + FG
Sbjct  178   KDLVINLRCISRNFTKSRQEDAHEYMVNLLESMHKCCLPSGVPSESSSAYEKSLVHKIFG  237

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C   S+ ++P +DLSLEI   DSL  AL +FT  E+++  E ++ C++C
Sbjct  238   GRLRSQVKCLQCSCCSNKFDPFLDLSLEIFKADSLQKALGNFTAAEQLDGGERQYQCQQC  297

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQ+ + + P V T HLKRF+       KI +HV F P LDL P+V  + +   
Sbjct  298   KQKVRALKQMTVHKPPYVLTIHLKRFRAHDP-GRKIDRHVKFGPTLDLRPFVSGSYE--G  354

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY L+ V+VH G S  SGHYYC+V  S   WY  DD++V +V E +V+ Q+AY+LFYV
Sbjct  355   DLKYTLYGVLVHCGASTYSGHYYCYVRTSSGMWYSLDDNQVFQVSERIVLEQKAYMLFYV  414

Query  1411  K  1409
             +
Sbjct  415   R  415



>ref|XP_010453037.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Camelina 
sativa]
Length=844

 Score =   225 bits (574),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/301 (40%), Positives = 173/301 (57%), Gaps = 7/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL  +++   H   C     GFC LCA+++ +  +  + G  + P
Sbjct  117   TCFLNSVLQCLTYTEPLAATLQTVAHQKYCNVA--GFCALCAIQKHVRTARQATGRILAP  174

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  C     +  + S  +  ++V + FG
Sbjct  175   KDLVSNLRCISRNFRNCRQEDAHEYMINLLECMHKCSLPSGVPSESSDAYRRSLVHKIFG  234

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H S+ ++P +DLSL+I   DSL  AL  FT VE ++D    + CE+C
Sbjct  235   GSLRSQVKCEQCSHCSNKFDPFLDLSLDISKADSLQRALLRFTAVELLDDGAKVYQCERC  294

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             + +V   KQL + +AP V T HLKRF+   S  EKI + V F   +D+ P+V    +   
Sbjct  295   RHKVKARKQLTIFKAPYVLTVHLKRFEAHRS--EKIDRKVQFTSAIDMKPFVSGPHE--G  350

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY L+ V+VH G S  SGHY CFV  S   WY  DD++V +V E  V  Q+AY+LFYV
Sbjct  351   NLKYTLYGVLVHYGRSSHSGHYACFVRTSSGMWYSLDDNRVFQVSEKTVFDQKAYMLFYV  410

Query  1411  K  1409
             +
Sbjct  411   R  411



>ref|XP_010047114.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X2 
[Eucalyptus grandis]
 gb|KCW78912.1| hypothetical protein EUGRSUZ_C00353 [Eucalyptus grandis]
 gb|KCW78913.1| hypothetical protein EUGRSUZ_C00353 [Eucalyptus grandis]
Length=949

 Score =   226 bits (576),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 186/302 (62%), Gaps = 10/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G ++ P
Sbjct  120   TCFLNSVLQCLTYTEPLAAYLQSGKHQNSCRI--NGFCALCAIQKHVSRALKSTGESLAP  177

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP+   +++V + F
Sbjct  178   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCC-LPSGVPTESPRAYDKSLVHKIF  236

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+T++P +DLSLEI   DS+  AL  FT  E+++  E ++ C++
Sbjct  237   GGRLRSQVKCMQCSYGSNTFDPFLDLSLEIAKADSVVKALKHFTAAEQLDGGERQYQCQQ  296

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +V   KQL + +AP V T HLKRF +     +KI K V F   LDL P+V  + +  
Sbjct  297   CKQKVRAIKQLTVHKAPYVLTVHLKRFHDP---TQKINKSVFFDTALDLKPFVSGSYE--  351

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
              + KY L+ V+VH G S  SGHYYC+V  S + WY  DD++V +V E+ V+ Q+AY+LFY
Sbjct  352   GDLKYTLYGVLVHHGWSTHSGHYYCYVRTSTNMWYSLDDNQVHQVSESKVLQQKAYMLFY  411

Query  1414  VK  1409
             V+
Sbjct  412   VR  413



>ref|XP_010047113.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X1 
[Eucalyptus grandis]
Length=955

 Score =   225 bits (574),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/306 (41%), Positives = 186/306 (61%), Gaps = 12/306 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G ++ P
Sbjct  120   TCFLNSVLQCLTYTEPLAAYLQSGKHQNSCRI--NGFCALCAIQKHVSRALKSTGESLAP  177

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP+   +++V + F
Sbjct  178   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCC-LPSGVPTESPRAYDKSLVHKIF  236

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+T++P +DLSLEI   DS+  AL  FT  E+++  E ++ C++
Sbjct  237   GGRLRSQVKCMQCSYGSNTFDPFLDLSLEIAKADSVVKALKHFTAAEQLDGGERQYQCQQ  296

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +V   KQL + +AP V T HLKRF +     +KI K V F   LDL P+V  +   I
Sbjct  297   CKQKVRAIKQLTVHKAPYVLTVHLKRFHDP---TQKINKSVFFDTALDLKPFVSGSYVSI  353

Query  1594  ----EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAY  1427
                  + KY L+ V+VH G S  SGHYYC+V  S + WY  DD++V +V E+ V+ Q+AY
Sbjct  354   ISKEGDLKYTLYGVLVHHGWSTHSGHYYCYVRTSTNMWYSLDDNQVHQVSESKVLQQKAY  413

Query  1426  ILFYVK  1409
             +LFYV+
Sbjct  414   MLFYVR  419



>ref|XP_010483358.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like [Camelina 
sativa]
Length=842

 Score =   224 bits (572),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 172/301 (57%), Gaps = 7/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL  +++   H   C     GFC LCA+++ +  +  + G  + P
Sbjct  115   TCFLNSVLQCLTYTEPLAATLQTVAHQKYCNVA--GFCALCAIQKHVRTARQATGRILAP  172

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  C     +  + S  +  ++V + FG
Sbjct  173   KDLVSNLRCISRNFRNCRQEDAHEYMINLLECMHKCSLPSGVPSESSDAYRRSLVHKIFG  232

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C H S+ ++P +DLSL+I   DSL  A   FT VE ++D    + CE+C
Sbjct  233   GSLRSQVKCEQCSHCSNKFDPFLDLSLDISKADSLQRAFLRFTAVELLDDGAKVYQCERC  292

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             + +V   KQL + +AP V T HLKRF+   S  EKI + V F   +D+ P+V    +   
Sbjct  293   RHKVKARKQLTISKAPYVLTVHLKRFEAHRS--EKIDRKVQFTSAIDMKPFVSGPHE--G  348

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
               KY L+ V+VH G S  SGHY CFV  S   WY  DD++V +V E  V  Q+AY+LFYV
Sbjct  349   NLKYTLYGVLVHYGRSSHSGHYACFVRTSSGMWYSLDDNRVFQVSEKTVFDQKAYMLFYV  408

Query  1411  K  1409
             +
Sbjct  409   R  409



>gb|KDP38672.1| hypothetical protein JCGZ_04025 [Jatropha curcas]
Length=929

 Score =   224 bits (571),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 117/301 (39%), Positives = 179/301 (59%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G ++ P
Sbjct  122   TCFLNSVLQCLTYTEPLAAYLQSGKHQNSCHIA--GFCALCAIQKHVSRALQSTGRSLVP  179

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    +  +    +E ++V + FG
Sbjct  180   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCCLPSGVPSESPAAYEKSLVHKIFG  239

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   D+L +AL +FT  E ++  E  + C++C
Sbjct  240   GRLRSQVECQQCSYCSNKFDPFLDLSLEIVKADTLPVALRNFTAAELLDGGEKHYQCQRC  299

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V  +K+L + +AP V T HLKRF        K  K V F   LD+ P+V  + +   
Sbjct  300   KQKVRAKKRLTVHKAPYVLTVHLKRFHAHDP-GRKYDKKVLFDRSLDMKPFVSGSYE--G  356

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY+L+ V+VH G S  SGHY CFV  S   WY  +D++V  V E  V+ Q+AY+LFYV
Sbjct  357   DLKYSLYGVLVHFGHSTHSGHYVCFVRTSSGIWYLLNDNEVRAVSEKTVLDQKAYMLFYV  416

Query  1411  K  1409
             +
Sbjct  417   R  417



>ref|XP_008794346.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23-like isoform 
X3 [Phoenix dactylifera]
Length=959

 Score =   224 bits (571),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 121/304 (40%), Positives = 175/304 (58%), Gaps = 29/304 (10%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  P    +++  H S C     GFC +CAL+  + ++L S G  + P
Sbjct  105   TCFLNSVLQCLTYTEPFAAYLQSGKHKSSCHTT--GFCAMCALQNHVMVALQSTGKILSP  162

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP--KHENVVKQTF  1955
               IV NL   S  F+ ++Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  163   SHIVKNLRCISRNFRNYRQEDAHEYMVNLLESMHKCC-LPSGVPSESPCAYEKSLVHKIF  221

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C + S+ ++P +DLSLEI   DSL  AL  FT+VE+++    ++ C++
Sbjct  222   GGRLRSQVKCMQCSYCSNKFDPFLDLSLEIVKADSLRKALAHFTEVEQLDGGGRQYQCQR  281

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEK  1601
             CK +V   KQL +D+AP V T HLKRF   GS +  +KI K      E +L         
Sbjct  282   CKEKVRALKQLTIDKAPCVLTIHLKRF---GSHIPGQKINKR-----EGNL---------  324

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                  KY L+ V+VH G S  SGHYYC+V  S   W+  DD++V +V E  V++Q+AY+L
Sbjct  325   -----KYTLYGVLVHAGWSTHSGHYYCYVRTSSGTWHSLDDNQVRQVSEKTVLAQKAYML  379

Query  1420  FYVK  1409
             FYV+
Sbjct  380   FYVR  383



>ref|XP_007203993.1| hypothetical protein PRUPE_ppa000932mg [Prunus persica]
 gb|EMJ05192.1| hypothetical protein PRUPE_ppa000932mg [Prunus persica]
Length=956

 Score =   223 bits (568),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 183/301 (61%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TC+LNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++++L S G ++ P
Sbjct  120   TCYLNSVLQCLTYTEPLAAYLQSGKHRNSCHIA--GFCALCAIQKHVSLALQSTGRSLVP  177

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V NL   S  F + +Q DAHE++   LE +  CC    +  + S  +E ++V + FG
Sbjct  178   KDLVINLRCISRNFTKSRQEDAHEYMVNLLESMHKCCLPSGVPSESSSAYEKSLVHKIFG  237

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C   S+ ++P +DLSLEI   DSL  AL +FT  E+++  E ++ C++C
Sbjct  238   GRLRSQVKCLQCSCCSNKFDPFLDLSLEIFKADSLQKALGNFTAAEQLDGGERQYQCQQC  297

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQ+ + + P V T HLKRF+       KI +HV F   LDL P+V  + +   
Sbjct  298   KQKVRALKQMTVHKPPYVLTIHLKRFRAHDP-GRKIDRHVKFGRTLDLRPFVSGSYE--G  354

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY L+ V+VH G S  SGHYYC+V  S   WY  DD++V +V E +V+ Q+AY+LFYV
Sbjct  355   DLKYTLYGVLVHCGASTYSGHYYCYVRTSSGMWYSLDDNQVFQVSERIVLEQKAYMLFYV  414

Query  1411  K  1409
             +
Sbjct  415   R  415



>ref|XP_007338261.1| cysteine proteinase [Auricularia delicata TFB-10046 SS5]
 gb|EJD53964.1| cysteine proteinase [Auricularia delicata TFB-10046 SS5]
Length=662

 Score =   219 bits (559),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/317 (36%), Positives = 177/317 (56%), Gaps = 16/317 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS LQC +H  PL+ ++   +HP  C A ++GFC+ C+ + +   S   KG+   P
Sbjct  116   TCFLNSALQCLLHTPPLLHAV--LNHPRDCPAQDDGFCITCSFRRVAQDSFKVKGNAFSP  173

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQ---VSPKHENV--VK  1964
               I++NL   + + +R +Q DAHEFL+  ++ ++  C    L+GQ   V P       V 
Sbjct  174   SPILHNLHKIAKSLRRGRQEDAHEFLRFLIDAMQKAC----LHGQPKKVDPAVAEATWVS  229

Query  1963  QTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFT  1784
             + FGG L S+++CC+C H SDT++ ++DLSL+I++  S+  AL  F  ++ +   + K+ 
Sbjct  230   RVFGGKLRSRVRCCSCNHPSDTFDSILDLSLDIQNASSVHQALKHFVAIDHLRGAD-KYK  288

Query  1783  CEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNE  1604
             CEKCK  V+ EKQ  +D APL  T HLKRF   G    K+A  V +   L L   + ++ 
Sbjct  289   CEKCKKPVNAEKQFTIDSAPLALTVHLKRFTPFG---RKLAHVVQYKEHLSLAGAMSKDA  345

Query  1603  KVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYI  1424
             K  +  +Y L+ V+ H G   +SGHYY F       WY+ +D  V+      +  + AY+
Sbjct  346   KE-QSPQYKLYGVICHAGSGPNSGHYYAFTKGPNGRWYEMNDDAVSLQTRPPLDLKSAYM  404

Query  1423  LFYVKQGTPWFSEIIET  1373
             LFY++      ++II T
Sbjct  405   LFYLRDEASALNDIIAT  421



>ref|XP_009874773.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 36-like, partial 
[Apaloderma vittatum]
Length=383

 Score =   211 bits (537),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 176/306 (58%), Gaps = 11/306 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS +QC  +  PL   + + +H   C+    GFC++C ++     + A+ G+TI+P
Sbjct  62    TCFLNSAVQCLTYTPPLANYLLSKEHGRSCD--QGGFCMMCVMQNHTIQAFANSGNTIKP  119

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC--NYPKLNGQVSPKHENVVKQTF  1955
                + NL   S   +  +Q DAHEFL+C ++ ++  C     KL+ Q   +   +V Q F
Sbjct  120   VSFIRNLKKISQHIRFGRQEDAHEFLRCTIDAMQRACLNGCTKLDRQT--QATTLVHQIF  177

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG+L S+++C  C   SDTY+P +DLSLEIE   +++ AL+ F + + +   E  + C K
Sbjct  178   GGYLRSRVKCSVCKSVSDTYDPYLDLSLEIERAANIARALELFVRPD-VLGGENAYMCAK  236

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +VS  K+  +  A  + T  LKRF   G    KI K V +P  L++ PY+ +N    
Sbjct  237   CKKKVSASKRFTIHRASNILTLSLKRFAGVGGC--KITKDVGYPEFLNIRPYMSQNNG--  292

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
             +   Y L+AV+VH G S  +GHYYC+V AS  +WY+ +D  V      VV++QEAY+LFY
Sbjct  293   DPVMYALYAVLVHSGFSCHAGHYYCYVKASNGQWYQMNDDVVRSSNIKVVLNQEAYLLFY  352

Query  1414  VKQGTP  1397
             ++  +P
Sbjct  353   LRIPSP  358



>ref|XP_011033415.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X1 
[Populus euphratica]
Length=952

 Score =   220 bits (561),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 179/301 (59%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSV+QC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G ++ P
Sbjct  117   TCFLNSVVQCLTYTEPLAAYLQSGKHQNSCHVA--GFCALCAIQKHVSRALQSSGRSLAP  174

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    +  +    +E ++V + FG
Sbjct  175   KDLVSNLRRISRNFRNARQEDAHEYMVNLLESMHKCCLPSGVPSESPAAYETSLVHKIFG  234

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   D+L   L +FT  E ++  E  + C++C
Sbjct  235   GSLCSQVECQQCSYCSNKFDPFLDLSLEIAKADTLPALLRNFTAAEMLDGGEKHYQCQRC  294

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V  +K+L + +AP V T HLKRF        K+ + V F   LD+ P+V  + +   
Sbjct  295   KQKVKAKKRLTVHKAPHVLTIHLKRFHAHDP-GRKVDRKVIFDRSLDMKPFVSGSYE--G  351

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY+L+ V+VH G +  SGHY CFV  S   W+  +D++V +V E  V+ Q+AY+LFYV
Sbjct  352   DLKYSLYGVLVHYGHNTHSGHYVCFVRTSSGIWHLLNDNQVRQVSEKAVLDQKAYMLFYV  411

Query  1411  K  1409
             +
Sbjct  412   R  412



>ref|XP_011033416.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 23 isoform X2 
[Populus euphratica]
Length=898

 Score =   220 bits (560),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 179/301 (59%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSV+QC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G ++ P
Sbjct  117   TCFLNSVVQCLTYTEPLAAYLQSGKHQNSCHVA--GFCALCAIQKHVSRALQSSGRSLAP  174

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    +  +    +E ++V + FG
Sbjct  175   KDLVSNLRRISRNFRNARQEDAHEYMVNLLESMHKCCLPSGVPSESPAAYETSLVHKIFG  234

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   D+L   L +FT  E ++  E  + C++C
Sbjct  235   GSLCSQVECQQCSYCSNKFDPFLDLSLEIAKADTLPALLRNFTAAEMLDGGEKHYQCQRC  294

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V  +K+L + +AP V T HLKRF        K+ + V F   LD+ P+V  + +   
Sbjct  295   KQKVKAKKRLTVHKAPHVLTIHLKRFHAHDP-GRKVDRKVIFDRSLDMKPFVSGSYE--G  351

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY+L+ V+VH G +  SGHY CFV  S   W+  +D++V +V E  V+ Q+AY+LFYV
Sbjct  352   DLKYSLYGVLVHYGHNTHSGHYVCFVRTSSGIWHLLNDNQVRQVSEKAVLDQKAYMLFYV  411

Query  1411  K  1409
             +
Sbjct  412   R  412



>ref|XP_008452958.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
23 [Cucumis melo]
Length=932

 Score =   220 bits (560),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 180/301 (60%), Gaps = 5/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G  + P
Sbjct  109   TCFLNSVLQCLTYTEPLAAYLQSGKHQNSCHVA--GFCALCAIQKHVSRALQSSGRILAP  166

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    L  +    +E ++V + FG
Sbjct  167   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCCLPLGLPSESPSAYEKSLVHKIFG  226

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C   S+ ++P +DLSL+I   DS+  A  +FT  E ++  E ++ C++C
Sbjct  227   GRLRSQVKCMQCSFCSNKFDPFLDLSLDIVKADSIYKAFKNFTTPELLDGGERQYQCQQC  286

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQ  + +AP V T HLKRF++  +L EKI K + F P LDL P+V        
Sbjct  287   KQKVKALKQFTVHKAPYVLTIHLKRFQS-YNLEEKIHKKIHFGPTLDLAPFVS-GSYADG  344

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY L+ V+VH G S  SGHYYC+V  S + WY  DD++V+ V +  V  Q+AY+LFYV
Sbjct  345   DLKYTLYGVLVHHGGSTRSGHYYCYVRTSSAMWYALDDNRVSHVGDRTVFEQQAYMLFYV  404

Query  1411  K  1409
             +
Sbjct  405   R  405



>emb|CDS05885.1| hypothetical protein LRAMOSA08413 [Absidia idahoensis var. thermophila]
Length=594

 Score =   215 bits (548),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 121/315 (38%), Positives = 178/315 (57%), Gaps = 18/315 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGS----  2141
             TCFLNSVLQC  +  PL Q +    H + C+    GFC LCA++  +++    +GS    
Sbjct  68    TCFLNSVLQCLTYTAPLAQHLLTAKHKNKCKM--PGFCALCAME--IHVQRVFEGSKSKG  123

Query  2140  TIRPKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE--NVV  1967
              I PK   +NL   S T +  +Q DAHEFL       +   +  +  G+V PK E   ++
Sbjct  124   AILPKYFTSNLQALSKTLKLRRQEDAHEFLMFVFTAFQK--SLLQGLGKVPPKVEESTML  181

Query  1966  KQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERI--EDPET  1793
                FGG + S+++C +C HRS+TYE L+DLS++I    SL  AL  + K+++I   DP++
Sbjct  182   HGIFGGRIQSQVRCFSCNHRSNTYEALLDLSVDIHHAHSLEHALKRYIKMDKIGGNDPDS  241

Query  1792  KFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRF--KNDGSLVEKIAKHVTFPPELDLLPY  1619
             K+ C  CK +V+  KQ+ + E P+    HLKRF  +     + K+   + +P  LD+  Y
Sbjct  242   KYRCSGCKQKVNAGKQMTIRELPMTMAIHLKRFTFEMQRGYMRKVNDRIKYPEFLDMAAY  301

Query  1618  V--ERNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVV  1445
             +  E  ++    +KY L+AV+VH+G S +SGHYY +V  S  +WY  DD  V  V    V
Sbjct  302   LSPESKQQQKGSTKYRLYAVLVHLGHSCNSGHYYAYVKNSDGQWYIMDDEDVHPVSVKEV  361

Query  1444  MSQEAYILFYVKQGT  1400
             MSQ+AYILFY  Q T
Sbjct  362   MSQQAYILFYANQDT  376



>gb|KFP92299.1| Ubiquitin carboxyl-terminal hydrolase 36, partial [Apaloderma 
vittatum]
Length=329

 Score =   207 bits (528),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/302 (37%), Positives = 173/302 (57%), Gaps = 10/302 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS +QC  +  PL   + + +H   C +   GFC++C ++     + A+ G+TI+P
Sbjct  36    TCFLNSAVQCLTYTPPLANYLLSKEHGRSCGS-QGGFCMMCVMQNHTIQAFANSGNTIKP  94

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC--NYPKLNGQVSPKHENVVKQTF  1955
                + NL   S   +  +Q DAHEFL+C ++ ++  C     KL+ Q       +V Q F
Sbjct  95    VSFIRNLKKISQHIRFGRQEDAHEFLRCTIDAMQRACLNGCTKLDRQTQA--TTLVHQIF  152

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG+L S+++C  C   SDTY+P +DLSLEIE   +++ AL+ F + + +   E  + C K
Sbjct  153   GGYLRSRVKCSVCKSVSDTYDPYLDLSLEIERAANIARALELFVRPD-VLGGENAYMCAK  211

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK +VS  K+  +  A  + T  LKRF   G    KI K V +P  L++ PY+ +N    
Sbjct  212   CKKKVSASKRFTIHRASNILTLSLKRFAGVGGC--KITKDVGYPEFLNIRPYMSQNNG--  267

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
             +   Y L+AV+VH G S  +GHYYC+V AS  +WY+ +D  V      VV++QEAY+LFY
Sbjct  268   DPVMYALYAVLVHSGFSCHAGHYYCYVKASNGQWYQMNDDVVRSSNIKVVLNQEAYLLFY  327

Query  1414  VK  1409
             ++
Sbjct  328   LR  329



>ref|XP_004144731.1| PREDICTED: uncharacterized protein LOC101219654 [Cucumis sativus]
 gb|KGN61042.1| hypothetical protein Csa_2G035420 [Cucumis sativus]
Length=933

 Score =   219 bits (558),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/301 (40%), Positives = 180/301 (60%), Gaps = 5/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G  + P
Sbjct  109   TCFLNSVLQCLTYTEPLAAYLQSGKHQNSCHVA--GFCALCAIQKHVSRALQSSGRILAP  166

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    L  +    +E ++V + FG
Sbjct  167   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCCLPLGLPSESPSAYEKSLVHKIFG  226

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C   S+ ++P +DLSL+I   DS+  A  +FT  E ++  E ++ C++C
Sbjct  227   GRLRSQVKCMQCSFCSNKFDPFLDLSLDIVKADSIYKAFKNFTTPELLDGGERQYQCQQC  286

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQ  + +AP V T HLKRF++  +L EKI K + F P LDL P+V        
Sbjct  287   KQKVKALKQFTVHKAPYVLTIHLKRFQS-YNLEEKIHKKIHFGPTLDLAPFVS-GSYADG  344

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY L+ V+VH G S  SGHYYC+V  S + WY  DD++V+ V +  V  Q+AY+LFYV
Sbjct  345   DLKYTLYGVLVHHGGSTRSGHYYCYVRTSSAMWYALDDNRVSHVGDRTVYEQQAYMLFYV  404

Query  1411  K  1409
             +
Sbjct  405   R  405



>emb|CDP07922.1| unnamed protein product [Coffea canephora]
Length=939

 Score =   218 bits (555),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 179/304 (59%), Gaps = 12/304 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H   C     GFC LCA+++ ++ +L S G  + P
Sbjct  125   TCFLNSVLQCLTYTEPLAAYLQSGRHKISCRTA--GFCALCAIQKHVSQALESTGRILAP  182

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
             K +V+NL   S  F+  +Q DAHE++   LE +  CC  P      SP    +++V + F
Sbjct  183   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCC-LPSGVPSESPSAYDKSLVHKIF  241

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S+++C  C   S+ ++P +DLSLEI   DSL  AL  FT  E+++  E ++ C++
Sbjct  242   GGRLRSQVKCMQCSFCSNKFDPFLDLSLEIVKADSLYKALAHFTAKEQLDGGERQYQCQQ  301

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLV--EKIAKHVTFPPELDLLPYVERNEK  1601
             CK +V   KQL + +AP V   HLKRF   GS +  +KI + + F P LDL P+V     
Sbjct  302   CKQKVKALKQLTVYKAPHVLAIHLKRF---GSHMPGQKIDRKIEFGPSLDLKPFV--TGP  356

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
                E KY L+ V+VH G S  SGHYYCFV  S   WY  DD++V +V E  V+ Q+AY+L
Sbjct  357   YDGELKYTLYGVLVHAGWSTHSGHYYCFVRTSSGMWYSLDDNQVVQVSERRVLEQKAYML  416

Query  1420  FYVK  1409
             FYV+
Sbjct  417   FYVR  420



>gb|EPB89438.1| hypothetical protein HMPREF1544_03807 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=532

 Score =   212 bits (539),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 120/310 (39%), Positives = 180/310 (58%), Gaps = 17/310 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLA-----SKG  2144
             TCFLNSVL+C  +  PL Q +   +H   C    +GFC LCA++  +   L      S+G
Sbjct  85    TCFLNSVLECLTYTPPLAQQMLKEEHQKQCRM--DGFCALCAMEVHVRRCLKDEKSFSRG  142

Query  2143  STIRPKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHEN--V  1970
             + I P+   +NL   S T +  +Q DAHEF    L   +      +  G++ PK E   +
Sbjct  143   AAILPRYFTSNLRALSKTLRLGRQEDAHEFYLFMLSAFQKAS--IQGLGKLPPKVEETAL  200

Query  1969  VKQTFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIED-VDSLSLALDSFTKVERI--EDP  1799
             V Q FGG L S+L+C +C   S+ YE  +DLS+++ +  DSL +A D+F +V+ I  +DP
Sbjct  201   VHQIFGGKLRSQLKCYSCKATSNNYEACLDLSVDLTNKADSLKMAFDNFIRVDVIGSDDP  260

Query  1798  ETKFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKND--GSLVEKIAKHVTFPPELDLL  1625
               ++ C+ CK  V   KQ+ ++E P++ T HLKRF  D     + KI   V +P  LD+ 
Sbjct  261   NNRYKCDHCKQMVKAGKQMTINELPMMLTVHLKRFAFDMYRGCMSKITTFVDYPETLDMA  320

Query  1624  PYVERNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVV  1445
             PY  +++K I++++Y+L+AV+VH G S +SGHYY +V A   +W + DD  VT V    V
Sbjct  321   PYTSQDKK-IKKAEYSLYAVLVHYGYSCNSGHYYAYVKAPNGQWNRMDDEDVTPVSVKEV  379

Query  1444  MSQEAYILFY  1415
             +SQ AY+LFY
Sbjct  380   LSQTAYMLFY  389



>ref|XP_002308397.2| hypothetical protein POPTR_0006s19890g [Populus trichocarpa]
 gb|EEE91920.2| hypothetical protein POPTR_0006s19890g [Populus trichocarpa]
Length=950

 Score =   218 bits (554),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 178/301 (59%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSV+QC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G ++ P
Sbjct  117   TCFLNSVVQCLTYTEPLAAYLQSGKHQNSCHVA--GFCALCAIQKHVSRALQSSGRSLVP  174

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    +  +    +E ++V + FG
Sbjct  175   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCCLPSGVPSESPAAYETSLVHKIFG  234

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C + S+ ++P +DLSLEI   D+L   L +FT  E ++  E  + C++C
Sbjct  235   GSLCSQVECQQCSYCSNKFDPFLDLSLEIAKADTLPALLRNFTAAEMLDGGEKHYQCQRC  294

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V  +K L + +AP V T HLKRF        K+ + V F   LD+ P+V  + +   
Sbjct  295   KQKVRAKKWLTVHKAPHVLTIHLKRFHAHDP-GRKVDRKVIFDRSLDMKPFVSGSYE--G  351

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY+L+ V+VH G +  SGHY CFV  S   W+  +D++V +V E  V+ Q+AY+LFYV
Sbjct  352   DLKYSLYGVLVHYGHNTHSGHYVCFVRTSSGIWHLLNDNQVRQVSEKAVLEQKAYMLFYV  411

Query  1411  K  1409
             +
Sbjct  412   R  412



>gb|EPZ36416.1| Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 domain-containing 
protein [Rozella allomycis CSF55]
Length=571

 Score =   212 bits (540),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/303 (38%), Positives = 173/303 (57%), Gaps = 14/303 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC ++  PL   +    H   C+    GFC  C +++L +  L ++   + P
Sbjct  106   TCFLNSVLQCLLYTAPLCNYLRTGMHSKECKIV--GFCSFCEMEKLFSKCLETRKGALEP  163

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNY---PKLNGQVSPKHENVVKQT  1958
              KIV  L   S   +  +Q D+HEFL+CF+E L+    +   PK++ ++  K   +V Q 
Sbjct  164   TKIVQGLRVISRRMKLGRQEDSHEFLRCFIESLQKNSLFGLDPKIDAKL--KETTIVYQM  221

Query  1957  FGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCE  1778
             FGGHL S++ C  C   SDT +P +DLSL+I   +S+  +L++F K E +     ++ C 
Sbjct  222   FGGHLQSQITCSICKTTSDTVDPFLDLSLDIRHSNSVIKSLETFVKPEFLRG-SNQYHCS  280

Query  1777  KCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKV  1598
             +C+ +V   K+  + +APLV T HLKRF   G   +KI K V F  +LDL P++ +    
Sbjct  281   RCQKKVDATKKFSITDAPLVLTLHLKRFSMTG---QKIPKFVEFKEKLDLTPFMSKGG--  335

Query  1597  IEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILF  1418
              E+  Y L+A++VH G S +SGHYY FV  S + WY  +DS  ++V  + V+ Q  YI F
Sbjct  336   -EKCHYELYAILVHSGSSCNSGHYYSFVKNSNNLWYCMNDSSTSQVGLSTVLKQNGYIFF  394

Query  1417  YVK  1409
             Y K
Sbjct  395   YKK  397



>ref|XP_004158744.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
23-like [Cucumis sativus]
Length=898

 Score =   217 bits (552),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 119/301 (40%), Positives = 180/301 (60%), Gaps = 6/301 (2%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   +++  H + C     GFC LCA+++ ++ +L S G  + P
Sbjct  109   TCFLNSVLQCLTYTEPLAAYLQSGKHQNSCHVA--GFCALCAIQKHVSRALQSSGRILAP  166

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHE-NVVKQTFG  1952
             K +V+NL   S  F+  +Q DAHE++   LE +  CC    L  +    +E ++V + FG
Sbjct  167   KDLVSNLRCISRNFRNARQEDAHEYMVNLLESMHKCCLPLGLPSESPSAYEKSLVHKIFG  226

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G L S+++C  C   S+ ++P +DLSL+I   DS+  A  +FT  E ++    ++ C++C
Sbjct  227   GRLRSQVKCMQCSXCSNKFDPFLDLSLDIVKADSIYKAFKNFTTPELLDGGXRQYQCQQC  286

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K +V   KQ  + +AP V T HLKRF++  +L EKI K + F P LDL P+V  +     
Sbjct  287   KQKVKALKQFTVHKAPYVLTIHLKRFQS-YNLEEKIHKKIHFGPTLDLAPFVSGSYD--G  343

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
             + KY L+ V+VH G S  SGHYYC+V  S + WY  DD++V+ V +  V  Q+AY+LFYV
Sbjct  344   DLKYTLYGVLVHHGGSTRSGHYYCYVRTSSAMWYALDDNRVSHVGDRTVYEQQAYMLFYV  403

Query  1411  K  1409
             +
Sbjct  404   R  404



>ref|XP_003289130.1| hypothetical protein DICPUDRAFT_15497 [Dictyostelium purpureum]
 gb|EGC34337.1| hypothetical protein DICPUDRAFT_15497 [Dictyostelium purpureum]
Length=810

 Score =   216 bits (549),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/307 (37%), Positives = 180/307 (59%), Gaps = 12/307 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF+NSVLQC  +   L   + + +H   C   N+ FC+ C+L+E +  S  + G +I P
Sbjct  190   TCFMNSVLQCLTYSPTLANYMISREHSKNC--TNKSFCIFCSLEEHIIASHKATGRSITP  247

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCC--NYPKLNGQVSPKHE--NVVKQ  1961
             K+I  N+   + TF+  +Q D+HEF++  +E L+  C   +PK  G +S +     V+  
Sbjct  248   KEIAANIRKVAPTFRIGRQEDSHEFIRFVIESLQKVCLSKFPK--GSISHRDSMTTVIGS  305

Query  1960  TFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTC  1781
              FGG+L S+++C  C + S+T++P +DL ++I   DSL+  L +F K E I D   ++ C
Sbjct  306   IFGGYLRSQVKCSVCQYESNTFDPFMDLCVDINQADSLTKGLQNFVKSE-ILDGSNRYKC  364

Query  1780  EKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEK  1601
              KCK  V   K+L +  +P + T  +KRF   GS   K+ KH+ F   L+L PY+ +   
Sbjct  365   SKCKKLVKAAKRLQIHISPPILTVQIKRFSFLGSYGGKVNKHIQFEQTLNLSPYMTQ---  421

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
               + S Y+L+AV+VH+G S +SGHYYC+V  +   WY  DDS V++V    V+  +AY+L
Sbjct  422   ANDHSIYDLYAVLVHLGGSTNSGHYYCYVKGTNGIWYNMDDSMVSQVSLQTVLGSKAYML  481

Query  1420  FYVKQGT  1400
             FY K+ T
Sbjct  482   FYSKRDT  488



>ref|XP_003227691.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase 42 [Anolis carolinensis]
Length=1298

 Score =   219 bits (558),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/337 (36%), Positives = 191/337 (57%), Gaps = 25/337 (7%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS LQC  +  PL   + + +H   C    +GFC++C ++  +  +L++ G+ I+P
Sbjct  119   TCFLNSALQCLTYTPPLANYMLSHEHSKTCH--EQGFCMMCTMQSHITQALSNSGNVIKP  176

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVS-PKHENV---VKQ  1961
               ++N+L   +  F+   Q DAHEFL+  ++ ++  C    LNG     +H      + Q
Sbjct  177   MPVINDLRRIAKHFRFGNQEDAHEFLRYTVDAMQKAC----LNGSNKLDRHTQATTFIHQ  232

Query  1960  TFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTC  1781
              FGG+L S+++C NC   SDT++P +D++LEI+   S++ AL+ F K E++ D E  + C
Sbjct  233   IFGGYLRSRVKCMNCKGVSDTFDPYLDITLEIKSAQSINKALEQFVKPEQL-DGENAYKC  291

Query  1780  EKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVER--N  1607
              KCK  V   K+  +  A  V T  LKRF N      KI K V +P  LD+ PY+ +   
Sbjct  292   SKCKKMVPASKRFTVHRASNVLTLSLKRFANFSG--GKITKEVKYPEYLDIRPYMSQPNG  349

Query  1606  EKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAY  1427
             E +I    Y L+AV+VH G S  +GHYYC++ AS  +WY+ +DS V+      V++Q+AY
Sbjct  350   EPII----YALYAVLVHTGFSCHAGHYYCYIKASNGQWYQMNDSTVSNSDIRTVLNQQAY  405

Query  1426  ILFYVKQGTPWFSEIIETQQLILDA-SISNSSPQPVL  1319
             +LFY++       ++    + I  A +   SSP+PV+
Sbjct  406   VLFYIRS-----HDMKNGGEHIHSAHTPGQSSPRPVI  437



>ref|XP_007425215.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 42 [Python bivittatus]
Length=1302

 Score =   219 bits (557),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/306 (37%), Positives = 178/306 (58%), Gaps = 19/306 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS LQC  +  PL   + + +H   C    +GFC++C ++  +N + ++ G+ I+P
Sbjct  118   TCFLNSALQCLTYTPPLANYMLSYEHSKTCH--EQGFCMMCTMQGHINQAFSNSGNVIKP  175

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVS-PKHENV---VKQ  1961
               ++N+L   +  F+   Q DAHEFL+  ++ ++  C    LNG     +H      + Q
Sbjct  176   MSVINDLRRIAKHFRFGNQEDAHEFLRYTVDAMQKAC----LNGSNKLDRHTQATTFIHQ  231

Query  1960  TFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTC  1781
              FGG+L S+++C NC   SDT++P +D++LEI+   S++ AL+ F K E++ D E  + C
Sbjct  232   IFGGYLRSRVKCMNCKGVSDTFDPYLDITLEIKSAQSVNKALEQFVKPEQL-DGENAYKC  290

Query  1780  EKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVER--N  1607
              KCK  V   K+  +  A  V T  LKRF N      KI K V +P  LD+ PY+ +   
Sbjct  291   SKCKKMVPASKRFTIHRASNVLTLSLKRFANFSG--GKITKEVKYPEYLDVRPYMSQPNG  348

Query  1606  EKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAY  1427
             E +I    Y L+AV+VH G S  +GHYYC++ AS  +WY+ +DS V+      V++Q+AY
Sbjct  349   EPII----YALYAVLVHTGFSCHAGHYYCYIKASNGQWYQMNDSTVSNSDIRTVLNQQAY  404

Query  1426  ILFYVK  1409
             +LFY++
Sbjct  405   VLFYIR  410



>ref|XP_008436360.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 42 [Poecilia 
reticulata]
Length=1175

 Score =   218 bits (555),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 190/335 (57%), Gaps = 19/335 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS LQC  +  PL   + + +H   C     GFC++C ++  M    A+ G+ I+P
Sbjct  120   TCFLNSALQCLTYTPPLANFMLSREHSKTCH--EPGFCMMCTMQNHMIQVFANSGNVIKP  177

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLE-SCCNYPKLNGQVSPKHENVVKQTFG  1952
               ++N L   +  F+   Q DAHEFL+  ++ ++ SC    KL+ Q   +    + Q FG
Sbjct  178   IGVLNELKRIAKHFRYGSQEDAHEFLRYTVDAMQKSCLPGTKLDRQT--QATTFIHQVFG  235

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G+L S+++C NC   SDT++P +D++LEI+   S+S AL+ F K E++ D E  + C KC
Sbjct  236   GYLRSRVKCLNCKSVSDTFDPFLDITLEIKTAPSVSKALEQFVKPEQL-DGENAYKCTKC  294

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K  V+  K+  +  +P V T  LKRF N      KI K V +P  L+L P++ +++   E
Sbjct  295   KKMVTASKRFTIHRSPNVLTLSLKRFAN--FTGGKITKDVKYPEYLELRPFMSQSQG--E  350

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
                Y L+AV+VH G S  +GHY+C++ AS  +WY+ +DS V+      V++Q+AY+LFY+
Sbjct  351   PQIYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSVSVSDIRSVLNQQAYVLFYI  410

Query  1411  K----QGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             K    + T  FS +     +        SSP+PV+
Sbjct  411   KSCNVKKTGEFSNVSHNPGM-----SGQSSPRPVV  440



>ref|XP_006401143.1| hypothetical protein EUTSA_v10012558mg [Eutrema salsugineum]
 gb|ESQ42596.1| hypothetical protein EUTSA_v10012558mg [Eutrema salsugineum]
Length=1002

 Score =   216 bits (551),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 122/323 (38%), Positives = 174/323 (54%), Gaps = 31/323 (10%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNSVLQC  +  PL   ++   H   C     GFC LCA+++ +  +  + G  + P
Sbjct  113   TCFLNSVLQCLTYTEPLAAYLQKVAHEKRCHVA--GFCALCAMQKHVRNARQASGRILVP  170

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPKHEN-VVKQTFG  1952
               +V+NL   S  F+  +Q DAHE++   LE +  CC    +  + S  + + +V + FG
Sbjct  171   NDLVSNLRSVSRNFRNQRQEDAHEYMISLLECMHKCCLPSGVPSESSDAYRSSLVHKIFG  230

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSL----------------ALDSFTK  1820
             G L S+++C  C H SD ++P +DLSL+I   DSL                  AL  FT 
Sbjct  231   GSLRSQVKCEQCSHCSDKFDPFLDLSLDIAKADSLQRSKANSWQMPKPDSLQRALYRFTA  290

Query  1819  VERIEDPETKFTCEKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPP  1640
             VE ++     + CE+CK +V  +KQL + +AP V T H KRF+   S  EK  + V F P
Sbjct  291   VELLDGGAKVYQCERCKQKVKAKKQLTVFKAPYVLTVHFKRFEAHRS--EKNDRKVDFAP  348

Query  1639  ELDLLPYV----ERNEKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSK  1472
              +D+ P+V    E N       KY L+ V+VH G S+ SGHY CFV  S   WY  DD+ 
Sbjct  349   TIDMKPFVSGPYEGN------LKYTLYGVLVHYGHSIHSGHYACFVRTSSGMWYSLDDNM  402

Query  1471  VTRVQENVVMSQEAYILFYVKQG  1403
             V  V E +V +Q+AY+LFYV+ G
Sbjct  403   VRLVSEKIVFNQKAYMLFYVRDG  425



>emb|CAG04440.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=535

 Score =   209 bits (533),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 173/301 (57%), Gaps = 10/301 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS LQC  +  P    +   +H   C     GFC++C ++  +    A+ G+ I+P
Sbjct  37    TCFLNSALQCLTYTAPFANYMLTREHSKTCH--EPGFCMMCTMQNHIIQVFANTGNVIKP  94

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLE-SCCNYPKLNGQVSPKHENVVKQTFG  1952
               ++N L   +  F+   Q DAHEFL+  ++ ++ SC    KL+ Q   +    + Q FG
Sbjct  95    IGVLNELKRIAKHFRYGSQEDAHEFLRYTVDAMQKSCLPGTKLDRQT--QATTFIHQVFG  152

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G+L S+++C NC   SDT++P +D+ LEI+   S+S AL+ F K E++ D E  + C KC
Sbjct  153   GYLRSRVKCLNCKAVSDTFDPFLDIPLEIKTAPSVSKALEQFVKPEQL-DGENAYKCTKC  211

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K  V+  K+  +  +  V T  LKRF N      KI K V +P  LDL P++ +++   E
Sbjct  212   KKMVTASKRFTIHRSANVLTLALKRFANFSG--GKITKDVKYPEYLDLRPFMSQSQG--E  267

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
                Y L+AV+VH G S  +GHY+C++ AS  +WY+ +DS V+      V+SQ+AY+LFY+
Sbjct  268   PQVYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSVSISDIRSVLSQQAYVLFYI  327

Query  1411  K  1409
             K
Sbjct  328   K  328



>ref|XP_004080264.1| PREDICTED: uncharacterized protein LOC101169567 [Oryzias latipes]
Length=1080

 Score =   216 bits (551),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 178/301 (59%), Gaps = 10/301 (3%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS LQC  +  PL   + + +H   C+    GFC++C ++  +    A+ G+ I+P
Sbjct  121   TCFLNSALQCLTYTPPLANHMLSREHSKTCQ--EPGFCMMCTMQNHIIQVFANSGNVIKP  178

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLE-SCCNYPKLNGQVSPKHENVVKQTFG  1952
               ++N L   +  F+   Q DAHEFL+  ++ ++ SC    KL+ Q   +    + Q FG
Sbjct  179   IGVLNELKRIAKHFRYGSQEDAHEFLRYTVDAMQKSCLPGTKLDRQT--QATTFIHQVFG  236

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G+L S+++C +C   SDT++P +D++LEI+   S+S AL+ F K E++ D E  + C KC
Sbjct  237   GYLRSRVKCLSCKAVSDTFDPFLDITLEIKMAPSVSKALEQFVKPEQL-DGENAYKCTKC  295

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K  V+  K+  +  +P V T  LKRF N      KI K V +P  LDL P++ +++   E
Sbjct  296   KKMVTASKRFTIHRSPNVLTLSLKRFAN--FTGGKITKDVKYPESLDLRPFMSQSQG--E  351

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
                Y L+AV+VH G S  +GHY+C++ AS  +WY+ +DS V+      V++Q+AY+LFY+
Sbjct  352   PQNYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSVSVSDIRSVLNQQAYVLFYI  411

Query  1411  K  1409
             K
Sbjct  412   K  412



>ref|XP_008301976.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 42 isoform X2 
[Stegastes partitus]
Length=1207

 Score =   217 bits (552),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 122/333 (37%), Positives = 192/333 (58%), Gaps = 15/333 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNE-GFCVLCALKELMNISLASKGSTIR  2132
             TCFLNS LQC  +  PL   +   +H    + C+E GFC++C ++  +    A+ G+ I+
Sbjct  121   TCFLNSALQCLTYTPPLANYMLTREH---SKTCHEPGFCMMCTMQNHIIQVFANSGNVIK  177

Query  2131  PKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLE-SCCNYPKLNGQVSPKHENVVKQTF  1955
             P  ++N L   +  F+   Q DAHEFL+  ++ ++ SC    KL+ Q   +    + Q F
Sbjct  178   PIGVLNELKRIAKHFRYGSQEDAHEFLRYTVDSMQKSCLPGTKLDRQT--QATTFIHQVF  235

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG+L S+++C NC   SDT++P +D++LEI+   S+S AL+ F K E++ D E  + C K
Sbjct  236   GGYLRSRVKCLNCKAVSDTFDPFLDITLEIKTAPSVSKALEQFVKPEQL-DGENAYKCTK  294

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK  V+  K+  +  +  V T  LKRF N      KI K V +P  LDL P++ +++   
Sbjct  295   CKKMVTASKRFTIHRSSNVLTLSLKRFANFSG--GKITKDVKYPEYLDLRPFMSQSQG--  350

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
             E   Y L+AV+VH G S  +GHY+C++ AS  +WY+ +DS V+      V++Q+AY+LFY
Sbjct  351   EPQVYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSVSVSDIRSVLNQQAYVLFY  410

Query  1414  VKQGTPWFSEIIETQQLILDASISN-SSPQPVL  1319
             +K  +    +  E   L  +  IS  SSP+PV+
Sbjct  411   MK--STDMKKTGEYTHLSHNPGISGQSSPRPVV  441



>ref|XP_008301971.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 42 isoform X1 
[Stegastes partitus]
 ref|XP_008301974.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 42 isoform X1 
[Stegastes partitus]
 ref|XP_008301975.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 42 isoform X1 
[Stegastes partitus]
Length=1208

 Score =   217 bits (552),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 122/333 (37%), Positives = 192/333 (58%), Gaps = 15/333 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNE-GFCVLCALKELMNISLASKGSTIR  2132
             TCFLNS LQC  +  PL   +   +H    + C+E GFC++C ++  +    A+ G+ I+
Sbjct  121   TCFLNSALQCLTYTPPLANYMLTREH---SKTCHEPGFCMMCTMQNHIIQVFANSGNVIK  177

Query  2131  PKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLE-SCCNYPKLNGQVSPKHENVVKQTF  1955
             P  ++N L   +  F+   Q DAHEFL+  ++ ++ SC    KL+ Q   +    + Q F
Sbjct  178   PIGVLNELKRIAKHFRYGSQEDAHEFLRYTVDSMQKSCLPGTKLDRQT--QATTFIHQVF  235

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG+L S+++C NC   SDT++P +D++LEI+   S+S AL+ F K E++ D E  + C K
Sbjct  236   GGYLRSRVKCLNCKAVSDTFDPFLDITLEIKTAPSVSKALEQFVKPEQL-DGENAYKCTK  294

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK  V+  K+  +  +  V T  LKRF N      KI K V +P  LDL P++ +++   
Sbjct  295   CKKMVTASKRFTIHRSSNVLTLSLKRFANFSG--GKITKDVKYPEYLDLRPFMSQSQG--  350

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
             E   Y L+AV+VH G S  +GHY+C++ AS  +WY+ +DS V+      V++Q+AY+LFY
Sbjct  351   EPQVYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSVSVSDIRSVLNQQAYVLFY  410

Query  1414  VKQGTPWFSEIIETQQLILDASISN-SSPQPVL  1319
             +K  +    +  E   L  +  IS  SSP+PV+
Sbjct  411   MK--STDMKKTGEYTHLSHNPGISGQSSPRPVV  441



>gb|KFM56762.1| Ubiquitin carboxyl-terminal hydrolase 42, partial [Stegodyphus 
mimosarum]
Length=1096

 Score =   216 bits (550),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 121/331 (37%), Positives = 190/331 (57%), Gaps = 16/331 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEA-CDHPSPCEACNEGFCVLCALKELMNISLASKGSTIR  2132
             TCF+N+V+QC  +  PL   +    DHPS C     GFC++C L++ M  ++   G  I+
Sbjct  128   TCFMNTVIQCLTYCPPLANYLLLDNDHPSKCTIT--GFCMMCLLQKHMKRAIGKSGDVIK  185

Query  2131  PKKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSP--KHENVVKQT  1958
             P  +   L   +  FQ  QQ DAHEFL+  ++ L   C +     ++ P  K   V+ Q 
Sbjct  186   PVDVYPRLKLIAKHFQFGQQEDAHEFLRYVIDHLWRSCLHQNNGIKLDPASKETTVINQI  245

Query  1957  FGGHLISKLQCCNCGHRSDTYEPLVDLSLEI-EDVDSLSLALDSFTKVERIEDPETKFTC  1781
             FGG+  S++ C  C  +S+T++  +D  L+I ++V +L  AL+ F + E +E  E  + C
Sbjct  246   FGGYHRSQVTCLRCREKSNTFDHFMDFILDIKQNVLTLEKALEKFIQPEILEQ-ENAYKC  304

Query  1780  EKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVE--RN  1607
              KCK++V  +K+  + +AP VATF LKRF    +   KI K +T+P  L+L PY+   + 
Sbjct  305   PKCKMKVVAQKRFSVFQAPNVATFQLKRFDYHRTFGGKITKQITYPERLNLRPYMSDPKG  364

Query  1606  EKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAY  1427
             + V     Y+L+AV+VH G + +SGHYYC+V  S + WY  DD +V +V  N V++Q AY
Sbjct  365   DPVW----YHLYAVLVHSGPTCNSGHYYCYVKNSNNLWYIMDDQRVHQVSLNQVLNQSAY  420

Query  1426  ILFYVKQGTPWFSEI---IETQQLILDASIS  1343
             +LFY+K+GT   + I    E +  ++  +IS
Sbjct  421   VLFYIKKGTTEGTSIKKNFENRNSLVKGTIS  451



>gb|EMP34977.1| Ubiquitin carboxyl-terminal hydrolase 42 [Chelonia mydas]
Length=834

 Score =   214 bits (544),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 111/306 (36%), Positives = 178/306 (58%), Gaps = 19/306 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS LQC  +  PL   + + +H   C    +GFC++C ++  +  +L++ G+ I+P
Sbjct  118   TCFLNSALQCLTYTPPLANYMLSHEHSKTCH--EQGFCMMCTMQAHITQALSNSGNVIKP  175

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQ----VSPKHENVVKQ  1961
               ++N+L   +  F+   Q DAHEFL+  ++ ++  C    LNG        +   ++ Q
Sbjct  176   MAVINDLRRIAKHFRFGNQEDAHEFLRYTVDAMQKAC----LNGSNKLDRHTQATTLIYQ  231

Query  1960  TFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTC  1781
              FGG+L S+++C NC   SDT++P +D++LEI+   S++ AL+ F K E++ D E  + C
Sbjct  232   IFGGYLRSRVKCMNCKGVSDTFDPYLDITLEIKTAQSVNKALEQFVKPEQL-DGENAYKC  290

Query  1780  EKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVER--N  1607
              KCK  V   K+  +  +  V T  LKRF N      KI K V +P  LD+ PY+ +   
Sbjct  291   SKCKKMVPASKRFTIHRSSNVLTLSLKRFANFSG--GKITKEVKYPEYLDIRPYMSQPNG  348

Query  1606  EKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAY  1427
             E +I    Y L+AV+VH G S  +GHYYC++ AS  +WY+ +DS V+      V++Q+AY
Sbjct  349   EPII----YVLYAVLVHTGFSCHAGHYYCYIKASNGQWYQMNDSIVSNSDIRSVLNQQAY  404

Query  1426  ILFYVK  1409
             +LFY++
Sbjct  405   VLFYIR  410



>ref|XP_007558965.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 42 [Poecilia 
formosa]
Length=1175

 Score =   216 bits (550),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 120/335 (36%), Positives = 190/335 (57%), Gaps = 19/335 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS LQC  +  PL   + + +H   C     GFC++C ++  +    A+ G+ I+P
Sbjct  120   TCFLNSALQCLTYTPPLANFMLSREHSKTCH--EPGFCMMCTMQNHIIQVFANSGNVIKP  177

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLE-SCCNYPKLNGQVSPKHENVVKQTFG  1952
               ++N L   +  F+   Q DAHEFL+  ++ ++ SC    KL+ Q   +    + Q FG
Sbjct  178   IGVLNELKRIAKHFRYGSQEDAHEFLRYTVDAMQKSCLPGTKLDRQT--QATTFIHQVFG  235

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G+L S+++C NC   SDT++P +D++LEI+   S+S AL+ F K E++ D E  + C KC
Sbjct  236   GYLRSRVKCLNCKSVSDTFDPFLDITLEIKTAPSVSKALEQFVKPEQL-DGENAYKCTKC  294

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K  V+  K+  +  +P V T  LKRF N      KI K V +P  L+L P++ +++   E
Sbjct  295   KKMVTASKRFTIHRSPNVLTLSLKRFAN--FTGGKITKDVKYPEYLELRPFMSQSQG--E  350

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
                Y L+AV+VH G S  +GHY+C++ AS  +WY+ +DS V+      V++Q+AY+LFY+
Sbjct  351   PQIYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSVSVSDIRSVLNQQAYVLFYI  410

Query  1411  K----QGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             K    + T  FS +     +        SSP+PV+
Sbjct  411   KPCNVKKTGEFSNVSHNPGM-----SGQSSPRPVV  440



>ref|XP_005811757.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 42-like [Xiphophorus 
maculatus]
Length=1119

 Score =   216 bits (549),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 120/335 (36%), Positives = 190/335 (57%), Gaps = 19/335 (6%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS LQC  +  PL   + + +H   C     GFC++C ++  +    A+ G+ I+P
Sbjct  120   TCFLNSALQCLTYTPPLANFMLSREHSKTCH--EPGFCMMCTMQNHIIQVFANSGNVIKP  177

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLE-SCCNYPKLNGQVSPKHENVVKQTFG  1952
               ++N L   +  F+   Q DAHEFL+  ++ ++ SC    KL+ Q   +    + Q FG
Sbjct  178   IGVLNELKRIAKHFRYGSQEDAHEFLRYTVDAMQKSCLPGTKLDRQT--QATTFIHQVFG  235

Query  1951  GHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEKC  1772
             G+L S+++C NC   SDT++P +D++LEI+   S+S AL+ F K E++ D E  + C KC
Sbjct  236   GYLRSRVKCLNCKSVSDTFDPFLDITLEIKTAPSVSKALEQFVKPEQL-DGENAYKCTKC  294

Query  1771  KVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVIE  1592
             K  V+  K+  +  +P V T  LKRF N      KI K V +P  L+L P++ +++   E
Sbjct  295   KKMVTASKRFTIHRSPNVLTLSLKRFAN--FTGGKITKDVKYPEYLELRPFMSQSQG--E  350

Query  1591  ESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFYV  1412
                Y L+AV+VH G S  +GHY+C++ AS  +WY+ +DS V+      V++Q+AY+LFY+
Sbjct  351   PQIYGLYAVLVHSGFSCHAGHYFCYIKASNGQWYQMNDSSVSVSDIRSVLNQQAYVLFYI  410

Query  1411  K----QGTPWFSEIIETQQLILDASISNSSPQPVL  1319
             K    + T  FS +     +        SSP+PV+
Sbjct  411   KSCNVKKTGEFSNMSHNPGM-----SGQSSPRPVV  440



>gb|EKC38387.1| Ubiquitin carboxyl-terminal hydrolase 36 [Crassostrea gigas]
Length=1002

 Score =   214 bits (546),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 122/352 (35%), Positives = 188/352 (53%), Gaps = 17/352 (5%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS LQC  +  PL+    + +H   C+    GFC++C L+  +     + GS I+P
Sbjct  107   TCFLNSTLQCLAYTAPLVNYCFSGEHNQTCK--QPGFCMMCELQRHIKRCYENSGSNIKP  164

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVS----PKHENVVKQ  1961
             + I+  L   +      +Q DAHEFL+  ++ ++       LNG        K   VV Q
Sbjct  165   QAILQKLKMIAKHMHWGRQEDAHEFLRYVVDSMQKSI----LNGHAKLDKFSKETTVVNQ  220

Query  1960  TFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTC  1781
              FGG+L S++QC  C  +S+TY+P +D+SL+I+ V SL  A + +   E++ D +  + C
Sbjct  221   IFGGYLRSQVQCLRCKEKSNTYDPFLDISLDIKTVPSLEKAFEKYVLPEKL-DCDNAYMC  279

Query  1780  EKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEK  1601
              +CK +V   K+  + + P V T  LKRF     +  KI +HV FP +L+L PY+  + +
Sbjct  280   NRCKQKVPALKRFSVHKPPNVLTVSLKRFDYSKMVQGKIGRHVHFPEKLNLRPYM--SNR  337

Query  1600  VIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYIL  1421
               E   ++L AV+VH G + +SGHYYC+V AS   WY  +DS V +V  N V+  EAY+L
Sbjct  338   GGEPILFHLNAVLVHSGYTANSGHYYCYVKASSGSWYCMNDSNVQQVSVNRVLGAEAYVL  397

Query  1420  FYVKQGTPWFSEIIETQQLILDASISNSSPQPVLYSVDQIFNPYPKMETDRP  1265
             FY K     F+EI   + +    S++N   +     +      YP  +T  P
Sbjct  398   FYTKA----FTEISAPKPVSSMTSLANHVDKKANLKLLNGLRKYPSTDTGVP  445



>ref|XP_004666304.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 42 [Jaculus 
jaculus]
Length=1476

 Score =   216 bits (551),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 152/482 (32%), Positives = 233/482 (48%), Gaps = 59/482 (12%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCF N+ LQC  +  PL   + + +H   C A  EGFC++C ++  +  +L + G  I+P
Sbjct  123   TCFANAALQCLTYTPPLANYMLSHEHSKTCHA--EGFCMMCTMQAHITQALNNPGDVIKP  180

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQ----VSPKHENVVKQ  1961
               ++N +   +  F+   Q DAHEFLQ  ++ ++  C    LNG        +   +V Q
Sbjct  181   MFVMNEMRRIARHFRFGNQEDAHEFLQYTVDAMQRAC----LNGSNKLDRHTQATTLVCQ  236

Query  1960  TFGGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTC  1781
              FGG+L S+++C NC   SDT++P +D++LEI+ V S++ AL+ F K E++ D E  + C
Sbjct  237   IFGGYLRSRVKCLNCKAVSDTFDPYLDITLEIKAVQSVTKALEQFVKPEQL-DGENSYKC  295

Query  1780  EKCKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERN--  1607
              KCK  V   K+  +  +  V T  LKRF N      KIAK V +P  LD+ PY+ ++  
Sbjct  296   SKCKKMVPASKRFTIHRSSNVLTISLKRFAN--FTGGKIAKDVKYPEYLDIRPYMSQHNG  353

Query  1606  EKVIEESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAY  1427
             E +I    Y L+AV+VH G +  +GHY+C++ AS   WY+ +DS V+      V++Q+AY
Sbjct  354   EPII----YVLYAVLVHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRSVLNQQAY  409

Query  1426  ILFYVKQGTPWFSEIIETQQLILDASISNSSPQPVL---------YSVDQIFNPYPKMET  1274
             +LFY++       ++   +      S S +SP+P +          S   I    P    
Sbjct  410   VLFYIRS-----LDVKNGEAAHSTHSPSQASPRPAVGQRVVNNKQASTGFIGPQLPSHMV  464

Query  1273  DRPCDVNETDNAADEASSNVDGPKDNGIDRSDGKENSNVVSALIHEGMNNSSDICSAEAE  1094
               P  +N T    D  SS+V  PK N +  S   +N +V                     
Sbjct  465   KNPPHLNGTGPVKDLPSSSVSSPKGNPVSASTSVQNWSVNR-------------------  505

Query  1093  KTPPPSVLKEKNCKQEFRIS---KRFADLTTETPSISPSLEIYREDTADNAYSPPRALLR  923
                 PSV+ E   KQ+  IS   K         P+ S SLE   E     A + P A   
Sbjct  506   ----PSVIPEHPKKQKITISIHNKLSVSQGQVQPNHSTSLEAPHEAGPPTAATSPSAATS  561

Query  922   PA  917
             P+
Sbjct  562   PS  563



>ref|XP_008035028.1| cysteine proteinase [Trametes versicolor FP-101664 SS1]
 gb|EIW61672.1| cysteine proteinase [Trametes versicolor FP-101664 SS1]
Length=664

 Score =   210 bits (535),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 167/303 (55%), Gaps = 11/303 (4%)
 Frame = -1

Query  2308  TCFLNSVLQCFMHIVPLIQSIEACDHPSPCEACNEGFCVLCALKELMNISLASKGSTIRP  2129
             TCFLNS LQC +H  PL+  +       PC A    +C +CAL+++M   + SK   + P
Sbjct  121   TCFLNSALQCLLHTPPLLHVLLKHSKGEPCRAPKNSYCTICALRQVMT-EIFSKSHPVTP  179

Query  2128  KKIVNNLSYFSSTFQRFQQGDAHEFLQCFLERLESCCNYPKLNGQVSPK--HENVVKQTF  1955
               I   L   +   +R +Q D+HEFL+  ++ L+   +   L G+V PK   +  V + F
Sbjct  180   YPITTKLQVIAKQMRRGRQEDSHEFLRYLVDALQKS-SLAGLPGKVDPKVAEKTWVYKIF  238

Query  1954  GGHLISKLQCCNCGHRSDTYEPLVDLSLEIEDVDSLSLALDSFTKVERIEDPETKFTCEK  1775
             GG L S++ C +C + SDTY+ ++DLS++I  V +L  AL  F  V+R+   + K+ CEK
Sbjct  239   GGLLRSRVNCLSCDYNSDTYDRMLDLSVDIAGVATLKDALRKFVAVDRLRGAD-KYKCEK  297

Query  1774  CKVQVSIEKQLLLDEAPLVATFHLKRFKNDGSLVEKIAKHVTFPPELDLLPYVERNEKVI  1595
             CK  V+ +K+  +DEAP+V T HLKRF   G    KI   V++P  L L PY+   +   
Sbjct  298   CKKPVNADKRFTIDEAPVVLTLHLKRFSPMG---RKIPHPVSYPERLTLQPYMSDGK---  351

Query  1594  EESKYNLFAVVVHIGVSLSSGHYYCFVHASPSEWYKFDDSKVTRVQENVVMSQEAYILFY  1415
                 Y+L+AV+ H G   +SGHYY  V      WY+ +D  V R        + AY+LFY
Sbjct  352   FGPSYSLYAVISHAGSGPNSGHYYAHVKGGNGTWYEMNDESVMRQSSAPTNMRSAYMLFY  411

Query  1414  VKQ  1406
             +++
Sbjct  412   IRE  414



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8270473149392