BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24017_g3_i1 len=144 path=[2149:0-70 7392:71-96 2246:97-126
2276:127-143]

Length=144
                                                                      Score     E

ref|XP_004174156.1|  PREDICTED: uncharacterized mitochondrial pro...  66.6    3e-12   
ref|XP_004174143.1|  PREDICTED: uncharacterized mitochondrial pro...  65.5    2e-11   
gb|ABI34329.1|  Integrase core domain containing protein              68.2    2e-11   Solanum demissum
emb|CAN75856.1|  hypothetical protein VITISV_005690                   65.1    2e-11   Vitis vinifera
emb|CAN70968.1|  hypothetical protein VITISV_033354                   65.5    2e-11   Vitis vinifera
emb|CAN79136.1|  hypothetical protein VITISV_034813                   65.1    3e-11   Vitis vinifera
emb|CAN77373.1|  hypothetical protein VITISV_008342                   64.7    3e-11   Vitis vinifera
emb|CAN59880.1|  hypothetical protein VITISV_029938                   64.7    3e-11   Vitis vinifera
gb|ABI34342.1|  Polyprotein, putative                                 67.4    3e-11   Solanum demissum
emb|CAN81070.1|  hypothetical protein VITISV_037301                   64.7    3e-11   Vitis vinifera
emb|CAN77642.1|  hypothetical protein VITISV_007624                   65.1    3e-11   Vitis vinifera
emb|CAN67493.1|  hypothetical protein VITISV_022776                   64.7    4e-11   Vitis vinifera
emb|CAN69178.1|  hypothetical protein VITISV_024410                   64.3    4e-11   Vitis vinifera
emb|CAN66306.1|  hypothetical protein VITISV_031415                   64.3    4e-11   Vitis vinifera
emb|CAN70825.1|  hypothetical protein VITISV_039828                   64.7    5e-11   Vitis vinifera
emb|CAN59895.1|  hypothetical protein VITISV_002882                   64.3    5e-11   Vitis vinifera
emb|CAN73073.1|  hypothetical protein VITISV_032385                   64.3    5e-11   Vitis vinifera
emb|CAN81771.1|  hypothetical protein VITISV_012076                   64.3    6e-11   Vitis vinifera
emb|CAN64462.1|  hypothetical protein VITISV_008322                   63.9    6e-11   Vitis vinifera
emb|CAN77222.1|  hypothetical protein VITISV_010482                   65.1    6e-11   Vitis vinifera
emb|CAN75571.1|  hypothetical protein VITISV_009506                   64.3    7e-11   Vitis vinifera
emb|CAN77643.1|  hypothetical protein VITISV_007625                   65.1    7e-11   Vitis vinifera
emb|CAN59884.1|  hypothetical protein VITISV_026166                   66.2    8e-11   Vitis vinifera
emb|CAN76181.1|  hypothetical protein VITISV_015418                   64.3    1e-10   Vitis vinifera
emb|CAN69420.1|  hypothetical protein VITISV_025306                   62.0    2e-10   Vitis vinifera
emb|CAN79805.1|  hypothetical protein VITISV_031503                   63.5    2e-10   Vitis vinifera
emb|CAN75815.1|  hypothetical protein VITISV_004636                   65.1    2e-10   Vitis vinifera
emb|CAN72663.1|  hypothetical protein VITISV_031849                   64.7    2e-10   Vitis vinifera
emb|CAN67892.1|  hypothetical protein VITISV_036690                   64.3    3e-10   Vitis vinifera
emb|CAN76432.1|  hypothetical protein VITISV_033849                   64.7    3e-10   Vitis vinifera
emb|CAN62614.1|  hypothetical protein VITISV_028123                   64.7    3e-10   Vitis vinifera
emb|CAN64673.1|  hypothetical protein VITISV_007430                   64.7    3e-10   Vitis vinifera
emb|CAN70689.1|  hypothetical protein VITISV_012155                   64.7    3e-10   Vitis vinifera
emb|CAN72018.1|  hypothetical protein VITISV_001841                   64.3    3e-10   Vitis vinifera
emb|CAN78616.1|  hypothetical protein VITISV_003658                   64.7    3e-10   Vitis vinifera
emb|CAN62328.1|  hypothetical protein VITISV_029806                   64.3    3e-10   Vitis vinifera
emb|CAN60609.1|  hypothetical protein VITISV_036599                   64.7    3e-10   Vitis vinifera
emb|CAN63507.1|  hypothetical protein VITISV_029435                   64.3    3e-10   Vitis vinifera
emb|CAN60274.1|  hypothetical protein VITISV_024841                   64.7    3e-10   Vitis vinifera
emb|CAN75922.1|  hypothetical protein VITISV_030752                   64.3    3e-10   Vitis vinifera
emb|CAN75744.1|  hypothetical protein VITISV_040125                   64.3    3e-10   Vitis vinifera
emb|CAN74064.1|  hypothetical protein VITISV_028146                   64.3    3e-10   Vitis vinifera
emb|CAN67925.1|  hypothetical protein VITISV_021168                   64.3    3e-10   Vitis vinifera
emb|CAN62074.1|  hypothetical protein VITISV_001619                   64.3    3e-10   Vitis vinifera
emb|CAN81139.1|  hypothetical protein VITISV_018760                   64.3    3e-10   Vitis vinifera
emb|CAN77046.1|  hypothetical protein VITISV_035257                   64.3    3e-10   Vitis vinifera
emb|CAN72440.1|  hypothetical protein VITISV_039162                   64.3    3e-10   Vitis vinifera
emb|CAN76679.1|  hypothetical protein VITISV_034325                   64.3    3e-10   Vitis vinifera
emb|CAN80753.1|  hypothetical protein VITISV_003323                   64.3    3e-10   Vitis vinifera
emb|CAN62535.1|  hypothetical protein VITISV_041880                   64.3    3e-10   Vitis vinifera
emb|CAN71273.1|  hypothetical protein VITISV_019661                   64.3    3e-10   Vitis vinifera
emb|CAN81715.1|  hypothetical protein VITISV_032902                   64.3    3e-10   Vitis vinifera
emb|CAN76133.1|  hypothetical protein VITISV_036298                   64.3    3e-10   Vitis vinifera
emb|CAN62266.1|  hypothetical protein VITISV_025647                   64.3    3e-10   Vitis vinifera
emb|CAN67076.1|  hypothetical protein VITISV_042382                   64.3    3e-10   Vitis vinifera
emb|CAN73234.1|  hypothetical protein VITISV_033857                   64.3    4e-10   Vitis vinifera
emb|CAN65230.1|  hypothetical protein VITISV_034221                   63.5    4e-10   Vitis vinifera
emb|CAN61011.1|  hypothetical protein VITISV_038445                   64.3    4e-10   Vitis vinifera
emb|CAN61207.1|  hypothetical protein VITISV_015446                   63.9    4e-10   Vitis vinifera
emb|CAN65410.1|  hypothetical protein VITISV_040416                   64.3    4e-10   Vitis vinifera
emb|CAN67119.1|  hypothetical protein VITISV_017483                   63.9    4e-10   Vitis vinifera
emb|CAN81940.1|  hypothetical protein VITISV_007358                   63.5    5e-10   Vitis vinifera
emb|CAN78880.1|  hypothetical protein VITISV_024991                   63.9    6e-10   Vitis vinifera
emb|CAN74101.1|  hypothetical protein VITISV_039542                   63.5    6e-10   Vitis vinifera
emb|CAN80853.1|  hypothetical protein VITISV_040353                   63.2    7e-10   Vitis vinifera
emb|CAN78142.1|  hypothetical protein VITISV_015958                   62.4    8e-10   Vitis vinifera
ref|XP_003594989.1|  Mitochondrial protein, putative                  59.7    8e-10   
ref|XP_006358759.1|  PREDICTED: uncharacterized protein LOC102586991  62.8    1e-09   
emb|CAN75244.1|  hypothetical protein VITISV_014212                   62.8    1e-09   Vitis vinifera
emb|CAN66265.1|  hypothetical protein VITISV_042702                   62.4    1e-09   Vitis vinifera
emb|CAN63193.1|  hypothetical protein VITISV_017130                   62.8    1e-09   Vitis vinifera
emb|CAN72132.1|  hypothetical protein VITISV_040707                   62.4    1e-09   Vitis vinifera
emb|CAN60837.1|  hypothetical protein VITISV_033823                   62.8    1e-09   Vitis vinifera
ref|XP_008382800.1|  PREDICTED: uncharacterized protein LOC103445565  60.8    1e-09   
emb|CAN78751.1|  hypothetical protein VITISV_028425                   62.4    1e-09   Vitis vinifera
emb|CAN73101.1|  hypothetical protein VITISV_042890                   62.4    1e-09   Vitis vinifera
emb|CAN83455.1|  hypothetical protein VITISV_029958                   62.0    1e-09   Vitis vinifera
emb|CAN74129.1|  hypothetical protein VITISV_041770                   62.0    1e-09   Vitis vinifera
ref|XP_009335215.1|  PREDICTED: uncharacterized protein LOC103927954  62.4    2e-09   
emb|CAN67338.1|  hypothetical protein VITISV_016115                   62.4    2e-09   Vitis vinifera
emb|CAN78715.1|  hypothetical protein VITISV_030863                   62.0    2e-09   Vitis vinifera
emb|CBL94154.1|  putative polyprotein (retrotrasposon protein)        62.0    2e-09   
ref|XP_006606754.1|  PREDICTED: uncharacterized mitochondrial pro...  58.9    2e-09   
emb|CAN63185.1|  hypothetical protein VITISV_000411                   61.6    2e-09   Vitis vinifera
emb|CAN71246.1|  hypothetical protein VITISV_011986                   62.0    2e-09   Vitis vinifera
emb|CAN63730.1|  hypothetical protein VITISV_030286                   62.0    2e-09   Vitis vinifera
emb|CAN63843.1|  hypothetical protein VITISV_036670                   61.6    2e-09   Vitis vinifera
ref|XP_004508230.1|  PREDICTED: uncharacterized mitochondrial pro...  59.7    3e-09   
emb|CAN63874.1|  hypothetical protein VITISV_038274                   61.2    3e-09   Vitis vinifera
emb|CAN69691.1|  hypothetical protein VITISV_026777                   61.6    3e-09   Vitis vinifera
emb|CAN77110.1|  hypothetical protein VITISV_013963                   60.8    3e-09   Vitis vinifera
ref|XP_008232022.1|  PREDICTED: uncharacterized protein LOC103331192  61.2    3e-09   
emb|CAN77834.1|  hypothetical protein VITISV_024733                   61.2    4e-09   Vitis vinifera
emb|CAN63917.1|  hypothetical protein VITISV_019573                   60.8    4e-09   Vitis vinifera
ref|XP_003630831.1|  50S ribosomal protein L17                        60.5    4e-09   
emb|CAN81671.1|  hypothetical protein VITISV_016409                   59.3    4e-09   Vitis vinifera
emb|CAN79672.1|  hypothetical protein VITISV_012210                   61.2    4e-09   Vitis vinifera
gb|AAO26683.1|AF478369_1  gag-pol polyprotein                         59.7    5e-09   Vitis vinifera
emb|CAN63530.1|  hypothetical protein VITISV_038849                   60.8    5e-09   Vitis vinifera
gb|AAO26684.1|AF478370_1  gag-pol polyprotein                         59.7    5e-09   Vitis vinifera
emb|CAN80247.1|  hypothetical protein VITISV_027801                   60.8    5e-09   Vitis vinifera
emb|CAN82711.1|  hypothetical protein VITISV_004468                   60.8    5e-09   Vitis vinifera
ref|XP_007028466.1|  Uncharacterized protein TCM_024268               60.8    5e-09   
emb|CAN60593.1|  hypothetical protein VITISV_023128                   60.8    6e-09   Vitis vinifera
emb|CAN79281.1|  hypothetical protein VITISV_034553                   60.5    6e-09   Vitis vinifera
emb|CAN77210.1|  hypothetical protein VITISV_000141                   60.1    8e-09   Vitis vinifera
emb|CAN84135.1|  hypothetical protein VITISV_000113                   60.1    9e-09   Vitis vinifera
emb|CAN61858.1|  hypothetical protein VITISV_016691                   60.1    1e-08   Vitis vinifera
emb|CAN73250.1|  hypothetical protein VITISV_027047                   60.1    1e-08   Vitis vinifera
emb|CAN80284.1|  hypothetical protein VITISV_035380                   60.1    1e-08   Vitis vinifera
emb|CAN78392.1|  hypothetical protein VITISV_034679                   59.3    1e-08   Vitis vinifera
ref|XP_003597218.1|  Beta-galactosidase                               60.1    1e-08   
emb|CAN63081.1|  hypothetical protein VITISV_016842                   59.7    1e-08   Vitis vinifera
gb|ABY49842.1|  hypothetical protein                                  59.7    1e-08   Vitis hybrid cultivar
ref|XP_007033044.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  56.6    1e-08   
emb|CAN73383.1|  hypothetical protein VITISV_003164                   59.7    1e-08   Vitis vinifera
emb|CAN70259.1|  hypothetical protein VITISV_002222                   57.8    2e-08   Vitis vinifera
emb|CAN69056.1|  hypothetical protein VITISV_022966                   58.5    2e-08   Vitis vinifera
emb|CAN60317.1|  hypothetical protein VITISV_002851                   59.3    2e-08   Vitis vinifera
emb|CAN62329.1|  hypothetical protein VITISV_029808                   58.5    2e-08   Vitis vinifera
emb|CAN65116.1|  hypothetical protein VITISV_012471                   57.8    2e-08   Vitis vinifera
ref|XP_010251941.1|  PREDICTED: uncharacterized protein LOC104593671  57.8    2e-08   
emb|CAN60453.1|  hypothetical protein VITISV_019551                   58.9    2e-08   Vitis vinifera
emb|CAN68348.1|  hypothetical protein VITISV_032025                   58.9    2e-08   Vitis vinifera
gb|KHN22607.1|  Retrovirus-related Pol polyprotein from transposo...  55.8    3e-08   
ref|XP_008343418.1|  PREDICTED: uncharacterized protein LOC103406190  58.5    3e-08   
emb|CAN78708.1|  hypothetical protein VITISV_019236                   58.2    3e-08   Vitis vinifera
emb|CAN69819.1|  hypothetical protein VITISV_025708                   58.9    3e-08   Vitis vinifera
emb|CAN83177.1|  hypothetical protein VITISV_042114                   58.5    3e-08   Vitis vinifera
gb|KHN17267.1|  Putative mitochondrial protein                        56.6    4e-08   
gb|AFN88207.1|  integrase core domain containing protein              58.2    4e-08   
dbj|BAK64102.1|  gag-pol polyprotein                                  58.2    4e-08   
emb|CAN80074.1|  hypothetical protein VITISV_018877                   58.2    5e-08   Vitis vinifera
gb|KHN45218.1|  Putative mitochondrial protein                        56.6    5e-08   
gb|KHN07818.1|  Retrovirus-related Pol polyprotein from transposo...  56.2    5e-08   
emb|CAN80831.1|  hypothetical protein VITISV_002503                   57.8    6e-08   Vitis vinifera
emb|CAN81716.1|  hypothetical protein VITISV_032903                   57.8    6e-08   Vitis vinifera
ref|XP_010095595.1|  Copia protein                                    57.8    6e-08   
ref|XP_008351713.1|  PREDICTED: uncharacterized protein LOC103415137  57.4    7e-08   
gb|KHN06274.1|  Retrovirus-related Pol polyprotein from transposo...  57.4    7e-08   
emb|CAN64827.1|  hypothetical protein VITISV_030308                   57.4    7e-08   Vitis vinifera
gb|AFP55546.1|  gag-pol polyprotein                                   57.4    8e-08   
emb|CAN72710.1|  hypothetical protein VITISV_018096                   57.4    8e-08   Vitis vinifera
gb|AAO26690.1|AF478377_1  gag-pol polyprotein                         56.2    9e-08   Vitis vinifera
emb|CAN82359.1|  hypothetical protein VITISV_027367                   57.0    1e-07   Vitis vinifera
ref|XP_008230429.1|  PREDICTED: uncharacterized protein LOC103329710  54.3    1e-07   
emb|CAN77113.1|  hypothetical protein VITISV_042189                   55.8    1e-07   Vitis vinifera
emb|CAN69900.1|  hypothetical protein VITISV_016957                   53.9    1e-07   Vitis vinifera
ref|XP_010107197.1|  Phosphoglucan, water dikinase                    56.6    1e-07   
emb|CAN75051.1|  hypothetical protein VITISV_020117                   57.0    1e-07   Vitis vinifera
ref|XP_006596647.1|  PREDICTED: uncharacterized mitochondrial pro...  55.1    1e-07   
ref|XP_004172804.1|  PREDICTED: uncharacterized mitochondrial pro...  53.5    1e-07   
emb|CAN64613.1|  hypothetical protein VITISV_030850                   56.2    1e-07   Vitis vinifera
emb|CAN63235.1|  hypothetical protein VITISV_040120                   55.5    1e-07   Vitis vinifera
ref|XP_006605112.1|  PREDICTED: uncharacterized mitochondrial pro...  53.1    2e-07   
emb|CAN66206.1|  hypothetical protein VITISV_041151                   55.1    2e-07   Vitis vinifera
emb|CAN74310.1|  hypothetical protein VITISV_037517                   56.2    2e-07   Vitis vinifera
gb|ABN08283.1|  hypothetical protein MtrDRAFT_AC155889g9v2            55.5    3e-07   Medicago truncatula
ref|XP_006584292.1|  PREDICTED: uncharacterized protein LOC102668041  55.5    3e-07   
emb|CAN69088.1|  hypothetical protein VITISV_031062                   55.5    3e-07   Vitis vinifera
ref|XP_010645227.1|  PREDICTED: nodulin-26-like                       54.7    4e-07   
emb|CAN81916.1|  hypothetical protein VITISV_038548                   55.5    4e-07   Vitis vinifera
ref|XP_004309610.1|  PREDICTED: uncharacterized mitochondrial pro...  52.4    4e-07   
emb|CAN75593.1|  hypothetical protein VITISV_030321                   54.3    4e-07   Vitis vinifera
ref|XP_006586529.1|  PREDICTED: uncharacterized mitochondrial pro...  52.4    4e-07   
emb|CAN63955.1|  hypothetical protein VITISV_034255                   55.1    5e-07   Vitis vinifera
ref|XP_004173128.1|  PREDICTED: uncharacterized mitochondrial pro...  52.4    5e-07   
gb|AAT38747.2|  Polyprotein, putative                                 55.1    5e-07   Solanum demissum
emb|CAN80547.1|  hypothetical protein VITISV_010898                   55.1    6e-07   Vitis vinifera
ref|XP_010095640.1|  Serine/threonine-protein kinase TOR              55.1    6e-07   
ref|XP_010107194.1|  Phosphoglucan, water dikinase                    54.7    6e-07   
emb|CAN65603.1|  hypothetical protein VITISV_021511                   54.3    6e-07   Vitis vinifera
ref|XP_007019411.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  54.7    6e-07   
emb|CAN76494.1|  hypothetical protein VITISV_024984                   54.3    1e-06   Vitis vinifera
emb|CAN77322.1|  hypothetical protein VITISV_002172                   53.9    1e-06   Vitis vinifera
emb|CAN65716.1|  hypothetical protein VITISV_015039                   53.9    1e-06   Vitis vinifera
emb|CAN60456.1|  hypothetical protein VITISV_019554                   54.3    1e-06   Vitis vinifera
ref|XP_007045697.1|  Uncharacterized protein TCM_011393               53.9    1e-06   
emb|CAN66375.1|  hypothetical protein VITISV_037549                   53.9    1e-06   Vitis vinifera
emb|CAN77272.1|  hypothetical protein VITISV_018551                   53.1    1e-06   Vitis vinifera
emb|CAN82507.1|  hypothetical protein VITISV_039314                   53.1    1e-06   Vitis vinifera
emb|CAN79872.1|  hypothetical protein VITISV_017186                   53.5    2e-06   Vitis vinifera
emb|CAN80340.1|  hypothetical protein VITISV_015365                   53.5    2e-06   Vitis vinifera
emb|CAN64822.1|  hypothetical protein VITISV_025364                   53.5    2e-06   Vitis vinifera
ref|XP_004162513.1|  PREDICTED: uncharacterized mitochondrial pro...  51.2    2e-06   
ref|XP_009353805.1|  PREDICTED: uncharacterized protein LOC103945027  53.1    2e-06   
emb|CAN76196.1|  hypothetical protein VITISV_041073                   53.5    2e-06   Vitis vinifera
ref|XP_006574281.1|  PREDICTED: uncharacterized mitochondrial pro...  50.4    2e-06   
ref|XP_010038876.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.5    2e-06   
emb|CAN72188.1|  hypothetical protein VITISV_020673                   53.1    2e-06   Vitis vinifera
emb|CAN62654.1|  hypothetical protein VITISV_033270                   53.1    2e-06   Vitis vinifera
emb|CAN70115.1|  hypothetical protein VITISV_020105                   52.8    2e-06   Vitis vinifera
ref|XP_010451381.1|  PREDICTED: uncharacterized protein LOC104733506  53.1    2e-06   
emb|CAN69825.1|  hypothetical protein VITISV_028626                   52.8    3e-06   Vitis vinifera
emb|CAN82268.1|  hypothetical protein VITISV_009286                   52.8    3e-06   Vitis vinifera
emb|CAN64090.1|  hypothetical protein VITISV_002951                   52.8    3e-06   Vitis vinifera
ref|XP_010651924.1|  PREDICTED: uncharacterized protein LOC104879740  52.8    3e-06   
emb|CAN61004.1|  hypothetical protein VITISV_015023                   52.8    3e-06   Vitis vinifera
emb|CAN65966.1|  hypothetical protein VITISV_005935                   52.8    3e-06   Vitis vinifera
emb|CAN63637.1|  hypothetical protein VITISV_038689                   52.4    3e-06   Vitis vinifera
ref|XP_006580800.1|  PREDICTED: uncharacterized mitochondrial pro...  51.6    3e-06   
emb|CAN82483.1|  hypothetical protein VITISV_006799                   52.8    4e-06   Vitis vinifera
emb|CAN81362.1|  hypothetical protein VITISV_013815                   52.8    4e-06   Vitis vinifera
emb|CAN73624.1|  hypothetical protein VITISV_042460                   52.4    4e-06   Vitis vinifera
emb|CDY01802.1|  BnaC06g28420D                                        49.7    4e-06   
emb|CAH67874.1|  OSIGBa0153E02-OSIGBa0093I20.3                        52.4    4e-06   Oryza sativa [red rice]
emb|CAN80183.1|  hypothetical protein VITISV_015370                   52.0    4e-06   Vitis vinifera
emb|CAN79194.1|  hypothetical protein VITISV_000236                   52.4    4e-06   Vitis vinifera
gb|KHN06596.1|  Copia protein                                         49.7    4e-06   
gb|KHN09542.1|  Copia protein                                         49.3    4e-06   
ref|XP_004297918.1|  PREDICTED: uncharacterized mitochondrial pro...  50.1    5e-06   
emb|CAN72277.1|  hypothetical protein VITISV_043408                   51.6    5e-06   Vitis vinifera
ref|XP_008374393.1|  PREDICTED: uncharacterized protein LOC103437682  51.2    5e-06   
emb|CAN76400.1|  hypothetical protein VITISV_001550                   52.0    5e-06   Vitis vinifera
emb|CAE05707.2|  OSJNBb0065J09.3                                      52.4    5e-06   Oryza sativa [red rice]
emb|CAN75033.1|  hypothetical protein VITISV_022185                   52.0    5e-06   Vitis vinifera
emb|CAN65108.1|  hypothetical protein VITISV_036622                   52.0    5e-06   Vitis vinifera
gb|KHN44882.1|  Putative mitochondrial protein                        50.8    5e-06   
emb|CAN76437.1|  hypothetical protein VITISV_013966                   50.4    5e-06   Vitis vinifera
gb|KHN23535.1|  Copia protein                                         50.1    5e-06   
emb|CAN80088.1|  hypothetical protein VITISV_021656                   52.0    5e-06   Vitis vinifera
gb|AAG09097.1|AC009323_8  Putative retroelement polyprotein           52.4    5e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAN62623.1|  hypothetical protein VITISV_001656                   52.0    5e-06   Vitis vinifera
emb|CAN75666.1|  hypothetical protein VITISV_016771                   51.6    5e-06   Vitis vinifera
emb|CAN60008.1|  hypothetical protein VITISV_024743                   52.0    5e-06   Vitis vinifera
emb|CAN71586.1|  hypothetical protein VITISV_009568                   52.0    5e-06   Vitis vinifera
emb|CAN67972.1|  hypothetical protein VITISV_033301                   50.4    5e-06   Vitis vinifera
emb|CAN80157.1|  hypothetical protein VITISV_028148                   50.8    6e-06   Vitis vinifera
emb|CAN64259.1|  hypothetical protein VITISV_038891                   48.5    6e-06   Vitis vinifera
emb|CAN60342.1|  hypothetical protein VITISV_031321                   50.4    6e-06   Vitis vinifera
emb|CAN68175.1|  hypothetical protein VITISV_010332                   52.0    6e-06   Vitis vinifera
emb|CAN79829.1|  hypothetical protein VITISV_025446                   51.6    6e-06   Vitis vinifera
emb|CAN72141.1|  hypothetical protein VITISV_017108                   52.0    6e-06   Vitis vinifera
emb|CAN79573.1|  hypothetical protein VITISV_017340                   50.8    6e-06   Vitis vinifera
emb|CAN74251.1|  hypothetical protein VITISV_019090                   51.2    6e-06   Vitis vinifera
ref|XP_004292127.1|  PREDICTED: uncharacterized mitochondrial pro...  49.7    6e-06   
emb|CAN73392.1|  hypothetical protein VITISV_022526                   52.0    6e-06   Vitis vinifera
emb|CBL94155.1|  putative polyprotein (retrotrasposon protein)        50.8    6e-06   
emb|CAN78733.1|  hypothetical protein VITISV_020436                   51.6    7e-06   Vitis vinifera
emb|CAN76179.1|  hypothetical protein VITISV_022751                   51.6    7e-06   Vitis vinifera
ref|XP_010113352.1|  Retrovirus-related Pol polyprotein from tran...  52.0    7e-06   
emb|CAN73399.1|  hypothetical protein VITISV_006541                   51.6    7e-06   Vitis vinifera
emb|CAN59824.1|  hypothetical protein VITISV_001983                   50.8    7e-06   Vitis vinifera
emb|CAN66857.1|  hypothetical protein VITISV_000450                   51.2    8e-06   Vitis vinifera
emb|CAN82468.1|  hypothetical protein VITISV_039784                   51.6    8e-06   Vitis vinifera
emb|CAN60930.1|  hypothetical protein VITISV_012765                   51.6    8e-06   Vitis vinifera
emb|CAN61409.1|  hypothetical protein VITISV_035127                   51.2    9e-06   Vitis vinifera
emb|CAN70109.1|  hypothetical protein VITISV_001696                   51.2    9e-06   Vitis vinifera
emb|CAN79066.1|  hypothetical protein VITISV_019693                   51.2    9e-06   Vitis vinifera
emb|CAN76176.1|  hypothetical protein VITISV_022748                   51.2    1e-05   Vitis vinifera
emb|CAN78025.1|  hypothetical protein VITISV_031335                   51.2    1e-05   Vitis vinifera
ref|YP_009049803.1|  hypothetical protein                             48.1    1e-05   
ref|XP_006584425.1|  PREDICTED: uncharacterized mitochondrial pro...  48.9    1e-05   
emb|CAN82526.1|  hypothetical protein VITISV_028058                   51.2    1e-05   Vitis vinifera
emb|CAN79949.1|  hypothetical protein VITISV_044422                   51.2    1e-05   Vitis vinifera
emb|CAN75900.1|  hypothetical protein VITISV_033582                   51.2    1e-05   Vitis vinifera
emb|CAN80919.1|  hypothetical protein VITISV_002640                   51.2    1e-05   Vitis vinifera
ref|XP_010678360.1|  PREDICTED: uncharacterized protein LOC104893919  50.4    1e-05   
ref|XP_004515892.1|  PREDICTED: uncharacterized mitochondrial pro...  50.1    1e-05   
ref|YP_009049732.1|  hypothetical protein                             47.8    2e-05   
ref|XP_008372290.1|  PREDICTED: uncharacterized protein LOC103435669  50.8    2e-05   
ref|XP_006591792.1|  PREDICTED: uncharacterized mitochondrial pro...  47.8    2e-05   
emb|CAN63881.1|  hypothetical protein VITISV_039357                   50.8    2e-05   Vitis vinifera
ref|XP_004511066.1|  PREDICTED: uncharacterized mitochondrial pro...  47.8    2e-05   
emb|CAN60058.1|  hypothetical protein VITISV_039054                   50.4    2e-05   Vitis vinifera
emb|CAN64770.1|  hypothetical protein VITISV_004450                   50.4    2e-05   Vitis vinifera
emb|CAN82041.1|  hypothetical protein VITISV_033522                   50.4    2e-05   Vitis vinifera
emb|CAN72986.1|  hypothetical protein VITISV_005624                   50.4    2e-05   Vitis vinifera
emb|CAN79175.1|  hypothetical protein VITISV_001884                   50.4    2e-05   Vitis vinifera
emb|CAN77225.1|  hypothetical protein VITISV_002211                   50.4    2e-05   Vitis vinifera
ref|XP_004490419.1|  PREDICTED: uncharacterized mitochondrial pro...  47.8    2e-05   
emb|CAN62636.1|  hypothetical protein VITISV_006313                   50.4    2e-05   Vitis vinifera
emb|CAN64785.1|  hypothetical protein VITISV_014070                   49.7    2e-05   Vitis vinifera
emb|CAH66946.1|  B0809H07.1                                           50.4    2e-05   Oryza sativa [red rice]
ref|XP_010678911.1|  PREDICTED: ABC transporter C family member 3...  50.4    2e-05   
emb|CAN78598.1|  hypothetical protein VITISV_001332                   50.4    2e-05   Vitis vinifera
emb|CAN77434.1|  hypothetical protein VITISV_017816                   50.1    2e-05   Vitis vinifera
ref|XP_006591738.1|  PREDICTED: uncharacterized mitochondrial pro...  48.1    2e-05   
emb|CAN76367.1|  hypothetical protein VITISV_024583                   50.4    2e-05   Vitis vinifera
emb|CAN81915.1|  hypothetical protein VITISV_044311                   49.3    2e-05   
ref|XP_006576040.1|  PREDICTED: uncharacterized mitochondrial pro...  49.3    2e-05   
ref|XP_008381486.1|  PREDICTED: uncharacterized protein LOC103444326  50.1    2e-05   
emb|CAN82137.1|  hypothetical protein VITISV_019176                   48.9    2e-05   
emb|CAN77985.1|  hypothetical protein VITISV_032699                   49.7    2e-05   
gb|AAO20078.1|  putative polyprotein                                  50.1    2e-05   
emb|CAN68802.1|  hypothetical protein VITISV_008809                   50.1    3e-05   
emb|CAN70453.1|  hypothetical protein VITISV_035056                   50.1    3e-05   
gb|AAG50751.1|AC079733_19  polyprotein, putative                      50.1    3e-05   
dbj|BAB10743.1|  retroelement pol polyprotein-like                    50.1    3e-05   
emb|CAN67449.1|  hypothetical protein VITISV_031400                   50.1    3e-05   
emb|CAA18107.1|  LTR retrotransposon like protein                     50.1    3e-05   
emb|CAN81385.1|  hypothetical protein VITISV_012324                   50.1    3e-05   
emb|CAN69715.1|  hypothetical protein VITISV_011263                   50.1    3e-05   
emb|CAN78330.1|  hypothetical protein VITISV_034973                   50.1    3e-05   
dbj|BAA97287.1|  retroelement pol polyprotein-like                    50.1    3e-05   
emb|CAN72054.1|  hypothetical protein VITISV_031315                   50.1    3e-05   
emb|CAN70029.1|  hypothetical protein VITISV_010388                   50.1    3e-05   
emb|CAN76326.1|  hypothetical protein VITISV_014220                   50.1    3e-05   
ref|XP_004173176.1|  PREDICTED: uncharacterized mitochondrial pro...  48.1    3e-05   
gb|KHN44566.1|  Copia protein                                         48.1    3e-05   
emb|CAN82928.1|  hypothetical protein VITISV_025045                   50.1    3e-05   
emb|CAN65647.1|  hypothetical protein VITISV_001300                   49.7    3e-05   
emb|CAN72886.1|  hypothetical protein VITISV_019713                   50.1    3e-05   
ref|XP_004172874.1|  PREDICTED: uncharacterized mitochondrial pro...  47.4    3e-05   
gb|KHN07234.1|  Retrovirus-related Pol polyprotein from transposo...  47.4    3e-05   
emb|CAN76913.1|  hypothetical protein VITISV_037050                   49.7    3e-05   
ref|XP_004295389.1|  PREDICTED: uncharacterized mitochondrial pro...  47.4    3e-05   
emb|CAN80368.1|  hypothetical protein VITISV_014720                   49.7    3e-05   
gb|KHN04829.1|  Copia protein                                         48.1    3e-05   
ref|XP_009364887.1|  PREDICTED: uncharacterized protein LOC103954788  48.9    3e-05   
ref|XP_007033769.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  48.9    3e-05   
emb|CAE04751.3|  OSJNBb0060E08.14                                     49.7    3e-05   
emb|CAN83575.1|  hypothetical protein VITISV_025852                   49.7    3e-05   
emb|CAN73122.1|  hypothetical protein VITISV_024228                   48.1    3e-05   
emb|CAN73272.1|  hypothetical protein VITISV_013115                   49.7    3e-05   
emb|CAN61660.1|  hypothetical protein VITISV_000260                   49.7    4e-05   
emb|CAN76591.1|  hypothetical protein VITISV_020293                   49.7    4e-05   
emb|CAN70229.1|  hypothetical protein VITISV_024789                   49.7    4e-05   
emb|CAN79977.1|  hypothetical protein VITISV_029183                   49.7    4e-05   
gb|KHN35824.1|  Copia protein                                         47.8    4e-05   
emb|CAN70765.1|  hypothetical protein VITISV_025298                   49.3    4e-05   
emb|CAN74917.1|  hypothetical protein VITISV_032458                   49.7    4e-05   
ref|XP_006338010.1|  PREDICTED: F-box protein CPR30-like              49.3    4e-05   
emb|CAN66596.1|  hypothetical protein VITISV_019893                   49.7    4e-05   
emb|CAN76585.1|  hypothetical protein VITISV_020286                   49.3    4e-05   
emb|CAN69870.1|  hypothetical protein VITISV_032283                   49.3    4e-05   
emb|CAN69597.1|  hypothetical protein VITISV_038518                   49.7    4e-05   
emb|CAN63629.1|  hypothetical protein VITISV_018697                   49.3    4e-05   
ref|XP_004516881.1|  PREDICTED: uncharacterized mitochondrial pro...  46.6    4e-05   
ref|XP_004515021.1|  PREDICTED: uncharacterized mitochondrial pro...  47.4    4e-05   
emb|CAN68148.1|  hypothetical protein VITISV_035665                   49.3    5e-05   
emb|CAN78328.1|  hypothetical protein VITISV_034971                   48.5    5e-05   
emb|CAN83015.1|  hypothetical protein VITISV_041694                   49.3    5e-05   
ref|XP_010095761.1|  hypothetical protein L484_017568                 49.3    5e-05   
emb|CAN82240.1|  hypothetical protein VITISV_044199                   49.3    5e-05   
emb|CAN79305.1|  hypothetical protein VITISV_036286                   48.9    5e-05   
emb|CAN66727.1|  hypothetical protein VITISV_041956                   48.5    5e-05   
emb|CAN75973.1|  hypothetical protein VITISV_019857                   48.9    5e-05   
emb|CAN82518.1|  hypothetical protein VITISV_042699                   49.3    5e-05   
emb|CAN61820.1|  hypothetical protein VITISV_015157                   48.9    5e-05   
gb|KHN27027.1|  Copia protein                                         47.8    5e-05   
ref|XP_006605045.1|  PREDICTED: uncharacterized mitochondrial pro...  48.1    5e-05   
emb|CAN63908.1|  hypothetical protein VITISV_044218                   49.3    5e-05   
emb|CAN64407.1|  hypothetical protein VITISV_003511                   49.3    5e-05   
emb|CAN71812.1|  hypothetical protein VITISV_037409                   48.9    5e-05   
emb|CAN74329.1|  hypothetical protein VITISV_018993                   48.9    5e-05   
emb|CAN71707.1|  hypothetical protein VITISV_013453                   48.9    6e-05   
ref|XP_006579139.1|  PREDICTED: uncharacterized mitochondrial pro...  47.0    6e-05   
ref|XP_010251369.1|  PREDICTED: uncharacterized protein LOC104593316  47.0    6e-05   
gb|ABA95230.1|  retrotransposon protein, putative, unclassified       48.9    6e-05   
emb|CAN77571.1|  hypothetical protein VITISV_008517                   48.9    6e-05   
emb|CAN74559.1|  hypothetical protein VITISV_042001                   48.9    6e-05   
emb|CAN73437.1|  hypothetical protein VITISV_031733                   48.9    6e-05   
emb|CAN76610.1|  hypothetical protein VITISV_040102                   48.5    6e-05   
ref|XP_003621655.1|  Mitochondrial protein, putative                  46.2    6e-05   
emb|CAN60373.1|  hypothetical protein VITISV_034932                   48.9    6e-05   
ref|XP_010555764.1|  PREDICTED: serine carboxypeptidase-like 18       48.5    6e-05   
emb|CAN65808.1|  hypothetical protein VITISV_033389                   48.9    7e-05   
ref|XP_004513430.1|  PREDICTED: uncharacterized mitochondrial pro...  46.2    7e-05   
ref|XP_009762811.1|  PREDICTED: L-arabinokinase-like                  48.5    7e-05   
emb|CAN73765.1|  hypothetical protein VITISV_035279                   48.9    7e-05   
gb|KHN19597.1|  Copia protein                                         47.0    7e-05   
emb|CAN63295.1|  hypothetical protein VITISV_032981                   48.5    7e-05   
ref|XP_004301110.1|  PREDICTED: uncharacterized mitochondrial pro...  47.8    7e-05   
ref|XP_004294137.1|  PREDICTED: uncharacterized mitochondrial pro...  47.8    7e-05   
ref|XP_006588017.1|  PREDICTED: uncharacterized mitochondrial pro...  47.8    8e-05   
ref|XP_009596774.1|  PREDICTED: uncharacterized protein LOC104092803  47.8    8e-05   
emb|CAN79930.1|  hypothetical protein VITISV_007488                   48.5    8e-05   
emb|CAN73377.1|  hypothetical protein VITISV_042216                   47.8    8e-05   
emb|CAN67064.1|  hypothetical protein VITISV_017541                   48.5    9e-05   
ref|XP_010268531.1|  PREDICTED: uncharacterized protein LOC104605449  47.8    9e-05   
gb|ABA95799.2|  retrotransposon protein, putative, unclassified, ...  48.5    9e-05   
ref|XP_010027409.1|  PREDICTED: uncharacterized protein LOC104417910  48.5    9e-05   
ref|XP_010274863.1|  PREDICTED: uncharacterized protein LOC104610083  47.8    1e-04   
emb|CAN73816.1|  hypothetical protein VITISV_023928                   46.6    1e-04   
emb|CAN82851.1|  hypothetical protein VITISV_027998                   48.5    1e-04   
ref|XP_006340058.1|  PREDICTED: F-box/LRR-repeat protein At5g0291...  48.1    1e-04   
emb|CAN60732.1|  hypothetical protein VITISV_010209                   48.5    1e-04   
emb|CAN59964.1|  hypothetical protein VITISV_022757                   48.5    1e-04   
emb|CAN72168.1|  hypothetical protein VITISV_004170                   48.5    1e-04   
ref|XP_004309959.1|  PREDICTED: uncharacterized mitochondrial pro...  47.0    1e-04   
emb|CAN65339.1|  hypothetical protein VITISV_038404                   47.4    1e-04   
ref|XP_004306286.1|  PREDICTED: uncharacterized mitochondrial pro...  47.0    1e-04   
emb|CAN76350.1|  hypothetical protein VITISV_025245                   48.1    1e-04   
emb|CAA36616.1|  unnamed protein product                              47.8    1e-04   
emb|CAN69838.1|  hypothetical protein VITISV_008389                   47.4    1e-04   
gb|AAP54332.2|  retrotransposon protein, putative, unclassified       48.1    1e-04   
emb|CAN80566.1|  hypothetical protein VITISV_029672                   48.1    1e-04   
gb|KHM99439.1|  Copia protein                                         45.4    1e-04   
ref|XP_008366108.1|  PREDICTED: uncharacterized protein LOC103429756  46.6    1e-04   
emb|CAN66039.1|  hypothetical protein VITISV_035755                   47.8    1e-04   
emb|CAN73405.1|  hypothetical protein VITISV_010053                   48.1    1e-04   
emb|CAN69836.1|  hypothetical protein VITISV_026000                   48.1    1e-04   
gb|ADN34014.1|  reverse transcriptase                                 47.4    1e-04   
emb|CAN67418.1|  hypothetical protein VITISV_005919                   48.1    1e-04   
ref|XP_008378267.1|  PREDICTED: uncharacterized protein LOC103441368  47.8    1e-04   
ref|XP_009117178.1|  PREDICTED: uncharacterized protein LOC103842315  48.1    1e-04   
ref|XP_010496136.1|  PREDICTED: uncharacterized protein LOC104773255  47.8    1e-04   
emb|CAN60972.1|  hypothetical protein VITISV_032051                   48.1    1e-04   
emb|CAN81067.1|  hypothetical protein VITISV_032537                   45.8    2e-04   
ref|XP_009338880.1|  PREDICTED: uncharacterized protein LOC103931184  47.8    2e-04   
emb|CAN61658.1|  hypothetical protein VITISV_040310                   47.8    2e-04   
gb|AAM91874.1|  putative copia-like polyprotein                       47.8    2e-04   
dbj|BAB10837.1|  retroelement pol polyprotein-like                    47.8    2e-04   
ref|XP_010110492.1|  Bifunctional phosphatase IMPL2                   47.0    2e-04   
emb|CAN68502.1|  hypothetical protein VITISV_015736                   47.4    2e-04   
emb|CAN68477.1|  hypothetical protein VITISV_029627                   47.4    2e-04   
emb|CAN74900.1|  hypothetical protein VITISV_041363                   46.6    2e-04   
ref|XP_004516756.1|  PREDICTED: uncharacterized mitochondrial pro...  45.8    2e-04   
emb|CAN73102.1|  hypothetical protein VITISV_042891                   47.8    2e-04   
emb|CAN62538.1|  hypothetical protein VITISV_031159                   47.8    2e-04   
ref|XP_010412990.1|  PREDICTED: uncharacterized protein LOC104699374  47.8    2e-04   
emb|CAN60445.1|  hypothetical protein VITISV_032468                   47.4    2e-04   
emb|CAN83978.1|  hypothetical protein VITISV_007067                   47.0    2e-04   
ref|XP_006604978.1|  PREDICTED: uncharacterized mitochondrial pro...  46.6    2e-04   
ref|XP_004306156.1|  PREDICTED: uncharacterized mitochondrial pro...  46.2    2e-04   
emb|CAN77772.1|  hypothetical protein VITISV_037439                   47.4    2e-04   
gb|AAP46207.1|  putative retrotransposon protein                      47.4    2e-04   
ref|XP_006603195.1|  PREDICTED: uncharacterized mitochondrial pro...  46.6    2e-04   
emb|CAN61094.1|  hypothetical protein VITISV_012861                   47.0    2e-04   
emb|CAN75730.1|  hypothetical protein VITISV_031410                   47.4    2e-04   
gb|AAL68641.1|AF458765_1  polyprotein                                 47.4    2e-04   
emb|CAD41085.2|  OSJNBb0011N17.2                                      47.4    2e-04   
emb|CAN78341.1|  hypothetical protein VITISV_000108                   47.4    2e-04   
ref|XP_007030040.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  47.0    2e-04   
emb|CAN62755.1|  hypothetical protein VITISV_008109                   47.4    2e-04   
emb|CAN62192.1|  hypothetical protein VITISV_023983                   47.0    2e-04   
emb|CAN80841.1|  hypothetical protein VITISV_002785                   47.4    2e-04   
ref|XP_008356075.1|  PREDICTED: uncharacterized protein LOC103419760  46.2    2e-04   
emb|CAN82285.1|  hypothetical protein VITISV_039753                   47.4    2e-04   
ref|XP_010421078.1|  PREDICTED: uncharacterized protein LOC104706578  47.4    2e-04   
gb|KHN24193.1|  Retrovirus-related Pol polyprotein from transposo...  45.8    2e-04   
emb|CAN80881.1|  hypothetical protein VITISV_018650                   47.4    2e-04   
emb|CAN65522.1|  hypothetical protein VITISV_031371                   47.0    2e-04   
emb|CAN80920.1|  hypothetical protein VITISV_014743                   47.0    2e-04   
ref|XP_004502314.1|  PREDICTED: uncharacterized mitochondrial pro...  45.1    3e-04   
ref|XP_003622005.1|  Heat shock protein                               47.0    3e-04   
emb|CAN69190.1|  hypothetical protein VITISV_001578                   47.0    3e-04   
ref|XP_010107755.1|  Retrovirus-related Pol polyprotein from tran...  47.4    3e-04   
ref|XP_010104938.1|  Retrovirus-related Pol polyprotein from tran...  47.4    3e-04   
ref|XP_007029470.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  47.0    3e-04   
emb|CAN76224.1|  hypothetical protein VITISV_017232                   47.0    3e-04   
gb|KHN18169.1|  Copia protein                                         45.4    3e-04   
emb|CAN70357.1|  hypothetical protein VITISV_013713                   47.0    3e-04   
ref|XP_010246030.1|  PREDICTED: nucleolar complex protein 2 homolog   47.0    3e-04   
ref|XP_004168188.1|  PREDICTED: uncharacterized mitochondrial pro...  45.1    3e-04   
emb|CAN74610.1|  hypothetical protein VITISV_029330                   46.2    3e-04   
ref|XP_006595208.1|  PREDICTED: uncharacterized mitochondrial pro...  45.4    3e-04   
emb|CAN71433.1|  hypothetical protein VITISV_010167                   46.2    3e-04   
emb|CAN76606.1|  hypothetical protein VITISV_012935                   47.0    3e-04   
emb|CAN62086.1|  hypothetical protein VITISV_035123                   47.0    3e-04   
emb|CAN75700.1|  hypothetical protein VITISV_035987                   47.0    3e-04   
emb|CAN77807.1|  hypothetical protein VITISV_036095                   47.0    3e-04   
gb|AAD19784.1|  putative retroelement pol polyprotein                 47.0    3e-04   
emb|CAN75563.1|  hypothetical protein VITISV_032579                   46.6    3e-04   
gb|KHN02742.1|  Copia protein                                         44.3    3e-04   
gb|AES72669.2|  SPFH domain/band 7 family protein                     46.6    3e-04   
emb|CAN65313.1|  hypothetical protein VITISV_041339                   46.6    3e-04   
ref|XP_010241271.1|  PREDICTED: cation/H(+) antiporter 28-like        46.6    4e-04   
gb|AAM98191.1|  unknown protein                                       46.6    4e-04   
emb|CAN59721.1|  hypothetical protein VITISV_032350                   46.6    4e-04   
gb|KFK45117.1|  hypothetical protein AALP_AA1G346500                  46.6    4e-04   
emb|CAN68372.1|  hypothetical protein VITISV_002006                   46.2    4e-04   
emb|CAN77572.1|  hypothetical protein VITISV_008518                   45.8    4e-04   
gb|KHN45190.1|  Copia protein                                         45.4    4e-04   
gb|KEH21922.1|  DnaK family protein                                   46.2    4e-04   
gb|ABD32757.1|  Integrase, catalytic region                           46.6    4e-04   
emb|CAN66316.1|  hypothetical protein VITISV_031761                   46.2    4e-04   
ref|XP_006601474.1|  PREDICTED: uncharacterized mitochondrial pro...  44.3    4e-04   
emb|CAN81026.1|  hypothetical protein VITISV_023317                   46.6    4e-04   
ref|XP_010086696.1|  Electron transfer flavoprotein-ubiquinone ox...  46.6    4e-04   
gb|AAB87099.1|  putative retroelement pol polyprotein                 46.6    4e-04   
ref|XP_003602418.1|  Stomatin-like protein                            46.2    4e-04   
ref|XP_004300707.1|  PREDICTED: uncharacterized mitochondrial pro...  45.8    4e-04   
emb|CAN70669.1|  hypothetical protein VITISV_037506                   46.6    4e-04   
ref|XP_010532348.1|  PREDICTED: uncharacterized protein LOC104808371  46.6    4e-04   
gb|ABA95797.1|  retrotransposon protein, putative, unclassified       46.6    4e-04   
emb|CAN73543.1|  hypothetical protein VITISV_037102                   45.8    4e-04   
ref|XP_009775681.1|  PREDICTED: uncharacterized protein LOC104225556  44.7    5e-04   
emb|CAN62921.1|  hypothetical protein VITISV_032126                   46.2    5e-04   
gb|KFK29521.1|  hypothetical protein AALP_AA7G145400                  45.8    5e-04   
gb|ABD32333.1|  polyprotein-like, putative                            46.2    5e-04   
gb|KHN11068.1|  Retrovirus-related Pol polyprotein from transposo...  44.7    5e-04   
emb|CAN71207.1|  hypothetical protein VITISV_030632                   46.2    5e-04   
emb|CAN75106.1|  hypothetical protein VITISV_019069                   45.8    5e-04   
ref|XP_010534024.1|  PREDICTED: uncharacterized protein LOC104809678  46.6    5e-04   
ref|XP_006340934.1|  PREDICTED: uncharacterized protein LOC102597361  46.2    5e-04   
ref|WP_010863376.1|  hypothetical protein                             43.9    5e-04   
ref|XP_010655195.1|  PREDICTED: uncharacterized protein LOC104880407  43.9    5e-04   
emb|CAN60502.1|  hypothetical protein VITISV_031514                   46.2    5e-04   
emb|CAN67762.1|  hypothetical protein VITISV_040650                   46.2    5e-04   
ref|XP_010102138.1|  hypothetical protein L484_021372                 45.4    5e-04   
ref|XP_007021787.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  45.1    6e-04   
ref|XP_004499457.1|  PREDICTED: uncharacterized mitochondrial pro...  43.9    6e-04   
ref|XP_009591673.1|  PREDICTED: uncharacterized protein LOC104088661  44.7    6e-04   
ref|XP_009139303.1|  PREDICTED: uncharacterized protein LOC103863290  46.2    6e-04   
emb|CAN77522.1|  hypothetical protein VITISV_005922                   45.4    6e-04   
emb|CAN60374.1|  hypothetical protein VITISV_001215                   46.2    6e-04   
emb|CAN67362.1|  hypothetical protein VITISV_001157                   46.2    6e-04   
emb|CAN66624.1|  hypothetical protein VITISV_037417                   46.2    6e-04   



>ref|XP_004174156.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Cucumis sativus]
Length=163

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS VSQFMSSPT  HW A  +I+ YLK++PG+ +LY D+GHT VE FS
Sbjct  41   VSFVSQFMSSPTMDHWAAVEQILCYLKASPGRGILYKDHGHTRVECFS  88



>ref|XP_004174143.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like, 
partial [Cucumis sativus]
Length=254

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFMSSPT  HW A  +I+ YLK+A G+ +LY D+GHT VE FS
Sbjct  156  VSVVSQFMSSPTVDHWAAVEQILCYLKAARGRGILYEDHGHTRVECFS  203



>gb|ABI34329.1| Integrase core domain containing protein [Solanum demissum]
Length=1775

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQFM+SP  +HWEA VRI+RY+KSAPGK +L+ D GH  +  ++
Sbjct  1185  VSVVSQFMTSPCDSHWEAVVRILRYIKSAPGKGLLFEDQGHEHIIGYT  1232



>emb|CAN75856.1| hypothetical protein VITISV_005690 [Vitis vinifera]
Length=268

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  189



>emb|CAN70968.1| hypothetical protein VITISV_033354 [Vitis vinifera]
Length=295

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  189



>emb|CAN79136.1| hypothetical protein VITISV_034813 [Vitis vinifera]
Length=278

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  189



>emb|CAN77373.1| hypothetical protein VITISV_008342 [Vitis vinifera]
Length=250

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  189



>emb|CAN59880.1| hypothetical protein VITISV_029938 [Vitis vinifera]
Length=250

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  189



>gb|ABI34342.1| Polyprotein, putative [Solanum demissum]
Length=1054

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM+SP  +HWEA VRI+RY+KSAPGK +L+ D GH  +  ++
Sbjct  946  VSVVSQFMTSPCDSHWEAVVRILRYIKSAPGKGLLFEDQGHEHIIGYT  993



>emb|CAN81070.1| hypothetical protein VITISV_037301 [Vitis vinifera]
Length=253

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  189



>emb|CAN77642.1| hypothetical protein VITISV_007624 [Vitis vinifera]
Length=286

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  205  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  252



>emb|CAN67493.1| hypothetical protein VITISV_022776 [Vitis vinifera]
Length=274

 Score = 64.7 bits (156),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYZNRGHTQVVGYT  189



>emb|CAN69178.1| hypothetical protein VITISV_024410 [Vitis vinifera]
Length=259

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  189



>emb|CAN66306.1| hypothetical protein VITISV_031415 [Vitis vinifera]
Length=250

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP   HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDNHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  189



>emb|CAN70825.1| hypothetical protein VITISV_039828 [Vitis vinifera]
Length=288

 Score = 64.7 bits (156),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  189



>emb|CAN59895.1| hypothetical protein VITISV_002882 [Vitis vinifera]
Length=267

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  189



>emb|CAN73073.1| hypothetical protein VITISV_032385 [Vitis vinifera]
Length=285

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  189



>emb|CAN81771.1| hypothetical protein VITISV_012076 [Vitis vinifera]
Length=276

 Score = 64.3 bits (155),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  189



>emb|CAN64462.1| hypothetical protein VITISV_008322 [Vitis vinifera]
Length=242

 Score = 63.9 bits (154),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  52   VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVDYT  99



>emb|CAN77222.1| hypothetical protein VITISV_010482 [Vitis vinifera]
Length=343

 Score = 65.1 bits (157),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  189



>emb|CAN75571.1| hypothetical protein VITISV_009506 [Vitis vinifera]
Length=308

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  189



>emb|CAN77643.1| hypothetical protein VITISV_007625 [Vitis vinifera]
Length=383

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  182  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  229



>emb|CAN59884.1| hypothetical protein VITISV_026166 [Vitis vinifera]
Length=6311

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1801  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1848



>emb|CAN76181.1| hypothetical protein VITISV_015418 [Vitis vinifera]
Length=323

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  212  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  259



>emb|CAN69420.1| hypothetical protein VITISV_025306 [Vitis vinifera]
Length=163

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+  +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  52   VSVVSQFLQSPCDSHWDVVIRILRYIKSRPGQGVLYENRGHTQVVGYT  99



>emb|CAN79805.1| hypothetical protein VITISV_031503 [Vitis vinifera]
Length=325

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI RY+KS PG+ VLY + GHT V  ++
Sbjct  124  VSVVSQFLQSPCDSHWDAVIRIPRYIKSTPGQGVLYENRGHTQVVGYT  171



>emb|CAN75815.1| hypothetical protein VITISV_004636 [Vitis vinifera]
Length=1511

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1461  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1508



>emb|CAN72663.1| hypothetical protein VITISV_031849 [Vitis vinifera]
Length=912

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  711  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYQNRGHTQVVGYT  758



>emb|CAN67892.1| hypothetical protein VITISV_036690 [Vitis vinifera]
Length=564

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  457  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYKNRGHTQVVGYT  504



>emb|CAN76432.1| hypothetical protein VITISV_033849 [Vitis vinifera]
Length=1126

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  936  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  983



>emb|CAN62614.1| hypothetical protein VITISV_028123 [Vitis vinifera]
Length=1102

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  901  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  948



>emb|CAN64673.1| hypothetical protein VITISV_007430 [Vitis vinifera]
Length=1079

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  878  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYKNRGHTQVVGYT  925



>emb|CAN70689.1| hypothetical protein VITISV_012155 [Vitis vinifera]
Length=1199

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  616  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  663



>emb|CAN72018.1| hypothetical protein VITISV_001841 [Vitis vinifera]
Length=1225

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1024  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1071



>emb|CAN78616.1| hypothetical protein VITISV_003658 [Vitis vinifera]
Length=2172

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1809  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1856



>emb|CAN62328.1| hypothetical protein VITISV_029806 [Vitis vinifera]
Length=996

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  795  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  842



>emb|CAN60609.1| hypothetical protein VITISV_036599 [Vitis vinifera]
Length=1455

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1275  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYQNRGHTQVVGYT  1322



>emb|CAN63507.1| hypothetical protein VITISV_029435 [Vitis vinifera]
Length=1211

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1010  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1057



>emb|CAN60274.1| hypothetical protein VITISV_024841 [Vitis vinifera]
Length=1573

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  903  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  950



>emb|CAN75922.1| hypothetical protein VITISV_030752 [Vitis vinifera]
Length=1214

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1026  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1073



>emb|CAN75744.1| hypothetical protein VITISV_040125 [Vitis vinifera]
Length=1257

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1056  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1103



>emb|CAN74064.1| hypothetical protein VITISV_028146 [Vitis vinifera]
Length=1203

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1002  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1049



>emb|CAN67925.1| hypothetical protein VITISV_021168 [Vitis vinifera]
Length=1354

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1133  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1180



>emb|CAN62074.1| hypothetical protein VITISV_001619 [Vitis vinifera]
Length=1237

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1036  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1083



>emb|CAN81139.1| hypothetical protein VITISV_018760 [Vitis vinifera]
Length=1403

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1263  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1310



>emb|CAN77046.1| hypothetical protein VITISV_035257 [Vitis vinifera]
Length=1478

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1277  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1324



>emb|CAN72440.1| hypothetical protein VITISV_039162 [Vitis vinifera]
Length=1253

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1052  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1099



>emb|CAN76679.1| hypothetical protein VITISV_034325 [Vitis vinifera]
Length=1117

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1000  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1047



>emb|CAN80753.1| hypothetical protein VITISV_003323 [Vitis vinifera]
Length=1304

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1119  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1166



>emb|CAN62535.1| hypothetical protein VITISV_041880 [Vitis vinifera]
Length=1314

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1145  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1192



>emb|CAN71273.1| hypothetical protein VITISV_019661 [Vitis vinifera]
Length=1276

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  639  VSVVSQFLQSPCDSHWDAIIRILRYIKSTPGQGVLYENKGHTQVVGYT  686



>emb|CAN81715.1| hypothetical protein VITISV_032902 [Vitis vinifera]
Length=848

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  647  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  694



>emb|CAN76133.1| hypothetical protein VITISV_036298 [Vitis vinifera]
Length=1161

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  974   VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTRVVGYT  1021



>emb|CAN62266.1| hypothetical protein VITISV_025647 [Vitis vinifera]
Length=1254

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1090  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1137



>emb|CAN67076.1| hypothetical protein VITISV_042382 [Vitis vinifera]
Length=1236

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1035  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1082



>emb|CAN73234.1| hypothetical protein VITISV_033857 [Vitis vinifera]
Length=1402

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1201  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1248



>emb|CAN65230.1| hypothetical protein VITISV_034221 [Vitis vinifera]
Length=482

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +SVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  281  MSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENKGHTQVVGYT  328



>emb|CAN61011.1| hypothetical protein VITISV_038445 [Vitis vinifera]
Length=1038

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  964   VSVVSQFLHSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1011



>emb|CAN61207.1| hypothetical protein VITISV_015446 [Vitis vinifera]
Length=900

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  699  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  746



>emb|CAN65410.1| hypothetical protein VITISV_040416 [Vitis vinifera]
Length=2253

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1699  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1746



>emb|CAN67119.1| hypothetical protein VITISV_017483 [Vitis vinifera]
Length=1970

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1072  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1119



>emb|CAN81940.1| hypothetical protein VITISV_007358 [Vitis vinifera]
Length=772

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +SVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  571  ISVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  618



>emb|CAN78880.1| hypothetical protein VITISV_024991 [Vitis vinifera]
Length=2264

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +SVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT +  ++
Sbjct  787  ISVVSQFLQSPCNSHWDAVIRILRYIKSTPGQGVLYKNRGHTQIVGYT  834



>emb|CAN74101.1| hypothetical protein VITISV_039542 [Vitis vinifera]
Length=1265

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGV  132
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V
Sbjct  999   VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQSVLYENRGHTQV  1042



>emb|CAN80853.1| hypothetical protein VITISV_040353 [Vitis vinifera]
Length=735

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +SVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT +  ++
Sbjct  534  MSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQSVLYENRGHTQIVGYT  581



>emb|CAN78142.1| hypothetical protein VITISV_015958 [Vitis vinifera]
Length=466

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +SVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  303  MSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  350



>ref|XP_003594989.1| Mitochondrial protein, putative [Medicago truncatula]
Length=119

 Score = 59.7 bits (143),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            V V+SQFM  P ++H +A  RI+RYLKSAPGK +L++++GH  VE ++
Sbjct  37   VIVMSQFMHDPRKSHMDAVERILRYLKSAPGKGLLFSNHGHLKVEGYT  84



>ref|XP_006358759.1| PREDICTED: uncharacterized protein LOC102586991 [Solanum tuberosum]
Length=1118

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM+SP  +HWEA VRI+RY+KSAPGK +L+   GH  +  ++
Sbjct  770  VSVVSQFMTSPCDSHWEAVVRILRYIKSAPGKGLLFEYQGHEHIIGYT  817



>emb|CAN75244.1| hypothetical protein VITISV_014212 [Vitis vinifera]
Length=884

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GH  V  ++
Sbjct  737  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHAQVVGYT  784



>emb|CAN66265.1| hypothetical protein VITISV_042702 [Vitis vinifera]
Length=588

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+  +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  484  VSVVSQFLQSPCDSHWDVVIRILRYIKSTPGQGVLYENRGHTQVVGYT  531



>emb|CAN63193.1| hypothetical protein VITISV_017130 [Vitis vinifera]
Length=2336

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGV  132
             VSVVSQF+ SP  +HW+A +RI RY+KS PG+ VLY + GHT V
Sbjct  2145  VSVVSQFLQSPCYSHWDAVIRIFRYIKSTPGQGVLYENRGHTQV  2188



>emb|CAN72132.1| hypothetical protein VITISV_040707 [Vitis vinifera]
Length=744

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+  +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  543  VSVVSQFLQSPCDSHWDXVIRILRYIKSTPGQGVLYENRGHTQVVGYT  590



>emb|CAN60837.1| hypothetical protein VITISV_033823 [Vitis vinifera]
Length=1155

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP   HW+A +RI+RY+K  PG+ +LY D GHT +  ++
Sbjct  961   VSVVSQFLQSPCDNHWDAVIRILRYIKGTPGQGMLYEDRGHTQIVGYT  1008



>ref|XP_008382800.1| PREDICTED: uncharacterized protein LOC103445565 [Malus domestica]
Length=292

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM SP+  H EA +RI+ YLKSAPGK VLY  + H  +E F+
Sbjct  202  VSVVSQFMHSPSVDHMEAVMRILAYLKSAPGKGVLYESHRHMRIEGFT  249



>emb|CAN78751.1| hypothetical protein VITISV_028425 [Vitis vinifera]
Length=926

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+  LY + GHT V  ++
Sbjct  725  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGXLYENRGHTQVVGYT  772



>emb|CAN73101.1| hypothetical protein VITISV_042890 [Vitis vinifera]
Length=772

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+  +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  571  VSVVSQFLQSPCDSHWDVVIRILRYIKSTPGQGVLYENRGHTQVVGYT  618



>emb|CAN83455.1| hypothetical protein VITISV_029958 [Vitis vinifera]
Length=459

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVS F+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  258  VSVVSXFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  305



>emb|CAN74129.1| hypothetical protein VITISV_041770 [Vitis vinifera]
Length=537

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+  P  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  445  VSVVSQFLQLPCDSHWDAVIRILRYIKSTPGQGVLYENKGHTQVVGYT  492



>ref|XP_009335215.1| PREDICTED: uncharacterized protein LOC103927954 [Pyrus x bretschneideri]
Length=1700

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQFM SP+  H  A +RI+ YLKSAPGK VLY  +GH  +E F+
Sbjct  1087  VSVVSQFMHSPSEDHMAAVMRILAYLKSAPGKGVLYRKHGHLRIEGFT  1134



>emb|CAN67338.1| hypothetical protein VITISV_016115 [Vitis vinifera]
Length=949

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS P + VLY + GHT V  ++
Sbjct  748  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPSQGVLYENRGHTQVVGYT  795



>emb|CAN78715.1| hypothetical protein VITISV_030863 [Vitis vinifera]
Length=1228

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VS VSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  1027  VSSVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  1074



>emb|CBL94154.1| putative polyprotein (retrotrasposon protein) [Malus domestica]
Length=1390

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
             VSVVSQFM SP+  H  A +RI+ YLKSAPGK VLY  +GH  VE F
Sbjct  1189  VSVVSQFMHSPSVDHMAAVMRILAYLKSAPGKGVLYQKHGHLNVEGF  1235



>ref|XP_006606754.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=164

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            V+V+SQFM  P + H +   RI+RYLKSAPGK +L++++GH  VE ++
Sbjct  90   VNVMSQFMHDPKKPHMDVVERILRYLKSAPGKGLLFSNHGHLKVEGYT  137



>emb|CAN63185.1| hypothetical protein VITISV_000411 [Vitis vinifera]
Length=577

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+  +RI+RY+KS PG+ +LY + GHT V  ++
Sbjct  370  VSVVSQFLQSPCDSHWDVVIRILRYIKSTPGQGMLYENRGHTQVFGYT  417



>emb|CAN71246.1| hypothetical protein VITISV_011986 [Vitis vinifera]
Length=937

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+ Y+KS PG+ VLY + GHT V  ++
Sbjct  736  VSVVSQFLQSPCDSHWDAVIRILXYIKSTPGQGVLYENRGHTQVVGYT  783



>emb|CAN63730.1| hypothetical protein VITISV_030286 [Vitis vinifera]
Length=1205

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS P + VLY + GHT V  ++
Sbjct  1004  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPSQGVLYENRGHTQVVGYT  1051



>emb|CAN63843.1| hypothetical protein VITISV_036670 [Vitis vinifera]
Length=753

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP   HW+A +RI+RY+K  PG+ +LY D GHT +  ++
Sbjct  582  VSVVSQFLQSPCDNHWDAMIRILRYIKGTPGQGMLYEDRGHTQIVGYT  629



>ref|XP_004508230.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Cicer arietinum]
Length=266

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+S+P  +HW   + I+RY+K+APGK +LY   G++GV  +S
Sbjct  160  VSVVSQFLSAPCDSHWNVVIHILRYIKNAPGKGLLYEHNGNSGVVGYS  207



>emb|CAN63874.1| hypothetical protein VITISV_038274 [Vitis vinifera]
Length=583

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS P + VLY + GHT V  ++
Sbjct  382  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPXQXVLYENRGHTQVVGYT  429



>emb|CAN69691.1| hypothetical protein VITISV_026777 [Vitis vinifera]
Length=1223

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+  +RI+RY+KS PG+ +LY + GHT V  ++
Sbjct  1038  VSVVSQFLQSPCDSHWDVVIRILRYIKSTPGQGMLYENKGHTQVVGYT  1085



>emb|CAN77110.1| hypothetical protein VITISV_013963 [Vitis vinifera]
Length=481

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + G+T V  +
Sbjct  393  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENKGNTQVVGY  439



>ref|XP_008232022.1| PREDICTED: uncharacterized protein LOC103331192 [Prunus mume]
Length=591

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM SP+  H  A +RI+RY K  PGK +++  YGHT VE ++
Sbjct  62   VSVVSQFMHSPSEDHMGAVMRILRYFKVTPGKGLMFCKYGHTNVEGYT  109



>emb|CAN77834.1| hypothetical protein VITISV_024733 [Vitis vinifera]
Length=1300

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +R +RY+KS PG+ VLY + GHT V  ++
Sbjct  1099  VSVVSQFLQSPCDSHWDAVIRXLRYVKSTPGQSVLYENRGHTQVVGYT  1146



>emb|CAN63917.1| hypothetical protein VITISV_019573 [Vitis vinifera]
Length=569

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  ++W+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  473  VSVVSQFLQSPYDSYWDAVIRILRYIKSTPGQDVLYKNRGHTQVVGYT  520



>ref|XP_003630831.1| 50S ribosomal protein L17 [Medicago truncatula]
Length=438

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF++SP  +HW A VRI++Y+K A GK +++ D GHT +  +S
Sbjct  171  VSVVSQFLNSPCDSHWNAVVRILKYIKRATGKGLVFTDRGHTNIVGYS  218



>emb|CAN81671.1| hypothetical protein VITISV_016409 [Vitis vinifera]
Length=283

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+S+PT  HW A  +I+ YLK APG  +LY+  GHT  E FS
Sbjct  120  VSVVSQFISTPTVKHWAALEQILCYLKKAPGLGILYSSQGHTRTECFS  167



>emb|CAN79672.1| hypothetical protein VITISV_012210 [Vitis vinifera]
Length=1211

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+  +RI++Y+KS PG+ VLY + GHT V  ++
Sbjct  1010  VSVVSQFLQSPCDSHWDVVIRILQYIKSTPGQGVLYENKGHTQVVGYT  1057



>gb|AAO26683.1|AF478369_1 gag-pol polyprotein [Vitis vinifera]
Length=326

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF S+PT  HW A  +I+ YLK APG  +LY+  GHT +E FS
Sbjct  125  VSVVSQFTSAPTIKHWAALEQILCYLKKAPGLGILYSSQGHTRIECFS  172



>emb|CAN63530.1| hypothetical protein VITISV_038849 [Vitis vinifera]
Length=938

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+  +RI+RY+KS PG+ VLY + GH  V  ++
Sbjct  737  VSVVSQFLQSPCDSHWDVVIRILRYIKSTPGQGVLYENRGHAQVVGYT  784



>gb|AAO26684.1|AF478370_1 gag-pol polyprotein [Vitis vinifera]
Length=326

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF S+PT  HW A  +I+ YLK APG  +LY+  GHT +E FS
Sbjct  125  VSVVSQFTSAPTIKHWAALEQILCYLKKAPGLGILYSSQGHTRIECFS  172



>emb|CAN80247.1| hypothetical protein VITISV_027801 [Vitis vinifera]
Length=1001

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP   HW+  +RI++Y+KS PG+ VLY + GHT V  ++
Sbjct  922  VSVVSQFLQSPCDNHWDVVIRILQYIKSTPGQGVLYENRGHTQVVGYT  969



>emb|CAN82711.1| hypothetical protein VITISV_004468 [Vitis vinifera]
Length=1157

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             V+VVSQF+ SP  +HW+A + I+RY+KS PG+ VLY + GHT V  ++
Sbjct  1001  VNVVSQFLQSPCDSHWDAVILILRYIKSTPGQGVLYENIGHTQVVGYT  1048



>ref|XP_007028466.1| Uncharacterized protein TCM_024268 [Theobroma cacao]
 gb|EOY08968.1| Uncharacterized protein TCM_024268 [Theobroma cacao]
Length=786

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVV+QFMS PT  HW    +I+ YLK APG  + Y ++GHT +E FS
Sbjct  585  VSVVNQFMSDPTINHWTDLKQILCYLKGAPGCGLFYGNHGHTNIECFS  632



>emb|CAN60593.1| hypothetical protein VITISV_023128 [Vitis vinifera]
Length=1285

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  + W+A +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  859  VSVVSQFLQSPCDSXWDAVIRILRYIKSTPGQGVLYENRGHTQVVGYT  906



>emb|CAN79281.1| hypothetical protein VITISV_034553 [Vitis vinifera]
Length=713

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS  G+ VLY + GHT V  ++
Sbjct  621  VSVVSQFLQSPCDSHWDAVIRILRYIKSTSGQGVLYENRGHTQVVGYT  668



>emb|CAN77210.1| hypothetical protein VITISV_000141 [Vitis vinifera]
Length=1236

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+  +RI+RY+KS P + VLY + GHT V  ++
Sbjct  1035  VSVVSQFLQSPCDSHWDVVIRILRYIKSTPSQGVLYENRGHTQVVGYT  1082



>emb|CAN84135.1| hypothetical protein VITISV_000113 [Vitis vinifera]
Length=1323

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS  G+ VLY + GHT V  ++
Sbjct  1122  VSVVSQFLQSPCDSHWDAVIRILRYIKSTLGQGVLYENRGHTQVVGYT  1169



>emb|CAN61858.1| hypothetical protein VITISV_016691 [Vitis vinifera]
Length=763

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF S+PT  HW A  +I+ YLK APG  +LY+  GHT +E FS
Sbjct  562  VSVVSQFTSAPTLKHWAALEQILCYLKKAPGLGILYSSQGHTRIECFS  609



>emb|CAN73250.1| hypothetical protein VITISV_027047 [Vitis vinifera]
Length=940

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+  +RI+RY+KS P + VLY + GHT V  ++
Sbjct  884  VSVVSQFLQSPCDSHWDVVIRILRYIKSTPSQGVLYENRGHTQVVGYT  931



>emb|CAN80284.1| hypothetical protein VITISV_035380 [Vitis vinifera]
Length=1228

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+VSQ + SP   HW+  +RI+RY+KS PG+ VLY + GHT V  ++
Sbjct  813  VSIVSQLLQSPCDCHWDVVIRILRYIKSTPGQGVLYENRGHTQVVGYT  860



>emb|CAN78392.1| hypothetical protein VITISV_034679 [Vitis vinifera]
Length=534

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            V+VVSQF+ SP  +HW+  + I+RY+KS PG+ VLY + GHT V  ++
Sbjct  477  VNVVSQFLQSPCDSHWDVVIHILRYIKSTPGQGVLYENIGHTQVVGYT  524



>ref|XP_003597218.1| Beta-galactosidase [Medicago truncatula]
Length=2260

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             V+VVSQFM  P + H +A  RI+RYLKSAPGK +L++++GH  VE ++
Sbjct  1740  VNVVSQFMHDPRKPHMDAVERILRYLKSAPGKGLLFSNHGHLKVEGYT  1787



>emb|CAN63081.1| hypothetical protein VITISV_016842 [Vitis vinifera]
Length=1179

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +HW+A +RI+RY+KS P + VLY + GH  V  ++
Sbjct  1064  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPSQGVLYENRGHAQVVGYT  1111



>gb|ABY49842.1| hypothetical protein [Vitis hybrid cultivar]
Length=1382

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF S+PT  HW A  +I+ YLK APG  +LY+  GHT +E FS
Sbjct  1181  VSVVSQFTSAPTIKHWAALEQILCYLKKAPGLGILYSSQGHTRIECFS  1228



>ref|XP_007033044.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8, putative 
[Theobroma cacao]
 gb|EOY03970.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8, putative 
[Theobroma cacao]
Length=194

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+VSQFMS+PT  HW A  +I+ YLK AP   + Y ++GHT +E FS
Sbjct  42   VSIVSQFMSAPTINHWAALEQILCYLKGAPRCGLFYENHGHTNIECFS  89



>emb|CAN73383.1| hypothetical protein VITISV_003164 [Vitis vinifera]
Length=960

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            VSVVSQFM  P+  H +  +RI+RYLKS+PGKW++++  GH  V  +
Sbjct  799  VSVVSQFMHCPSEDHMDVVMRILRYLKSSPGKWLMFSKNGHLNVAGY  845



>emb|CAN70259.1| hypothetical protein VITISV_002222 [Vitis vinifera]
Length=274

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY+KS  G+ VLY +  HT V  ++
Sbjct  142  VSVVSQFLQSPCDSHWDAVIRILRYIKSTLGQGVLYENRSHTQVVGYT  189



>emb|CAN69056.1| hypothetical protein VITISV_022966 [Vitis vinifera]
Length=388

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+VSQFM SP++ H EAA RI+RYLKS+P K +L+   G   +EA++
Sbjct  211  VSMVSQFMHSPSKEHLEAAYRILRYLKSSPRKGLLFKKGGQQTIEAYT  258



>emb|CAN60317.1| hypothetical protein VITISV_002851 [Vitis vinifera]
Length=975

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP   HW+A + I+RY+K  PG+ +LY D GHT +  ++
Sbjct  925  VSVVSQFLQSPCDNHWDAXIYILRYIKGTPGQGMLYEDRGHTQIVGYT  972



>emb|CAN62329.1| hypothetical protein VITISV_029808 [Vitis vinifera]
Length=374

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+ Y+KS PG+ VLY + G T V  ++
Sbjct  227  VSVVSQFLQSPCDSHWDAVIRILXYIKSTPGQGVLYENRGXTQVVGYT  274



>emb|CAN65116.1| hypothetical protein VITISV_012471 [Vitis vinifera]
Length=312

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+VSQFM SP + H++A  +I+RYL+  PGK +LY + GH  V+ F+
Sbjct  251  VSMVSQFMHSPNQGHFDAVYKILRYLRGTPGKGLLYENRGHLQVDVFT  298



>ref|XP_010251941.1| PREDICTED: uncharacterized protein LOC104593671 [Nelumbo nucifera]
Length=311

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            V V+SQFM SP + H EAA R++RYLK  PG  +L++ + H  VEAF
Sbjct  261  VGVLSQFMHSPKKPHMEAAERVLRYLKKHPGTGLLFSKHNHLKVEAF  307



>emb|CAN60453.1| hypothetical protein VITISV_019551 [Vitis vinifera]
Length=941

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM +P+  H +A +RI+RYLKS+PGK ++++  GH  +  ++
Sbjct  740  VSVVSQFMHNPSEDHMDAVIRILRYLKSSPGKGLMFSKNGHLRINGYT  787



>emb|CAN68348.1| hypothetical protein VITISV_032025 [Vitis vinifera]
Length=1670

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHT  126
             VSV SQF+ SP  +HW+  +RI+RY+KS PG+ VLY + GHT
Sbjct  981   VSVXSQFLXSPCDSHWDXVIRILRYIKSTPGQGVLYENRGHT  1022



>gb|KHN22607.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=172

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            V VVSQFM +P   HW A +RI+RY+K APG+ +LY D G T +  +
Sbjct  11   VGVVSQFMQNPHLDHWNAVMRILRYVKKAPGQGLLYEDKGSTQLSGY  57



>ref|XP_008343418.1| PREDICTED: uncharacterized protein LOC103406190 [Malus domestica]
Length=627

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVS FM SP+  H  A +RI+ YLKSAPGK +LY  +GH  +E F+
Sbjct  312  VSVVSXFMHSPSVDHMAAVMRILAYLKSAPGKGILYEHHGHMRIEGFT  359



>emb|CAN78708.1| hypothetical protein VITISV_019236 [Vitis vinifera]
Length=542

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGV  132
            VSVVSQF+ SP   HW+  +RI+RY+K  PG+ +LY D  HT +
Sbjct  490  VSVVSQFLQSPCDNHWDTVIRILRYIKGTPGQGMLYEDRSHTQI  533



>emb|CAN69819.1| hypothetical protein VITISV_025708 [Vitis vinifera]
Length=1626

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGH  123
             VSVVSQF+ SP  +HW+A +RI+RY+KS PG+ VLY + G+
Sbjct  1452  VSVVSQFLQSPCDSHWDAVIRILRYIKSTPGQGVLYENRGN  1492



>emb|CAN83177.1| hypothetical protein VITISV_042114 [Vitis vinifera]
Length=1085

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A +RI+RY KS P + V Y + GHT V  ++
Sbjct  883  VSVVSQFLQSPCDSHWDAVIRILRYNKSTPSQGVFYENRGHTQVVGYT  930



>gb|KHN17267.1| Putative mitochondrial protein, partial [Glycine soja]
Length=283

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            V VVSQFM +P   HW A +RI+RY+K APG+ +LY D G+T +  +
Sbjct  125  VGVVSQFMQNPHLDHWNAVMRILRYIKRAPGQGLLYEDKGNTQLSGY  171



>gb|AFN88207.1| integrase core domain containing protein [Phaseolus vulgaris]
Length=1387

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF++SP   HW A +RI++Y+K +PGK +LY    HT V  +S
Sbjct  1186  VSVVSQFLNSPCEDHWNAVIRILKYIKGSPGKGLLYGHNNHTKVVCYS  1233



>dbj|BAK64102.1| gag-pol polyprotein [Eustoma exaltatum subsp. russellianum]
Length=1591

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             V VVSQFM SP + H EA  RI+RYLK  PG+ +L+ + GH  +EA++
Sbjct  1386  VGVVSQFMHSPQKHHLEAVFRIMRYLKGTPGRGLLFKNNGHLNIEAYT  1433



>emb|CAN80074.1| hypothetical protein VITISV_018877 [Vitis vinifera]
Length=1001

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP   HW+  +RI+RY+K  PG+ +LY D G+T +  ++
Sbjct  860  VSVVSQFLQSPCDNHWDVVIRILRYIKGTPGQGMLYEDRGYTKIVGYT  907



>gb|KHN45218.1| Putative mitochondrial protein, partial [Glycine soja]
Length=283

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            V VVSQFM +P   HW A +RI+RY+K APG+ +LY D G+T +  +
Sbjct  125  VGVVSQFMQNPHLDHWNAVMRILRYIKRAPGQGLLYEDKGNTQLSGY  171



>gb|KHN07818.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=270

 Score = 56.2 bits (134),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            V VVSQFM +P   HW   +RI+RY+K APG+ +LY D G+T V  +
Sbjct  112  VGVVSQFMQNPRVDHWNVVMRILRYIKRAPGQGLLYEDKGNTQVSGY  158



>emb|CAN80831.1| hypothetical protein VITISV_002503 [Vitis vinifera]
Length=977

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP  +HW+A + I+RY+KS P + VLY + GHT V  ++
Sbjct  885  VSVVSQFLQSPCDSHWDAVICILRYIKSTPDQGVLYKNRGHTQVVGYT  932



>emb|CAN81716.1| hypothetical protein VITISV_032903 [Vitis vinifera]
Length=1170

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             +SVVSQF+ SP   HW+A + I+RY+K  PG+ +LY D GHT +  ++
Sbjct  969   MSVVSQFLQSPCNNHWDAVIHILRYIKGIPGQGMLYEDRGHTQIVGYT  1016



>ref|XP_010095595.1| Copia protein [Morus notabilis]
 gb|EXB61168.1| Copia protein [Morus notabilis]
Length=1303

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS++SQFM SP +TH EAA RI+RYLK +PGK +++  + +  +EA++
Sbjct  51   VSMISQFMHSPQKTHIEAAYRILRYLKGSPGKGLMFRKHDNRTIEAYT  98



>ref|XP_008351713.1| PREDICTED: uncharacterized protein LOC103415137 [Malus domestica]
Length=577

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            VSVVSQFM SP   H    +RI+ YLKSAPGK VL   +GH  VE F
Sbjct  498  VSVVSQFMHSPNVDHMTIVMRILAYLKSAPGKGVLNGKHGHLRVEGF  544



>gb|KHN06274.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1353

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
             V VVSQFM +P   HW A +RI+RY+K APG+ +LY D G+T V  +
Sbjct  1159  VGVVSQFMQNPRVDHWNAVMRILRYIKRAPGQGLLYEDKGNTQVSGY  1205



>emb|CAN64827.1| hypothetical protein VITISV_030308 [Vitis vinifera]
Length=1096

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ SP  +H +A +RI+ Y+KS PG+ VLY + GHT V  ++
Sbjct  1022  VSVVSQFLQSPCDSHXDAVIRILXYIKSTPGQXVLYENRGHTQVVGYT  1069



>gb|AFP55546.1| gag-pol polyprotein [Rosa rugosa]
Length=1180

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQFM +P+  H +A  RI++YLKSAPGK ++++ Y H  V  ++
Sbjct  979   VSVVSQFMHNPSEAHMDAVFRILQYLKSAPGKGLIFSKYSHLDVSGYT  1026



>emb|CAN72710.1| hypothetical protein VITISV_018096 [Vitis vinifera]
Length=1110

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP   HW++ +RI+RY+K  PG+ +LY D G T +  ++
Sbjct  923  VSVVSQFLQSPYDNHWDSVIRILRYIKGTPGQGMLYEDRGQTQIVGYT  970



>gb|AAO26690.1|AF478377_1 gag-pol polyprotein [Vitis vinifera]
Length=326

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF S+PT  HW A  +I+ YLK AP   +LY   GHT +E FS
Sbjct  125  VSVVSQFTSAPTIKHWAALEQILCYLKKAPSLGILYRSQGHTRIECFS  172



>emb|CAN82359.1| hypothetical protein VITISV_027367 [Vitis vinifera]
Length=984

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHT  126
            VSVVSQF+ SP  +HW+A + I+RY+KS PG+ VLY + G T
Sbjct  943  VSVVSQFLQSPCDSHWDAVICILRYIKSTPGQGVLYENRGRT  984



>ref|XP_008230429.1| PREDICTED: uncharacterized protein LOC103329710 [Prunus mume]
Length=186

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +S+VSQFM SP   H  A +RI+RYLK  PG  +++  YG+T VE ++
Sbjct  95   LSIVSQFMHSPNEDHMSAVMRILRYLKVTPGNGLMFCKYGYTDVEGYT  142



>emb|CAN77113.1| hypothetical protein VITISV_042189 [Vitis vinifera]
Length=314

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF S+PT  HW A  +I+ YLK A G  +LY+  GHT +E FS
Sbjct  128  VSVVSQFTSAPTIKHWAALEQILCYLKKALGLGILYSSQGHTRIECFS  175



>emb|CAN69900.1| hypothetical protein VITISV_016957 [Vitis vinifera]
Length=152

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+V QFM SP++ H +A +RI+RYLKS  GK +L++   H  VEA++
Sbjct  52   VSIVIQFMHSPSKCHMDAILRILRYLKSTLGKGLLFSKNNHLRVEAYT  99



>ref|XP_010107197.1| Phosphoglucan, water dikinase [Morus notabilis]
 gb|EXC14221.1| Phosphoglucan, water dikinase [Morus notabilis]
Length=894

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM+SP   H+EA  RI+RYLK   GK +L+   GH  VEA++
Sbjct  844  VSVVSQFMNSPGFAHFEAVFRILRYLKGTLGKGLLFKSRGHLQVEAYT  891



>emb|CAN75051.1| hypothetical protein VITISV_020117 [Vitis vinifera]
Length=1625

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQFM  P+  H +A +RI+RYLKS+PGK ++++  GH  V  ++
Sbjct  1166  VSVVSQFMHRPSEXHMDAVMRILRYLKSSPGKGLMFSKNGHLKVAGYT  1213



>ref|XP_006596647.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=271

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS++SQF  +PT +HW AA+RI+RY+K+A G  +LY D G+  +  +S
Sbjct  186  VSLLSQFPKAPTDSHWNAAMRILRYIKNAQGHGLLYEDKGNAKIVCYS  233



>ref|XP_004172804.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like, 
partial [Cucumis sativus]
Length=129

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM +P   H +A  RI+RYLKS PGK +++       +EA++
Sbjct  78   VSVVSQFMQTPNEEHMKAVNRILRYLKSTPGKGLMFRKTERKTIEAYT  125



>emb|CAN64613.1| hypothetical protein VITISV_030850 [Vitis vinifera]
Length=598

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM  P+  H +A +RI+RYLKS+PGK ++++  GH  V  ++
Sbjct  432  VSVVSQFMHRPSEDHMDAVMRILRYLKSSPGKGLMFSKNGHLKVVGYT  479



>emb|CAN63235.1| hypothetical protein VITISV_040120 [Vitis vinifera]
Length=317

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF S+PT  HW A   I+ YLK A G  +LY+  GHT +E FS
Sbjct  116  VSVVSQFTSAPTXKHWAALEXILCYLKKAXGLAILYSGQGHTRIECFS  163



>ref|XP_006605112.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=128

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +S+VSQF  SP   H EA  RI+RYLKS PG+ + +   G   +E F+
Sbjct  78   ISLVSQFTKSPHEEHLEAIPRILRYLKSTPGRGLFFKKTGQQAIEVFT  125



>emb|CAN66206.1| hypothetical protein VITISV_041151 [Vitis vinifera]
Length=339

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP   HW+  +RI++Y+K  P + +LY D  HT +  ++
Sbjct  248  VSVVSQFLQSPCDNHWDVVIRIIQYIKGTPDQGMLYEDRDHTQIVGYT  295



>emb|CAN74310.1| hypothetical protein VITISV_037517 [Vitis vinifera]
Length=1266

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ S   +HW+  +RI+RY+KS PG+ VLY +  HT V  ++
Sbjct  1065  VSVVSQFLQSRCDSHWDVVIRILRYIKSTPGQGVLYENRDHTQVVGYT  1112



>gb|ABN08283.1| hypothetical protein MtrDRAFT_AC155889g9v2 [Medicago truncatula]
Length=531

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+++P   HW   +RI++Y+K+A GK +LY + G+T V  +S
Sbjct  354  VSVVSQFLNAPCDDHWNVVIRILKYIKNAQGKGLLYENKGNTKVVGYS  401



>ref|XP_006584292.1| PREDICTED: uncharacterized protein LOC102668041 [Glycine max]
Length=1176

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
             V V+SQFM +P   HW A +RI+RY+K APG+ +LY D G T +  +
Sbjct  975   VGVISQFMQNPHLDHWNAVMRILRYVKRAPGQGLLYEDKGSTQLSGY  1021



>emb|CAN69088.1| hypothetical protein VITISV_031062 [Vitis vinifera]
Length=940

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSV+SQF+ SP   HW+  +RI+RY+K  P + +LY D GHT +  ++
Sbjct  744  VSVISQFLQSPCDNHWDVMIRILRYIKRIPCQGMLYEDRGHTQIVGYT  791



>ref|XP_010645227.1| PREDICTED: nodulin-26-like [Vitis vinifera]
Length=411

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+VSQFM  P+  H +A +RI+ YLKS+PGK ++++   H  +E ++
Sbjct  22   VSIVSQFMHCPSEDHIDAVIRILLYLKSSPGKGLMFSKNNHLNIEGYT  69



>emb|CAN81916.1| hypothetical protein VITISV_038548 [Vitis vinifera]
Length=1202

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYAD  114
             VSVVSQF+ SP   HW+A +RI+RY+KS PG+ VLY +
Sbjct  1019  VSVVSQFLQSPCDNHWDAVIRILRYIKSTPGQGVLYEN  1056



>ref|XP_004309610.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like, 
partial [Fragaria vesca subsp. vesca]
Length=146

 Score = 52.4 bits (124),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADY  117
            VSVVSQFM +P+  H +A VRI+RYLKSAPG+ V+++ +
Sbjct  52   VSVVSQFMHNPSVDHMDAVVRILRYLKSAPGRGVMFSKH  90



>emb|CAN75593.1| hypothetical protein VITISV_030321 [Vitis vinifera]
Length=324

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+VSQFM S  + H++A  +I+RYL+  PGK +LY + GH  V+ F+
Sbjct  149  VSMVSQFMHSSNQGHFDAVYKILRYLRRTPGKGLLYENRGHLQVDVFT  196



>ref|XP_006586529.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=168

 Score = 52.4 bits (124),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            V VVSQFM +P   HW A +RI+RY+K A G+ +LY D G+T +  +
Sbjct  42   VEVVSQFMQNPHLDHWNAVMRILRYVKRALGQGLLYEDKGNTQLSRY  88



>emb|CAN63955.1| hypothetical protein VITISV_034255 [Vitis vinifera]
Length=1117

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTG  129
             +SVVSQF+ SP  +HW+A +RI+RY+KS PG+ V Y D    G
Sbjct  961   ISVVSQFLQSPCDSHWDAVIRILRYIKSTPGQVVGYTDADXAG  1003



>ref|XP_004173128.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like, 
partial [Cucumis sativus]
Length=160

 Score = 52.4 bits (124),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM +P   H +A  RI+RYLKS PGK +++       +EA++
Sbjct  96   VSVVSQFMQTPNEEHMKAVNRILRYLKSTPGKGLMFRKTDRKTIEAYT  143



>gb|AAT38747.2| Polyprotein, putative [Solanum demissum]
Length=1402

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VS+VSQFMS+PT  HW A  +I+ YLK APG  ++Y +  HT +E F+
Sbjct  1223  VSIVSQFMSTPTIKHWAALEQILCYLKGAPGLGIVYRNNEHTRIECFA  1270



>emb|CAN80547.1| hypothetical protein VITISV_010898 [Vitis vinifera]
Length=1181

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYAD  114
             VSVVSQF+ SP  +HW+  +RI+RY+KS PG+ VLY +
Sbjct  1005  VSVVSQFLQSPCDSHWDVVIRILRYIKSTPGQGVLYEN  1042



>ref|XP_010095640.1| Serine/threonine-protein kinase TOR [Morus notabilis]
 gb|EXB61547.1| Serine/threonine-protein kinase TOR [Morus notabilis]
Length=1513

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            V++VSQFM SP   H +A  RI+RYLKS PGK  L+  +G   +EA++
Sbjct  52   VNMVSQFMHSPREEHLQAVYRILRYLKSTPGKGRLFEKHGQKTIEAYT  99



>ref|XP_010107194.1| Phosphoglucan, water dikinase [Morus notabilis]
 gb|EXC14218.1| Phosphoglucan, water dikinase [Morus notabilis]
Length=688

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +SVVSQFM++PT    EA  RI RYLK  PG+ +LY    +  VE FS
Sbjct  42   ISVVSQFMNNPTEERMEAVNRIFRYLKMTPGRGLLYKKNDNRDVEVFS  89



>emb|CAN65603.1| hypothetical protein VITISV_021511 [Vitis vinifera]
Length=491

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+VSQFM SP   H+EA  RI+RYLKS PGK + +       +EA++
Sbjct  290  VSIVSQFMHSPYEVHFEAVYRILRYLKSTPGKGLFFKKSEQKTIEAYT  337



>ref|XP_007019411.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY16636.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=1118

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQ+M SP+  H+EA  RI+RYLKS PGK + +       VEAF+
Sbjct  917  VSVVSQYMHSPSEEHFEAVNRILRYLKSTPGKGLFFKKNELRSVEAFT  964



>emb|CAN76494.1| hypothetical protein VITISV_024984 [Vitis vinifera]
Length=988

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+VSQFM +P   H+EA  RI+RYLK  PG+ +L+   GH  +E ++
Sbjct  799  VSMVSQFMHAPGPEHFEAIYRILRYLKGTPGRGLLFKSRGHLQIETYT  846



>emb|CAN77322.1| hypothetical protein VITISV_002172 [Vitis vinifera]
Length=776

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGH  123
            VSVVSQFM  P+  H +A +RI+RYLKS+PGK ++++  GH
Sbjct  590  VSVVSQFMHRPSEDHXDAVMRILRYLKSSPGKGLMFSKNGH  630



>emb|CAN65716.1| hypothetical protein VITISV_015039 [Vitis vinifera]
Length=829

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM  P+  H  A ++I+RYLKS+PGK ++++   H  VE ++
Sbjct  628  VSVVSQFMHCPSEDHMSAVMQILRYLKSSPGKGLMFSKNDHLRVEGYT  675



>emb|CAN60456.1| hypothetical protein VITISV_019554 [Vitis vinifera]
Length=1552

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+VSQFM +P   H+EA  RI+RYLK  PG+ +L+   GH  +E ++
Sbjct  779  VSMVSQFMHAPGPEHFEAVYRILRYLKGTPGRGLLFKSRGHLQIETYT  826



>ref|XP_007045697.1| Uncharacterized protein TCM_011393 [Theobroma cacao]
 gb|EOY01529.1| Uncharacterized protein TCM_011393 [Theobroma cacao]
Length=827

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVV+QFM +PT  +W A  +I+ YLK  PG  + Y ++GHT +E FS
Sbjct  656  VSVVNQFMFAPTINYWAALEQILCYLKGVPGCGLFYGNHGHTNIECFS  703



>emb|CAN66375.1| hypothetical protein VITISV_037549 [Vitis vinifera]
Length=1347

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYA-DYGHTGVEAFS  144
            +SVVSQ+M +P + H  A +RI+RYLK+APGK +L+A +  H  +E ++
Sbjct  830  LSVVSQYMHNPGKQHMNAVMRILRYLKNAPGKGILFAKNVDHQSIEVYT  878



>emb|CAN77272.1| hypothetical protein VITISV_018551 [Vitis vinifera]
Length=405

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +SVVSQFM++PT+ H EA  RI+RYLK   GK +LY       VE FS
Sbjct  253  ISVVSQFMNNPTKEHMEAVNRILRYLKMTSGKGLLYKKNDTRDVEIFS  300



>emb|CAN82507.1| hypothetical protein VITISV_039314 [Vitis vinifera]
Length=393

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM++PT  H  A +RI+RYLK  PGK + +    +  +E FS
Sbjct  255  VSVVSQFMNNPTEKHMTAMIRILRYLKMTPGKGLFFQRTTNKEIEIFS  302



>emb|CAN79872.1| hypothetical protein VITISV_017186 [Vitis vinifera]
Length=908

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+VSQFM SP   H EA  RI+RYLKS PGK + +       +EA++
Sbjct  707  VSIVSQFMHSPYEVHLEAVYRILRYLKSTPGKGLFFKKSKQKTIEAYT  754



>emb|CAN80340.1| hypothetical protein VITISV_015365 [Vitis vinifera]
Length=683

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+VSQFM  P+  H EA +RI+RYLKS+ GK ++++   H  V+ ++
Sbjct  505  VSIVSQFMHCPSEEHMEAVIRILRYLKSSLGKGLMFSKNDHVRVDGYT  552



>emb|CAN64822.1| hypothetical protein VITISV_025364 [Vitis vinifera]
Length=756

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYA-DYGHTGVEAFS  144
            +SVVSQ+M +P   H  A +RI+RYLK+APGK +L+A +  H  +E ++
Sbjct  573  LSVVSQYMHNPGEQHMNAVMRILRYLKNAPGKGILFAKNVNHQSIEVYT  621



>ref|XP_004162513.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Cucumis sativus]
Length=209

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM +P   H +A  RI+RYLKS PGK +++       +EA++
Sbjct  96   VSVVSQFMQTPNEEHMKAVNRILRYLKSTPGKGLMFRKTDRKTIEAYT  143



>ref|XP_009353805.1| PREDICTED: uncharacterized protein LOC103945027 [Pyrus x bretschneideri]
Length=700

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +SVVSQ+M +P   H  A +RI+RYLK +PGK +L+    H GV+ ++
Sbjct  595  LSVVSQYMHNPGEQHMNAVIRILRYLKGSPGKGILFKRNNHLGVKGYT  642



>emb|CAN76196.1| hypothetical protein VITISV_041073 [Vitis vinifera]
Length=1505

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VS+VSQFM SP   H EA  RI+RYLKS PGK + +       +EA++
Sbjct  1304  VSIVSQFMHSPYEVHLEAVYRILRYLKSTPGKGLFFKKSEQKTIEAYT  1351



>ref|XP_006574281.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=141

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            V  +SQ+M +PT TH +AA RI+RYLK +PG  + +A  G   + AFS
Sbjct  44   VQQLSQYMLAPTTTHLQAAFRILRYLKGSPGSGLFFAANGTPQLRAFS  91



>ref|XP_010038876.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104427482 
[Eucalyptus grandis]
Length=1868

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  13    SQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             S+FM SP + HW+A  RI+RYLKS+PGK ++Y   G + +  +S
Sbjct  1419  SKFMESPKKAHWDAVCRILRYLKSSPGKGLIYKSNGSSTLVGYS  1462



>emb|CAN72188.1| hypothetical protein VITISV_020673 [Vitis vinifera]
Length=988

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYA-DYGHTGVEAF  141
            +SVVSQ+M +P   H  A +RI+RYLK+APGK +L+A +  H  +E +
Sbjct  786  LSVVSQYMHNPEEQHMNAVMRILRYLKNAPGKGILFAKNVNHQSIEVY  833



>emb|CAN62654.1| hypothetical protein VITISV_033270 [Vitis vinifera]
Length=963

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +S+VSQFM +P   H+EA  RI+RYLK  PG+ +L+   GH  +E ++
Sbjct  764  MSMVSQFMHAPGPEHFEAVYRILRYLKETPGRGLLFKSRGHLQIETYT  811



>emb|CAN70115.1| hypothetical protein VITISV_020105 [Vitis vinifera]
Length=642

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM++PT+ H  A +RI+RYLK  PGK + +       +E FS
Sbjct  441  VSVVSQFMNNPTKKHMTAVIRILRYLKMTPGKGLFFQRTTKKEIEIFS  488



>ref|XP_010451381.1| PREDICTED: uncharacterized protein LOC104733506 [Camelina sativa]
Length=1354

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYA  111
             V ++SQFM  PT+ HWEAA+R+VRYL  +PG+ +L +
Sbjct  1153  VHILSQFMQRPTQAHWEAALRVVRYLNGSPGQGILLS  1189



>emb|CAN69825.1| hypothetical protein VITISV_028626 [Vitis vinifera]
Length=974

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGH  123
            VS+VSQFM +P+  H +A +RI+RYLK +PGK +L++  GH
Sbjct  627  VSIVSQFMHNPSEDHMDAVIRILRYLKFSPGKGLLFSKNGH  667



>emb|CAN82268.1| hypothetical protein VITISV_009286 [Vitis vinifera]
Length=961

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+VSQFM +P   H+E   RI+RYLK  PG+ +L+   GH  +E ++
Sbjct  760  VSMVSQFMHAPGPEHFEVVYRILRYLKGTPGRGLLFKSRGHLQIETYT  807



>emb|CAN64090.1| hypothetical protein VITISV_002951 [Vitis vinifera]
Length=1336

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYA-DYGHTGVEAFS  144
             +SVVSQ+M +P   H  A +RI+RYLK+APGK +L+A +  H  +E ++
Sbjct  1123  LSVVSQYMHNPGEQHMNAVMRILRYLKNAPGKGILFAKNVDHQSIEVYT  1171



>ref|XP_010651924.1| PREDICTED: uncharacterized protein LOC104879740 [Vitis vinifera]
Length=1002

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            V+VVSQFM  P+  H  A ++I+RYLKS+PGK ++++   H  VE ++
Sbjct  899  VNVVSQFMHCPSEDHMSAVMQILRYLKSSPGKGLMFSKNDHLRVEEYT  946



>emb|CAN61004.1| hypothetical protein VITISV_015023 [Vitis vinifera]
Length=1010

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM++PT  H  A +RI+RYLK  PGK + +    +  +E FS
Sbjct  809  VSVVSQFMNNPTEKHMTAVIRILRYLKMTPGKGLFFQRTTNKEIEIFS  856



>emb|CAN65966.1| hypothetical protein VITISV_005935 [Vitis vinifera]
Length=1154

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
             VS+VSQFM  P++ H  A VRI+RYLKS+PG+ +++    H  ++ +
Sbjct  998   VSLVSQFMHCPSKDHMSAVVRILRYLKSSPGRGLMFTKSQHLHIDGY  1044



>emb|CAN63637.1| hypothetical protein VITISV_038689 [Vitis vinifera]
Length=601

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ S    HW+  +RI+RY+K   G+ +LY D GHT +  ++
Sbjct  460  VSVVSQFLQSLCDNHWDVVIRILRYIKGTLGQGILYEDRGHTQIVGYT  507



>ref|XP_006580800.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=284

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            V  +SQ+MS+PT  H +AA RI+RYLK  PG  + YA  G   + AFS
Sbjct  108  VQQLSQYMSTPTNIHLQAAFRILRYLKGTPGSGLFYAATGTPQLRAFS  155



>emb|CAN82483.1| hypothetical protein VITISV_006799 [Vitis vinifera]
Length=1180

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQFM++PT  H  A +RI+RYLK  PGK + +       +E FS
Sbjct  979   VSVVSQFMNNPTEKHMTAVIRILRYLKMTPGKGLFFQRTTKKEIEIFS  1026



>emb|CAN81362.1| hypothetical protein VITISV_013815 [Vitis vinifera]
Length=1535

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAV--RIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            V VVSQF+ SP  +HW+A +     RY+KS PG+ VLY + GHT V  ++
Sbjct  318  VXVVSQFLQSPCDSHWDAVIPGNFFRYIKSTPGQGVLYENRGHTQVVGYT  367



>emb|CAN73624.1| hypothetical protein VITISV_042460 [Vitis vinifera]
Length=1287

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQFM++PT  H  A +RI+RYLK  PGK + +       +E FS
Sbjct  1086  VSVVSQFMNNPTEKHMTAVIRILRYLKMTPGKGLFFQRTTKKEIEIFS  1133



>emb|CDY01802.1| BnaC06g28420D [Brassica napus]
Length=162

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            +++++QFM +P + HWEAAVR+V YLK  PG+ +L +      V A+
Sbjct  72   INILAQFMQAPRQAHWEAAVRVVLYLKGCPGQGILLSSTSDLRVTAY  118



>emb|CAH67874.1| OSIGBa0153E02-OSIGBa0093I20.3 [Oryza sativa Indica Group]
Length=806

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            VSVVS++M  P   H +A  RI+RYLK +PGK + +   GH GVE +
Sbjct  605  VSVVSRYMHDPRSGHMDAVYRILRYLKGSPGKGLWFKKNGHLGVEGY  651



>emb|CAN80183.1| hypothetical protein VITISV_015370 [Vitis vinifera]
Length=538

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYA-DYGHTGVEAFS  144
            +SVVSQ+M +P   H  A +RI+RYLK+APGK +L+A +  H  +E ++
Sbjct  336  LSVVSQYMHNPGEQHMNAVMRILRYLKNAPGKGILFAKNVNHQSIEVYT  384



>emb|CAN79194.1| hypothetical protein VITISV_000236 [Vitis vinifera]
Length=1210

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQF+ S    HW+  +RI+RY+K   G+ +LY D GHT +  ++
Sbjct  1046  VSVVSQFLQSRCDNHWDVVIRILRYIKGTLGQGMLYEDRGHTQIVGYT  1093



>gb|KHN06596.1| Copia protein, partial [Glycine soja]
Length=162

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +  +SQ+M++PT TH +AA R++RY+K +PG  + +A  G   ++AFS
Sbjct  1    IQQLSQYMANPTSTHSQAAFRVLRYIKGSPGSSIFFAAQGRLTLKAFS  48



>gb|KHN09542.1| Copia protein, partial [Glycine soja]
Length=151

 Score = 49.3 bits (116),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  10   VSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +SQ+MS+PT TH +A  R++RYLK +PG  + +A +G   + AFS
Sbjct  2    LSQYMSTPTTTHHQAGFRVLRYLKGSPGMGLFFAAHGTPQLCAFS  46



>ref|XP_004297918.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Fragaria vesca subsp. vesca]
Length=204

 Score = 50.1 bits (118),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQ+M +P+  H  A +RI+RYLKS PGK +++  +G      ++
Sbjct  113  VSVVSQYMHNPSEDHMNAVMRILRYLKSTPGKGLVFRKHGQLRTSGYT  160



>emb|CAN72277.1| hypothetical protein VITISV_043408 [Vitis vinifera]
Length=388

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS VSQFM SPT  H EA  RI+RYLK  PGK + +    +  +E +S
Sbjct  187  VSAVSQFMHSPTEEHMEAVYRILRYLKMTPGKGLFFRKTENRDIEVYS  234



>ref|XP_008374393.1| PREDICTED: uncharacterized protein LOC103437682 [Malus domestica]
Length=331

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +SVVSQ+M  P   H  A +RI+RYLK +PGK +L+    H  VE ++
Sbjct  52   LSVVSQYMHDPGEHHMNAVMRILRYLKGSPGKGILFKKNNHXRVEGYT  99



>emb|CAN76400.1| hypothetical protein VITISV_001550 [Vitis vinifera]
Length=626

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSV+SQFM SP  +H + A R+++YLK  PGK +L+   G   +EA++
Sbjct  459  VSVISQFMHSPKESHLQVAYRVLQYLKGTPGKGILFKRNGGLVLEAYT  506



>emb|CAE05707.2| OSJNBb0065J09.3 [Oryza sativa Japonica Group]
Length=1015

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            VSVVS++M  P   H +A  RI+RYLK +PGK + +   GH GVE +
Sbjct  796  VSVVSRYMHDPRSGHMDAVYRILRYLKGSPGKGLWFKKNGHLGVEGY  842



>emb|CAN75033.1| hypothetical protein VITISV_022185 [Vitis vinifera]
Length=792

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+VSQFM  P+  H +A ++I+ YLKS+PGK ++ +   H  +E ++
Sbjct  591  VSIVSQFMYCPSEDHMDAVIQILHYLKSSPGKGLMLSKNNHLNIEGYT  638



>emb|CAN65108.1| hypothetical protein VITISV_036622 [Vitis vinifera]
Length=607

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM++PT  H  A +RI+RYLK  PGK + +       +E FS
Sbjct  406  VSVVSQFMNNPTEKHMTAVIRILRYLKMTPGKGLFFQRTTKKEIEIFS  453



>gb|KHN44882.1| Putative mitochondrial protein, partial [Glycine soja]
Length=283

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            V VVSQFM +P   HW   +RI+RY+K A G+ +LY D G T +  +
Sbjct  125  VGVVSQFMQNPHLDHWNVVMRILRYVKKATGQGLLYEDKGSTQLSGY  171



>emb|CAN76437.1| hypothetical protein VITISV_013966 [Vitis vinifera]
Length=243

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS VSQFM SPT  H EA  RI+RYLK  PGK + +    +   E +S
Sbjct  42   VSAVSQFMHSPTEEHMEAVYRILRYLKMTPGKGLFFRKTENRDTEVYS  89



>gb|KHN23535.1| Copia protein, partial [Glycine soja]
Length=220

 Score = 50.1 bits (118),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            V  +SQFM  P + HW+AA+R++RY+K  PG+ +L++      ++AF
Sbjct  20   VQTLSQFMHEPRKPHWDAALRVLRYIKGTPGQGLLFSSANDLTLKAF  66



>emb|CAN80088.1| hypothetical protein VITISV_021656 [Vitis vinifera]
Length=1099

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQF+ SP   HW+  + I+ Y+K   G+ +LY D GHT +  ++
Sbjct  923  VSVVSQFLQSPCDNHWDXVIXILXYIKGTXGQGMLYEDRGHTQIVGYT  970



>gb|AAG09097.1|AC009323_8 Putative retroelement polyprotein [Arabidopsis thaliana]
Length=1486

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVL  105
             + ++SQFM +P   HWEAA+R+VRYLKS+PG+ +L
Sbjct  1285  IHILSQFMHNPKPAHWEAALRVVRYLKSSPGQGIL  1319



>emb|CAN62623.1| hypothetical protein VITISV_001656 [Vitis vinifera]
Length=1394

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQFM++PT  H  A +RI+RYLK  PGK + +       +E FS
Sbjct  1202  VSVVSQFMNNPTEKHMTAVIRILRYLKMTPGKGLFFQRTTKKEIEIFS  1249



>emb|CAN75666.1| hypothetical protein VITISV_016771 [Vitis vinifera]
Length=568

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM +P++ H    +RI+ YLKS+PGK ++++   H  +E ++
Sbjct  386  VSVVSQFMHNPSKDHMGVVIRILWYLKSSPGKGLMFSKNAHLNIEWYT  433



>emb|CAN60008.1| hypothetical protein VITISV_024743 [Vitis vinifera]
Length=1102

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS VSQFM SPT  H EA  RI+RYLK APGK + +    +   E +S
Sbjct  929  VSAVSQFMHSPTEEHMEAVYRILRYLKMAPGKGLFFRKTENRDTEVYS  976



>emb|CAN71586.1| hypothetical protein VITISV_009568 [Vitis vinifera]
Length=1303

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYA-DYGHTGVEAFS  144
             +SVVSQ+M +P   H  A +R++RYLK+APGK +L+A +  H  +E ++
Sbjct  1114  LSVVSQYMHNPGEQHMNAVMRVLRYLKNAPGKGILFAKNVDHQSIEVYT  1162



>emb|CAN67972.1| hypothetical protein VITISV_033301 [Vitis vinifera]
Length=253

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS VSQFM SPT  H EA  RI+RYLK  PGK + +    +   E +S
Sbjct  52   VSAVSQFMHSPTEEHMEAVYRILRYLKMTPGKGLFFRKTENRDTEVYS  99



>emb|CAN80157.1| hypothetical protein VITISV_028148 [Vitis vinifera]
Length=270

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM  P+  H  A ++I+RYLKS PGK ++++   H  V+ ++
Sbjct  90   VSVVSQFMHYPSEDHMSAVMQILRYLKSFPGKGLMFSKNDHLRVKGYT  137



>emb|CAN64259.1| hypothetical protein VITISV_038891 [Vitis vinifera]
Length=80

 Score = 48.5 bits (114),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS+VSQ+M  P++ H +   RI+RYLK+  G+W+        GVEA++
Sbjct  30   VSLVSQYMRDPSQKHLDVVHRILRYLKTTLGRWLFLGKNEKRGVEAYA  77



>emb|CAN60342.1| hypothetical protein VITISV_031321 [Vitis vinifera]
Length=237

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS VSQFM SPT  H EA  RI+RYLK  PGK + +    +   E +S
Sbjct  36   VSAVSQFMHSPTEEHMEAVYRILRYLKMTPGKGLFFRKTENRDTEVYS  83



>emb|CAN68175.1| hypothetical protein VITISV_010332 [Vitis vinifera]
Length=660

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYA-DYGHTGVEAFS  144
            +SVVSQ+M +P   H  A +RI+RYLK+APGK +L+A +  H  +E ++
Sbjct  471  LSVVSQYMHNPGEQHINAVMRILRYLKNAPGKGILFAKNVNHQNIEVYT  519



>emb|CAN79829.1| hypothetical protein VITISV_025446 [Vitis vinifera]
Length=527

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYA-DYGHTGVEAF  141
            +SVVSQ+M +P   H  A +RI+RYLK+APGK +L+A +  H  +E +
Sbjct  301  LSVVSQYMHNPREQHMNAVMRILRYLKNAPGKGILFAKNVNHQSIEVY  348



>emb|CAN72141.1| hypothetical protein VITISV_017108 [Vitis vinifera]
Length=1416

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VS+VSQFM  P   H+E   RI+RYLK  PG+ +L+   GH  +E ++
Sbjct  1215  VSMVSQFMHVPRPEHFEVVYRILRYLKGTPGRGLLFKSRGHLQIETYT  1262



>emb|CAN79573.1| hypothetical protein VITISV_017340 [Vitis vinifera]
Length=279

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS VSQFM SPT  H EA  RI+RYLK  PGK + +    +   E +S
Sbjct  78   VSAVSQFMHSPTEEHMEAVYRILRYLKMTPGKGLFFRKTENRDTEVYS  125



>emb|CAN74251.1| hypothetical protein VITISV_019090 [Vitis vinifera]
Length=406

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSV+SQFM SP   H+E   +I+RYLKS PG+ +L+       VE F+
Sbjct  291  VSVLSQFMHSPYEEHFEVVYQILRYLKSTPGRGLLFKKGNQRNVEVFT  338



>ref|XP_004292127.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Fragaria vesca subsp. vesca]
Length=193

 Score = 49.7 bits (117),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM  P   H +A  RI++YLK APGK +L+   G   V  ++
Sbjct  103  VSVVSQFMYCPNEEHIDAVYRILKYLKMAPGKGLLFEKKGELEVVGYT  150



>emb|CAN73392.1| hypothetical protein VITISV_022526 [Vitis vinifera]
Length=1020

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYA-DYGHTGVEAFS  144
            +SVVSQ+M +P   H  A +RI+RYLK+APGK +L+A +  H  +E ++
Sbjct  818  LSVVSQYMHNPREQHMNAVMRILRYLKNAPGKGILFAKNVNHQSIEVYT  866



>emb|CBL94155.1| putative polyprotein (retrotrasposon protein) [Malus domestica]
Length=338

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VSVVSQFM S +  H +A  RI+RYLK APG+  +++   H  VE ++
Sbjct  280  VSVVSQFMHSHSEAHMDAVTRILRYLKIAPGRDSVFSKNSHLNVEGYT  327



>emb|CAN78733.1| hypothetical protein VITISV_020436 [Vitis vinifera]
Length=592

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLY  108
            VSVVSQFM SPT+ H EA  RI+RYLK  PGK + +
Sbjct  391  VSVVSQFMHSPTKEHMEAVYRILRYLKMTPGKGLFF  426



>emb|CAN76179.1| hypothetical protein VITISV_022751 [Vitis vinifera]
Length=754

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            V++VSQFM +P   H+E   RI+RYLK  PG+ +L+   GH  +E ++
Sbjct  553  VNMVSQFMHTPGPEHFEVVYRILRYLKGTPGRGLLFKSRGHLQIETYT  600



>ref|XP_010113352.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
 gb|EXC35359.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
Length=3263

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
             VSVVSQFM SPT  H EA  R++RYLK  PGK + +    +   E +S
Sbjct  1286  VSVVSQFMHSPTEEHMEAVYRVLRYLKMTPGKGLFFIKTENRNTEVYS  1333



>emb|CAN73399.1| hypothetical protein VITISV_006541 [Vitis vinifera]
Length=834

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +SVVSQFM++PT  H  A +RI+RYLK  PGK + +       +E FS
Sbjct  633  ISVVSQFMNNPTEKHMTAVIRILRYLKMTPGKGLFFQRTTKKEIEIFS  680



>emb|CAN59824.1| hypothetical protein VITISV_001983 [Vitis vinifera]
Length=368

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +S+ SQFM SP   H +A +RI+RYLKS  GK  L++   H  VEA++
Sbjct  167  ISMFSQFMHSPLECHMDAVLRILRYLKSTLGKGXLFSKNNHFRVEAYT  214



>emb|CAN66857.1| hypothetical protein VITISV_000450 [Vitis vinifera]
Length=497

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAF  141
            VS+VSQFM  P+  H +  +RI+RYLKS+P K ++++   H  +E +
Sbjct  336  VSIVSQFMHCPSEDHMDTVIRILRYLKSSPXKGLMFSKNNHLNIEGY  382



>emb|CAN82468.1| hypothetical protein VITISV_039784 [Vitis vinifera]
Length=906

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYA-DYGHTGVEAFS  144
            +SVVSQ+M +P   H  A +RI+RYLK+APGK +L+  +  H  +E ++
Sbjct  704  LSVVSQYMHNPGEQHMNAVMRILRYLKNAPGKGILFTKNVDHQSIEVYT  752



>emb|CAN60930.1| hypothetical protein VITISV_012765 [Vitis vinifera]
Length=1201

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +1

Query  1     VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYA-DYGHTGVEAFS  144
             +SVVSQ+M +P   H  A +RI+RYLK+APGK +L+A +  H  +E ++
Sbjct  999   LSVVSQYMHNPGEQHMNAVMRILRYLKNAPGKGILFAKNVNHQSIEVYT  1047



>emb|CAN61409.1| hypothetical protein VITISV_035127 [Vitis vinifera]
Length=714

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            VS VSQFM SPT  H EA  RI+RYLK  PGK + +    +   E +S
Sbjct  123  VSAVSQFMHSPTEEHMEAVYRILRYLKMTPGKGLFFKKTENRDTEVYS  170



>emb|CAN70109.1| hypothetical protein VITISV_001696 [Vitis vinifera]
Length=920

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYA-DYGHTGVEAFS  144
            +SVVSQ+M +P   H  A +RI+RYLK+APGK +L+A +  H  +E ++
Sbjct  718  LSVVSQYMHNPGEQHMNAVMRILRYLKNAPGKGILFAKNVDHQSIEVYT  766



>emb|CAN79066.1| hypothetical protein VITISV_019693 [Vitis vinifera]
Length=797

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYA-DYGHTGVEAF  141
            +SVVSQ+M +P   H  A +RI+RYLK+APGK +L+A +  H  +E +
Sbjct  570  LSVVSQYMHNPGEQHMNAVMRILRYLKNAPGKGILFAKNVNHQSIEVY  617



>emb|CAN76176.1| hypothetical protein VITISV_022748 [Vitis vinifera]
Length=1025

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    VSVVSQFMSSPTRTHWEAAVRIVRYLKSAPGKWVLYADYGHTGVEAFS  144
            +SVVSQF+  P  +HW+A + I+RY+KS P + VLY + G+  V  ++
Sbjct  823  MSVVSQFLQLPCDSHWDAVIHILRYIKSTPSQGVLYENRGYIQVVGYT  870



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506149393984