BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2400_g1_i1 len=565 path=[1:0-423 425:424-564]

Length=565
                                                                      Score     E

ref|XP_009590776.1|  PREDICTED: uncharacterized protein LOC104087...    151   3e-42   
emb|CDP01422.1|  unnamed protein product                                139   7e-38   
ref|XP_009600626.1|  PREDICTED: uncharacterized protein LOC104096044    133   1e-35   
emb|CBI41084.3|  unnamed protein product                                133   3e-35   
ref|XP_003635513.1|  PREDICTED: uncharacterized protein LOC100261790    132   3e-35   
ref|XP_009786645.1|  PREDICTED: uncharacterized protein LOC104234727    130   2e-34   
gb|KHF97984.1|  hypothetical protein F383_15064                         130   2e-34   
ref|XP_004237417.1|  PREDICTED: uncharacterized protein LOC101267225    126   6e-33   
ref|XP_011097598.1|  PREDICTED: uncharacterized protein LOC105176481    125   8e-33   
ref|XP_007048013.1|  Thioesterase superfamily protein                   125   2e-32   
gb|KHF97368.1|  hypothetical protein F383_13795                         124   6e-32   
ref|XP_006428152.1|  hypothetical protein CICLE_v10026585mg             124   9e-32   
gb|KDO47041.1|  hypothetical protein CISIN_1g030226mg                   124   1e-31   
gb|AFK40825.1|  unknown                                                 120   1e-30   
ref|XP_007136224.1|  hypothetical protein PHAVU_009G028800g             118   7e-30   
ref|XP_003526592.1|  PREDICTED: uncharacterized protein LOC100803140    118   8e-30   
ref|XP_002306588.1|  senescence-associated family protein               117   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_004288223.1|  PREDICTED: uncharacterized protein LOC101303450    115   2e-28   
ref|XP_011030961.1|  PREDICTED: uncharacterized protein LOC105130...    115   2e-28   
ref|NP_001237297.1|  uncharacterized protein LOC100527013               114   2e-28   
gb|KHN09138.1|  hypothetical protein glysoja_025599                     114   3e-28   
ref|XP_004500606.1|  PREDICTED: uncharacterized protein LOC101511560    114   3e-28   
gb|KDP32696.1|  hypothetical protein JCGZ_11988                         112   8e-28   
ref|XP_009342374.1|  PREDICTED: uncharacterized protein LOC103934349    114   9e-28   
ref|XP_011006154.1|  PREDICTED: uncharacterized protein LOC105112230    112   1e-27   
ref|XP_010905906.1|  PREDICTED: uncharacterized protein LOC105032993    113   1e-27   
ref|XP_011030960.1|  PREDICTED: uncharacterized protein LOC105130...    112   3e-27   
ref|XP_002309988.1|  senescence-associated family protein               112   4e-27   Populus trichocarpa [western balsam poplar]
ref|XP_011008600.1|  PREDICTED: uncharacterized protein LOC105113929    112   5e-27   
ref|XP_008352590.1|  PREDICTED: uncharacterized protein LOC103416102    111   9e-27   
ref|XP_010261230.1|  PREDICTED: uncharacterized protein LOC104600098    109   3e-26   
ref|XP_007205966.1|  hypothetical protein PRUPE_ppa012051mg             109   4e-26   
ref|XP_002302279.2|  senescence-associated family protein               107   6e-26   Populus trichocarpa [western balsam poplar]
ref|XP_006826981.1|  hypothetical protein AMTR_s00010p00202670          107   8e-26   
ref|XP_008809319.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    108   1e-25   
ref|XP_006472642.1|  PREDICTED: uncharacterized protein LOC102618405    107   2e-25   
gb|KDO80903.1|  hypothetical protein CISIN_1g029576mg                   107   3e-25   
ref|XP_004299635.1|  PREDICTED: uncharacterized protein LOC101315051    105   3e-25   
ref|XP_006434029.1|  hypothetical protein CICLE_v10002627mg             107   3e-25   
ref|XP_009106449.1|  PREDICTED: uncharacterized protein LOC103832227    105   5e-25   
ref|XP_003638769.1|  hypothetical protein MTR_145s0001                  105   5e-25   
ref|XP_002306320.1|  senescence-associated family protein               106   5e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010521201.1|  PREDICTED: uncharacterized protein LOC104800162    106   6e-25   
ref|XP_011027684.1|  PREDICTED: uncharacterized protein LOC105127902    105   7e-25   
emb|CDX87485.1|  BnaA07g33880D                                          105   8e-25   
gb|KDP46872.1|  hypothetical protein JCGZ_24081                         105   9e-25   
emb|CDP01192.1|  unnamed protein product                                104   1e-24   
ref|XP_010060157.1|  PREDICTED: uncharacterized protein LOC104448072    104   1e-24   
ref|XP_010269192.1|  PREDICTED: uncharacterized protein LOC104605932    104   2e-24   
ref|XP_010529093.1|  PREDICTED: uncharacterized protein LOC104806075    103   2e-24   
gb|AFK38834.1|  unknown                                                 103   3e-24   
ref|XP_009590782.1|  PREDICTED: uncharacterized protein LOC104087...    104   3e-24   
ref|XP_008440627.1|  PREDICTED: uncharacterized protein LOC103484988    103   3e-24   
gb|EYU43555.1|  hypothetical protein MIMGU_mgv1a015819mg                102   4e-24   
ref|XP_010526654.1|  PREDICTED: uncharacterized protein LOC104804...    102   7e-24   
gb|EYU24010.1|  hypothetical protein MIMGU_mgv1a015307mg                102   8e-24   
ref|XP_009590789.1|  PREDICTED: uncharacterized protein LOC104087...    102   8e-24   
emb|CDX88407.1|  BnaC06g38510D                                          102   1e-23   
ref|XP_009596984.1|  PREDICTED: uncharacterized protein LOC104092991    102   1e-23   
ref|XP_007141143.1|  hypothetical protein PHAVU_008G171100g             101   1e-23   
ref|XP_009128272.1|  PREDICTED: uncharacterized protein LOC103853106    102   2e-23   
ref|XP_010025488.1|  PREDICTED: uncharacterized protein LOC104415811    101   3e-23   
ref|XP_007018848.1|  Uncharacterized protein TCM_034955                 101   3e-23   
ref|XP_010105883.1|  hypothetical protein L484_021540                   100   4e-23   
ref|XP_006390032.1|  hypothetical protein EUTSA_v10019245mg             100   4e-23   
ref|XP_002513883.1|  conserved hypothetical protein                     100   5e-23   Ricinus communis
ref|XP_011074154.1|  PREDICTED: uncharacterized protein LOC105158935    100   6e-23   
ref|XP_010472001.1|  PREDICTED: uncharacterized protein LOC104751697    100   7e-23   
ref|XP_010428907.1|  PREDICTED: uncharacterized protein LOC104713477    100   7e-23   
emb|CDX72671.1|  BnaC07g46930D                                        99.4    8e-23   
ref|XP_010416769.1|  PREDICTED: uncharacterized protein LOC104702585  99.8    1e-22   
emb|CDY14641.1|  BnaC02g24720D                                        99.8    1e-22   
ref|XP_004143480.1|  PREDICTED: uncharacterized protein LOC101212321  99.4    1e-22   
ref|XP_002285807.2|  PREDICTED: uncharacterized protein LOC100252409    100   1e-22   Vitis vinifera
ref|XP_006416227.1|  hypothetical protein EUTSA_v10008987mg           99.0    2e-22   
ref|XP_006305752.1|  hypothetical protein CARUB_v10010569mg           98.6    2e-22   
gb|KHG27100.1|  50s ribosomal l24e                                    99.0    2e-22   
ref|XP_008367211.1|  PREDICTED: uncharacterized protein LOC103430537  99.4    3e-22   
ref|XP_009390578.1|  PREDICTED: uncharacterized protein LOC103976940  99.4    3e-22   
ref|XP_006302931.1|  hypothetical protein CARUB_v10021070mg           98.6    3e-22   
gb|KDO80904.1|  hypothetical protein CISIN_1g029576mg                 99.4    3e-22   
ref|XP_004150522.1|  PREDICTED: uncharacterized protein LOC101206644  98.2    4e-22   
ref|NP_565167.1|  uncharacterized protein                             97.4    8e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010534566.1|  PREDICTED: uncharacterized protein LOC104810072  97.4    8e-22   
ref|NP_001239707.1|  uncharacterized protein LOC100796944             97.1    9e-22   
ref|XP_009803978.1|  PREDICTED: uncharacterized protein LOC104249283  97.1    9e-22   
ref|XP_009373178.1|  PREDICTED: uncharacterized protein LOC103962220  97.1    1e-21   
ref|XP_010498679.1|  PREDICTED: uncharacterized protein LOC104776336  96.7    1e-21   
ref|XP_002889171.1|  hypothetical protein ARALYDRAFT_476964           97.1    1e-21   
gb|EYU35236.1|  hypothetical protein MIMGU_mgv1a015843mg              96.3    1e-21   
gb|AAM65894.1|  unknown                                               96.7    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444103.1|  PREDICTED: uncharacterized protein LOC103487542  96.3    2e-21   
ref|XP_009803841.1|  PREDICTED: uncharacterized protein LOC104249164  96.7    2e-21   
ref|XP_004239993.1|  PREDICTED: uncharacterized protein LOC101248202  96.3    2e-21   
ref|XP_008453781.1|  PREDICTED: uncharacterized protein LOC103494409  95.9    2e-21   
gb|KFK44308.1|  hypothetical protein AALP_AA1G241200                  95.9    2e-21   
ref|NP_001238472.1|  uncharacterized protein LOC100527853             95.9    2e-21   
ref|NP_564160.1|  uncharacterized protein                             95.9    3e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CBI19129.3|  unnamed protein product                              95.1    3e-21   
ref|XP_004149159.1|  PREDICTED: uncharacterized protein LOC101212822  95.5    3e-21   
ref|XP_004163494.1|  PREDICTED: uncharacterized protein LOC101227972  95.1    4e-21   
ref|XP_010939620.1|  PREDICTED: uncharacterized protein LOC105058394  95.9    4e-21   
gb|AEK94314.1|  hypothetical protein                                  95.5    5e-21   
emb|CDX68033.1|  BnaA07g20730D                                        94.7    6e-21   
ref|XP_010477472.1|  PREDICTED: uncharacterized protein LOC104756564  94.7    7e-21   
ref|XP_009145371.1|  PREDICTED: uncharacterized protein LOC103869073  94.7    7e-21   
ref|XP_004237884.1|  PREDICTED: uncharacterized protein LOC101246821  94.7    8e-21   
ref|XP_009617931.1|  PREDICTED: uncharacterized protein LOC104110189  94.7    1e-20   
gb|KHN41499.1|  hypothetical protein glysoja_039200                   94.0    2e-20   
ref|XP_002866884.1|  predicted protein                                93.2    2e-20   
ref|XP_010090557.1|  hypothetical protein L484_016607                 94.0    2e-20   
ref|XP_009103259.1|  PREDICTED: uncharacterized protein LOC103829349  93.6    2e-20   
ref|XP_008234007.1|  PREDICTED: uncharacterized protein LOC103332988  93.6    2e-20   
emb|CDY01294.1|  BnaA07g10670D                                        93.6    2e-20   
ref|XP_010446541.1|  PREDICTED: uncharacterized protein LOC104729...  92.4    3e-20   
emb|CDY00425.1|  BnaC07g14010D                                        93.2    3e-20   
ref|XP_009104591.1|  PREDICTED: uncharacterized protein LOC103830542  93.2    3e-20   
ref|XP_006360277.1|  PREDICTED: uncharacterized protein LOC102586001  92.4    4e-20   
ref|XP_010459956.1|  PREDICTED: uncharacterized protein LOC104740916  92.4    4e-20   
ref|XP_010431960.1|  PREDICTED: uncharacterized protein LOC104716265  92.0    5e-20   
ref|XP_007223641.1|  hypothetical protein PRUPE_ppa012701mg           92.8    5e-20   
ref|XP_009369650.1|  PREDICTED: uncharacterized protein LOC103959039  92.8    5e-20   
ref|XP_004502441.1|  PREDICTED: uncharacterized protein LOC101499079  92.0    7e-20   
ref|XP_009377991.1|  PREDICTED: uncharacterized protein LOC103966546  92.0    8e-20   
ref|XP_002890496.1|  hypothetical protein ARALYDRAFT_472449           91.3    1e-19   
ref|XP_010437102.1|  PREDICTED: uncharacterized protein LOC104720905  90.9    1e-19   
ref|NP_680776.2|  uncharacterized protein                             90.5    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002534088.1|  conserved hypothetical protein                   91.7    1e-19   Ricinus communis
gb|AAY17404.1|  At4g39795                                             90.5    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380843.1|  PREDICTED: uncharacterized protein LOC103969120  91.3    2e-19   
ref|XP_009403062.1|  PREDICTED: uncharacterized protein LOC103986703  90.1    4e-19   
ref|XP_006284748.1|  hypothetical protein CARUB_v10006014mg           88.2    1e-18   
ref|XP_004162308.1|  PREDICTED: uncharacterized protein LOC101231026  88.6    1e-18   
emb|CBI33031.3|  unnamed protein product                              86.7    1e-18   
ref|XP_004252540.1|  PREDICTED: uncharacterized protein LOC101250672  87.4    3e-18   
ref|XP_009417425.1|  PREDICTED: uncharacterized protein LOC103997824  87.8    4e-18   
ref|XP_003601999.1|  hypothetical protein MTR_3g087700                88.2    5e-18   
ref|XP_006366521.1|  PREDICTED: uncharacterized protein LOC102587376  86.7    6e-18   
ref|XP_009130485.1|  PREDICTED: uncharacterized protein LOC103855271  85.5    8e-18   
ref|XP_006354015.1|  PREDICTED: uncharacterized protein LOC102578669  86.7    9e-18   
ref|XP_006411776.1|  hypothetical protein EUTSA_v10027166mg           85.9    1e-17   
ref|XP_010444470.1|  PREDICTED: uncharacterized protein LOC104727149  85.1    1e-17   
ref|XP_009409968.1|  PREDICTED: uncharacterized protein LOC103992102  86.3    1e-17   
ref|XP_009394961.1|  PREDICTED: uncharacterized protein LOC103980321  85.9    1e-17   
gb|KHG00164.1|  50S ribosomal L24e                                    85.1    2e-17   
gb|AFK49113.1|  unknown                                               85.9    3e-17   
emb|CDY33991.1|  BnaC02g43460D                                        84.0    3e-17   
ref|XP_010462432.1|  PREDICTED: uncharacterized protein LOC104743011  83.6    4e-17   
ref|XP_009127647.1|  PREDICTED: uncharacterized protein LOC103852462  83.6    7e-17   
emb|CDY31291.1|  BnaA02g34500D                                        82.8    9e-17   
emb|CDY38242.1|  BnaC05g17590D                                        83.6    1e-16   
emb|CDX95609.1|  BnaC03g24900D                                        81.6    1e-16   
ref|XP_010527378.1|  PREDICTED: uncharacterized protein LOC104804734  82.4    1e-16   
gb|ABK22160.1|  unknown                                               82.4    2e-16   Picea sitchensis
ref|XP_006394083.1|  hypothetical protein EUTSA_v10005159mg           81.3    3e-16   
ref|XP_006281347.1|  hypothetical protein CARUB_v10027399mg           81.3    3e-16   
gb|KFK30553.1|  hypothetical protein AALP_AA7G277000                  80.9    5e-16   
ref|XP_003572180.2|  PREDICTED: uncharacterized protein LOC100844787  81.6    7e-16   
ref|XP_002866648.1|  hypothetical protein ARALYDRAFT_496726           80.5    7e-16   
gb|AFO38381.1|  uncharacterized protein                               82.0    7e-16   
ref|XP_010484308.1|  PREDICTED: uncharacterized protein LOC104762671  80.1    9e-16   
ref|NP_201309.1|  uncharacterized protein                             79.3    1e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79243.1|  BnaC06g20600D                                        79.0    2e-15   
ref|XP_009133680.1|  PREDICTED: uncharacterized protein LOC103858138  77.0    6e-15   
ref|NP_001237494.1|  uncharacterized protein LOC100500658             79.0    8e-15   
ref|XP_003564065.1|  PREDICTED: uncharacterized protein LOC100839281  77.8    9e-15   
ref|XP_008460479.1|  PREDICTED: uncharacterized protein LOC103499283  77.8    1e-14   
gb|KDO47042.1|  hypothetical protein CISIN_1g030226mg                 77.8    1e-14   
ref|XP_004140318.1|  PREDICTED: uncharacterized protein LOC101217585  77.4    1e-14   
ref|XP_009401282.1|  PREDICTED: uncharacterized protein LOC103985344  76.6    2e-14   
gb|EEC83556.1|  hypothetical protein OsI_29199                        77.8    2e-14   Oryza sativa Indica Group [Indian rice]
gb|EAZ00205.1|  hypothetical protein OsI_22207                        76.6    2e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_010446542.1|  PREDICTED: uncharacterized protein LOC104729...  76.3    3e-14   
ref|NP_001061776.1|  Os08g0407600                                     77.8    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001241641.1|  uncharacterized protein LOC100775423             77.4    3e-14   
emb|CDY38416.1|  BnaC01g10250D                                        76.3    3e-14   
ref|NP_001142433.1|  uncharacterized protein LOC100274617             76.6    3e-14   Zea mays [maize]
ref|XP_007163635.1|  hypothetical protein PHAVU_001G250900g           77.8    3e-14   
ref|NP_001057184.1|  Os06g0223700                                     76.3    4e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009130866.1|  PREDICTED: uncharacterized protein LOC103855611  76.3    4e-14   
ref|NP_001140205.1|  hypothetical protein                             76.6    4e-14   Zea mays [maize]
gb|ADK38581.1|  hypothetical protein                                  75.9    5e-14   
ref|XP_002445473.1|  hypothetical protein SORBIDRAFT_07g020070        76.6    6e-14   Sorghum bicolor [broomcorn]
ref|XP_002868047.1|  hypothetical protein ARALYDRAFT_329762           75.9    6e-14   
ref|XP_010481379.1|  PREDICTED: uncharacterized protein LOC104760190  76.3    6e-14   
ref|XP_009413685.1|  PREDICTED: uncharacterized protein LOC103994943  75.9    7e-14   
gb|ABR17544.1|  unknown                                               75.1    7e-14   Picea sitchensis
ref|XP_009403338.1|  PREDICTED: uncharacterized protein LOC103986915  75.9    8e-14   
ref|XP_006414201.1|  hypothetical protein EUTSA_v10026417mg           75.9    9e-14   
ref|XP_004241979.1|  PREDICTED: uncharacterized protein LOC101246541  75.1    9e-14   
ref|XP_010274555.1|  PREDICTED: uncharacterized protein LOC104609853  75.1    1e-13   
ref|NP_001234971.1|  uncharacterized protein LOC100527873             75.1    1e-13   
ref|NP_001140351.1|  uncharacterized protein LOC100272399             75.5    1e-13   Zea mays [maize]
gb|ABD65149.1|  hypothetical protein 40.t00027                        75.1    2e-13   Brassica oleracea
ref|XP_004973402.1|  PREDICTED: uncharacterized protein LOC101755318  75.1    2e-13   
emb|CDX90460.1|  BnaA03g43210D                                        74.7    2e-13   
ref|XP_009136860.1|  PREDICTED: uncharacterized protein LOC103860927  74.7    2e-13   
emb|CDP09389.1|  unnamed protein product                              72.8    2e-13   
gb|ABK23770.1|  unknown                                               74.3    2e-13   Picea sitchensis
ref|XP_004953940.1|  PREDICTED: uncharacterized protein LOC101778044  74.3    2e-13   
ref|NP_001143475.1|  uncharacterized protein LOC100276146             73.9    3e-13   Zea mays [maize]
gb|ABK26039.1|  unknown                                               74.3    3e-13   Picea sitchensis
emb|CDY71221.1|  BnaUnng04250D                                        72.4    3e-13   
gb|EPS69545.1|  hypothetical protein M569_05223                       71.6    3e-13   
ref|XP_004956677.1|  PREDICTED: uncharacterized protein LOC101754400  74.3    3e-13   
gb|AFW85265.1|  hypothetical protein ZEAMMB73_571650                  73.9    3e-13   
ref|XP_009142277.1|  PREDICTED: uncharacterized protein LOC103866151  72.4    3e-13   
ref|XP_010055390.1|  PREDICTED: uncharacterized protein LOC104443595  73.6    4e-13   
ref|NP_001144738.1|  uncharacterized protein LOC100277785             73.9    4e-13   Zea mays [maize]
ref|XP_009150580.1|  PREDICTED: uncharacterized protein LOC103873928  72.4    4e-13   
gb|ABK23097.1|  unknown                                               72.8    5e-13   Picea sitchensis
ref|XP_006361165.1|  PREDICTED: uncharacterized protein LOC102600983  72.8    6e-13   
ref|NP_001048135.1|  Os02g0751300                                     72.8    7e-13   Oryza sativa Japonica Group [Japonica rice]
emb|CAB10547.1|  hypothetical protein                                 72.8    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001143024.1|  uncharacterized protein LOC100275491             73.2    8e-13   Zea mays [maize]
ref|XP_006354644.1|  PREDICTED: uncharacterized protein LOC102588165  71.2    1e-12   
gb|KGN60442.1|  hypothetical protein Csa_3G911280                     72.8    1e-12   
emb|CDY23451.1|  BnaC04g49790D                                        70.9    1e-12   
ref|XP_004508985.1|  PREDICTED: uncharacterized protein LOC101505923  72.0    1e-12   
ref|XP_003517388.1|  PREDICTED: uncharacterized protein LOC100797178  72.0    1e-12   
ref|XP_010677199.1|  PREDICTED: M-phase inducer phosphatase           72.8    1e-12   
ref|XP_004162419.1|  PREDICTED: uncharacterized LOC101216261          72.4    1e-12   
ref|XP_010494916.1|  PREDICTED: uncharacterized protein LOC104771979  72.4    2e-12   
ref|NP_567534.1|  uncharacterized protein                             72.0    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284649.1|  hypothetical protein CARUB_v10005906mg           72.0    2e-12   
gb|AAM65981.1|  unknown                                               72.0    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451414.1|  PREDICTED: uncharacterized protein LOC104733541  73.6    2e-12   
ref|XP_004229715.1|  PREDICTED: uncharacterized protein LOC101248137  70.5    2e-12   
dbj|BAJ86070.1|  predicted protein                                    71.2    2e-12   
gb|KHN01655.1|  hypothetical protein glysoja_012966                   72.0    2e-12   
gb|KFK31405.1|  hypothetical protein AALP_AA6G107800                  71.6    2e-12   
dbj|BAD25910.1|  unknown protein                                      72.0    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002444452.1|  hypothetical protein SORBIDRAFT_07g022140        72.0    2e-12   Sorghum bicolor [broomcorn]
gb|AFK39199.1|  unknown                                               71.6    2e-12   
ref|XP_009391158.1|  PREDICTED: uncharacterized protein LOC103977389  71.6    2e-12   
ref|XP_011032003.1|  PREDICTED: uncharacterized protein LOC105130963  71.6    2e-12   
gb|KFK23378.1|  hypothetical protein AALP_AAs60861U000400             71.6    2e-12   
ref|XP_010439966.1|  PREDICTED: uncharacterized protein LOC104723321  71.6    2e-12   
ref|XP_010236109.1|  PREDICTED: uncharacterized protein LOC100845407  71.2    2e-12   
gb|KFK28189.1|  hypothetical protein AALP_AA8G483700                  70.1    2e-12   
ref|NP_001183875.1|  hypothetical protein                             72.0    2e-12   
ref|XP_006296201.1|  hypothetical protein CARUB_v10025366mg           70.1    2e-12   
ref|XP_009592195.1|  PREDICTED: uncharacterized protein LOC104089085  71.6    2e-12   
ref|XP_008670148.1|  PREDICTED: uncharacterized protein LOC103647382  71.6    2e-12   
ref|XP_006661172.1|  PREDICTED: uncharacterized protein LOC102708743  70.1    2e-12   
ref|XP_009143055.1|  PREDICTED: uncharacterized protein LOC103866822  70.1    3e-12   
ref|XP_010434632.1|  PREDICTED: uncharacterized protein LOC104718567  71.2    3e-12   
ref|XP_006397648.1|  hypothetical protein EUTSA_v10001797mg           70.1    3e-12   
ref|XP_009592194.1|  PREDICTED: uncharacterized protein LOC104089084  71.2    3e-12   
ref|XP_010518071.1|  PREDICTED: uncharacterized protein LOC104793416  69.7    3e-12   
gb|ACU14599.1|  unknown                                               71.6    3e-12   Glycine max [soybeans]
ref|XP_002880129.1|  hypothetical protein ARALYDRAFT_483597           69.7    3e-12   
ref|NP_199517.1|  uncharacterized protein                             71.2    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001235594.1|  uncharacterized protein LOC100306220             70.1    4e-12   
ref|XP_010508268.1|  PREDICTED: uncharacterized protein LOC104784870  69.3    4e-12   
gb|AFW73468.1|  hypothetical protein ZEAMMB73_953450                  70.9    4e-12   
ref|NP_001235150.1|  uncharacterized protein LOC100499981             70.1    4e-12   
ref|NP_566023.1|  uncharacterized protein                             69.3    4e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDP13427.1|  unnamed protein product                              70.9    5e-12   
ref|XP_009590372.1|  PREDICTED: uncharacterized protein LOC104087567  69.3    5e-12   
ref|XP_006281192.1|  hypothetical protein CARUB_v10027227mg           70.5    6e-12   
gb|KHN19719.1|  hypothetical protein glysoja_046293                   69.3    6e-12   
ref|XP_009400220.1|  PREDICTED: uncharacterized protein LOC103984456  69.7    7e-12   
gb|KGN56685.1|  hypothetical protein Csa_3G128930                     70.1    7e-12   
emb|CDY48248.1|  BnaC04g05070D                                        68.9    7e-12   
gb|ACF85195.1|  unknown                                               70.1    7e-12   Zea mays [maize]
ref|XP_010413590.1|  PREDICTED: uncharacterized protein LOC104699888  68.9    7e-12   
ref|XP_006398400.1|  hypothetical protein EUTSA_v10001043mg           70.1    8e-12   
emb|CDY40586.1|  BnaC02g33060D                                        70.1    8e-12   
emb|CDY12406.1|  BnaC08g08950D                                        70.1    8e-12   
ref|XP_010053559.1|  PREDICTED: uncharacterized protein LOC104441977  69.7    1e-11   
ref|XP_002438085.1|  hypothetical protein SORBIDRAFT_10g007830        70.5    1e-11   Sorghum bicolor [broomcorn]
ref|XP_008646282.1|  PREDICTED: uncharacterized protein LOC103627751  70.1    1e-11   
ref|XP_009801353.1|  PREDICTED: uncharacterized protein LOC104247102  69.7    1e-11   
ref|XP_010524451.1|  PREDICTED: uncharacterized protein LOC104802506  67.8    1e-11   
ref|XP_006361166.1|  PREDICTED: uncharacterized protein LOC102601330  68.9    1e-11   
ref|XP_002865146.1|  hypothetical protein ARALYDRAFT_494274           69.3    1e-11   
ref|XP_004516993.1|  PREDICTED: uncharacterized protein LOC101511328  68.2    1e-11   
ref|XP_009116700.1|  PREDICTED: uncharacterized protein LOC103841874  67.4    2e-11   
ref|XP_006385590.1|  senescence-associated family protein             68.9    2e-11   
ref|XP_009778943.1|  PREDICTED: uncharacterized protein LOC104228208  67.8    2e-11   
gb|EMT21963.1|  hypothetical protein F775_32123                       68.9    2e-11   
emb|CDX71827.1|  BnaC08g30470D                                        67.4    2e-11   
gb|KHN21045.1|  hypothetical protein glysoja_034167                   68.9    2e-11   
ref|XP_004245848.1|  PREDICTED: myb-like protein D                    68.9    2e-11   
ref|XP_002460131.1|  hypothetical protein SORBIDRAFT_02g023170        69.3    2e-11   
ref|XP_009101451.1|  PREDICTED: uncharacterized protein LOC103827672  68.6    3e-11   
gb|KFK37271.1|  hypothetical protein AALP_AA4G235600                  67.0    3e-11   
gb|KCW77877.1|  hypothetical protein EUGRSUZ_D02144                   68.9    3e-11   
ref|XP_008246259.1|  PREDICTED: uncharacterized protein LOC103344451  67.8    3e-11   
gb|AAF86553.1|AC069252_12  F2E2.23                                    67.8    3e-11   
ref|XP_009393543.1|  PREDICTED: uncharacterized protein LOC103979204  68.2    4e-11   
ref|XP_007155736.1|  hypothetical protein PHAVU_003G227300g           67.8    4e-11   
gb|KHG21598.1|  Altered inheritance of mitochondria 39, mitochond...  68.2    4e-11   
gb|AFK41036.1|  unknown                                               67.0    4e-11   
dbj|BAJ86652.1|  predicted protein                                    67.8    4e-11   
gb|EYU28620.1|  hypothetical protein MIMGU_mgv1a017149mg              66.6    4e-11   
ref|XP_008788650.1|  PREDICTED: uncharacterized protein LOC103706359  67.8    5e-11   
gb|AFK46500.1|  unknown                                               67.8    5e-11   
ref|XP_007209692.1|  hypothetical protein PRUPE_ppa012410mg           67.8    5e-11   
ref|XP_004956917.1|  PREDICTED: uncharacterized protein LOC101753052  67.8    5e-11   
ref|XP_008373624.1|  PREDICTED: uncharacterized protein LOC103436948  67.8    5e-11   
ref|XP_004511754.1|  PREDICTED: uncharacterized protein LOC101494744  67.4    5e-11   
gb|EMS62546.1|  hypothetical protein TRIUR3_32495                     66.2    6e-11   
ref|XP_009389272.1|  PREDICTED: uncharacterized protein LOC103975877  67.4    6e-11   
ref|XP_009397012.1|  PREDICTED: uncharacterized protein LOC103981959  66.6    6e-11   
ref|XP_002517517.1|  conserved hypothetical protein                   67.4    6e-11   
ref|XP_009800116.1|  PREDICTED: uncharacterized protein LOC104246078  67.4    7e-11   
ref|XP_007156610.1|  hypothetical protein PHAVU_002G003100g           67.0    7e-11   
ref|XP_007134381.1|  hypothetical protein PHAVU_010G043000g           65.9    8e-11   
ref|XP_009617661.1|  PREDICTED: uncharacterized protein LOC104109961  67.4    9e-11   
emb|CDX77736.1|  BnaC07g19900D                                        67.4    9e-11   
ref|NP_001158980.1|  uncharacterized protein LOC100303941             67.0    1e-10   
ref|XP_006385394.1|  senescence-associated family protein             66.6    1e-10   
ref|XP_003626766.1|  hypothetical protein MTR_8g008840                65.9    1e-10   
ref|XP_008438278.1|  PREDICTED: uncharacterized protein LOC103483439  65.5    1e-10   
ref|XP_010935033.1|  PREDICTED: uncharacterized protein LOC105055036  66.2    1e-10   
ref|XP_009381936.1|  PREDICTED: uncharacterized protein LOC103970035  65.9    1e-10   
ref|XP_009796645.1|  PREDICTED: uncharacterized protein LOC104243187  65.5    1e-10   
gb|KFK35225.1|  hypothetical protein AALP_AA5G256600                  65.1    1e-10   
ref|XP_009401481.1|  PREDICTED: uncharacterized protein LOC103985491  66.2    1e-10   
gb|AFK48841.1|  unknown                                               66.2    1e-10   
gb|EAZ09213.1|  hypothetical protein OsI_31488                        66.6    1e-10   
ref|XP_010056465.1|  PREDICTED: uncharacterized protein LOC104444493  65.5    1e-10   
ref|XP_006854021.1|  hypothetical protein AMTR_s00048p00032230        66.2    1e-10   
gb|KHG03818.1|  Sensor histidine kinase resE                          66.2    2e-10   
ref|XP_009385945.1|  PREDICTED: uncharacterized protein LOC103973...  65.5    2e-10   
ref|XP_006292117.1|  hypothetical protein CARUB_v10018313mg           64.7    2e-10   
gb|ADE77804.1|  unknown                                               65.9    2e-10   
ref|XP_007039622.1|  Uncharacterized protein TCM_015808               65.9    2e-10   
ref|XP_010056466.1|  PREDICTED: uncharacterized protein LOC104444494  65.1    2e-10   
ref|XP_004133966.1|  PREDICTED: uncharacterized protein LOC101206344  65.1    2e-10   
ref|XP_010042905.1|  PREDICTED: uncharacterized protein LOC104432125  65.1    2e-10   
ref|XP_002268179.1|  PREDICTED: uncharacterized protein LOC100264994  64.7    2e-10   
ref|XP_010916911.1|  PREDICTED: uncharacterized protein LOC105041...  65.5    2e-10   
gb|ADE77033.1|  unknown                                               66.6    2e-10   
ref|XP_011018664.1|  PREDICTED: uncharacterized protein LOC105121633  65.9    2e-10   
ref|XP_006647701.1|  PREDICTED: uncharacterized protein LOC102717495  64.3    3e-10   
ref|XP_004300295.1|  PREDICTED: uncharacterized protein LOC101301109  65.5    3e-10   
ref|XP_010110529.1|  hypothetical protein L484_023363                 65.9    3e-10   
ref|XP_004964990.1|  PREDICTED: uncharacterized protein LOC101777...  65.5    3e-10   
ref|XP_008786205.1|  PREDICTED: ELMO domain-containing protein E-...  65.5    3e-10   
emb|CAN64280.1|  hypothetical protein VITISV_036896                   65.1    3e-10   
gb|KHG01126.1|  E3 ubiquitin-protein ligase LAP                       65.5    3e-10   
ref|XP_002282724.1|  PREDICTED: uncharacterized protein LOC100257499  65.1    3e-10   
ref|XP_003578037.1|  PREDICTED: uncharacterized protein LOC100838231  65.5    4e-10   
ref|XP_009597207.1|  PREDICTED: uncharacterized protein LOC104093193  63.9    4e-10   
gb|AFK45474.1|  unknown                                               65.1    4e-10   
ref|XP_009128930.1|  PREDICTED: uncharacterized protein LOC103853774  65.1    4e-10   
ref|XP_010916910.1|  PREDICTED: uncharacterized protein LOC105041...  65.1    4e-10   
gb|EYU40329.1|  hypothetical protein MIMGU_mgv1a023601mg              65.1    5e-10   
ref|XP_010235189.1|  PREDICTED: uncharacterized protein LOC100821938  65.1    5e-10   
gb|KDP45980.1|  hypothetical protein JCGZ_11883                       65.1    5e-10   
ref|XP_003611419.1|  hypothetical protein MTR_5g013770                64.7    5e-10   
ref|NP_001047773.1|  Os02g0686700                                     63.5    5e-10   
ref|XP_004973592.1|  PREDICTED: uncharacterized protein LOC101766833  65.1    5e-10   
emb|CDY72627.1|  BnaAnng41720D                                        64.7    6e-10   
gb|AFW72841.1|  hypothetical protein ZEAMMB73_540288                  63.2    7e-10   
gb|ABK25262.1|  unknown                                               63.9    7e-10   
ref|XP_009111864.1|  PREDICTED: uncharacterized protein LOC103837274  63.9    7e-10   
ref|XP_008462244.1|  PREDICTED: uncharacterized protein LOC103500647  64.3    7e-10   
ref|XP_002876541.1|  hypothetical protein ARALYDRAFT_907544           63.2    7e-10   
emb|CDY70231.1|  BnaAnng33040D                                        63.9    7e-10   
emb|CDY33512.1|  BnaA06g35610D                                        64.7    7e-10   
gb|ACU15545.1|  unknown                                               64.3    7e-10   
ref|XP_006647901.1|  PREDICTED: uncharacterized protein LOC102704489  64.3    7e-10   
ref|XP_008382232.1|  PREDICTED: uncharacterized protein LOC103445047  63.2    8e-10   
ref|XP_004141729.1|  PREDICTED: uncharacterized protein LOC101210921  63.9    8e-10   
gb|KDO38680.1|  hypothetical protein CISIN_1g031026mg                 64.3    8e-10   
ref|XP_009371900.1|  PREDICTED: uncharacterized protein LOC103961107  64.3    8e-10   
ref|NP_001145317.1|  uncharacterized protein LOC100278632             62.8    8e-10   
ref|XP_010692001.1|  PREDICTED: uncharacterized protein LOC104905235  63.2    1e-09   
ref|XP_009413251.1|  PREDICTED: uncharacterized protein LOC103994594  64.7    1e-09   
ref|XP_008799431.1|  PREDICTED: uncharacterized protein LOC103714075  64.7    1e-09   
ref|XP_008794925.1|  PREDICTED: uncharacterized protein LOC103710804  63.9    1e-09   
ref|XP_010482194.1|  PREDICTED: uncharacterized protein LOC104760895  63.2    1e-09   
ref|XP_004952956.1|  PREDICTED: uncharacterized protein LOC101764776  62.8    1e-09   
ref|XP_010442365.1|  PREDICTED: uncharacterized protein LOC104725399  63.2    1e-09   
ref|XP_004510561.1|  PREDICTED: uncharacterized protein LOC101513746  63.2    1e-09   
gb|AHY23249.1|  hypothetical protein                                  63.2    2e-09   
ref|NP_564644.1|  uncharacterized protein                             62.8    2e-09   
gb|KHG01478.1|  hypothetical protein F383_22703                       63.5    2e-09   
ref|XP_011093489.1|  PREDICTED: uncharacterized protein LOC105173450  62.4    2e-09   
ref|XP_007138931.1|  hypothetical protein PHAVU_009G250000g           62.8    2e-09   
ref|XP_006477045.1|  PREDICTED: uncharacterized protein LOC102616292  63.9    2e-09   
ref|XP_011085486.1|  PREDICTED: uncharacterized protein LOC105167450  62.0    2e-09   
ref|XP_006440128.1|  hypothetical protein CICLE_v10021925mg           63.9    2e-09   
ref|XP_009370942.1|  PREDICTED: uncharacterized protein LOC103960230  61.6    2e-09   
ref|XP_010269869.1|  PREDICTED: uncharacterized protein LOC104606398  62.8    2e-09   
ref|XP_010469214.1|  PREDICTED: uncharacterized protein LOC104749314  61.6    2e-09   
ref|XP_008229501.1|  PREDICTED: uncharacterized protein LOC103328874  62.8    2e-09   
ref|XP_008803746.1|  PREDICTED: uncharacterized protein LOC103717217  62.0    2e-09   
ref|XP_010446540.1|  PREDICTED: uncharacterized protein LOC104729...  62.4    3e-09   
ref|XP_006358618.1|  PREDICTED: uncharacterized protein LOC102583567  62.8    3e-09   
emb|CDY24065.1|  BnaA06g00630D                                        62.0    3e-09   
ref|XP_006661266.1|  PREDICTED: uncharacterized protein LOC102718107  62.4    3e-09   
ref|XP_004953486.1|  PREDICTED: uncharacterized protein LOC101773149  61.2    4e-09   
ref|XP_002891779.1|  hypothetical protein ARALYDRAFT_892440           61.6    4e-09   
ref|XP_001775605.1|  predicted protein                                60.1    4e-09   
gb|AAM62960.1|  unknown                                               61.6    4e-09   
ref|XP_008448751.1|  PREDICTED: uncharacterized protein LOC103490823  62.0    4e-09   
ref|NP_001063247.1|  Os09g0433800                                     62.0    4e-09   
ref|XP_010089774.1|  hypothetical protein L484_008024                 60.8    4e-09   
gb|EAZ44839.1|  hypothetical protein OsJ_29476                        62.0    5e-09   
ref|XP_009384696.1|  PREDICTED: uncharacterized protein LOC103972186  61.6    5e-09   
ref|XP_004307264.1|  PREDICTED: uncharacterized protein LOC101307154  60.8    5e-09   
ref|XP_010033660.1|  PREDICTED: uncharacterized protein LOC104422899  61.2    5e-09   
ref|XP_006828650.1|  hypothetical protein AMTR_s00129p00107910        61.6    5e-09   
ref|XP_011093870.1|  PREDICTED: uncharacterized protein LOC105173708  62.8    5e-09   
gb|EMS48072.1|  hypothetical protein TRIUR3_06994                     61.2    6e-09   
ref|XP_004148386.1|  PREDICTED: uncharacterized protein LOC101216261  61.6    6e-09   
gb|EEC83665.1|  hypothetical protein OsI_29437                        62.0    6e-09   
ref|XP_002449333.1|  hypothetical protein SORBIDRAFT_05g008190        61.2    6e-09   
ref|XP_004147248.1|  PREDICTED: uncharacterized protein LOC101209142  61.2    6e-09   
gb|EEE68793.1|  hypothetical protein OsJ_27531                        62.0    7e-09   
ref|XP_002449336.1|  hypothetical protein SORBIDRAFT_05g008210        62.0    7e-09   
ref|XP_009797679.1|  PREDICTED: uncharacterized protein LOC104244...  60.8    7e-09   
gb|EPS68156.1|  hypothetical protein M569_06618                       59.3    8e-09   
ref|XP_009407980.1|  PREDICTED: uncharacterized protein LOC103990530  60.1    8e-09   
ref|XP_008797361.1|  PREDICTED: uncharacterized protein LOC103712580  61.2    8e-09   
gb|KDO73844.1|  hypothetical protein CISIN_1g023035mg                 62.0    8e-09   
ref|XP_006474697.1|  PREDICTED: uncharacterized protein LOC102630338  62.0    8e-09   
emb|CDY56677.1|  BnaCnng30940D                                        60.8    9e-09   
gb|KDO73843.1|  hypothetical protein CISIN_1g023035mg                 62.0    9e-09   
ref|XP_006452849.1|  hypothetical protein CICLE_v10009353mg           62.0    9e-09   
ref|XP_004144050.1|  PREDICTED: uncharacterized protein LOC101213046  62.0    9e-09   
gb|KEH37210.1|  DUF581 family protein                                 60.8    1e-08   
ref|NP_001145606.1|  uncharacterized protein LOC100279084             60.1    1e-08   
ref|XP_006281276.1|  hypothetical protein CARUB_v10027324mg           60.5    1e-08   
ref|XP_010029507.1|  PREDICTED: uncharacterized protein LOC104419524  61.2    1e-08   
ref|XP_008784369.1|  PREDICTED: uncharacterized protein LOC103703330  60.8    1e-08   
gb|AFK37041.1|  unknown                                               60.5    1e-08   
ref|XP_010668468.1|  PREDICTED: uncharacterized protein LOC104885479  60.5    1e-08   
ref|XP_004171679.1|  PREDICTED: uncharacterized protein LOC101225191  61.6    1e-08   
ref|XP_010440169.1|  PREDICTED: uncharacterized protein LOC104723484  60.5    1e-08   
ref|XP_009106955.1|  PREDICTED: uncharacterized protein LOC103832648  59.7    1e-08   
ref|XP_001784196.1|  predicted protein                                62.4    1e-08   
emb|CDY69532.1|  BnaCnng64020D                                        59.7    2e-08   
ref|XP_004138928.1|  PREDICTED: uncharacterized protein LOC101206273  59.3    2e-08   
ref|XP_010917382.1|  PREDICTED: uncharacterized protein LOC105041988  60.1    2e-08   
ref|NP_001241006.1|  uncharacterized protein LOC100816015             60.1    2e-08   
gb|KDO73842.1|  hypothetical protein CISIN_1g023035mg                 62.0    2e-08   
ref|XP_010932338.1|  PREDICTED: uncharacterized protein LOC105053...  60.1    2e-08   
ref|XP_009401537.1|  PREDICTED: uncharacterized protein LOC103985536  60.1    2e-08   
emb|CDX85392.1|  BnaC07g27030D                                        59.7    2e-08   
gb|AGT16221.1|  hypothetical protein SHCRBa_267_M24_R_460             60.1    2e-08   
ref|XP_008450954.1|  PREDICTED: uncharacterized protein LOC103492390  60.8    2e-08   
ref|XP_006395093.1|  hypothetical protein EUTSA_v10005101mg           59.7    2e-08   
ref|XP_002991624.1|  hypothetical protein SELMODRAFT_448491           61.6    2e-08   
gb|KHN07883.1|  hypothetical protein glysoja_032427                   60.8    2e-08   
ref|NP_001053682.1|  Os04g0586000                                     59.3    3e-08   
ref|XP_009407253.1|  PREDICTED: uncharacterized protein LOC103989991  59.7    3e-08   
ref|XP_002452735.1|  hypothetical protein SORBIDRAFT_04g031510        59.3    3e-08   
ref|XP_011048616.1|  PREDICTED: uncharacterized protein LOC105142605  59.7    3e-08   
ref|XP_009596467.1|  PREDICTED: uncharacterized protein LOC104092...  60.5    3e-08   
gb|ACU13810.1|  unknown                                               60.8    3e-08   
ref|XP_008668977.1|  PREDICTED: zinc finger protein 57 homolog        58.9    3e-08   
ref|XP_003627431.1|  hypothetical protein MTR_8g022950                58.9    3e-08   
ref|XP_007220486.1|  hypothetical protein PRUPE_ppa013788mg           58.5    3e-08   
ref|XP_009151711.1|  PREDICTED: uncharacterized protein LOC103875018  59.3    3e-08   
ref|XP_010529993.1|  PREDICTED: uncharacterized protein LOC104806685  59.3    3e-08   
emb|CDY25682.1|  BnaC03g69930D                                        58.9    3e-08   
ref|XP_007154560.1|  hypothetical protein PHAVU_003G129000g           60.5    3e-08   
ref|XP_010941252.1|  PREDICTED: uncharacterized protein LOC105059598  59.3    3e-08   
ref|XP_010687552.1|  PREDICTED: uncharacterized protein LOC104901657  60.8    4e-08   
ref|XP_009135815.1|  PREDICTED: uncharacterized protein LOC103859963  60.8    4e-08   
emb|CDX92948.1|  BnaA03g36700D                                        60.8    4e-08   
ref|NP_001141226.1|  uncharacterized protein LOC100273313             59.3    4e-08   
ref|XP_007138634.1|  hypothetical protein PHAVU_009G225200g           60.5    4e-08   
ref|XP_002862777.1|  hypothetical protein ARALYDRAFT_497299           58.9    4e-08   
gb|KFK35688.1|  hypothetical protein AALP_AA4G024300                  58.5    4e-08   
gb|AGT16217.1|  hypothetical protein SHCRBa_267_M24_R_150             58.5    4e-08   
gb|KHN17740.1|  hypothetical protein glysoja_005937                   60.1    4e-08   
ref|NP_001053680.1|  Os04g0585700                                     58.9    4e-08   
gb|AFW63424.1|  hypothetical protein ZEAMMB73_556861                  58.5    5e-08   
gb|KDP33943.1|  hypothetical protein JCGZ_07514                       60.5    5e-08   
gb|EAY95317.1|  hypothetical protein OsI_17143                        58.9    5e-08   
emb|CAH66860.1|  H0307D04.5                                           58.9    5e-08   
ref|NP_001276134.1|  uncharacterized protein LOC100816402             60.1    5e-08   
gb|AFK36042.1|  unknown                                               60.1    5e-08   
ref|NP_199723.1|  uncharacterized protein                             58.9    5e-08   
ref|NP_001058578.1|  Os06g0714800                                     58.5    5e-08   
ref|XP_010501054.1|  PREDICTED: uncharacterized protein LOC104778326  58.5    5e-08   
ref|XP_002526492.1|  conserved hypothetical protein                   57.8    5e-08   
ref|XP_003575267.1|  PREDICTED: uncharacterized protein LOC100826263  58.2    5e-08   
emb|CDY68741.1|  BnaA06g39590D                                        58.5    5e-08   
ref|XP_002451637.1|  hypothetical protein SORBIDRAFT_04g005000        60.1    5e-08   
ref|XP_010479971.1|  PREDICTED: uncharacterized protein LOC104758743  58.5    5e-08   
ref|XP_003542370.1|  PREDICTED: uncharacterized protein LOC100499825  60.5    5e-08   
gb|KDP27820.1|  hypothetical protein JCGZ_18900                       58.5    5e-08   
ref|XP_008232342.1|  PREDICTED: uncharacterized protein LOC103331495  57.8    6e-08   
gb|AFK43551.1|  unknown                                               60.1    6e-08   
ref|XP_010462297.1|  PREDICTED: uncharacterized protein LOC104742912  58.2    6e-08   
ref|XP_003580407.1|  PREDICTED: angiomotin-like                       58.2    6e-08   
gb|EMT12432.1|  hypothetical protein F775_30432                       58.2    6e-08   
ref|XP_006652705.1|  PREDICTED: uncharacterized protein LOC102717700  58.5    6e-08   
ref|XP_003595357.1|  hypothetical protein MTR_2g042970                60.1    6e-08   
ref|XP_002448409.1|  hypothetical protein SORBIDRAFT_06g026650        58.2    6e-08   
gb|EPS61645.1|  hypothetical protein M569_13152                       57.4    6e-08   
gb|ABR09296.1|  ethphon-induced protein                               57.0    8e-08   



>ref|XP_009590776.1| PREDICTED: uncharacterized protein LOC104087903 isoform X1 [Nicotiana 
tomentosiformis]
Length=176

 Score =   151 bits (381),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 96/150 (64%), Gaps = 26/150 (17%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPA-----------------VEGQ---A  201
            MMLGK+ RPP RRTTSMTGITVD+G+G    Q P+                  E Q   +
Sbjct  1    MMLGKRGRPPMRRTTSMTGITVDIGTGTGSEQEPSDYRPKVIVDHHDQFKGSSEKQVMMS  60

Query  202  TAVPNGYDHRS-MAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIF  378
            +    GYDH+  MAAMVSPRY         SG+G+  ET +FL TC LCNRRLAP RDI+
Sbjct  61   STTAGGYDHQYFMAAMVSPRY-----QRRISGEGFQTETANFLRTCGLCNRRLAPGRDIY  115

Query  379  MYRGDTAFCSQECREQKMKQDERKERSTNL  468
            MYRGD AFCS ECREQ+MKQDERKE+S  L
Sbjct  116  MYRGDIAFCSMECREQQMKQDERKEKSNKL  145



>emb|CDP01422.1| unnamed protein product [Coffea canephora]
Length=173

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 91/141 (65%), Gaps = 21/141 (15%)
 Frame = +1

Query  85   MLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAV---------------EGQATAVPNG  219
            MLGK++R P RRTTSMTGITVDVG+G      PA                EG     P+ 
Sbjct  1    MLGKRARAPMRRTTSMTGITVDVGAGNMAMDAPASLDPQNPITSGDHGVPEGHVMVGPSA  60

Query  220  YDHRSMAAMV-SPRYYGGRTTTMTSGDGYH-IETPSFLTTCSLCNRRLAPCRDIFMYRGD  393
            YDHR  A M+ SPRY+        S D +  +ET +FL TC LCNRRLAP RDI+MYRGD
Sbjct  61   YDHRLTAPMLLSPRYF----RRDPSADHHQPLETANFLRTCGLCNRRLAPGRDIYMYRGD  116

Query  394  TAFCSQECREQKMKQDERKER  456
            +AFCSQECREQ+MKQDERKE+
Sbjct  117  SAFCSQECREQRMKQDERKEK  137



>ref|XP_009600626.1| PREDICTED: uncharacterized protein LOC104096044 [Nicotiana tomentosiformis]
Length=157

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 92/129 (71%), Gaps = 11/129 (9%)
 Frame = +1

Query  82   MMLGKQSR-PPFRRTTSMTGITVDVGSGMEDGQP-PAVEGQATAVPNGYDH-RSMAAMVS  252
            M+LGK  R P  RRTTSMTGITVDV +    G+P P+       V NGYD+ ++  A+V 
Sbjct  1    MILGKMGRRPSMRRTTSMTGITVDVVNA---GEPEPSDVVDEFKVANGYDNNQNSIAIVL  57

Query  253  PRYYGGRTTTMTSGDGYHIE-TPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQK  429
            PRYY  R++++    G+ IE T  FL TC LCNRRLAP RDI+MYRGDTAFCS ECREQ+
Sbjct  58   PRYYHQRSSSV----GFQIEETAHFLKTCGLCNRRLAPGRDIYMYRGDTAFCSMECREQQ  113

Query  430  MKQDERKER  456
            +K+DERKE+
Sbjct  114  LKKDERKEK  122



>emb|CBI41084.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 83/129 (64%), Gaps = 19/129 (15%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            MMLGK++RP  +RTTSMTGITVD+G  M  G             NGYD R +AA VSPR 
Sbjct  9    MMLGKRARPQIKRTTSMTGITVDLGHNMVAG------------SNGYDPRFLAATVSPRI  56

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +           G  +ET  FL TC LC RRL P RDI+MYRGDTAFCS ECREQ+MKQD
Sbjct  57   H-------RRSSGEFMETAHFLRTCGLCQRRLQPGRDIYMYRGDTAFCSLECREQQMKQD  109

Query  442  ERKERSTNL  468
            ERKE+ + +
Sbjct  110  ERKEKYSGM  118



>ref|XP_003635513.1| PREDICTED: uncharacterized protein LOC100261790 [Vitis vinifera]
 ref|XP_003635265.2| PREDICTED: uncharacterized protein LOC100853335 [Vitis vinifera]
Length=160

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 87/140 (62%), Gaps = 18/140 (13%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGS----GMEDGQPPAVEGQATAV-------PNGYDH  228
            MMLGK++RP  +RTTSMTGITVD+G        D Q P  +  A A         NGYD 
Sbjct  1    MMLGKRARPQIKRTTSMTGITVDLGHVEAPAPADPQNPIKDVHAAARVENMVAGSNGYDP  60

Query  229  RSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCS  408
            R +AA VSPR +           G  +ET  FL TC LC RRL P RDI+MYRGDTAFCS
Sbjct  61   RFLAATVSPRIH-------RRSSGEFMETAHFLRTCGLCQRRLQPGRDIYMYRGDTAFCS  113

Query  409  QECREQKMKQDERKERSTNL  468
             ECREQ+MKQDERKE+ + +
Sbjct  114  LECREQQMKQDERKEKYSGM  133



>ref|XP_009786645.1| PREDICTED: uncharacterized protein LOC104234727 [Nicotiana sylvestris]
Length=155

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 88/128 (69%), Gaps = 11/128 (9%)
 Frame = +1

Query  82   MMLGKQSR-PPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDH-RSMAAMVSP  255
            MM+GK  R P  +RTTSMTGITVDV +  E  +P  V  +  A  NGYDH ++  A+V P
Sbjct  1    MMVGKMGRRPSMKRTTSMTGITVDVVNAGE-SEPSDVVDEFKA--NGYDHNQNSIAIVLP  57

Query  256  RYYGGRTTTMTSGDGYHIE-TPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKM  432
            RY+       +S  G+ IE T  FL TC LCNRRLAP RDI+MYRGDTAFCS ECREQ+M
Sbjct  58   RYH-----QRSSSVGFKIEETAHFLKTCGLCNRRLAPGRDIYMYRGDTAFCSMECREQQM  112

Query  433  KQDERKER  456
            K DERKE+
Sbjct  113  KNDERKEK  120



>gb|KHF97984.1| hypothetical protein F383_15064 [Gossypium arboreum]
 gb|KHG30071.1| hypothetical protein F383_12895 [Gossypium arboreum]
Length=169

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 88/140 (63%), Gaps = 19/140 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMED------------GQPPAVEGQATAVPNG--  219
            MMLGK+SR P +RTTSMTGITVDV S  ED              PP         P+G  
Sbjct  1    MMLGKRSRQPIKRTTSMTGITVDV-SDAEDVIDHHHQDPIISHLPPPQIHPMHESPDGNS  59

Query  220  -YDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDT  396
             YDHR +A MVSPR     T  +   D    +T SFL  C LCNRRLAP RDI+MYRGDT
Sbjct  60   RYDHRFLA-MVSPRNPASFTNRIV--DSSTTDTASFLRACWLCNRRLAPGRDIYMYRGDT  116

Query  397  AFCSQECREQKMKQDERKER  456
            +FCSQECRE++MKQDERKE+
Sbjct  117  SFCSQECREKQMKQDERKEK  136



>ref|XP_004237417.1| PREDICTED: uncharacterized protein LOC101267225 [Solanum lycopersicum]
Length=156

 Score =   126 bits (317),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 95/145 (66%), Gaps = 14/145 (10%)
 Frame = +1

Query  85   MLGKQSRPPFRRTTSMTGITVDVGSGME----DGQPPAV---EGQATAVPNGYDHRSMAA  243
            MLGK+ RPP RRTTSMTGITVDVG+G E    D   P +   E ++++V  G  + S+ A
Sbjct  1    MLGKRGRPPMRRTTSMTGITVDVGTGTESEPSDCNKPKITVDEIKSSSVIMG-GYSSVPA  59

Query  244  MVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECRE  423
            MVSPRY         SG+G+  E  +FL  C  CNRRL   RDI+MYRGD AFCS ECRE
Sbjct  60   MVSPRY-----QRRISGEGFERERANFLRICGRCNRRLINGRDIYMYRGDAAFCSIECRE  114

Query  424  QKMKQDERKERSTNLQIENNGGISD  498
            ++MKQDER ++S  ++ EN+   S+
Sbjct  115  EQMKQDERNDKS-KIKPENHHNHSE  138



>ref|XP_011097598.1| PREDICTED: uncharacterized protein LOC105176481 [Sesamum indicum]
Length=135

 Score =   125 bits (314),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 84/140 (60%), Gaps = 21/140 (15%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            MMLGK+ RP FRRTTSMTGI+ DV    E   PP + G        YDH     M+SPRY
Sbjct  1    MMLGKRGRPTFRRTTSMTGISFDV----EAPPPPPLGGV-------YDH----MMLSPRY  45

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +       +S D    ET  FL +C LCNRRLAP RDI+MYRGDTAFCS ECREQ+MKQD
Sbjct  46   F---RRNDSSADA---ETADFLRSCGLCNRRLAPGRDIYMYRGDTAFCSLECREQQMKQD  99

Query  442  ERKERSTNLQIENNGGISDH  501
            ER ER          G S H
Sbjct  100  ERNERRAAATSVTKDGESHH  119



>ref|XP_007048013.1| Thioesterase superfamily protein [Theobroma cacao]
 gb|EOX92170.1| Thioesterase superfamily protein [Theobroma cacao]
Length=162

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 90/139 (65%), Gaps = 21/139 (15%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATA--------VPNG----YD  225
            M+LGK+SR P +RTTSMTGITVDV S +ED Q P +               PNG    YD
Sbjct  1    MLLGKRSRHPIKRTTSMTGITVDV-SNVEDVQEPLIISDPPPPPQDPLHEFPNGNFAGYD  59

Query  226  HRSMAAMVSPRY-YGGRTTTMTSGDGYHI-ETPSFLTTCSLCNRRLAPCRDIFMYRGDTA  399
             R +A MVSPR    GR     SG   H+ +T  FL +C LC RRLAP RDI+MYRGDTA
Sbjct  60   QRFLA-MVSPRNPAAGR-----SGSTNHVVDTAPFLRSCCLCKRRLAPSRDIYMYRGDTA  113

Query  400  FCSQECREQKMKQDERKER  456
            FCS ECREQ+MKQDERKE+
Sbjct  114  FCSSECREQQMKQDERKEK  132



>gb|KHF97368.1| hypothetical protein F383_13795 [Gossypium arboreum]
Length=168

 Score =   124 bits (311),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 86/138 (62%), Gaps = 16/138 (12%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSG-----------MEDGQPPAVE--GQATAVPNGY  222
            MMLGK+SR P +RTTSMTGITVDV              +    PP +    ++  V + Y
Sbjct  1    MMLGKRSRQPIKRTTSMTGITVDVSDAEDVVDHHQDPIISHPPPPQIHPLHESPDVNSRY  60

Query  223  DHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAF  402
            D R +A MVSPR     T+ +  G       P FL  C LCNRRLAP RDI+MYRGDTAF
Sbjct  61   DQRFLA-MVSPRNPASFTSHVI-GSSTTAAAP-FLRACWLCNRRLAPGRDIYMYRGDTAF  117

Query  403  CSQECREQKMKQDERKER  456
            CSQECRE++MKQDERKE+
Sbjct  118  CSQECREKQMKQDERKEK  135



>ref|XP_006428152.1| hypothetical protein CICLE_v10026585mg [Citrus clementina]
 ref|XP_006464207.1| PREDICTED: uncharacterized protein LOC102611793 [Citrus sinensis]
 gb|ESR41392.1| hypothetical protein CICLE_v10026585mg [Citrus clementina]
Length=183

 Score =   124 bits (311),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 86/152 (57%), Gaps = 27/152 (18%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNG--------------  219
            M+LGK+ RPP +RTTSMTGITVD+ +   DG       Q                     
Sbjct  1    MLLGKRPRPPIKRTTSMTGITVDITNVESDGPSDHHHRQQQQQHQSAPAAAAAPHHQMMN  60

Query  220  ----------YDHRSM-AAMVSPR--YYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLA  360
                      YDH+   AAMVSPR  Y   + +T+       IET  FL TC LCNRRLA
Sbjct  61   FGYDDNNNFMYDHQPFFAAMVSPRNNYQQQQRSTIGRSSNELIETAHFLRTCGLCNRRLA  120

Query  361  PCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            P +DI+MYRGDTAFCS ECREQ+MKQDERKE+
Sbjct  121  PGKDIYMYRGDTAFCSFECREQQMKQDERKEK  152



>gb|KDO47041.1| hypothetical protein CISIN_1g030226mg [Citrus sinensis]
Length=181

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 92/171 (54%), Gaps = 33/171 (19%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNG--------------  219
            M+LGK+ RPP +RTTSMTGITVD+ +   DG       Q                     
Sbjct  1    MLLGKRPRPPIKRTTSMTGITVDITNVESDGPSDHHHRQQQQQQQHQSAPAAAAATHHQM  60

Query  220  ------------YDHRSM-AAMVSPR--YYGGRTTTMTSGDGYHIETPSFLTTCSLCNRR  354
                        YDH+   AAMVSPR  Y   + +T+       IET  FL TC LCNRR
Sbjct  61   MNFGYDDDNNFMYDHQPFFAAMVSPRNNYQQQQRSTIGRSSNELIETAHFLRTCGLCNRR  120

Query  355  LAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNLQIE----NNGGIS  495
            LAP +DI+MYRGDTAFCS ECREQ+MKQDERKE+ ++   E    NN   S
Sbjct  121  LAPGKDIYMYRGDTAFCSFECREQQMKQDERKEKLSSKNKEESDKNNAAAS  171



>gb|AFK40825.1| unknown [Lotus japonicus]
Length=148

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 80/125 (64%), Gaps = 7/125 (6%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            MMLGK+ RPP +RTTSM+ IT D+ +  EDG          A  NG D   + A VSPR 
Sbjct  1    MMLGKRPRPPMKRTTSMSEITFDLNTAPEDGGAAGNRHGGAAGFNGSDQSRILATVSPRN  60

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +  RT ++        +TP FL  C LC RRLAP RDI+MYRGD+AFCS ECR+Q+M QD
Sbjct  61   H--RTHSVD-----FAQTPDFLRCCFLCKRRLAPGRDIYMYRGDSAFCSLECRQQQMNQD  113

Query  442  ERKER  456
            ERK++
Sbjct  114  ERKDK  118



>ref|XP_007136224.1| hypothetical protein PHAVU_009G028800g [Phaseolus vulgaris]
 gb|ESW08218.1| hypothetical protein PHAVU_009G028800g [Phaseolus vulgaris]
Length=158

 Score =   118 bits (296),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 80/133 (60%), Gaps = 17/133 (13%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVP----------NGYDHR  231
            M+LGK+ RPP +RTTSM+ IT D+ + ++D Q   V+G     P          NG D  
Sbjct  1    MLLGKRPRPPMKRTTSMSEITFDLNTTLDDAQNNPVKGGLGPDPWSKHTPVVGSNGLDQS  60

Query  232  SMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQ  411
             + A+VSPR +        S D  H  TP FL  C LC  RL P RDI+MYRGD+AFCS 
Sbjct  61   RVWALVSPRNH-----RRHSEDSAH--TPEFLRVCFLCKHRLVPGRDIYMYRGDSAFCSS  113

Query  412  ECREQKMKQDERK  450
            ECRE++MKQDERK
Sbjct  114  ECREKQMKQDERK  126



>ref|XP_003526592.1| PREDICTED: uncharacterized protein LOC100803140 [Glycine max]
Length=154

 Score =   118 bits (295),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 82/130 (63%), Gaps = 13/130 (10%)
 Frame = +1

Query  82   MMLGKQSRPPF-RRTTSMTGITVDVGSGMEDGQPPAVEGQATAVP----NGYDHRSMAAM  246
            M+LGK+ RPP  +RTTSM+ IT D+ + ++D    +V+G     P    NG D   + AM
Sbjct  1    MLLGKRPRPPIMKRTTSMSEITFDLNTSLDDDPNNSVKGPGGDGPPVGLNGLDQNRVWAM  60

Query  247  VSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQ  426
            VSPR +  R         Y  +TP FL  C LC RRL P RDIFMY+GD+AFCS ECREQ
Sbjct  61   VSPRNHHRRQ--------YSEDTPGFLRVCFLCKRRLVPGRDIFMYKGDSAFCSSECREQ  112

Query  427  KMKQDERKER  456
            +MK DERK++
Sbjct  113  QMKHDERKDK  122



>ref|XP_002306588.1| senescence-associated family protein [Populus trichocarpa]
 gb|ABK96690.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE93584.1| senescence-associated family protein [Populus trichocarpa]
Length=148

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 78/126 (62%), Gaps = 7/126 (6%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNG-YDHRSMAAMVSPR  258
            M+LGK+ R P +RTTS+T I  D+ +   +  PP+   Q      G  D RS AA  SPR
Sbjct  1    MLLGKRPRNPMKRTTSLTEIKFDLNTASSEAAPPSDHPQKQVGYGGMIDQRSSAATGSPR  60

Query  259  YYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQ  438
                  T+        +ETP+FL  CSLC RRL P RDI+MY+GD+AFCSQECR+Q+M  
Sbjct  61   ------TSHRRASADFLETPNFLRACSLCKRRLIPGRDIYMYKGDSAFCSQECRQQQMSL  114

Query  439  DERKER  456
            DERKE+
Sbjct  115  DERKEK  120



>ref|XP_004288223.1| PREDICTED: uncharacterized protein LOC101303450 [Fragaria vesca 
subsp. vesca]
Length=174

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 86/146 (59%), Gaps = 24/146 (16%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQP---PAVEGQATA-----VPNG------  219
            M+LGK+ RPP RRTTSMTGITVD  S +ED +P   P++     A     VP+G      
Sbjct  1    MLLGKRPRPPIRRTTSMTGITVD-QSNVEDQEPTENPSMMMDVHAPSMVVVPDGPLNHLH  59

Query  220  -------YDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIF  378
                   ++     AM+SPR     +    + D   +ET  FL TC LC R LA  RD++
Sbjct  60   SPSSLGYHEQHRFLAMLSPR--TNSSNHRRNSDSDLVETAHFLRTCGLCKRSLASGRDLY  117

Query  379  MYRGDTAFCSQECREQKMKQDERKER  456
            MYRGDTAFCS ECREQ+MKQDER E+
Sbjct  118  MYRGDTAFCSLECREQQMKQDERVEK  143



>ref|XP_011030961.1| PREDICTED: uncharacterized protein LOC105130254 isoform X2 [Populus 
euphratica]
Length=191

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 90/163 (55%), Gaps = 33/163 (20%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVD----VGSGMEDGQPPAVEGQATAVPNGYDHRS-----  234
            M+LGK+ R P RRTTSMTGI+VD    VG+G  +      +          D+ +     
Sbjct  12   MLLGKRQRGPMRRTTSMTGISVDLQSHVGAGSSEPSDDTTQNHQMIKEGSLDYHNKNNMM  71

Query  235  -----------------MAAMVSPRYYGGRTTTMTSGDGYH-IETPSFLTTCSLCNRRLA  360
                             +A+M+SPR +       +SG G H +E   FL TC LC RRLA
Sbjct  72   DTSCGGNTSGFLHDQPFLASMLSPRNH-----QKSSGSGNHFVEDSHFLRTCGLCKRRLA  126

Query  361  PCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNLQIENNGG  489
            P +D++MYRGDTAFCSQECR Q+MKQDERKE + N+ I +  G
Sbjct  127  PGKDLYMYRGDTAFCSQECRAQQMKQDERKE-NRNVMITSKKG  168



>ref|NP_001237297.1| uncharacterized protein LOC100527013 [Glycine max]
 gb|ACU16049.1| unknown [Glycine max]
 gb|KHN19735.1| hypothetical protein glysoja_024836 [Glycine soja]
Length=136

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 79/126 (63%), Gaps = 19/126 (15%)
 Frame = +1

Query  82   MMLGKQSRPPF-RRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPR  258
            M+LGK+ RPP  +RTTSM+ IT D+ + ++D     V+G     P G  +R + AMVSPR
Sbjct  1    MLLGKRPRPPIMKRTTSMSEITFDLNTTLDDDPNNPVKG-----PGGNQNR-VWAMVSPR  54

Query  259  YYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQ  438
             +   TT            P FL  C LC RRL P RDIFMY+GD+AFCS ECREQ MKQ
Sbjct  55   NHSEDTT------------PDFLRVCFLCKRRLVPARDIFMYKGDSAFCSSECREQLMKQ  102

Query  439  DERKER  456
            DERK++
Sbjct  103  DERKDK  108



>gb|KHN09138.1| hypothetical protein glysoja_025599 [Glycine soja]
Length=154

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 81/130 (62%), Gaps = 13/130 (10%)
 Frame = +1

Query  82   MMLGKQSRPPF-RRTTSMTGITVDVGSGMEDGQPPAVEGQATAVP----NGYDHRSMAAM  246
            M+LGK+ RPP  +RTTSM+ IT D+ + ++D    +V+G     P    NG D   + AM
Sbjct  1    MLLGKRPRPPIMKRTTSMSEITFDLNTSLDDDPNNSVKGPGGDGPPVGLNGLDQNRVWAM  60

Query  247  VSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQ  426
            VSPR +  R         Y  +TP FL  C LC R L P RDIFMY+GD+AFCS ECREQ
Sbjct  61   VSPRNHHRRQ--------YSEDTPGFLRVCFLCKRCLVPGRDIFMYKGDSAFCSSECREQ  112

Query  427  KMKQDERKER  456
            +MK DERK++
Sbjct  113  QMKHDERKDK  122



>ref|XP_004500606.1| PREDICTED: uncharacterized protein LOC101511560 [Cicer arietinum]
Length=152

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 79/130 (61%), Gaps = 12/130 (9%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVP-----NGYDHRSMAAM  246
            M+LGK+ RPP +RTTSM+ IT D+ +  ++            V      NG D   + AM
Sbjct  1    MLLGKRPRPPMKRTTSMSEITFDLNTVTDENPNNLFNRHGAGVAPYDGINGSDQSRVMAM  60

Query  247  VSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQ  426
            VSPR +   ++ MT        TP FL +C LC RRL P RDI+MY+GD+AFCS ECR+Q
Sbjct  61   VSPRNHRRNSSDMT-------HTPDFLRSCFLCKRRLVPGRDIYMYKGDSAFCSLECRQQ  113

Query  427  KMKQDERKER  456
            +M QDERK++
Sbjct  114  QMNQDERKDK  123



>gb|KDP32696.1| hypothetical protein JCGZ_11988 [Jatropha curcas]
Length=148

 Score =   112 bits (281),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 86/140 (61%), Gaps = 12/140 (9%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDV-GSGMEDGQPPAVEGQATAVPNGYDHRSMAAM-VSP  255
            M+LGK++R P +RTTS++ IT D+  +G E   P  +  Q   +    D R +AA  +SP
Sbjct  1    MLLGKRTRHPIKRTTSLSEITFDLDANGCEAAPPSDLHKQ---MVGQLDQRLLAAANISP  57

Query  256  RYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMK  435
            R    R     S D   +ET  FL  CSLC RRL P RDI+MYRGD+AFCS ECR+Q+M 
Sbjct  58   RVTHRRA----SAD--FLETAHFLRACSLCKRRLVPGRDIYMYRGDSAFCSLECRQQQMN  111

Query  436  QDERKERSTNLQIENNGGIS  495
            QDERKE+ + L  +   G+S
Sbjct  112  QDERKEKCS-LASKKQAGVS  130



>ref|XP_009342374.1| PREDICTED: uncharacterized protein LOC103934349 [Pyrus x bretschneideri]
Length=190

 Score =   114 bits (284),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 95/177 (54%), Gaps = 43/177 (24%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGM------EDGQPPAV---------------EGQ  198
            M+LGK+ RPP RRTTSMTGITVD+          E   PPA+               +G 
Sbjct  1    MLLGKRPRPPIRRTTSMTGITVDMSDVQGQEPTDELQNPPAMNDVHAVAVAATVVDAQGP  60

Query  199  ATAVPN--------------GY--DHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLT  330
            A  + N              GY  +HR +A M+SPR      T   S     +ET  FL 
Sbjct  61   APVINNNNYYDVEKMNMNNLGYLEEHRFLA-MLSPR---NNHTRRNSASHDVVETAHFLR  116

Query  331  TCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKE--RSTNLQIENNGGIS  495
            TC LC R+LA  RDI+MYRGD AFCS ECREQ+MKQDERKE  ++ + +IE+   +S
Sbjct  117  TCGLCKRQLASGRDIYMYRGDAAFCSLECREQQMKQDERKEKCKAASSKIEDRHAVS  173



>ref|XP_011006154.1| PREDICTED: uncharacterized protein LOC105112230 [Populus euphratica]
Length=148

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 76/126 (60%), Gaps = 7/126 (6%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNG-YDHRSMAAMVSPR  258
            M+LGK+ R P +RTTS+T I  D+ +   +  PP+   Q      G  D RS AA  SPR
Sbjct  1    MLLGKRPRNPMKRTTSLTEIKFDLNTASTEAAPPSDHAQKQVGYGGMIDQRSSAATGSPR  60

Query  259  YYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQ  438
                  T+        +ET  FL  CSLC RRL P RDI+MY+GD+AFCSQECR+Q+M  
Sbjct  61   ------TSHRRASADFLETAHFLRACSLCKRRLIPGRDIYMYKGDSAFCSQECRQQQMSL  114

Query  439  DERKER  456
            DERK++
Sbjct  115  DERKKK  120



>ref|XP_010905906.1| PREDICTED: uncharacterized protein LOC105032993 [Elaeis guineensis]
Length=183

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 85/162 (52%), Gaps = 32/162 (20%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVE-----------------------  192
            M+LGK+ RPP RRTTSMT  + D+ + +E  QP   E                       
Sbjct  1    MLLGKRPRPPMRRTTSMTEFSGDILADVEAPQPSDQERAHHGHGHNGHQRDRQRAAAAES  60

Query  193  --GQ----ATAVPNGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRR  354
              GQ      A     D R + AMVSPR  G R +   SGD   +ET  FL  CSLC RR
Sbjct  61   SGGQRRYAGAAGAEWMDARHLGAMVSPRGAGYRRS---SGDLAMVETAPFLKACSLCKRR  117

Query  355  LAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNLQIEN  480
            L P RD FMYRGD AFCS ECR+Q+M  DERKE+ +   I++
Sbjct  118  LGPGRDTFMYRGDIAFCSLECRQQQMNLDERKEKCSLTSIKD  159



>ref|XP_011030960.1| PREDICTED: uncharacterized protein LOC105130254 isoform X1 [Populus 
euphratica]
Length=201

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 95/173 (55%), Gaps = 43/173 (25%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGS----------------------------GMEDG-  174
            M+LGK+ R P RRTTSMTGI+VD+ S                            G+E+G 
Sbjct  12   MLLGKRQRGPMRRTTSMTGISVDLQSHVGAGSSEPSDDTTQNHQMIIRGLHASAGLEEGS  71

Query  175  -----QPPAVEGQATAVPNGYDHRS--MAAMVSPRYYGGRTTTMTSGDGYH-IETPSFLT  330
                 +   ++       +G+ H    +A+M+SPR +       +SG G H +E   FL 
Sbjct  72   LDYHNKNNMMDTSCGGNTSGFLHDQPFLASMLSPRNH-----QKSSGSGNHFVEDSHFLR  126

Query  331  TCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNLQIENNGG  489
            TC LC RRLAP +D++MYRGDTAFCSQECR Q+MKQDERKE + N+ I +  G
Sbjct  127  TCGLCKRRLAPGKDLYMYRGDTAFCSQECRAQQMKQDERKE-NRNVMITSKKG  178



>ref|XP_002309988.1| senescence-associated family protein [Populus trichocarpa]
 gb|EEE90438.1| senescence-associated family protein [Populus trichocarpa]
Length=184

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 85/155 (55%), Gaps = 34/155 (22%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDG--QPPAVEG---QATAVPNG---------  219
            M+LGK+ R P RRT SMTGITVD+   ++ G  +P +       ATA P           
Sbjct  1    MLLGKRPRGPMRRTASMTGITVDLPRNVDAGSSEPNSDNNDTLHATAGPEEGSLDYHHNN  60

Query  220  ----------------YDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNR  351
                            +D R +A MVSPR +     +  S D + +E   FL TC LC R
Sbjct  61   NMVDAFDGGNTSGFLLHDQRLLATMVSPRNH---YRSSDSSDHF-VEAAHFLRTCGLCKR  116

Query  352  RLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            RL P +D+FMYRGD AFCSQECREQ+MKQD RKE+
Sbjct  117  RLGPGKDLFMYRGDMAFCSQECREQQMKQDARKEK  151



>ref|XP_011008600.1| PREDICTED: uncharacterized protein LOC105113929 [Populus euphratica]
Length=185

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 85/156 (54%), Gaps = 35/156 (22%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDG--QPPAVEG---QATAVPNG---------  219
            M+LGK+ R P RRT SMTGITVD+ S ++ G  +P +       ATA P           
Sbjct  1    MLLGKRPRGPIRRTASMTGITVDLPSNVDAGSSEPNSDNNDTLHATAGPEEGSLDYHHNN  60

Query  220  -----------------YDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCN  348
                             +D R +A MVSPR +     +  S D + +E   FL TC LC 
Sbjct  61   NNMVDAFDGGNTSGFLLHDQRLLATMVSPRNH---YRSSDSSDHF-VEAAHFLRTCGLCK  116

Query  349  RRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            R+L P  D+FMYRGD AFCSQECREQ+MKQD RKE+
Sbjct  117  RQLGPGNDLFMYRGDMAFCSQECREQQMKQDARKEK  152



>ref|XP_008352590.1| PREDICTED: uncharacterized protein LOC103416102 [Malus domestica]
Length=190

 Score =   111 bits (277),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 87/164 (53%), Gaps = 45/164 (27%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVE-----------------------  192
            M+LGK+ RPP RRTTSMTGITVD+     +GQ P  E                       
Sbjct  1    MLLGKRPRPPIRRTTSMTGITVDMSDV--EGQEPTDELQNPXAMNDVHAVAVAATVVDAQ  58

Query  193  GQATAVPN--------------GY--DHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSF  324
            G A  + N              GY  +HR +A M+SPR      T   S     +ET  F
Sbjct  59   GPAPVINNNNYYDIEKMNMNNLGYHEEHRFLA-MLSPR---NNHTRRNSPSHDVVETAHF  114

Query  325  LTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            L TC LC R+LA  RDI+MYRGDTAFCS ECREQ+MKQDERKE+
Sbjct  115  LRTCGLCKRQLASGRDIYMYRGDTAFCSLECREQQMKQDERKEK  158



>ref|XP_010261230.1| PREDICTED: uncharacterized protein LOC104600098 [Nelumbo nucifera]
Length=164

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 84/149 (56%), Gaps = 29/149 (19%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPP----AVEGQATAVP------------  213
            M+LGK+ RPP +RTTS+T  TVD+ S +E   P     +V+     VP            
Sbjct  1    MLLGKRPRPPMKRTTSLTEFTVDL-SNIEAPVPSDLQNSVKDAQKPVPQEVHVRRNQPGG  59

Query  214  ----NGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFM  381
                +G DHR ++A VSPR                +ET  FL  C LC RRLAP RDI+M
Sbjct  60   GLGSDGIDHRFLSA-VSPR-------NPRRNSANFVETAHFLRACGLCKRRLAPGRDIYM  111

Query  382  YRGDTAFCSQECREQKMKQDERKERSTNL  468
            YRGD+AFCS ECR+Q+M QDERKE+ + L
Sbjct  112  YRGDSAFCSLECRQQQMNQDERKEKCSLL  140



>ref|XP_007205966.1| hypothetical protein PRUPE_ppa012051mg [Prunus persica]
 gb|EMJ07165.1| hypothetical protein PRUPE_ppa012051mg [Prunus persica]
Length=185

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 87/158 (55%), Gaps = 39/158 (25%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQ-----------------ATAV  210
            M+LGK+ RPP RRTTSMTGITVD+ + +E  +P  V                    A AV
Sbjct  1    MLLGKRPRPPMRRTTSMTGITVDLNN-VEGEEPTDVHAAAAAAAAAAMVVGPQQVPAAAV  59

Query  211  PN--------------GY--DHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSL  342
             N              GY   HR +A M+SPR      TT  + D   +ET  FL TC L
Sbjct  60   NNNNNIESMDMKNNNFGYHEQHRFLA-MLSPR--NNHRTTSAAHDV--VETAHFLRTCGL  114

Query  343  CNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            C R LA  RDI+MYRGDTAFCS ECREQ+MKQDER E+
Sbjct  115  CKRHLASGRDIYMYRGDTAFCSLECREQQMKQDERVEK  152



>ref|XP_002302279.2| senescence-associated family protein [Populus trichocarpa]
 gb|EEE81552.2| senescence-associated family protein [Populus trichocarpa]
Length=150

 Score =   107 bits (268),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 76/127 (60%), Gaps = 8/127 (6%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNG--YDHRSMAAMVSP  255
            M+LGK+ R P +RTTS + IT D+ +   +  PP  +        G   D R ++   SP
Sbjct  1    MLLGKRPRNPMKRTTSFSEITFDLNTATSEAAPPPSDHHQKQAGYGGLIDQRFLSDAGSP  60

Query  256  RYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMK  435
            R     TT   + D + +ET  FL  CSLC RRL P RDI+MYRGD+AFCS ECR+Q+M 
Sbjct  61   R-----TTYRRASDDF-LETAHFLRACSLCKRRLIPGRDIYMYRGDSAFCSLECRQQQMS  114

Query  436  QDERKER  456
             DERKE+
Sbjct  115  LDERKEK  121



>ref|XP_006826981.1| hypothetical protein AMTR_s00010p00202670 [Amborella trichopoda]
 gb|ERM94218.1| hypothetical protein AMTR_s00010p00202670 [Amborella trichopoda]
Length=140

 Score =   107 bits (267),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 79/133 (59%), Gaps = 12/133 (9%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+ RP  +RTTSMT  TVD+GS +    PP+       VP  ++     A+ SPR 
Sbjct  1    MLLGKRPRP-VKRTTSMTEFTVDIGSEV----PPSDADGPIHVPELFEGARYPAIASPRN  55

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +           G  IET  FL  C+LC RRL P RDI+MYRGD+AFCS ECR+Q+M  D
Sbjct  56   H-------RRFSGNFIETAHFLQCCTLCKRRLGPGRDIYMYRGDSAFCSLECRQQQMNID  108

Query  442  ERKERSTNLQIEN  480
            ERKE+     ++N
Sbjct  109  ERKEKCALSSMKN  121



>ref|XP_008809319.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103721061 
[Phoenix dactylifera]
Length=182

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 79/155 (51%), Gaps = 36/155 (23%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPP-----------------------AVE  192
            M+LGK+ RPP RRTTSMT  + D+   + DG  P                       A E
Sbjct  1    MLLGKRPRPPMRRTTSMTEFSGDI---LADGDAPQPSDQQRGHHGHGHGHQRDRQRAAAE  57

Query  193  GQA-------TAVPNGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNR  351
            G            P   + R + AM+SPR   G     +SGD   +ET  FL  CSLC R
Sbjct  58   GSGGQRRYGGAVGPEWLEARHLGAMLSPR---GAGHPRSSGDFGMVETAPFLKACSLCKR  114

Query  352  RLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            RL P RD FMYRGD AFCS ECR+Q+M  DERKE+
Sbjct  115  RLGPGRDTFMYRGDIAFCSLECRQQQMNLDERKEK  149



>ref|XP_006472642.1| PREDICTED: uncharacterized protein LOC102618405 [Citrus sinensis]
Length=184

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 81/142 (57%), Gaps = 15/142 (11%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQA---TAVPNGY----------  222
            M+LGK+ RPP +RTTS++ I+ D+  G +D    A   Q    TA    +          
Sbjct  1    MLLGKRPRPPMKRTTSLSEISFDLDGGGDDSSSAAASHQQKNPTAALTKHPGSGGGGVDD  60

Query  223  -DHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTA  399
             D R ++ + SPR              + +ETP FL TC LC RRL P RDI+MYRGD+A
Sbjct  61   VDQRFLSTVSSPRNNNNNNNNSRHSADF-LETPHFLRTCGLCKRRLVPGRDIYMYRGDSA  119

Query  400  FCSQECREQKMKQDERKERSTN  465
            FCS ECR+Q+M QDERK++ T+
Sbjct  120  FCSLECRQQQMNQDERKQKCTS  141



>gb|KDO80903.1| hypothetical protein CISIN_1g029576mg [Citrus sinensis]
Length=182

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 82/142 (58%), Gaps = 17/142 (12%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQA---TAVPNGY----------  222
            M+LGK+ RPP +RTTS++ I+ D+  G +D    A   Q    TA    +          
Sbjct  1    MLLGKRPRPPMKRTTSLSEISFDLDGGGDDSSSAAASHQQKNPTAALTKHPGSGGGGVDD  60

Query  223  -DHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTA  399
             D R ++ + SPR         ++     +ETP FL TC LC RRL P RDI+MYRGD+A
Sbjct  61   VDQRFLSTVSSPRNNNNNNNRHSAD---FLETPHFLRTCGLCKRRLVPGRDIYMYRGDSA  117

Query  400  FCSQECREQKMKQDERKERSTN  465
            FCS ECR+Q+M QDERK++ T+
Sbjct  118  FCSLECRQQQMNQDERKQKCTS  139



>ref|XP_004299635.1| PREDICTED: uncharacterized protein LOC101315051 [Fragaria vesca 
subsp. vesca]
Length=144

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 73/125 (58%), Gaps = 6/125 (5%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+ RPP +RTTSM+ IT D+ +   + QP   +      P   D   M  M S   
Sbjct  1    MLLGKRPRPPMKRTTSMSEITFDLST---EAQPQPSDPLNPFSPLAVDGL-MVKMASSSS  56

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
               R     S D   +ETP FL  C LC RRL P RDI+MYRGDTAFCS ECR+Q+M  D
Sbjct  57   PSPRNHRRNSAD--FVETPHFLRACGLCKRRLVPGRDIYMYRGDTAFCSLECRQQQMTLD  114

Query  442  ERKER  456
            ERK++
Sbjct  115  ERKDK  119



>ref|XP_006434029.1| hypothetical protein CICLE_v10002627mg [Citrus clementina]
 gb|ESR47269.1| hypothetical protein CICLE_v10002627mg [Citrus clementina]
Length=182

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 82/142 (58%), Gaps = 17/142 (12%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQA---TAVPNGY----------  222
            M+LGK+ RPP +RTTS++ I+ D+  G +D    A   Q    TA    +          
Sbjct  1    MLLGKRPRPPMKRTTSLSEISFDLDGGGDDSSSAAASHQQKNPTAALTKHPGSGGGGVDD  60

Query  223  -DHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTA  399
             D R ++ + SPR         ++     +ETP FL TC LC RRL P RDI+MYRGD+A
Sbjct  61   VDQRFLSTVSSPRNNNNNNNRHSAD---FLETPHFLRTCGLCKRRLVPGRDIYMYRGDSA  117

Query  400  FCSQECREQKMKQDERKERSTN  465
            FCS ECR+Q+M QDERK++ T+
Sbjct  118  FCSLECRQQQMNQDERKQKCTS  139



>ref|XP_009106449.1| PREDICTED: uncharacterized protein LOC103832227 [Brassica rapa]
Length=154

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 77/130 (59%), Gaps = 5/130 (4%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEG--QATAV-PNGYDHRSMAAMVS  252
            M+LGK+ RPP  RTTS++ I  D+    E   P   +   Q T V P+G + + +AA V 
Sbjct  1    MLLGKRQRPPINRTTSLSEIKFDLNLPSESDVPSTQQSRSQNTVVGPSGSNGQHVAAAVD  60

Query  253  PRYYGGRTT--TMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQ  426
            PR+    +    +    G   +   FL +CSLC R L P RDI+MYRGDTAFCS ECREQ
Sbjct  61   PRFLAMVSPRGNLRRHSGEFSDAGHFLRSCSLCERLLVPGRDIYMYRGDTAFCSSECREQ  120

Query  427  KMKQDERKER  456
            +M QDE KE+
Sbjct  121  QMTQDEGKEK  130



>ref|XP_003638769.1| hypothetical protein MTR_145s0001 [Medicago truncatula]
 gb|KEH34885.1| DUF581 family protein [Medicago truncatula]
Length=156

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 78/141 (55%), Gaps = 23/141 (16%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQP-----------PAVEGQATAVP-----  213
            MMLGK+ RPP +RTTSM+ IT D+ +   +  P           P V       P     
Sbjct  1    MMLGKRPRPPMKRTTSMSEITFDLNTVTTEEDPNNNNNLFNRHGPGVGPYGPYPPTSPGI  60

Query  214  NGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGD  393
            NG D   + +MVSPR     +  MT         P FL +C LC RRL P RDI+MY+GD
Sbjct  61   NGSDQSRVMSMVSPRNLRRNSADMT-------HNPDFLRSCFLCKRRLVPGRDIYMYKGD  113

Query  394  TAFCSQECREQKMKQDERKER  456
            +AFCS ECR+Q+M QDE+K++
Sbjct  114  SAFCSLECRQQQMNQDEKKDK  134



>ref|XP_002306320.1| senescence-associated family protein [Populus trichocarpa]
 gb|EEE93316.1| senescence-associated family protein [Populus trichocarpa]
Length=190

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 90/173 (52%), Gaps = 43/173 (25%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVD----VGSGMEDGQPPAVEGQATAVP------------  213
            M LGK+ R P RRTTSMTGI VD    VG+G  +      +     +             
Sbjct  1    MSLGKRPRGPMRRTTSMTGIAVDLPSNVGAGSSEPSDDTTQNHQMIIKGLHATAGLEEGS  60

Query  214  ------------------NGYDHRS--MAAMVSPRYYGGRTTTMTSGDGYH-IETPSFLT  330
                              +G+ H    +A+++SPR +       +SG G H +E   FL 
Sbjct  61   LDYHNKNNMMDTSCGENTSGFLHDQPFLASVLSPRNH-----HKSSGSGNHFVEDSHFLR  115

Query  331  TCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNLQIENNGG  489
            TC LC RRLAP +D++MYRGDTAFCSQECR Q+MKQDERKE + N+ I +  G
Sbjct  116  TCGLCKRRLAPGKDLYMYRGDTAFCSQECRAQQMKQDERKE-NRNVMITSKKG  167



>ref|XP_010521201.1| PREDICTED: uncharacterized protein LOC104800162 [Tarenaya hassleriana]
Length=176

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 80/145 (55%), Gaps = 18/145 (12%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGME------DGQPPAVEGQATAVPNGYDHRSMAA  243
            M+LGK+ RPP +RTTSM+ IT+D+   +       D Q P+       +P G + +   A
Sbjct  1    MLLGKRQRPPMKRTTSMSEITIDLNLNLSGESEPSDQQKPSPSVDLRRIPYGQNGQLTTA  60

Query  244  MVSPRYYGG----RTTTMTSGDG--------YHIETPSFLTTCSLCNRRLAPCRDIFMYR  387
            +  PR + G    R     S  G        Y+     FL +C LC R+L P  DI+MYR
Sbjct  61   IDQPRGHHGLLDQRLLAAVSPRGLQRRHSADYNSNAAHFLRSCYLCKRQLVPGHDIYMYR  120

Query  388  GDTAFCSQECREQKMKQDERKERST  462
            GD AFCS ECRE++MKQDE+KE+S 
Sbjct  121  GDRAFCSSECREKQMKQDEKKEKSA  145



>ref|XP_011027684.1| PREDICTED: uncharacterized protein LOC105127902 [Populus euphratica]
Length=150

 Score =   105 bits (261),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 72/127 (57%), Gaps = 8/127 (6%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNG--YDHRSMAAMVSP  255
            M+LGK+ R P +RTTS + IT D+ +   +  PP  +        G   D R ++   S 
Sbjct  1    MLLGKRPRNPLKRTTSFSEITFDLNTATSEAAPPPSDHHQKQAGYGGPLDKRFLSDAGSA  60

Query  256  RYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMK  435
            R      TT        +ET  FL  CSLC RRL P RDI+MYRGD+AFCS ECR+Q+M 
Sbjct  61   R------TTYRRASADFLETAHFLRACSLCKRRLIPGRDIYMYRGDSAFCSLECRQQQMS  114

Query  436  QDERKER  456
             DERKE+
Sbjct  115  LDERKEK  121



>emb|CDX87485.1| BnaA07g33880D [Brassica napus]
Length=154

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 77/130 (59%), Gaps = 5/130 (4%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVE--GQATAV-PNGYDHRSMAAMVS  252
            M+LGK+ RPP  RTTS++ I  D+    E   P   +   Q T V P+G + + +AA V 
Sbjct  1    MLLGKRQRPPINRTTSLSEIKFDLNLPSESEVPSTHQSPNQNTVVGPSGSNGQHVAAAVD  60

Query  253  PRYYGGRTT--TMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQ  426
            PR+    +    +    G   +   FL +CSLC R L P RDI+MYRGDTAFCS ECREQ
Sbjct  61   PRFLAMVSPRGNLRRHSGEFSDAGHFLRSCSLCERLLVPGRDIYMYRGDTAFCSSECREQ  120

Query  427  KMKQDERKER  456
            +M QDE KE+
Sbjct  121  QMTQDEGKEK  130



>gb|KDP46872.1| hypothetical protein JCGZ_24081 [Jatropha curcas]
Length=191

 Score =   105 bits (263),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 90/174 (52%), Gaps = 47/174 (27%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEG--------------QATAVP--  213
            M+LGK+ RP  RRTTSMTGI VD+   M+  +P                    A  +P  
Sbjct  1    MLLGKRPRPHIRRTTSMTGIAVDL-PNMDPTEPSDHNKNNNNQNHQMIGDPPHALPIPVV  59

Query  214  -------------------NGY---DHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFL  327
                               NG    DHR +  MVSPR    R    +SGD   +ET  FL
Sbjct  60   VEVLEEVTSPNYYYNNNDMNGLYDGDHRFLTTMVSPRNNQRR----SSGD--FLETAHFL  113

Query  328  TTCSLCNRRLAPCRDIFM--YRGDTAFCSQECREQKMKQDERKERSTNLQIENN  483
             TC LC RRL P RDI+M  YRGDTAFCS ECRE++MK DER+ER + +Q E++
Sbjct  114  RTCGLCKRRLVPGRDIYMYRYRGDTAFCSLECREKQMKHDERRERCSRVQKEDH  167



>emb|CDP01192.1| unnamed protein product [Coffea canephora]
Length=163

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 79/138 (57%), Gaps = 17/138 (12%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAV----PN----GYDHRSM  237
            M+LGK+ RPP +RTTSMT  ++D+     +G    V G         PN    G D R M
Sbjct  1    MLLGKRQRPPMKRTTSMTEFSLDLSIAAVEGGGGGVNGGVNVSQQFDPNNPCKGLDQRFM  60

Query  238  AAMV-----SPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAF  402
            AA       SPR    R  ++     +  ET  FL  CSLC RRL P RDI+MYRGD+AF
Sbjct  61   AAAAVSPSPSPRPRNLRRNSV----DFTTETAHFLRACSLCKRRLIPGRDIYMYRGDSAF  116

Query  403  CSQECREQKMKQDERKER  456
            CS ECR+Q+M QDERKE+
Sbjct  117  CSLECRQQQMNQDERKEK  134



>ref|XP_010060157.1| PREDICTED: uncharacterized protein LOC104448072 [Eucalyptus grandis]
 ref|XP_010042498.1| PREDICTED: uncharacterized protein LOC104431587 [Eucalyptus grandis]
 gb|KCW66725.1| hypothetical protein EUGRSUZ_F00485 [Eucalyptus grandis]
Length=152

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 79/128 (62%), Gaps = 11/128 (9%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPP-AVEGQATAVP-NGYDHR-SMAAMVS  252
            M LGK+ R   +RTTSMT IT D+    E   PP + +G   A P  G+D R  M    S
Sbjct  1    MSLGKRPRQ-MKRTTSMTEITFDLSINDEAAAPPPSRKGHKPAGPGEGWDPRLVMPGPAS  59

Query  253  PRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKM  432
            PR +   +  +       I+T  FL +CSLC RRL P RDI+MYRGD+AFCS ECR+Q+M
Sbjct  60   PRPHRRHSCEI-------IDTADFLRSCSLCKRRLVPGRDIYMYRGDSAFCSLECRQQQM  112

Query  433  KQDERKER  456
            KQDERKE+
Sbjct  113  KQDERKEK  120



>ref|XP_010269192.1| PREDICTED: uncharacterized protein LOC104605932 [Nelumbo nucifera]
Length=164

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 80/144 (56%), Gaps = 27/144 (19%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGS-----------GMEDGQPPAVEGQAT--------  204
            M+LGK+ R P RRTTS+T  TVD+ +            M+D Q P  E            
Sbjct  1    MLLGKRPRLPMRRTTSLTEFTVDLNNVEAPVPSDPQNPMKDRQKPVGEETHARRTQPGGG  60

Query  205  AVPNGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMY  384
              P G++ R + A VSPR     +  +       ++T  FL  C LC RRLAP RDI+MY
Sbjct  61   KAPGGFNDR-LLATVSPRNPRRNSADL-------VQTAHFLRACGLCKRRLAPGRDIYMY  112

Query  385  RGDTAFCSQECREQKMKQDERKER  456
            RGD+AFCS ECR+Q+M QDERKE+
Sbjct  113  RGDSAFCSLECRQQQMNQDERKEK  136



>ref|XP_010529093.1| PREDICTED: uncharacterized protein LOC104806075 [Tarenaya hassleriana]
 ref|XP_010523331.1| PREDICTED: uncharacterized protein LOC104801701 [Tarenaya hassleriana]
 ref|XP_010527300.1| PREDICTED: uncharacterized protein LOC104804657 [Tarenaya hassleriana]
Length=134

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 73/133 (55%), Gaps = 17/133 (13%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPP-------AVEGQATAVPNGYDHRSMA  240
            M+LGK+  PP RRTTSM GITVD  + ME  QP        AV    T   N    R   
Sbjct  1    MLLGKRPGPPIRRTTSMVGITVDPTATMEASQPSDYPETIMAVHQNPTTAMNPRSSR---  57

Query  241  AMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECR  420
              ++PR Y  R             + +FL TCSLCNR L   RDI+MYRGD AFCS ECR
Sbjct  58   --IAPRKYQKRNPPAAEN-----ASDNFLRTCSLCNRHLRHNRDIYMYRGDKAFCSLECR  110

Query  421  EQKMKQDERKERS  459
            E++M  DERK ++
Sbjct  111  EKQMMLDERKAKN  123



>gb|AFK38834.1| unknown [Lotus japonicus]
Length=154

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 78/126 (62%), Gaps = 8/126 (6%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPP-AVEGQATAVPNGYDHRSMAAMVSPR  258
            M+LGK+ RPP +RTTSM+ IT+D+ +         +  G +    NG D   + A V PR
Sbjct  1    MLLGKRPRPPMKRTTSMSEITLDLNTTTVVTTDVRSGGGGSGGFNNGLDQTKVLAPVPPR  60

Query  259  YYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQ  438
             +   ++  T        TP FL +C LC RRL P RDI+MYRGD+AFCS ECR+Q+MKQ
Sbjct  61   NHRRHSSDFTG-------TPDFLRSCCLCRRRLVPGRDIYMYRGDSAFCSLECRQQQMKQ  113

Query  439  DERKER  456
            DERKE+
Sbjct  114  DERKEK  119



>ref|XP_009590782.1| PREDICTED: uncharacterized protein LOC104087903 isoform X2 [Nicotiana 
tomentosiformis]
Length=171

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 73/123 (59%), Gaps = 26/123 (21%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPA-----------------VEGQ---A  201
            MMLGK+ RPP RRTTSMTGITVD+G+G    Q P+                  E Q   +
Sbjct  1    MMLGKRGRPPMRRTTSMTGITVDIGTGTGSEQEPSDYRPKVIVDHHDQFKGSSEKQVMMS  60

Query  202  TAVPNGYDHRS-MAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIF  378
            +    GYDH+  MAAMVSPRY         SG+G+  ET +FL TC LCNRRLAP RDI+
Sbjct  61   STTAGGYDHQYFMAAMVSPRY-----QRRISGEGFQTETANFLRTCGLCNRRLAPGRDIY  115

Query  379  MYR  387
            MYR
Sbjct  116  MYR  118



>ref|XP_008440627.1| PREDICTED: uncharacterized protein LOC103484988 [Cucumis melo]
Length=165

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 80/146 (55%), Gaps = 14/146 (10%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQA---------TAVPNGYDHRS  234
            M+LGK+ R P +RTTSMTGI  D+     + QP                 +VP      +
Sbjct  1    MLLGKRPRLPIKRTTSMTGIRGDIPDVEFEEQPSDQNNTGYDLLHHPMPVSVPRNTTAIN  60

Query  235  MAAMVSPRYYGGRTTTMTSGDGY-HIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQ  411
             +A+VSPR         ++ DG        FL TC LC RRLAP RDI+MYRGDTAFCS 
Sbjct  61   YSALVSPR----NLRNQSARDGLSQPPNDHFLRTCGLCKRRLAPGRDIYMYRGDTAFCSS  116

Query  412  ECREQKMKQDERKERSTNLQIENNGG  489
            ECRE+++K+DERKE     + E  GG
Sbjct  117  ECREKQIKEDERKEYGGKKKEERQGG  142



>gb|EYU43555.1| hypothetical protein MIMGU_mgv1a015819mg [Erythranthe guttata]
Length=144

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 76/129 (59%), Gaps = 12/129 (9%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            MMLGK+ RPP +RTTSMT  T+D   G  D     ++       N ++  + AA  SPR 
Sbjct  1    MMLGKRGRPPMKRTTSMTEFTLDFTGGGADAVYQPLDPH-----NPFNVGAAAAAASPRS  55

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +        S D   ++T  FL  C LC RRL P RDIFMYRGD+AFCS ECR+ +M QD
Sbjct  56   H-----RRNSAD--FVQTAQFLRVCFLCQRRLVPGRDIFMYRGDSAFCSLECRQNQMTQD  108

Query  442  ERKERSTNL  468
            ERKE+  +L
Sbjct  109  ERKEKKCSL  117



>ref|XP_010526654.1| PREDICTED: uncharacterized protein LOC104804160 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526655.1| PREDICTED: uncharacterized protein LOC104804160 isoform X2 [Tarenaya 
hassleriana]
Length=139

 Score =   102 bits (254),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 78/134 (58%), Gaps = 19/134 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDG------------QPPAVEGQATAVPNGYD  225
            M++GK+ RP  RRTTS+TGITV++ +   +                +      AV  GY+
Sbjct  1    MLVGKRPRPQMRRTTSVTGITVELTNQEAESACSDHPNGGVGAGGGSAVAWTAAVAGGYE  60

Query  226  HRSMAAMVSPRYYGGRTTTMTSGDG-YHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAF  402
             R    M+SPR   GR      GD  Y +ET  FL  C LC RRLAP RDI+MY+GDTAF
Sbjct  61   QR---LMMSPRNDVGRKNC---GDCRYSLETSHFLRICGLCKRRLAPGRDIYMYKGDTAF  114

Query  403  CSQECREQKMKQDE  444
            CS+ECREQ+M+ DE
Sbjct  115  CSEECREQQMEHDE  128



>gb|EYU24010.1| hypothetical protein MIMGU_mgv1a015307mg [Erythranthe guttata]
Length=161

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 76/124 (61%), Gaps = 8/124 (6%)
 Frame = +1

Query  85   MLGKQSRPPFRRTTSMTGITVDVGSGMED---GQPPAVEGQATAVPNG--YDHRSMAAMV  249
            MLGK+    FRRTTSM  I  DVG   E+      P ++   T +  G  ++      M+
Sbjct  1    MLGKRGSSSFRRTTSMKEINFDVGCMEEETAAAAAPPLQPPLTVIGGGGEFNGCDYNYML  60

Query  250  SPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQK  429
            SPRY+G  +   ++G    + T  FL +C LCNRRLAP RDI+MYRGDTAFCS ECREQ+
Sbjct  61   SPRYFGNTSPVFSAGG---VGTADFLRSCGLCNRRLAPRRDIYMYRGDTAFCSLECREQQ  117

Query  430  MKQD  441
            +KQD
Sbjct  118  IKQD  121



>ref|XP_009590789.1| PREDICTED: uncharacterized protein LOC104087903 isoform X3 [Nicotiana 
tomentosiformis]
Length=157

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 73/123 (59%), Gaps = 26/123 (21%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPA-----------------VEGQ---A  201
            MMLGK+ RPP RRTTSMTGITVD+G+G    Q P+                  E Q   +
Sbjct  1    MMLGKRGRPPMRRTTSMTGITVDIGTGTGSEQEPSDYRPKVIVDHHDQFKGSSEKQVMMS  60

Query  202  TAVPNGYDHRS-MAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIF  378
            +    GYDH+  MAAMVSPRY         SG+G+  ET +FL TC LCNRRLAP RDI+
Sbjct  61   STTAGGYDHQYFMAAMVSPRY-----QRRISGEGFQTETANFLRTCGLCNRRLAPGRDIY  115

Query  379  MYR  387
            MYR
Sbjct  116  MYR  118



>emb|CDX88407.1| BnaC06g38510D [Brassica napus]
Length=154

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 76/130 (58%), Gaps = 5/130 (4%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEG--QATAV-PNGYDHRSMAAMVS  252
            M+LGK+ RPP  RTTS++ I  D+    E   P   +   Q T V  +G + + +AA V 
Sbjct  1    MLLGKRQRPPINRTTSLSEIKFDLNLPSESDVPSTQQSPSQNTVVGLSGSNGQYVAAAVD  60

Query  253  PRYYGGRTT--TMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQ  426
            PRY    +    +    G   +   FL +CSLC R L P RDI+MYRGDTAFCS ECREQ
Sbjct  61   PRYLAMVSPRGNLRRHSGEFSDAGHFLRSCSLCERLLVPGRDIYMYRGDTAFCSSECREQ  120

Query  427  KMKQDERKER  456
            +M QDE KE+
Sbjct  121  QMTQDEGKEK  130



>ref|XP_009596984.1| PREDICTED: uncharacterized protein LOC104092991 [Nicotiana tomentosiformis]
Length=156

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 81/153 (53%), Gaps = 28/153 (18%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSG-----------MEDGQPPAVEGQATAVPNGYDH  228
            M+LGK++RPP +RTTSM   T+D+               +   P    G      NG D 
Sbjct  1    MLLGKRARPPIKRTTSMKEFTLDLNINDPSVAVINYQPFDPLNPYNFTGPIPPASNGLDQ  60

Query  229  RSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCS  408
            R +             T   S D + +ET  FL  C LC R+L P RDI+MYRGD+AFCS
Sbjct  61   RLI------------LTRRRSADNF-VETAHFLRACFLCKRQLIPGRDIYMYRGDSAFCS  107

Query  409  QECREQKMKQDERKER----STNLQIENNGGIS  495
             +CRE++MKQDERKE+    +T  ++ N+  I+
Sbjct  108  LDCREKQMKQDERKEKFPKVATRKKVTNSAAIA  140



>ref|XP_007141143.1| hypothetical protein PHAVU_008G171100g [Phaseolus vulgaris]
 gb|ESW13137.1| hypothetical protein PHAVU_008G171100g [Phaseolus vulgaris]
Length=138

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 73/125 (58%), Gaps = 19/125 (15%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+ RPP +RTTSM+ IT+D+ +   D              N     +    ++P+ 
Sbjct  1    MLLGKRPRPPMKRTTSMSEITLDLNAAASDAA------------NQRRSGASGGALTPKI  48

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
                ++ +       ++TP FL  C+LC  RLAP RDI+MYRGD+AFCS ECR+ +M QD
Sbjct  49   LRRHSSDL-------VDTPHFLRVCALCKGRLAPGRDIYMYRGDSAFCSLECRQHQMNQD  101

Query  442  ERKER  456
            ERKE+
Sbjct  102  ERKEK  106



>ref|XP_009128272.1| PREDICTED: uncharacterized protein LOC103853106 [Brassica rapa]
 emb|CDY26845.1| BnaA02g18700D [Brassica napus]
Length=163

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 78/143 (55%), Gaps = 23/143 (16%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVG----SGMEDGQ----------PPAVEGQATAVP--  213
            M+LGK+ RPP +RTTS++ I  D+     S +   Q          P    GQ  A    
Sbjct  1    MLLGKRQRPPIKRTTSLSEIKFDLNLPAESEVSSNQQSPTQTTVVGPYGSNGQVVAASVN  60

Query  214  --NGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYR  387
               G D R +A MV+PR  G     +    G   +   FL +CSLC R L P RDI+MYR
Sbjct  61   QQRGIDERFLA-MVTPRPRG----NLRRHSGDFADAGHFLRSCSLCERLLVPGRDIYMYR  115

Query  388  GDTAFCSQECREQKMKQDERKER  456
            GDTAFCS ECR+Q+M QDERKE+
Sbjct  116  GDTAFCSSECRQQQMAQDERKEK  138



>ref|XP_010025488.1| PREDICTED: uncharacterized protein LOC104415811 [Eucalyptus grandis]
 gb|KCW62153.1| hypothetical protein EUGRSUZ_H04814 [Eucalyptus grandis]
Length=164

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 84/163 (52%), Gaps = 39/163 (24%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITV---------DVGSGMEDGQPPAVEG---QATAVPNGYD  225
            M+LGK+ R   +RTTS+T ITV         ++ SG     PP   G    A A  + YD
Sbjct  1    MLLGKRPRHRIQRTTSVTSITVVDLEVDDEQELPSGDARQDPPGEGGPPLSAVAPDHRYD  60

Query  226  -----------------HRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRR  354
                               S  A+VSPR Y     +    +G H     FL TC LC RR
Sbjct  61   GEDGENINVDGFGPYDPQSSFLALVSPRNY-----SSMEAEGAH-----FLNTCGLCKRR  110

Query  355  LAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNLQIENN  483
            L P RDI+MYRGDTAFCS ECREQ+MK+DE+KE+ +N  +  N
Sbjct  111  LFPGRDIYMYRGDTAFCSLECREQQMKEDEKKEKHSNPNVAAN  153



>ref|XP_007018848.1| Uncharacterized protein TCM_034955 [Theobroma cacao]
 gb|EOY16073.1| Uncharacterized protein TCM_034955 [Theobroma cacao]
Length=177

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 75/155 (48%), Gaps = 38/155 (25%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPN---------------  216
            M+LGK+ RPP +RTTSM  IT D+ +   +  P          P                
Sbjct  1    MLLGKRPRPPMKRTTSMKEITFDLNTSNAEAPPSDRHNPLNNYPKQAAGPFGGVWGPQIQ  60

Query  217  ---------------GYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNR  351
                           G+D R + A VSPR +   +          IET  FL  C LC R
Sbjct  61   ANGGGGAAGGGSGLEGFDQR-LLATVSPRAHRRHSADF-------IETAHFLRACGLCRR  112

Query  352  RLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            RL P RDI+MYRGDTAFCS ECR+Q+M QDE+KE+
Sbjct  113  RLVPGRDIYMYRGDTAFCSLECRQQQMNQDEKKEK  147



>ref|XP_010105883.1| hypothetical protein L484_021540 [Morus notabilis]
 gb|EXC06702.1| hypothetical protein L484_021540 [Morus notabilis]
Length=165

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 73/134 (54%), Gaps = 11/134 (8%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSG--MEDGQPPAVEGQATAVPNGYDHRSMAAMVSP  255
            M+LGK+ RPP +RTTSMT IT D+ +   M   QP              D R +AA    
Sbjct  1    MLLGKRPRPPMKRTTSMTEITFDLSTNDEMMSSQPSDPHNPFKVDVRQQDQRLLAAHNHN  60

Query  256  RYY-------GGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQE  414
                        R     S D   +ET  FL +CSLC RRL P RDI+MYRGD+AFCS E
Sbjct  61   NNNSNHMMMASPRNHRRNSAD--FVETSHFLRSCSLCRRRLVPNRDIYMYRGDSAFCSLE  118

Query  415  CREQKMKQDERKER  456
            CR+Q+M QDER E+
Sbjct  119  CRQQQMNQDERMEK  132



>ref|XP_006390032.1| hypothetical protein EUTSA_v10019245mg [Eutrema salsugineum]
 gb|ESQ27318.1| hypothetical protein EUTSA_v10019245mg [Eutrema salsugineum]
Length=162

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 75/141 (53%), Gaps = 22/141 (16%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVD--------VGSGMEDGQPPAVEGQATAVPN-------  216
            M+LGK+ RPP  RTTS++ I  D        V +     Q P V    +   N       
Sbjct  1    MLLGKRQRPPINRTTSLSEIKFDLNLPGETEVSNQQNPSQNPVVGSYVSNAQNIAAVDQH  60

Query  217  -GYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGD  393
             G   +   AMVSPR    R +   S  G+      FL +CSLC R L P RDI+MYRGD
Sbjct  61   RGLLDQRFLAMVSPRGNLRRHSGDFSDAGH------FLRSCSLCERLLVPGRDIYMYRGD  114

Query  394  TAFCSQECREQKMKQDERKER  456
            TAFCS ECR+Q+M QDERKE+
Sbjct  115  TAFCSSECRQQQMAQDERKEK  135



>ref|XP_002513883.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48466.1| conserved hypothetical protein [Ricinus communis]
Length=172

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 74/127 (58%), Gaps = 4/127 (3%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSG--MEDGQPPAVEGQATAVPNGYDHRSMAAMVSP  255
            M+LGK+ RPP +RTTS++ IT D+ +    E  Q  A  G       G   +     ++ 
Sbjct  1    MLLGKRPRPPMKRTTSLSEITFDLDTNGSCESAQQAAGFGGDGTGTGGGQQQLDQRFLAA  60

Query  256  RYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMK  435
                 R     S D   +ET  FL +CSLC+RRL   RDI+MYRGD+AFCS ECR+Q+M 
Sbjct  61   ATISPRNHRRASAD--FLETAHFLRSCSLCHRRLVTGRDIYMYRGDSAFCSLECRQQQMN  118

Query  436  QDERKER  456
            QDERKE+
Sbjct  119  QDERKEK  125



>ref|XP_011074154.1| PREDICTED: uncharacterized protein LOC105158935 [Sesamum indicum]
Length=152

 Score =   100 bits (248),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 73/131 (56%), Gaps = 14/131 (11%)
 Frame = +1

Query  85   MLGKQSRPPFRRTTSMTGITVDVGSGMEDG-------QPPAVEGQATAVPNGYDHRSMAA  243
            MLGK++R P +RTTSMT  T+DV +   +G         P   G    V   Y   S AA
Sbjct  1    MLGKRARQPMKRTTSMTEFTLDVNAAAAEGVFHPSDPHNPFNAGGVAGVDQRYAASSAAA  60

Query  244  MVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECRE  423
              S R          S D   I T  FL  CSLC RRL P RDI+MYRGD+AFCS ECRE
Sbjct  61   ANSTR-----PQRRNSAD--FIGTAIFLRVCSLCKRRLVPGRDIYMYRGDSAFCSLECRE  113

Query  424  QKMKQDERKER  456
            Q+M QDERKE+
Sbjct  114  QQMTQDERKEK  124



>ref|XP_010472001.1| PREDICTED: uncharacterized protein LOC104751697 [Camelina sativa]
Length=162

 Score =   100 bits (249),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 82/147 (56%), Gaps = 21/147 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVG----SGMEDGQ-PPAVEG-------QATAVPN---  216
            M+LGK+ RPP  RTTS++ I  D+     S   D Q PPAV G         TA  +   
Sbjct  1    MLLGKRQRPPINRTTSLSEIKFDLNLPSESETSDQQNPPAVVGPYVSNGQHVTADVDQNR  60

Query  217  GYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDT  396
            G+  + + +MVSPR        +    G   +   FL +CSLC R L P RDI+MYRGD 
Sbjct  61   GFLDQRLLSMVSPR------GNLRRHSGDFTDAGHFLRSCSLCERLLVPGRDIYMYRGDK  114

Query  397  AFCSQECREQKMKQDERKERSTNLQIE  477
            AFCS ECR+++M QDERKE+  +  ++
Sbjct  115  AFCSSECRQEQMAQDERKEKGKSAPVK  141



>ref|XP_010428907.1| PREDICTED: uncharacterized protein LOC104713477 [Camelina sativa]
Length=162

 Score =   100 bits (248),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 81/147 (55%), Gaps = 21/147 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVG----SGMEDGQ-PPAVEG-------QATAVPN---  216
            M+LGK+ RPP  RTTS++ I  D+     S   D Q PP + G         TA  +   
Sbjct  1    MLLGKRQRPPINRTTSLSEIKFDLNLPSESETSDQQNPPVITGPYVSNGQHVTAAADQNR  60

Query  217  GYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDT  396
            G+  + + +MVSPR        +    G   +   FL +CSLC R L P RDI+MYRGD 
Sbjct  61   GFLDQRLLSMVSPR------GNLRRHSGDFTDAGHFLRSCSLCERLLVPGRDIYMYRGDK  114

Query  397  AFCSQECREQKMKQDERKERSTNLQIE  477
            AFCS ECR+++M QDERKE+  +  ++
Sbjct  115  AFCSSECRQEQMAQDERKEKGKSAPVK  141



>emb|CDX72671.1| BnaC07g46930D [Brassica napus]
Length=131

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 80/137 (58%), Gaps = 9/137 (7%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNG---YDHRSMAAMVS  252
            M+LG + +P  +RT S+T IT+++      GQ   V   A AV +G   YDHR +A M S
Sbjct  1    MLLGNRRQPHMQRTRSITRITIEIDDTHTAGQDSDV---AMAVVDGGYNYDHRFLA-MFS  56

Query  253  PRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKM  432
            PR +  R      G    + + SFL +C  C RRL P  DI+MY+GD AFCS ECREQ+M
Sbjct  57   PRNH--RRNERKDGGKSSLPSSSFLGSCGFCKRRLTPGHDIYMYKGDAAFCSVECREQQM  114

Query  433  KQDERKERSTNLQIENN  483
            + DE K R+ ++   +N
Sbjct  115  EHDEGKARNCDVLSPSN  131



>ref|XP_010416769.1| PREDICTED: uncharacterized protein LOC104702585 [Camelina sativa]
Length=163

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 81/148 (55%), Gaps = 22/148 (15%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVG----SGMEDGQ-PPAV-------EGQ----ATAVP  213
            M+LGK+ RPP  RTTS++ I  D+     S   D Q PPAV        GQ    A    
Sbjct  1    MLLGKRQRPPINRTTSLSEIKFDLNLPSESETSDQQNPPAVVVGPYVSNGQHVTAAVDQN  60

Query  214  NGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGD  393
             G+  + + +MVSPR        +    G   +   FL +CSLC R L P RDI+MYRGD
Sbjct  61   RGFLDQRLLSMVSPR------GNLRRHSGDFTDAGHFLRSCSLCERLLVPGRDIYMYRGD  114

Query  394  TAFCSQECREQKMKQDERKERSTNLQIE  477
             AFCS ECR+++M QDERKE+  +  ++
Sbjct  115  KAFCSSECRQEQMAQDERKEKGKSAPVK  142



>emb|CDY14641.1| BnaC02g24720D [Brassica napus]
Length=163

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 76/143 (53%), Gaps = 23/143 (16%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVG----SGMEDGQ----------PPAVEGQATAVP--  213
            M+LGK+ RPP  RTTS++ I  D+     S +   Q          P    GQ  A    
Sbjct  1    MLLGKRQRPPINRTTSLSEIKFDLNLPPESEVSSNQQSPTQTTVVGPYGSNGQVVAASVN  60

Query  214  --NGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYR  387
               G D R   AMV+PR  G     +    G   +   FL +CSLC R L P RDI+MYR
Sbjct  61   QQRGIDKR-FQAMVTPRPRG----NLRRHSGDFSDAGHFLRSCSLCERLLVPGRDIYMYR  115

Query  388  GDTAFCSQECREQKMKQDERKER  456
            GDTAFCS ECR+Q+M QDERKE+
Sbjct  116  GDTAFCSSECRQQQMAQDERKEK  138



>ref|XP_004143480.1| PREDICTED: uncharacterized protein LOC101212321 [Cucumis sativus]
 gb|KGN48767.1| hypothetical protein Csa_6G500590 [Cucumis sativus]
Length=157

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 77/129 (60%), Gaps = 6/129 (5%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYD-HRSMAAMVSPR  258
            M+LGK+ R P +RTTSMTGI  D+   +E  + P+ +        GYD H  +  +  P 
Sbjct  1    MLLGKRPRLPIKRTTSMTGIRGDI-PDVEFEEQPSSDQIINNPGGGYDLHHPIPPVSLPH  59

Query  259  YYGG-RTTTMTSGDGYHIETP---SFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQ  426
                   + + S      ++P    FL TC LC RRLAP RDI+MYRGDTAFCS ECRE+
Sbjct  60   NTTAINYSALVSPRNLRDQSPPNDHFLRTCGLCKRRLAPGRDIYMYRGDTAFCSSECREK  119

Query  427  KMKQDERKE  453
            ++K+DERKE
Sbjct  120  QIKEDERKE  128



>ref|XP_002285807.2| PREDICTED: uncharacterized protein LOC100252409 [Vitis vinifera]
Length=208

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 80/141 (57%), Gaps = 24/141 (17%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGME---DGQPPAVE--------GQATAVPNG---  219
            M+LGK+ RPP +RTTSMT  T+D  S  +   D Q P  +        G     P+G   
Sbjct  52   MLLGKRPRPPMKRTTSMTEFTLDPNSVQQPPSDSQNPFKDRPKSVGFGGDPYRQPSGVDG  111

Query  220  --YDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGD  393
              +DHR ++A VSPR    R  +    D  H     FL  C LC RRL   RDI+MYRGD
Sbjct  112  YGFDHRFLSA-VSPR--NPRRYSADFVDNSH-----FLRACCLCKRRLVSGRDIYMYRGD  163

Query  394  TAFCSQECREQKMKQDERKER  456
            +AFCS ECR+Q+M QDERKE+
Sbjct  164  SAFCSLECRQQQMNQDERKEK  184



>ref|XP_006416227.1| hypothetical protein EUTSA_v10008987mg [Eutrema salsugineum]
 gb|ESQ34580.1| hypothetical protein EUTSA_v10008987mg [Eutrema salsugineum]
Length=156

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 80/140 (57%), Gaps = 18/140 (13%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVG-------SGMEDGQPPAVEGQATAVPNGYDH----  228
            M+LGK+ RPP +RTTS++ I  D+        S  +   PP+ +   T   +G  H    
Sbjct  1    MLLGKRQRPPIKRTTSLSEIKFDLNLPSEQEPSDHQIQNPPSRKQLMTVDEHGDVHHHVT  60

Query  229  --RSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAF  402
              + + AMVSPR   G     ++ +  H     FL +CSLC R L P RDI+MYRGD AF
Sbjct  61   LDQRLLAMVSPR---GAQRRHSADNSTH--AGEFLRSCSLCKRHLVPGRDIYMYRGDRAF  115

Query  403  CSQECREQKMKQDERKERST  462
            CS ECR+Q++  DERKE+++
Sbjct  116  CSLECRQQQITVDERKEKAS  135



>ref|XP_006305752.1| hypothetical protein CARUB_v10010569mg [Capsella rubella]
 gb|EOA38650.1| hypothetical protein CARUB_v10010569mg [Capsella rubella]
Length=147

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 74/132 (56%), Gaps = 17/132 (13%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDH-------RSMA  240
            M+LGK+ RPP +RTTS++ I  D+    E  Q P+         + + H       + + 
Sbjct  1    MLLGKRQRPPIKRTTSLSEIKFDLNQPSE--QEPSDHQIQLVTIDEHRHVHQRLLDQRLL  58

Query  241  AMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECR  420
            AMVSPR    R +   S D        FL +CSLC R L P RDI+MYRGD AFCS ECR
Sbjct  59   AMVSPRGTQRRHSADCSED--------FLRSCSLCKRHLVPGRDIYMYRGDRAFCSLECR  110

Query  421  EQKMKQDERKER  456
            +Q++  DERKE+
Sbjct  111  QQQITVDERKEK  122



>gb|KHG27100.1| 50s ribosomal l24e [Gossypium arboreum]
Length=168

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 80/144 (56%), Gaps = 27/144 (19%)
 Frame = +1

Query  82   MMLGKQSRP--PFRRTTSMTGITVDVG-SGMEDGQPP---------------AVEG-QAT  204
            M LGK+ RP  P +RTTS+  IT D+  S + +  PP                V G Q  
Sbjct  1    MQLGKRPRPRQPMKRTTSLMEITFDLNTSNVAEAAPPPDPLNPFKNHPKQQAGVWGPQIQ  60

Query  205  AVPNGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMY  384
            A   G D +S+A  VSPR +   +          +ET  FL +C LC RRL P RDI+MY
Sbjct  61   ADDGGLDQQSLAT-VSPRVHRRHSADF-------METSHFLRSCGLCRRRLVPGRDIYMY  112

Query  385  RGDTAFCSQECREQKMKQDERKER  456
            RGD+AFCS ECR+Q+M QDE+KE+
Sbjct  113  RGDSAFCSLECRQQQMNQDEKKEK  136



>ref|XP_008367211.1| PREDICTED: uncharacterized protein LOC103430537 [Malus domestica]
Length=194

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 79/167 (47%), Gaps = 47/167 (28%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPN---------------  216
            M+LGK+ RPP +RT SMTGIT+D+     +GQ P  + Q  +  N               
Sbjct  1    MLLGKRPRPPMKRTASMTGITIDLTDV--EGQEPTYDLQNPSAINDEHAVAVAATVVGPQ  58

Query  217  ---------------------------GYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIET  315
                                        Y+      M+SPR    R  + +      +ET
Sbjct  59   EPCPVINNNHNSNYNIEKMNMNNISLGNYEEHRFLTMLSPRNNHRRRNSASQDV---VET  115

Query  316  PSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
              FL TC LC R+LA  RDI+MYRGDTAFCS ECREQ+ KQDER E+
Sbjct  116  AHFLRTCGLCKRQLASGRDIYMYRGDTAFCSLECREQQXKQDERIEK  162



>ref|XP_009390578.1| PREDICTED: uncharacterized protein LOC103976940 [Musa acuminata 
subsp. malaccensis]
Length=190

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 81/161 (50%), Gaps = 31/161 (19%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVG-SGMEDGQPP-------------------------  183
            M+LGK+ RPP RRTTSMT    DV  + +E  Q P                         
Sbjct  13   MLLGKRQRPPMRRTTSMTEFAADVVLTDVEATQAPFDHEKTSDVLHHQWNPWMEPQRAAE  72

Query  184  -AVEGQATAVPNGYDHRSMAAMV-SPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRL  357
               + +A+ V N  + R   ++V SPR  G R     S D   +ET  FL  C LC RRL
Sbjct  73   LPAQRRASGVANWLEARYHGSLVLSPRTGGHRKN---SADLAVVETAPFLRACGLCKRRL  129

Query  358  APCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNLQIEN  480
             P RD FMYRGD AFCS ECR+Q +  +ERKE+ +   I++
Sbjct  130  GPGRDTFMYRGDIAFCSLECRQQHINLEERKEKCSLTSIKD  170



>ref|XP_006302931.1| hypothetical protein CARUB_v10021070mg [Capsella rubella]
 gb|EOA35829.1| hypothetical protein CARUB_v10021070mg [Capsella rubella]
Length=162

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 79/146 (54%), Gaps = 20/146 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGME----DGQPPAVEGQ----------ATAVPNG  219
            M+LGK+ RPP  RTTS++ I  D+    E    D Q P   G           A     G
Sbjct  1    MLLGKRQRPPINRTTSLSEIKFDLNLPSESEPSDQQNPTAVGPYVSNGQLVTPAADQNRG  60

Query  220  YDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTA  399
            +  + + +MVSPR    R +   S  G+      FL +CSLC R L P RDI+MYRGD A
Sbjct  61   FLDQRLLSMVSPRGNPRRHSGDFSDAGH------FLRSCSLCERLLVPGRDIYMYRGDKA  114

Query  400  FCSQECREQKMKQDERKERSTNLQIE  477
            FCS ECR+++M QDERKE+  +  ++
Sbjct  115  FCSSECRQEQMAQDERKEKGKSAPVK  140



>gb|KDO80904.1| hypothetical protein CISIN_1g029576mg [Citrus sinensis]
Length=191

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 82/151 (54%), Gaps = 26/151 (17%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQA---TAVPNGY----------  222
            M+LGK+ RPP +RTTS++ I+ D+  G +D    A   Q    TA    +          
Sbjct  1    MLLGKRPRPPMKRTTSLSEISFDLDGGGDDSSSAAASHQQKNPTAALTKHPGSGGGGVDD  60

Query  223  -DHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMY-----  384
             D R ++ + SPR         ++     +ETP FL TC LC RRL P RDI+MY     
Sbjct  61   VDQRFLSTVSSPRNNNNNNNRHSAD---FLETPHFLRTCGLCKRRLVPGRDIYMYRLFLL  117

Query  385  ----RGDTAFCSQECREQKMKQDERKERSTN  465
                RGD+AFCS ECR+Q+M QDERK++ T+
Sbjct  118  MCFCRGDSAFCSLECRQQQMNQDERKQKCTS  148



>ref|XP_004150522.1| PREDICTED: uncharacterized protein LOC101206644 [Cucumis sativus]
 ref|XP_004173860.1| PREDICTED: uncharacterized protein LOC101230847 [Cucumis sativus]
 gb|KGN54618.1| hypothetical protein Csa_4G378780 [Cucumis sativus]
Length=151

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 75/127 (59%), Gaps = 14/127 (11%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVG-SGMEDGQ-PPAVEGQATAVPNGYDHRSMAAMVSP  255
            M LGK+SR P R+T SMT IT D+G +G    Q PP++        +GY       MVSP
Sbjct  1    MSLGKRSRAPIRKTPSMTEITFDLGGTGSAAEQFPPSLGYPTNTQISGYQQ-----MVSP  55

Query  256  RYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMK  435
            R +   +  +        E  +FL  CSLC+R L P RDI+MYRGD  FCS ECR+++MK
Sbjct  56   RNFRRHSVDLQ-------ENANFLRACSLCSRPLVPGRDIYMYRGDRGFCSDECRQKQMK  108

Query  436  QDERKER  456
            QDER E+
Sbjct  109  QDERMEK  115



>ref|NP_565167.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF17687.1|AC009243_14 F28K19.24 [Arabidopsis thaliana]
 gb|AAL36238.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51406.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36058.1| uncharacterized protein AT1G78020 [Arabidopsis thaliana]
Length=162

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 78/139 (56%), Gaps = 20/139 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGME----DGQPPAV------EGQATAVP----NG  219
            M+LGK+ RPP  RTTS++ I  D+    E    + Q P V       GQA         G
Sbjct  1    MLLGKRQRPPINRTTSLSEIKFDLNLPSESEPSNQQKPTVASPYGSNGQAVTAAVDQNRG  60

Query  220  YDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTA  399
            +  + + +MV+PR    R +   S  G+      FL +C+LC R L P RDI+MYRGD A
Sbjct  61   FLDQRLLSMVTPRGNLRRHSGDFSDAGH------FLRSCALCERLLVPGRDIYMYRGDKA  114

Query  400  FCSQECREQKMKQDERKER  456
            FCS ECR+++M QDERKE+
Sbjct  115  FCSSECRQEQMAQDERKEK  133



>ref|XP_010534566.1| PREDICTED: uncharacterized protein LOC104810072 [Tarenaya hassleriana]
Length=165

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 77/148 (52%), Gaps = 36/148 (24%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVG-----------------------SGMEDGQPPAVE  192
            M+LGK+ RPP  RTTSM+ I  D+                        SG+ D    AV+
Sbjct  1    MLLGKRQRPPMNRTTSMSEIRSDLNLPGESEPSDQLNPPSLTDPHRRPSGLNDQLIVAVD  60

Query  193  GQATAVPNGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRD  372
                +    +D R + AMVSPR    R +   + D        FL +CSLC RRL P  D
Sbjct  61   QHRGS----FDQR-LLAMVSPRGLQRRHSADYNSD--------FLRSCSLCKRRLVPGHD  107

Query  373  IFMYRGDTAFCSQECREQKMKQDERKER  456
            I+MYRGD AFCS ECRE ++KQDE+KE+
Sbjct  108  IYMYRGDRAFCSSECREHQIKQDEKKEK  135



>ref|NP_001239707.1| uncharacterized protein LOC100796944 [Glycine max]
 gb|ACU22977.1| unknown [Glycine max]
Length=143

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 77/125 (62%), Gaps = 8/125 (6%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+ RPP +RTTSM+ +T+D+ +  +     A + ++   P+    ++   + SP+ 
Sbjct  1    MLLGKRPRPPMKRTTSMSEMTLDLNTAADAAAA-ADQQRSGVGPSAAADQTTRMLASPKI  59

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
               R  +   GD  H     FL  CSLC R L P RDI+MYRGD+AFCS ECR+Q++ QD
Sbjct  60   L--RRHSSYFGDARH-----FLRACSLCKRPLVPGRDIYMYRGDSAFCSLECRQQQINQD  112

Query  442  ERKER  456
            ERKE+
Sbjct  113  ERKEK  117



>ref|XP_009803978.1| PREDICTED: uncharacterized protein LOC104249283 [Nicotiana sylvestris]
Length=155

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 78/142 (55%), Gaps = 7/142 (5%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+ RPP +RTTSM   T+D+   + D     +  Q     N Y+      M S   
Sbjct  1    MLLGKRPRPPIKRTTSMKEFTLDLN--INDPSVAVINYQPFDPLNPYNFTGPVPMPS-NG  57

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
               R           + T  FL  CSLC R+L P RDI+MYRGD+AFCS +CRE++MKQD
Sbjct  58   LDQRLILTRRRSADFVGTAHFLRACSLCKRQLIPGRDIYMYRGDSAFCSLDCREKQMKQD  117

Query  442  ERKER----STNLQIENNGGIS  495
            E+KE+    +T  ++ N+  ++
Sbjct  118  EKKEKYPKVATRKKVTNSAAMA  139



>ref|XP_009373178.1| PREDICTED: uncharacterized protein LOC103962220 [Pyrus x bretschneideri]
Length=157

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 78/144 (54%), Gaps = 17/144 (12%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVD---VGSGMEDGQP--PAVEGQATAVPNGYD-------  225
            M+LGK+ RPP +RTTSM+ IT D   + +G    QP  P    Q  A+ +          
Sbjct  1    MLLGKRPRPPMKRTTSMSEITFDLNTISTGAPHSQPSDPNNPYQPPALWSSGGGGGGGLD  60

Query  226  ---HRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDT  396
                R M  + SP          +S D    ET  FL  C LC RRL P RDI+MYRGDT
Sbjct  61   GLDQRLMMKLPSPSSASPGNHRRSSAD--FGETAHFLKACGLCKRRLIPGRDIYMYRGDT  118

Query  397  AFCSQECREQKMKQDERKERSTNL  468
            AFCS ECR+Q+M  DERK++ +++
Sbjct  119  AFCSLECRQQQMNLDERKDKCSSI  142



>ref|XP_010498679.1| PREDICTED: uncharacterized protein LOC104776336 [Camelina sativa]
Length=143

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 73/132 (55%), Gaps = 18/132 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNG-------YDHRSMA  240
            M+LGK+ RPP +RTTS++ I  D+     + +P   + Q   +           D + + 
Sbjct  1    MLLGKRQRPPIKRTTSLSEIKFDLNQQPSEQEPSDHQIQLVTIDEHRHVHQRLLDQQRLL  60

Query  241  AMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECR  420
            AMVS R   G     ++ D        FL +CSLC R L P RDI+MYRGD AFCS ECR
Sbjct  61   AMVSLR---GVQRKHSAED--------FLRSCSLCKRHLVPGRDIYMYRGDRAFCSLECR  109

Query  421  EQKMKQDERKER  456
            +Q++  DERKE+
Sbjct  110  QQQITVDERKEK  121



>ref|XP_002889171.1| hypothetical protein ARALYDRAFT_476964 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65430.1| hypothetical protein ARALYDRAFT_476964 [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 74/134 (55%), Gaps = 10/134 (7%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPR-  258
            M+LGK+ RPP  RTTS++ I  D+    E  +P   +      P G + +++ A V    
Sbjct  1    MLLGKRQRPPINRTTSLSEIKFDLNLPSE-SEPSNQQNPTVVSPYGSNGQAVTAAVDQNR  59

Query  259  -YYGGRTTTMTSG-------DGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQE  414
             +   R  +M S         G   +   FL +CSLC R L P RDI+MYRGD AFCS E
Sbjct  60   AFLDQRLLSMVSSRGNLRRHSGDFSDAGHFLRSCSLCERLLVPGRDIYMYRGDKAFCSSE  119

Query  415  CREQKMKQDERKER  456
            CR+++M QDERKE+
Sbjct  120  CRQEQMAQDERKEK  133



>gb|EYU35236.1| hypothetical protein MIMGU_mgv1a015843mg [Erythranthe guttata]
Length=143

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 77/132 (58%), Gaps = 17/132 (13%)
 Frame = +1

Query  82   MMLGKQSRPP-FRRTTSMTGITVDVGSGMEDGQPPAVEG--QATAVPN----GYDHRSMA  240
            MMLGK+ RPP  +RTTSMT  T D+  G       A EG  Q   + N    G D + MA
Sbjct  1    MMLGKRGRPPPMKRTTSMTEFTWDLNGGA------AAEGVYQPFDLNNPYNGGLDQKYMA  54

Query  241  AMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECR  420
            +  +      R     S +     T +FL  CSLC RRL P RDIFMYRGD+AFCSQECR
Sbjct  55   SAAAAAAASPRGQRRNSAE----VTGNFLRVCSLCKRRLIPGRDIFMYRGDSAFCSQECR  110

Query  421  EQKMKQDERKER  456
            +Q+M +DERK++
Sbjct  111  QQQMNKDERKDK  122



>gb|AAM65894.1| unknown [Arabidopsis thaliana]
Length=162

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 78/139 (56%), Gaps = 20/139 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGME----DGQPPAV------EGQATAVP----NG  219
            M+LGK+ RPP  RTTS++ I  D+    E    + Q P V       GQA         G
Sbjct  1    MLLGKRQRPPINRTTSLSEIKFDLNLPSESEPSNQQKPTVASPYGSNGQAVTAAVDQNRG  60

Query  220  YDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTA  399
            +  + + +MV+PR    R +   S D  H     FL +C+LC R L P RDI+MYRGD A
Sbjct  61   FLDQRLLSMVTPRGNLRRHSGDFS-DARH-----FLRSCALCERLLVPGRDIYMYRGDKA  114

Query  400  FCSQECREQKMKQDERKER  456
            FCS ECR+++M QDERKE+
Sbjct  115  FCSSECRQEQMAQDERKEK  133



>ref|XP_008444103.1| PREDICTED: uncharacterized protein LOC103487542 [Cucumis melo]
Length=151

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 75/127 (59%), Gaps = 14/127 (11%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVG-SGMEDGQ-PPAVEGQATAVPNGYDHRSMAAMVSP  255
            M LGK+SR P R+T SMT IT D+G +G    Q PP++        +GY       M+SP
Sbjct  1    MSLGKRSRAPIRKTPSMTEITFDLGGTGSAAEQFPPSLGYPTNTQISGYQQ-----MLSP  55

Query  256  RYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMK  435
            R +   +  +        E  +FL  CSLC+R L P RDI+MYRGD  FCS ECR+++MK
Sbjct  56   RNFRRHSVDLQ-------ENANFLRACSLCSRPLVPGRDIYMYRGDRGFCSDECRQKQMK  108

Query  436  QDERKER  456
            QDER E+
Sbjct  109  QDERMEK  115



>ref|XP_009803841.1| PREDICTED: uncharacterized protein LOC104249164 [Nicotiana sylvestris]
Length=164

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 70/131 (53%), Gaps = 6/131 (5%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQP---PAVEGQATAVPNGYDHRSMAAMVS  252
            M+LGK++RPP +RTTSMT  T+D+    +   P      +      P    +  +     
Sbjct  1    MLLGKRTRPPMKRTTSMTEFTLDLNLNHDPNSPVNYQPFDPHNPLTPISSSNTQLLDQKQ  60

Query  253  PRYYGGRTTTMTSG---DGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECRE  423
                  +T   T         +ET +FL  C LC RRL P RDI+MYRGD+AFCS ECRE
Sbjct  61   RILTTAKTIPTTRNRRKSADFLETANFLKACFLCKRRLIPGRDIYMYRGDSAFCSLECRE  120

Query  424  QKMKQDERKER  456
            Q+M  DE+KE+
Sbjct  121  QQMNIDEKKEK  131



>ref|XP_004239993.1| PREDICTED: uncharacterized protein LOC101248202 [Solanum lycopersicum]
Length=149

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 69/112 (62%), Gaps = 12/112 (11%)
 Frame = +1

Query  115  RRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRYYGGRTTTMTSG  294
            RRT S T ITVDV +  E G+P  ++        G+DH+ +++    R         +S 
Sbjct  6    RRTISTTRITVDVMNNGE-GKPFDLDLGTNYGFYGHDHQHVSSKYHHR--------SSSY  56

Query  295  DGYH--IETPS-FLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
             G+H  IE  S FLTTC LCN RL PCRDI+MYRGDTAFCS ECREQ+MK D
Sbjct  57   QGFHHQIEEKSHFLTTCGLCNHRLTPCRDIYMYRGDTAFCSMECREQQMKSD  108



>ref|XP_008453781.1| PREDICTED: uncharacterized protein LOC103494409 [Cucumis melo]
Length=146

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 78/137 (57%), Gaps = 14/137 (10%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAV----PNGYDHRSM----  237
            M+LGK+ R   +RT S++GITVD+     +GQ P+ + Q        P     +S+    
Sbjct  2    MLLGKRPRGQMKRTASVSGITVDLSH--VEGQEPSEDHQVPTTGEIPPVICSSQSLDCDV  59

Query  238  ----AAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFC  405
                 + VSPR     +    + D  H  +  FL +C+ C RRL+P RDI+MY GDTAFC
Sbjct  60   MNYTLSFVSPRGRKNLSPAAFNKDIDHRSSDHFLRSCTFCRRRLSPGRDIYMYMGDTAFC  119

Query  406  SQECREQKMKQDERKER  456
            S ECREQKMK+D RKE+
Sbjct  120  SAECREQKMKEDWRKEK  136



>gb|KFK44308.1| hypothetical protein AALP_AA1G241200 [Arabis alpina]
Length=138

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 73/127 (57%), Gaps = 13/127 (10%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMA--AMVSP  255
            M+LGK+ RPP +RTTS++ I  D+       QP   +     +   ++HR +A   MVS 
Sbjct  1    MLLGKRQRPPIKRTTSLSDIKFDLNLP---SQPEPSDQIQIPLVTVHEHRQVADQRMVSH  57

Query  256  RYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMK  435
            R          + D Y  +T  FL +CSLC R L P RDI+MYRGD  FCS ECR++++ 
Sbjct  58   R--------RNTADYYSTQTGDFLRSCSLCKRHLVPGRDIYMYRGDRGFCSLECRQKQIT  109

Query  436  QDERKER  456
             DERK++
Sbjct  110  VDERKKK  116



>ref|NP_001238472.1| uncharacterized protein LOC100527853 [Glycine max]
 gb|ACU17046.1| unknown [Glycine max]
Length=150

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 75/126 (60%), Gaps = 11/126 (9%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAV-PNGYDHRSMAAMVSPR  258
            M+LGK+ RPP +RTTSM+ +T+D+ +   D    A   Q + V P     ++   + +P+
Sbjct  1    MLLGKRPRPPMKRTTSMSEMTLDLNTAAADA---AANQQRSGVGPGAAADQTTRMLATPK  57

Query  259  YYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQ  438
                R  +   GD     TP FL  CSLC R L P  DI+MYRGD AFCS ECR+Q+M Q
Sbjct  58   IL--RRHSSDFGD-----TPPFLRACSLCKRSLVPGHDIYMYRGDNAFCSLECRQQQMNQ  110

Query  439  DERKER  456
            DERKE+
Sbjct  111  DERKEK  116



>ref|NP_564160.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL62362.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47934.1| unknown protein [Arabidopsis thaliana]
 gb|AAM64388.1| unknown [Arabidopsis thaliana]
 gb|AEE30204.1| uncharacterized protein AT1G22160 [Arabidopsis thaliana]
Length=147

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 75/134 (56%), Gaps = 21/134 (16%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRS---------  234
            M+LGK+ RPP +RTTS++ I  D+    E  Q P+       + N  +HR          
Sbjct  1    MLLGKRQRPPIKRTTSLSEIKFDLNQPSE--QEPS--DHQIQLVNVDEHRQVHQRLLDQR  56

Query  235  MAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQE  414
            + AMVSPR    R ++  S D        FL +CSLC R L   RDI+MYRGD AFCS E
Sbjct  57   LLAMVSPRGTQRRHSSDYSED--------FLRSCSLCKRLLVHGRDIYMYRGDRAFCSLE  108

Query  415  CREQKMKQDERKER  456
            CR+Q++  DERKE+
Sbjct  109  CRQQQITVDERKEK  122



>emb|CBI19129.3| unnamed protein product [Vitis vinifera]
Length=131

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 72/125 (58%), Gaps = 18/125 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+ RPP +RTTSMT  T+D  S     QPP+     +  P     +S+     PRY
Sbjct  1    MLLGKRPRPPMKRTTSMTEFTLDPNSVQ---QPPS----DSQNPFKDRPKSVGFGGDPRY  53

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
                     S D   ++   FL  C LC RRL   RDI+MYRGD+AFCS ECR+Q+M QD
Sbjct  54   ---------SAD--FVDNSHFLRACCLCKRRLVSGRDIYMYRGDSAFCSLECRQQQMNQD  102

Query  442  ERKER  456
            ERKE+
Sbjct  103  ERKEK  107



>ref|XP_004149159.1| PREDICTED: uncharacterized protein LOC101212822 [Cucumis sativus]
 gb|KGN53228.1| hypothetical protein Csa_4G030990 [Cucumis sativus]
Length=145

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 80/138 (58%), Gaps = 12/138 (9%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATA-VPN------GYDHRSM-  237
            M+LGK+ R   +RT S++GITVD+ S +E  QP   +   T  +P         D   M 
Sbjct  2    MLLGKRPRGQMKRTASVSGITVDL-SHVEGQQPSEDQNPTTGDIPKVICSTQTLDSDVMN  60

Query  238  --AAMVSPRYYGGRTTTMT-SGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCS  408
               + VSPR     +   + + D  H  +  FL +C+ C RRL+P RDI+MY GDTAFCS
Sbjct  61   YTLSFVSPRGRKNLSPAASFNKDSDHRSSDHFLRSCTFCRRRLSPGRDIYMYMGDTAFCS  120

Query  409  QECREQKMKQDERKERST  462
             ECREQKM+QD RKE+ T
Sbjct  121  AECREQKMEQDWRKEKGT  138



>ref|XP_004163494.1| PREDICTED: uncharacterized protein LOC101227972 [Cucumis sativus]
Length=145

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 80/138 (58%), Gaps = 12/138 (9%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATA-VP------NGYDHRSM-  237
            M+LGK+ R   +RT S++GITVD+ S +E  QP   +   T  +P         D   M 
Sbjct  2    MLLGKRPRGQMKRTASVSGITVDL-SHVEGQQPSEDQNPTTGDIPTVICSTQTLDSDVMN  60

Query  238  --AAMVSPRYYGGRTTTMT-SGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCS  408
               + VSPR     +   + + D  H  +  FL +C+ C RRL+P RDI+MY GDTAFCS
Sbjct  61   YTLSFVSPRGRKNLSPAASFNKDSDHRSSDHFLRSCTFCRRRLSPGRDIYMYMGDTAFCS  120

Query  409  QECREQKMKQDERKERST  462
             ECREQKM+QD RKE+ T
Sbjct  121  AECREQKMEQDWRKEKGT  138



>ref|XP_010939620.1| PREDICTED: uncharacterized protein LOC105058394 [Elaeis guineensis]
Length=176

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 76/156 (49%), Gaps = 34/156 (22%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVE-----------------------  192
            M LGK+ R P  RTTSMT +  ++ + ++  QP   E                       
Sbjct  1    MSLGKRPRRPMTRTTSMTELAGEIFADVQVLQPLDQERAHQGHQRYRQRAAAAAAAKAKA  60

Query  193  --------GQATAVPNGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCN  348
                       +A   G + R + AMV+P   G R     SGD   +E  SFL  CSLC 
Sbjct  61   DGGGGKRTYGGSAGVEGLETRYLEAMVAPWSTGNRR---NSGDFGVVEVASFLKACSLCK  117

Query  349  RRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            RRL P RD FMYRGD AFCS ECR+Q+M  DERKE+
Sbjct  118  RRLGPGRDTFMYRGDIAFCSLECRQQQMNLDERKEK  153



>gb|AEK94314.1| hypothetical protein [Pyrus x bretschneideri]
Length=161

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 75/144 (52%), Gaps = 21/144 (15%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVD---VGSGMEDGQP--PAVEGQATAV------------  210
            M LGK+ RPP +RTTSM+ IT D   + +     QP  P    Q  A+            
Sbjct  1    MSLGKRPRPPMKRTTSMSEITFDPNTISTEAPHSQPSDPNNPYQPLALWGGGGSGGGGRG  60

Query  211  --PNGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMY  384
               +G D R M  + SP     R     S D    ET  FL  C LC RRL P RDI+MY
Sbjct  61   GGLDGLDQRLMMKLPSPSSASPRNQKRNSAD--FGETAHFLKACGLCKRRLIPGRDIYMY  118

Query  385  RGDTAFCSQECREQKMKQDERKER  456
            RGDTAFCS ECR+Q++  DERK++
Sbjct  119  RGDTAFCSLECRQQQINLDERKDK  142



>emb|CDX68033.1| BnaA07g20730D [Brassica napus]
Length=152

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 74/139 (53%), Gaps = 23/139 (17%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDG--------------QPPAVEGQATAVPNG  219
            M+LGK+ RPP  R TS++ I  D+    E                +P    GQ  A    
Sbjct  1    MLLGKRQRPPINRITSLSEIKFDLNLPGESEVSSTQQSPIQNTMVEPYVSNGQLVAA--A  58

Query  220  YDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTA  399
             D R + AMVSPR    R +   S  G+      FL +CSLC R L P RDI+MYRGDTA
Sbjct  59   VDQR-LLAMVSPRGNLRRHSGDFSDAGH------FLRSCSLCERLLVPGRDIYMYRGDTA  111

Query  400  FCSQECREQKMKQDERKER  456
            FCS +CR+Q+M QDE KE+
Sbjct  112  FCSLDCRQQQMAQDEWKEK  130



>ref|XP_010477472.1| PREDICTED: uncharacterized protein LOC104756564 [Camelina sativa]
Length=144

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 73/133 (55%), Gaps = 19/133 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPA--------VEGQATAVPNGYDHRSM  237
            M+LGK+ RPP +RTTS++ I  D+     + +P +        ++          D + +
Sbjct  1    MLLGKRQRPPIKRTTSLSEIKFDLNQQPSEQEPSSDHQIQLVTIDEHRHVHQRLLDQQRL  60

Query  238  AAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQEC  417
             AMVS R   G     ++ D        FL +CSLC R L P RDI+MYRGD AFCS EC
Sbjct  61   LAMVSLR---GVQRKHSAED--------FLRSCSLCKRHLVPGRDIYMYRGDRAFCSLEC  109

Query  418  REQKMKQDERKER  456
            R+Q++  DERKE+
Sbjct  110  RQQQITVDERKEK  122



>ref|XP_009145371.1| PREDICTED: uncharacterized protein LOC103869073 [Brassica rapa]
 emb|CDY21344.1| BnaA09g30830D [Brassica napus]
Length=157

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 72/140 (51%), Gaps = 20/140 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVP---------------N  216
            M+LGK+ RP  +RTTS++ I  D+    E  +P   +   T  P               +
Sbjct  2    MLLGKRQRPEIKRTTSLSEIKFDLNLPCEPEEPSDHQHVQTLSPRKSKLVTVDEHRQVHH  61

Query  217  GYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDT  396
            G   + + AMVSPR      T     + Y      FL  CSLC R L P RDI+MYRGD 
Sbjct  62   GLLDQRLLAMVSPR-----GTQRRHSEDYSTHAGDFLRCCSLCKRNLVPGRDIYMYRGDR  116

Query  397  AFCSQECREQKMKQDERKER  456
            AFCS ECR+Q++  DERKE+
Sbjct  117  AFCSLECRQQQITVDERKEK  136



>ref|XP_004237884.1| PREDICTED: uncharacterized protein LOC101246821 [Solanum lycopersicum]
Length=168

 Score = 94.7 bits (234),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 75/136 (55%), Gaps = 16/136 (12%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYD-HRSMAAMVSPR  258
            M+LGK++RPP +RTTSMT  T+D+         P      +   N +D H   +   + +
Sbjct  1    MLLGKRTRPPMKRTTSMTEFTLDLNLNN-----PDPNSSLSNYNNPFDPHNPFSPANTQQ  55

Query  259  YYGGRTTTMTSGDGYHI----------ETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCS  408
             +  +   +T+     +          ET +FL  C LC RRL P RDI+MYRGD+AFCS
Sbjct  56   QHLDQQRLLTAAKTVSVRNRRKSADFLETANFLKACFLCKRRLIPGRDIYMYRGDSAFCS  115

Query  409  QECREQKMKQDERKER  456
             ECR+Q+M  DE+K++
Sbjct  116  LECRQQQMNLDEKKDK  131



>ref|XP_009617931.1| PREDICTED: uncharacterized protein LOC104110189 [Nicotiana tomentosiformis]
Length=164

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 76/139 (55%), Gaps = 22/139 (16%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSP--  255
            M+LGK++RPP +RTTSMT  T+D+    +     AV  Q       +D  +    +SP  
Sbjct  1    MLLGKRTRPPMKRTTSMTEFTLDLNLNHDPNS--AVNYQP------FDPHNPFTPISPIN  52

Query  256  --------RYYGGRTTTMTSGD----GYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTA  399
                    R      T  T+ +       +ET +FL  C LC RRL P RDI+MYRGD+A
Sbjct  53   TQLQDQQQRILTTAKTIPTTRNRRKSADFVETANFLKACFLCKRRLIPGRDIYMYRGDSA  112

Query  400  FCSQECREQKMKQDERKER  456
            FCS ECR+Q+M  DE+KE+
Sbjct  113  FCSLECRQQQMNIDEKKEK  131



>gb|KHN41499.1| hypothetical protein glysoja_039200 [Glycine soja]
Length=163

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 74/126 (59%), Gaps = 10/126 (8%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAV-PNGYDHRSMAAMVSPR  258
            M+LGK+ RPP +RTTSM+ +T+D+ +        A   Q + V P     ++   + +P+
Sbjct  1    MLLGKRPRPPMKRTTSMSEMTLDLNTAAAADA--AANQQRSGVGPGAAADQTTRMLATPK  58

Query  259  YYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQ  438
                R  +   GD     TP FL  CSLC R L P  DI+MYRGD AFCS ECR+Q+M Q
Sbjct  59   IL--RRHSSDFGD-----TPPFLRACSLCKRCLVPGHDIYMYRGDNAFCSLECRQQQMNQ  111

Query  439  DERKER  456
            DERKE+
Sbjct  112  DERKEK  117



>ref|XP_002866884.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43143.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=132

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 69/126 (55%), Gaps = 2/126 (2%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M++G + RP  +RT S+T IT++V      GQ   V        + YD R +  M+SP  
Sbjct  1    MLIGSRPRPQMQRTASITRITIEVDDDQTAGQDSDVAMTVVDGGDNYDQRFLG-MLSPVN  59

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +  R      G        SFL  C  C RRLAP RDI+MY+GD AFCS ECREQ+M+ D
Sbjct  60   HR-RNERKDGGRSSPSSLSSFLGNCGFCKRRLAPGRDIYMYKGDAAFCSIECREQQMEHD  118

Query  442  ERKERS  459
            E K R+
Sbjct  119  EDKTRN  124



>ref|XP_010090557.1| hypothetical protein L484_016607 [Morus notabilis]
 gb|EXB39763.1| hypothetical protein L484_016607 [Morus notabilis]
Length=165

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 79/152 (52%), Gaps = 31/152 (20%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQP---------------PAVEGQATAVPN  216
            M+LGK+ R P +RTTSMTGITVD+ +G E  +P                 +E Q+     
Sbjct  1    MLLGKRPRLPIKRTTSMTGITVDL-TGGEAPEPCDQLAPPPPHHHHNHNFIEAQSQDNNT  59

Query  217  GY----------DHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPC  366
             +          +H  + +M+SP     RT T        +ET  FL TC LC RRLA  
Sbjct  60   SFLGYNYQESRSNHNFLQSMLSP-----RTNTYRRNSTDFVETADFLRTCGLCKRRLASG  114

Query  367  RDIFMYRGDTAFCSQECREQKMKQDERKERST  462
            RDI++Y GD AFCS ECRE+ +KQ E K  S+
Sbjct  115  RDIYIYMGDMAFCSLECREKHIKQAEEKGNSS  146



>ref|XP_009103259.1| PREDICTED: uncharacterized protein LOC103829349 [Brassica rapa]
Length=158

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 74/141 (52%), Gaps = 20/141 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNG--------------  219
            M+LGK+ RP  +RTTS++ I  D+    E  +P   + Q  + P G              
Sbjct  1    MLLGKRQRPQIKRTTSLSEIKFDLNLPNEPEEPSDHQVQMLSNPKGKLVTVDEQRQAHHG  60

Query  220  -YDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDT  396
              D R + A VSPR     T    S D        FL +CSLC R L P RDI+MYRGD 
Sbjct  61   LLDQR-LLATVSPRG----TQRRHSADHSTHAGADFLRSCSLCKRLLVPGRDIYMYRGDR  115

Query  397  AFCSQECREQKMKQDERKERS  459
            AFCS ECR+Q++  DE+KE+S
Sbjct  116  AFCSLECRQQQITVDEKKEKS  136



>ref|XP_008234007.1| PREDICTED: uncharacterized protein LOC103332988 [Prunus mume]
Length=158

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 73/143 (51%), Gaps = 22/143 (15%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYD------------  225
            M+LGK+ RPP +RTTSM+ IT D+ +   +    A + Q +   N ++            
Sbjct  1    MLLGKRPRPPMKRTTSMSEITFDLNTISTE----AAQSQPSDPNNPFNPLAFWGGGGGGG  56

Query  226  ------HRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYR  387
                   R M  M SP        +        +ET  FL  C LC RRL P RDI+MYR
Sbjct  57   GLDGLDQRLMMKMASPSPSSPSPRSHRRNSADFVETAHFLRACGLCKRRLVPGRDIYMYR  116

Query  388  GDTAFCSQECREQKMKQDERKER  456
            GDTAFCS ECR+Q+M  DER ++
Sbjct  117  GDTAFCSLECRQQQMNLDERNDK  139



>emb|CDY01294.1| BnaA07g10670D [Brassica napus]
Length=158

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 74/141 (52%), Gaps = 20/141 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNG--------------  219
            M+LGK+ RP  +RTTS++ I  D+    E  +P   + Q  + P G              
Sbjct  1    MLLGKRQRPQIKRTTSLSEIKFDLNLPNEPEEPSDHQVQMLSNPKGKLVTVDEQRQVHHG  60

Query  220  -YDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDT  396
              D R + A VSPR     T    S D        FL +CSLC R L P RDI+MYRGD 
Sbjct  61   LLDQR-LLATVSPRG----TQRRHSADHSTHAGADFLRSCSLCKRLLVPGRDIYMYRGDR  115

Query  397  AFCSQECREQKMKQDERKERS  459
            AFCS ECR+Q++  DE+KE+S
Sbjct  116  AFCSLECRQQQITVDEKKEKS  136



>ref|XP_010446541.1| PREDICTED: uncharacterized protein LOC104729302 isoform X2 [Camelina 
sativa]
Length=131

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 73/130 (56%), Gaps = 2/130 (2%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M++G + RP  +RTTS+T ITV+V      GQ   V        N YD R +  ++SP  
Sbjct  1    MLIGNRPRPQMQRTTSITRITVEVDDDQTSGQDSDVAMTVVDGGNNYDQRFLG-ILSPTN  59

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +    +           + SFL  C LC RRLAP RDI+MY+GD AFCS ECREQ+M+ D
Sbjct  60   HRRNESQDGGRSSPSSSSSSFLGNCGLCKRRLAPGRDIYMYKGD-AFCSVECREQQMEHD  118

Query  442  ERKERSTNLQ  471
            E K R+  +Q
Sbjct  119  EGKTRNRAVQ  128



>emb|CDY00425.1| BnaC07g14010D [Brassica napus]
Length=158

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 74/141 (52%), Gaps = 20/141 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNG--------------  219
            M+LGK+ RP  +RTTS++ I  D+    E  +P   + Q  + P G              
Sbjct  1    MLLGKRQRPQIKRTTSLSEIKFDLNLPNEPEEPSDHQVQMLSNPKGKLVTGDEQRQVHHG  60

Query  220  -YDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDT  396
              D R + A VSPR     T    S D        FL +CSLC R L P RDI+MYRGD 
Sbjct  61   LLDQR-LLATVSPRG----TQRRHSADHSTHARADFLRSCSLCKRLLVPRRDIYMYRGDG  115

Query  397  AFCSQECREQKMKQDERKERS  459
            AFCS ECR+Q++  DE+KE+S
Sbjct  116  AFCSLECRQQQITVDEKKEKS  136



>ref|XP_009104591.1| PREDICTED: uncharacterized protein LOC103830542 [Brassica rapa]
Length=152

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 73/139 (53%), Gaps = 23/139 (17%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDG--------------QPPAVEGQATAVPNG  219
            M+LGK+ RPP  R TS++ I  D+    E                +P    GQ  A    
Sbjct  1    MLLGKRQRPPINRITSLSEIKFDLNLPGESEVSSTQQSPIQNTMVEPYVSNGQLVAA--A  58

Query  220  YDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTA  399
             D R + AMVSPR    R +   S  G+      FL +CSLC R L P RDI+MYRGDTA
Sbjct  59   VDQR-LLAMVSPRGNLRRHSGDFSDAGH------FLRSCSLCERLLVPGRDIYMYRGDTA  111

Query  400  FCSQECREQKMKQDERKER  456
            FCS +CR+Q+M QDE  E+
Sbjct  112  FCSLDCRQQQMAQDEWNEK  130



>ref|XP_006360277.1| PREDICTED: uncharacterized protein LOC102586001 [Solanum tuberosum]
Length=138

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 73/131 (56%), Gaps = 26/131 (20%)
 Frame = +1

Query  82   MMLGKQSRPPF-RRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPR  258
            MMLGK++RPP  +RTTSMT  T+D          P +  Q        DH +      PR
Sbjct  1    MMLGKRARPPIIKRTTSMTEFTLD----------PTLNYQ-------LDHHT------PR  37

Query  259  YYGGRTTTMTS--GDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKM  432
              G   T + +       IET  FL +CSLC R L P  DI+MYRGD+AFCS +CRE++M
Sbjct  38   SNGQDQTLLLTRRKSADFIETSHFLRSCSLCERHLIPGHDIYMYRGDSAFCSLDCREKQM  97

Query  433  KQDERKERSTN  465
             QD RKE+ T+
Sbjct  98   NQDARKEKCTS  108



>ref|XP_010459956.1| PREDICTED: uncharacterized protein LOC104740916 [Camelina sativa]
Length=142

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+ RPP +RTTS++ I  D+     + +    + Q   +    +HR     V  R 
Sbjct  1    MLLGKRQRPPIKRTTSLSEIKFDLNQQPSEQELSDHQIQLVTID---EHRH----VHQRL  53

Query  262  YGGRTTTMTSGDGYHIETPS--FLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMK  435
               R     S  G   +  +  FL +CSLC R L P RDI+MYRGD AFCS ECR+Q++ 
Sbjct  54   LDQRLLATVSPRGVQRKHSAEDFLRSCSLCKRHLVPGRDIYMYRGDRAFCSLECRQQQIT  113

Query  436  QDERKER  456
             DERKE+
Sbjct  114  VDERKEK  120



>ref|XP_010431960.1| PREDICTED: uncharacterized protein LOC104716265 [Camelina sativa]
Length=134

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M++G + RP  +R TS+T ITV+V      GQ   V        N YD R +  +    +
Sbjct  1    MLIGNRPRPQMQRATSITRITVEVDDDQTAGQDSDVAMTVVDGGNNYDQRFLGILSPANH  60

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
                +          + + SFL  C LC R LAP RDI+MY+GD AFCS ECREQ+M+ D
Sbjct  61   RRNESQDGGRSSPSSLSSSSFLGNCGLCKRHLAPDRDIYMYKGDAAFCSVECREQQMEHD  120

Query  442  ERKERS  459
            E K R+
Sbjct  121  EGKTRN  126



>ref|XP_007223641.1| hypothetical protein PRUPE_ppa012701mg [Prunus persica]
 gb|EMJ24840.1| hypothetical protein PRUPE_ppa012701mg [Prunus persica]
Length=158

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 73/142 (51%), Gaps = 14/142 (10%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGS-GMEDGQPPAVEGQATAVPNGY------------  222
            M+LGK+ RPP +RTTSM+ IT D+ +   E  Q    +      P  +            
Sbjct  1    MLLGKRPRPPMKRTTSMSEITFDLNTISTEAAQSQPSDPNNPFNPLAFWGGGGGGGGLDG  60

Query  223  -DHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTA  399
             D R M  M SP        +        +ET  FL  C LC RRL P RDI+MYRGDTA
Sbjct  61   LDQRLMMKMASPSPSSPSPGSHRRNSADFVETAHFLRACGLCKRRLVPGRDIYMYRGDTA  120

Query  400  FCSQECREQKMKQDERKERSTN  465
            FCS ECR+Q+M  DER ++ ++
Sbjct  121  FCSLECRQQQMNLDERNDKCSS  142



>ref|XP_009369650.1| PREDICTED: uncharacterized protein LOC103959039 [Pyrus x bretschneideri]
Length=161

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 75/144 (52%), Gaps = 21/144 (15%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVD---VGSGMEDGQP--PAVEGQATAV------------  210
            M LGK+ RPP +RTTSM+ IT D   + +     QP  P    Q  A+            
Sbjct  1    MSLGKRPRPPMKRTTSMSEITFDPNTISTEAPHSQPSDPNNPYQPLALWGGGGSGGGGGG  60

Query  211  --PNGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMY  384
               +G D R M  + SP     R     S D    ET  FL  C LC RRL P RDI+MY
Sbjct  61   GGLDGLDQRPMMKLPSPSSASPRNQKRNSAD--FGETAHFLKACGLCKRRLIPGRDIYMY  118

Query  385  RGDTAFCSQECREQKMKQDERKER  456
            RGDTAFCS ECR+Q++  DERK++
Sbjct  119  RGDTAFCSLECRQQQINLDERKDK  142



>ref|XP_004502441.1| PREDICTED: uncharacterized protein LOC101499079 [Cicer arietinum]
Length=147

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 76/133 (57%), Gaps = 19/133 (14%)
 Frame = +1

Query  82   MMLGKQSRPP-FRRTTSMTG-ITVDVGSGMEDGQPPAVEGQAT----AVPNGYDHRSMAA  243
            +++GK+ RP   RRTTS++G +++D+    E+        Q T     VP   DH    +
Sbjct  2    LLVGKRPRPSVMRRTTSISGDMSMDLEPHHEELLISHSHHQGTHGGLTVP---DHTKTVS  58

Query  244  MVSPRYYGGRTTTMTSGDGYHI-----ETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCS  408
            ++ P      TT   + +  H       TP FL TC+LCN RL P RDI+MYRGDTAFCS
Sbjct  59   LIFPS-----TTNTNNHNPLHTAHAIHNTPHFLLTCALCNCRLPPARDIYMYRGDTAFCS  113

Query  409  QECREQKMKQDER  447
             ECREQ+MKQD R
Sbjct  114  LECREQQMKQDRR  126



>ref|XP_009377991.1| PREDICTED: uncharacterized protein LOC103966546 [Pyrus x bretschneideri]
Length=161

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 75/144 (52%), Gaps = 21/144 (15%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVD---VGSGMEDGQP--PAVEGQATAV------------  210
            M LGK+ RPP +RTTSM+ IT D   + +     QP  P    Q  A+            
Sbjct  1    MSLGKRPRPPMKRTTSMSEITFDPNTISTEAPHSQPSDPNNPYQPLALWGGGGSGGGGGG  60

Query  211  --PNGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMY  384
               +G D R M  + SP     R     S D    ET  FL  C LC RRL P RDI+MY
Sbjct  61   GGLDGLDQRLMMKLPSPSSASPRNQKRNSAD--FGETAHFLKACGLCKRRLIPGRDIYMY  118

Query  385  RGDTAFCSQECREQKMKQDERKER  456
            RGDTAFCS ECR+Q++  DERK++
Sbjct  119  RGDTAFCSLECRQQQINLDERKDK  142



>ref|XP_002890496.1| hypothetical protein ARALYDRAFT_472449 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66755.1| hypothetical protein ARALYDRAFT_472449 [Arabidopsis lyrata subsp. 
lyrata]
Length=143

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 73/132 (55%), Gaps = 21/132 (16%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRS---------  234
            M+LGK+ RPP +RTTS++ I  D+    E  +P   + Q   +    +HR          
Sbjct  1    MLLGKRQRPPIKRTTSLSEIKFDLNQPSEQ-EPSNHQIQLVTID---EHRQVHQRLLDQR  56

Query  235  MAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQE  414
            + AMVSPR    R ++  S D        FL +CSLC R L P RDI+MYRGD  FCS E
Sbjct  57   LLAMVSPRGTQRRHSSDYSED--------FLRSCSLCKRLLVPGRDIYMYRGDRGFCSLE  108

Query  415  CREQKMKQDERK  450
            CR+Q++  DE+K
Sbjct  109  CRQQQITVDEKK  120



>ref|XP_010437102.1| PREDICTED: uncharacterized protein LOC104720905 [Camelina sativa]
Length=134

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 70/129 (54%), Gaps = 6/129 (5%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M++G + RP  +RTTS+T I V+V      GQ   V        N YD R +  M+SP  
Sbjct  1    MLIGNRPRPQMQRTTSITRINVEVDDDQTAGQDSDVAMTVVDGGNNYDQRFLG-MLSPTN  59

Query  262  YGGRTTTMTSG---DGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKM  432
            +  R      G         + SFL  C LC R LAP RDI+MY+GD AFCS ECREQ+M
Sbjct  60   H--RRNERQDGRRSSPSSSSSSSFLGNCGLCKRHLAPGRDIYMYKGDAAFCSVECREQQM  117

Query  433  KQDERKERS  459
            + DE K R+
Sbjct  118  EHDEGKTRN  126



>ref|NP_680776.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE87120.1| uncharacterized protein AT4G39795 [Arabidopsis thaliana]
Length=126

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 69/129 (53%), Gaps = 14/129 (11%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAM---VS  252
            M+LG + RP  +RT S+T IT++V      GQ   V          Y  R ++ +    +
Sbjct  1    MLLGNRPRPQMQRTASITRITIEVDGDQTAGQDSDVSMTVVDGGENYAQRFLSPVNHQRN  60

Query  253  PRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKM  432
             R YGGR++             SFL  C  C R LAP RDI+MY+GD AFCS ECREQ+M
Sbjct  61   ERKYGGRSSP-----------SSFLVNCGFCKRGLAPGRDIYMYKGDAAFCSIECREQQM  109

Query  433  KQDERKERS  459
            + DE K R+
Sbjct  110  EHDEGKTRN  118



>ref|XP_002534088.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28292.1| conserved hypothetical protein [Ricinus communis]
Length=161

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 58/83 (70%), Gaps = 6/83 (7%)
 Frame = +1

Query  220  YDHRSMAA-MVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDT  396
            YD   +AA M+SPR      T   S D  ++ET +FL TC LC RRLAP +DI+MYRGDT
Sbjct  47   YDQLFLAATMLSPR---NVPTRRNSAD--YLETANFLRTCGLCQRRLAPGKDIYMYRGDT  101

Query  397  AFCSQECREQKMKQDERKERSTN  465
            AFCS ECRE++MK DERKE+  N
Sbjct  102  AFCSLECREKQMKHDERKEKCIN  124



>gb|AAY17404.1| At4g39795 [Arabidopsis thaliana]
 gb|AAY57309.1| At4g39795 [Arabidopsis thaliana]
Length=134

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 69/129 (53%), Gaps = 14/129 (11%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMV---S  252
            M+LG + RP  +RT S+T IT++V      GQ   V          Y  R ++ +    +
Sbjct  9    MLLGNRPRPQMQRTASITRITIEVDGDQTAGQDSDVSMTVVDGGENYAQRFLSPVNHQRN  68

Query  253  PRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKM  432
             R YGGR++             SFL  C  C R LAP RDI+MY+GD AFCS ECREQ+M
Sbjct  69   ERKYGGRSSP-----------SSFLVNCGFCKRGLAPGRDIYMYKGDAAFCSIECREQQM  117

Query  433  KQDERKERS  459
            + DE K R+
Sbjct  118  EHDEGKTRN  126



>ref|XP_009380843.1| PREDICTED: uncharacterized protein LOC103969120 [Musa acuminata 
subsp. malaccensis]
Length=169

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 83/158 (53%), Gaps = 22/158 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEG----------QATAVPN-----  216
            M+LGK+ RPP RRTTS T     V   +E  +P A +G           AT V       
Sbjct  1    MLLGKRPRPPMRRTTSSTEFDAGVLFDVEPPEPFAQDGIGSRHLEPRHGATEVAQRTAGT  60

Query  217  GYDHRS---MAAMVSPRYYGGRTTTMTSGD-GYHIETPSFLTTCSLCNRRLAPCRDIFMY  384
            G D R+   + +M+SPR   G      SGD      T  FL  C LCNRRL P RD +MY
Sbjct  61   GADWRAASYVGSMLSPR---GGVHRRNSGDFEAAARTAPFLRACGLCNRRLGPGRDAYMY  117

Query  385  RGDTAFCSQECREQKMKQDERKERSTNLQIENNGGISD  498
            RG+ AFCS ECR+Q+M  DE++E+ +   +++    +D
Sbjct  118  RGEVAFCSLECRQQQMNLDEQREKCSPTSMKDTPSPTD  155



>ref|XP_009403062.1| PREDICTED: uncharacterized protein LOC103986703 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 72/134 (54%), Gaps = 16/134 (12%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTG--------ITVD-VGSGMEDGQPPAVEGQATAVPNGYDHRS  234
            M+L K+ RPP RRTTSMT         +T D VG+  +  +P  ++ Q        + R 
Sbjct  1    MLLRKRQRPPMRRTTSMTEFAAEVEGPVTADQVGAENQSRRPHILQKQ-------RNQRR  53

Query  235  MAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQE  414
             A     R  G       SG+   +ET SFL  C LC RRL P RD FMYRGD AFCS E
Sbjct  54   AAEAALWRSGGAGGRRRNSGNFAVVETASFLMACGLCKRRLGPGRDTFMYRGDIAFCSLE  113

Query  415  CREQKMKQDERKER  456
            CR+Q M QDE KE+
Sbjct  114  CRQQHMNQDEPKEK  127



>ref|XP_006284748.1| hypothetical protein CARUB_v10006014mg [Capsella rubella]
 gb|EOA17646.1| hypothetical protein CARUB_v10006014mg [Capsella rubella]
Length=132

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 68/127 (54%), Gaps = 4/127 (3%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMED-GQPPAVEGQATAVPNGYDHRSMAAMVSPR  258
            M++G + RP  +RTTS+T ITV+V    +  GQ   V        + YD R +     P 
Sbjct  1    MLIGNRPRPQMQRTTSITRITVEVDDDDQTAGQDSDVAMTVVDAGDNYDRRFLGMFSPPN  60

Query  259  YYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQ  438
            +   R      G      + SFL  C  C  RLAP RDI+MY+GD AFCS ECREQ+M+ 
Sbjct  61   H---RRNKRQDGGRSSSPSSSFLGNCGFCKHRLAPGRDIYMYKGDAAFCSIECREQQMEH  117

Query  439  DERKERS  459
            DE + R+
Sbjct  118  DEGETRN  124



>ref|XP_004162308.1| PREDICTED: uncharacterized protein LOC101231026 [Cucumis sativus]
Length=144

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 71/123 (58%), Gaps = 6/123 (5%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYD-HRSMAAMVSPR  258
            M+LGK+ R P +RTTSMTGI  D+   +E  + P+ +        GYD H  +  +  P 
Sbjct  1    MLLGKRPRLPIKRTTSMTGIRGDI-PDVEFEEQPSSDQIINNPGGGYDLHHPIPPVSLPH  59

Query  259  YYGG-RTTTMTSGDGYHIETP---SFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQ  426
                   + + S      ++P    FL TC LC RRLAP RDI+MYRGDTAFCS ECRE+
Sbjct  60   NTTAINYSALVSPRNLRDQSPPNDHFLRTCGLCKRRLAPGRDIYMYRGDTAFCSSECREK  119

Query  427  KMK  435
            ++K
Sbjct  120  QIK  122



>emb|CBI33031.3| unnamed protein product [Vitis vinifera]
Length=81

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  307  IETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            +ET  FL TC LC RRL P RDI+MYRGDTAFCS ECREQ+MKQDERKE+ + +
Sbjct  1    METAHFLRTCGLCQRRLQPGRDIYMYRGDTAFCSLECREQQMKQDERKEKYSGM  54



>ref|XP_004252540.1| PREDICTED: uncharacterized protein LOC101250672 [Solanum lycopersicum]
Length=138

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 71/131 (54%), Gaps = 26/131 (20%)
 Frame = +1

Query  82   MMLGKQSRPPF-RRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPR  258
            MM+GK++RPP  +RTTSMT  T+D          P +  Q        DH +      PR
Sbjct  1    MMIGKRARPPIIKRTTSMTEFTLD----------PTLNYQ-------LDHHT------PR  37

Query  259  YYGGRTTTMTS--GDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKM  432
              G   T + +       IE+  FL  CSLC R L    DI+MYRGD+AFCS +CRE++M
Sbjct  38   SNGQDQTVLLTRRKSADFIESSHFLRACSLCERHLISGHDIYMYRGDSAFCSLDCREKQM  97

Query  433  KQDERKERSTN  465
             QD RKE+ T+
Sbjct  98   NQDARKEKCTS  108



>ref|XP_009417425.1| PREDICTED: uncharacterized protein LOC103997824 [Musa acuminata 
subsp. malaccensis]
Length=174

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +1

Query  265  GGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDE  444
            GGR+    SGD   +ET  FL  C LC RRL P RD FMYRGD AFCS ECR+Q+MKQDE
Sbjct  84   GGRSR-RNSGDFAVVETAPFLRACGLCKRRLGPGRDTFMYRGDIAFCSHECRQQQMKQDE  142

Query  445  RKERSTNLQIEN  480
            RKE+ +   I++
Sbjct  143  RKEKCSLTSIKD  154



>ref|XP_003601999.1| hypothetical protein MTR_3g087700 [Medicago truncatula]
 gb|AES72250.1| DUF581 family protein [Medicago truncatula]
 gb|AFK35802.1| unknown [Medicago truncatula]
Length=197

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 85/169 (50%), Gaps = 45/169 (27%)
 Frame = +1

Query  82   MMLGKQSRPPF-RRTTSMTG-ITVDVGSGMEDGQPPAVEGQATAV---------PNGYDH  228
            M+LGK+ RPP  RRT SM+G ++VD+ +  +     +   + + +         P+  DH
Sbjct  1    MLLGKRPRPPIMRRTRSMSGGLSVDMQAHDQTNNLESHHEKESVMSHHNPLQPHPHHDDH  60

Query  229  RSM-------------------------------AAMVSPRYYGGRTTTMTSG--DGYHI  309
            +                                 +A++ P +       +++   D  H 
Sbjct  61   QEHGINIKNPHTVVMGTETHIQSKLTVSDERLVGSAVMFPSHTNNIINPLSASAHDVIH-  119

Query  310  ETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
             TP FL TC LCN RLAP RDI+MYRGDTAFCS ECREQ++KQD+RKE+
Sbjct  120  STPHFLRTCGLCNCRLAPGRDIYMYRGDTAFCSLECREQQIKQDKRKEK  168



>ref|XP_006366521.1| PREDICTED: uncharacterized protein LOC102587376 [Solanum tuberosum]
Length=149

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 58/92 (63%), Gaps = 7/92 (8%)
 Frame = +1

Query  169  DGQPPAVEGQATAVPNGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPS-FLTTCSLC  345
            +G+P  ++        G+DHR     VS +Y+    ++   G  +HIE  + FLTTC LC
Sbjct  23   EGKPSDLDLGTNNGLYGHDHRH----VSSKYH--HRSSSYQGFHHHIEEKAHFLTTCGLC  76

Query  346  NRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            N RL P RDI+MYRGDTAFCS ECREQ+MK D
Sbjct  77   NHRLTPSRDIYMYRGDTAFCSMECREQQMKSD  108



>ref|XP_009130485.1| PREDICTED: uncharacterized protein LOC103855271 [Brassica rapa]
Length=115

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 68/126 (54%), Gaps = 22/126 (17%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+     +RTTSM  IT D+ +  +    P+            DH +M      ++
Sbjct  1    MVLGKRHGSLIKRTTSMLMITDDIATIYDHASQPS------------DHLTM-----HQH  43

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +   T  M + +        FL TCSLCNR L   RDI+MYRGD AFCS ECRE+++K D
Sbjct  44   HHNPTVMMATNND-----DDFLRTCSLCNRNLCHRRDIYMYRGDNAFCSLECREKQIKLD  98

Query  442  ERKERS  459
            ERK ++
Sbjct  99   ERKVKN  104



>ref|XP_006354015.1| PREDICTED: uncharacterized protein LOC102578669 [Solanum tuberosum]
Length=165

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 77/138 (56%), Gaps = 20/138 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYD-HRSMA------  240
            M+LGK++RPP +RT+SMT  T+D+          ++    T   N +D H  ++      
Sbjct  1    MLLGKRTRPPMKRTSSMTEFTLDLNLNNNPDPNSSL----TNYNNPFDPHNPISPANTQQ  56

Query  241  ------AMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAF  402
                   + +P+    R    ++     +ET +FL  C LC RRL P RDI+MYRGD+AF
Sbjct  57   QLDQQRLLTAPKTVSARNRRKSAD---FLETSNFLKACFLCKRRLIPGRDIYMYRGDSAF  113

Query  403  CSQECREQKMKQDERKER  456
            CS ECR+Q+M  DE+K++
Sbjct  114  CSLECRQQQMNLDEKKDK  131



>ref|XP_006411776.1| hypothetical protein EUTSA_v10027166mg [Eutrema salsugineum]
 gb|ESQ53229.1| hypothetical protein EUTSA_v10027166mg [Eutrema salsugineum]
Length=133

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 71/130 (55%), Gaps = 7/130 (5%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNG---YDHRSMAAMVS  252
            M++G + +P  +RTTS+T ITV+V      GQ   +   A A+ +G   Y+ R  + M S
Sbjct  1    MLIGNRRKPQMQRTTSITRITVEVEDDQTAGQDSDM---AMAMVDGGGNYNQR-FSGMFS  56

Query  253  PRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKM  432
            P                   + +FL  C  C RRLAP RDI+MY+GD AFC  ECREQ+M
Sbjct  57   PGNNQSERKDDRKSSLSSSSSSTFLGNCGFCKRRLAPGRDIYMYKGDIAFCRVECREQQM  116

Query  433  KQDERKERST  462
            + DE K R++
Sbjct  117  EHDEGKTRNS  126



>ref|XP_010444470.1| PREDICTED: uncharacterized protein LOC104727149 [Camelina sativa]
Length=114

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 65/125 (52%), Gaps = 24/125 (19%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+     +RTTSM  IT+D  +  +  QP              DH S    + P +
Sbjct  1    MVLGKRHGSLIKRTTSMKMITLDTPTIYDASQPS-------------DHLS----IHPHH  43

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +       T  D        FL TCSLCNR L   RDI+MYRG+ AFCS ECRE+++K D
Sbjct  44   HNQTVVMATYYDD-------FLKTCSLCNRSLCHHRDIYMYRGNNAFCSLECREKQIKLD  96

Query  442  ERKER  456
            ERK +
Sbjct  97   ERKAK  101



>ref|XP_009409968.1| PREDICTED: uncharacterized protein LOC103992102 [Musa acuminata 
subsp. malaccensis]
Length=152

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 72/131 (55%), Gaps = 13/131 (10%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQP---PAVEGQATAVPNGYDHRSM---AA  243
            M+L K+ RPP RRTTS T     V   +E  QP    A+  +      G D R+     +
Sbjct  1    MLLEKRPRPPMRRTTSSTEFASSVLFDVEAPQPFDQVAIGVRHLESRWGADWRTTWYTGS  60

Query  244  MVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECRE  423
            M+SPR   G     +SGD      P FL  C LCNR L P RD +MYRGD AFCS ECR+
Sbjct  61   MLSPR---GGVHRRSSGD---FAAP-FLRACGLCNRGLGPGRDAYMYRGDIAFCSLECRQ  113

Query  424  QKMKQDERKER  456
            Q+M  DE++E+
Sbjct  114  QQMNLDEQREK  124



>ref|XP_009394961.1| PREDICTED: uncharacterized protein LOC103980321 [Musa acuminata 
subsp. malaccensis]
Length=161

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 72/138 (52%), Gaps = 18/138 (13%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDH-----------  228
            M+LGK+ RPP RRTTSMT    DV       QP   E  + A+ +  D            
Sbjct  1    MLLGKRQRPPMRRTTSMTEFAADVEVMQ---QPFDQEKVSNALHHQRDQSRERQTASDWL  57

Query  229  --RSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAF  402
              +++    +P   GGR     S +   ++T  FL  C LC RRL P +D FMYRGD AF
Sbjct  58   ETKNLGNPAAPSPRGGRCPR-NSAELVVVDTAPFLRACGLCKRRLGPGQDTFMYRGD-AF  115

Query  403  CSQECREQKMKQDERKER  456
            CS ECR+Q + QDE +E+
Sbjct  116  CSFECRQQHITQDELQEK  133



>gb|KHG00164.1| 50S ribosomal L24e [Gossypium arboreum]
Length=140

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 69/119 (58%), Gaps = 19/119 (16%)
 Frame = +1

Query  115  RRTTSMTGITVDVGSGMEDGQPPAVEGQATAVP-----NGYDHRSMAAMVSPRYYGGRTT  279
            +RT S+TG ++ + S   +G P     + + +P     N     +  +++SP       T
Sbjct  2    KRTISVTGQSIPIIS---NGSP----SRLSPLPEFPKDNFVFDENFLSLLSP-------T  47

Query  280  TMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            +  SG     ET  FL  C LCNRRLAP RDI+MYRGDTAFCS+ CRE++MK DER+ R
Sbjct  48   SANSGRFPVAETAPFLRFCCLCNRRLAPARDIYMYRGDTAFCSENCREKQMKLDERQRR  106



>gb|AFK49113.1| unknown [Medicago truncatula]
Length=197

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 85/169 (50%), Gaps = 45/169 (27%)
 Frame = +1

Query  82   MMLGKQSRPPF-RRTTSMTG-ITVDVGSGMEDGQPPAVEGQATAV---------PNGYDH  228
            M+LGK+ RPP  RRT SM+G ++VD+ +  +     +   + + +         P+  DH
Sbjct  1    MLLGKRPRPPIMRRTRSMSGGLSVDMQAHDQTNNLESHHEKESVMSHHNPLQPHPHHDDH  60

Query  229  RSM-------------------------------AAMVSPRYYGGRTTTMTSG--DGYHI  309
            +                                 +A++ P +       +++   D  H 
Sbjct  61   QEHGINIKNPHTVVMGTETHIQSKLTVSDERLVGSAVMFPSHTNNIINPLSASAHDVIH-  119

Query  310  ETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
             TP FL TC LC+ RLAP RDI+MYRGDTAFCS ECREQ++KQD+RKE+
Sbjct  120  STPHFLRTCGLCDCRLAPGRDIYMYRGDTAFCSLECREQQIKQDKRKEK  168



>emb|CDY33991.1| BnaC02g43460D [Brassica napus]
Length=115

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 68/126 (54%), Gaps = 22/126 (17%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+     +RTTSM  IT D+ +  +    P+            DH +M      ++
Sbjct  1    MVLGKRHGSLIKRTTSMLMITDDIATIYDHASQPS------------DHLTM-----HQH  43

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +   T  M + +        FL TCSLCNR L   RDI+MYRGD AFCS +CRE+++K D
Sbjct  44   HHNPTVMMATNND-----DDFLRTCSLCNRNLCHRRDIYMYRGDNAFCSLDCREKQIKLD  98

Query  442  ERKERS  459
            ERK ++
Sbjct  99   ERKVKN  104



>ref|XP_010462432.1| PREDICTED: uncharacterized protein LOC104743011 [Camelina sativa]
Length=114

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 67/125 (54%), Gaps = 24/125 (19%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+     +RTTSM  IT+D  +  +  QP              DH ++      ++
Sbjct  1    MVLGKRHGSLIKRTTSMKMITLDTPTIYDASQPS-------------DHLTIH-----QH  42

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +  +T  M +          FL TCSLCNR L   RDI+MYRG+ AFCS ECRE+++K D
Sbjct  43   HHNQTVVMATN------YDDFLKTCSLCNRSLCHHRDIYMYRGNNAFCSLECREKQIKLD  96

Query  442  ERKER  456
            ERK +
Sbjct  97   ERKAK  101



>ref|XP_009127647.1| PREDICTED: uncharacterized protein LOC103852462 [Brassica rapa]
Length=128

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 71/127 (56%), Gaps = 6/127 (5%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M++G +     +R  SM  IT++V      GQ   V        + +D R +A M+SPR 
Sbjct  1    MLIGNRQ---MQRKPSMPRITIEVDDNHTAGQDSDVSMAVVDGGDNFDQRFLA-MLSPRN  56

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +  RT     G    + + SFL +C  C RRLAP RDI+MY+GD AFCS ECREQ+++QD
Sbjct  57   HT-RTERKDCGKST-LPSSSFLGSCGFCKRRLAPGRDIYMYKGDAAFCSMECREQQIEQD  114

Query  442  ERKERST  462
             +  + +
Sbjct  115  RQNSKQS  121



>emb|CDY31291.1| BnaA02g34500D [Brassica napus]
Length=115

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 67/126 (53%), Gaps = 22/126 (17%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+     +RTTS   IT D+ +  +    P+            DH +M      ++
Sbjct  1    MVLGKRHGSLIKRTTSTLMITDDIATIYDHASQPS------------DHLTM-----HQH  43

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +   T  M + +        FL TCSLCNR L   RDI+MYRGD AFCS ECRE+++K D
Sbjct  44   HHNPTVMMATNND-----DDFLRTCSLCNRNLCHRRDIYMYRGDNAFCSLECREKQIKLD  98

Query  442  ERKERS  459
            ERK ++
Sbjct  99   ERKVKN  104



>emb|CDY38242.1| BnaC05g17590D [Brassica napus]
Length=157

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 68/140 (49%), Gaps = 20/140 (14%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVP---------------N  216
            M+LGK+ R   +RTTS++ I  D+    E  +P   +   T  P               +
Sbjct  2    MLLGKRQRSEIKRTTSLSKIKFDLNLPCEPEEPSDHQHVQTLSPRKSKLVAVDEHRQVHH  61

Query  217  GYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDT  396
            G   + +  MVSPR      T     + Y      FL  CSLC   L   RDI+MYRGD 
Sbjct  62   GLLDQRLLPMVSPR-----GTQRRHSEDYSTHAGDFLRCCSLCKGHLVSGRDIYMYRGDR  116

Query  397  AFCSQECREQKMKQDERKER  456
            AFCS ECR+Q++  DERKE+
Sbjct  117  AFCSLECRQQQITVDERKEK  136



>emb|CDX95609.1| BnaC03g24900D [Brassica napus]
Length=94

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  310  ETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            E P FL +CSLC++ L P  DIFMYRGDTAFCSQECRE++++ DE KERS  L
Sbjct  12   EEPHFLESCSLCSKHLGPNSDIFMYRGDTAFCSQECREEQIESDEAKERSWKL  64



>ref|XP_010527378.1| PREDICTED: uncharacterized protein LOC104804734, partial [Tarenaya 
hassleriana]
Length=116

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 5/76 (7%)
 Frame = +1

Query  235  MAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQE  414
            + + VSPR    R +   + D  H     FL +CSLC R+L P  DI+MYRGD AFCS E
Sbjct  16   LLSTVSPRGLQRRHSADYNSDAAH-----FLRSCSLCRRQLVPGHDIYMYRGDRAFCSSE  70

Query  415  CREQKMKQDERKERST  462
            CR+Q+MKQDE+KE+S 
Sbjct  71   CRQQQMKQDEKKEKSA  86



>gb|ABK22160.1| unknown [Picea sitchensis]
Length=142

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 69/126 (55%), Gaps = 22/126 (17%)
 Frame = +1

Query  85   MLGKQSRPPF-RRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            MLGK+ RPP   RTTSM+ +      G  D    AVE +   +P+    +    + S   
Sbjct  1    MLGKRPRPPLMNRTTSMSQL------GSTDF---AVESEQ--IPDSSVFQMGPGIRSNYS  49

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            Y  +           IE   FL  C LCNRRL+  RDI+MYRGDTAFCS ECR+Q++  D
Sbjct  50   YSNKP----------IEPAHFLDACHLCNRRLSDGRDIYMYRGDTAFCSVECRQQQITMD  99

Query  442  ERKERS  459
            ERKE+S
Sbjct  100  ERKEKS  105



>ref|XP_006394083.1| hypothetical protein EUTSA_v10005159mg [Eutrema salsugineum]
 gb|ESQ31369.1| hypothetical protein EUTSA_v10005159mg [Eutrema salsugineum]
Length=114

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 69/126 (55%), Gaps = 23/126 (18%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+     +RTTSM  IT+D  +         +  QA+  P   DH     + + ++
Sbjct  1    MVLGKRHGSLIKRTTSMRMITLDTAT---------INDQASQPP---DH-----LTTHQH  43

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +   T  M +      +   FL TCS CNR L   RDI+MYRGD AFCS +CRE+++K D
Sbjct  44   HHNPTVVMAT------QNDDFLRTCSFCNRNLCHRRDIYMYRGDNAFCSLKCREKQIKLD  97

Query  442  ERKERS  459
            ERK ++
Sbjct  98   ERKVKN  103



>ref|XP_006281347.1| hypothetical protein CARUB_v10027399mg [Capsella rubella]
 gb|EOA14245.1| hypothetical protein CARUB_v10027399mg [Capsella rubella]
Length=114

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 65/126 (52%), Gaps = 23/126 (18%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+     +RTTSM  IT+D  +  +  QP              DH      ++   
Sbjct  1    MVLGKRHGSLIKRTTSMNMITLDTPTIYDASQPS-------------DH------LTFHQ  41

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +    T +     Y      FL TCSLCNR L   RDI+MYRG+ AFCS ECRE+++K D
Sbjct  42   HHHTPTKVVMATNY----DDFLKTCSLCNRSLCHHRDIYMYRGNNAFCSLECREKQIKLD  97

Query  442  ERKERS  459
            ERK +S
Sbjct  98   ERKAKS  103



>gb|KFK30553.1| hypothetical protein AALP_AA7G277000 [Arabis alpina]
Length=123

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +1

Query  115  RRTTSMTGITVDVGSGMED-GQPPAVEGQATAVPNG---YDHRSMAAMVSPRYYGGRTTT  282
            +RT+S+T IT++V    ++ GQ   V   A  + +G   YD +   AM S   +  R   
Sbjct  2    QRTSSITRITIEVDDDDQNSGQDSDV---AMVIVDGGYSYDDKQFLAMFSQENH--RRNE  56

Query  283  MTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERST  462
                      + SFL  C  C  RLAP RDI+MY+GD AFCS ECREQ+++ DE K R +
Sbjct  57   RKDDGKSAFSSSSFLGNCGFCKSRLAPSRDIYMYKGDAAFCSVECREQQIEHDEAKHRKS  116



>ref|XP_003572180.2| PREDICTED: uncharacterized protein LOC100844787 [Brachypodium 
distachyon]
Length=165

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 70/130 (54%), Gaps = 5/130 (4%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITV-DVGSGMEDGQPPAVEGQATA---VPNGYDHRSMAAMV  249
            MM+G +S  P RRTTSMT     DV +G+ + Q  A+  + T      +      +A   
Sbjct  1    MMMGTKSAGPMRRTTSMTEFAPPDVLAGVAEEQEEAMAAEETTDRLQVHEEKEEEIAHGW  60

Query  250  SPRYYGGRTTTMTSGD-GYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQ  426
              R Y  R     S D    +ET +FL  C LCNRRL P RD FMYRGD AFCS ECR+Q
Sbjct  61   IGRGYRARPHRRNSADFSAAVETAAFLHACGLCNRRLGPGRDTFMYRGDAAFCSLECRQQ  120

Query  427  KMKQDERKER  456
             +  +E K++
Sbjct  121  HIAHEEWKDK  130



>ref|XP_002866648.1| hypothetical protein ARALYDRAFT_496726 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42907.1| hypothetical protein ARALYDRAFT_496726 [Arabidopsis lyrata subsp. 
lyrata]
Length=113

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 65/126 (52%), Gaps = 24/126 (19%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+     +RTTSM  IT+D  +  +  QP              DH ++       +
Sbjct  1    MVLGKRHGSLIKRTTSMKMITLDTPTIYDASQPS-------------DHLTL-------H  40

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
                  T+     Y      FL TCSLCNR L   RDI+MYRG+ AFCS ECRE+++K D
Sbjct  41   QHPHNPTLVMATNY----DDFLKTCSLCNRSLCHHRDIYMYRGNNAFCSLECREKQIKLD  96

Query  442  ERKERS  459
            ERK ++
Sbjct  97   ERKAKT  102



>gb|AFO38381.1| uncharacterized protein [Glycine max]
 gb|KHN44328.1| hypothetical protein glysoja_014369 [Glycine soja]
Length=188

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 79/168 (47%), Gaps = 47/168 (28%)
 Frame = +1

Query  82   MMLGKQSRPPF-RRTTSMTG-ITVDVGSGMEDGQ---------PPAVEGQATAVPNGY--  222
            M+LGK+ R P  +RTTSM+G + V+  +  E+            P V   A   PN    
Sbjct  1    MLLGKRPRAPIMKRTTSMSGGLAVETKTSKEEEVLMSDNMKLVDPHVNVVAMGTPNDQFV  60

Query  223  -DHRSMAAMVSPRY-YGGRTTTMTSGDGYHIETP--------------------------  318
             +H    +  +  Y YG R   M    G ++  P                          
Sbjct  61   PNHTKNVSQANGSYVYGDRLMGM----GVNMSMPLSPTTSNNHRHHMTHNHTTNTNNIHT  116

Query  319  --SFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
               FL TC LCN  LAP RDI+MYRGDTAFCS ECRE++MKQD+RKE+
Sbjct  117  TSHFLRTCGLCNCHLAPGRDIYMYRGDTAFCSLECREKQMKQDQRKEK  164



>ref|XP_010484308.1| PREDICTED: uncharacterized protein LOC104762671 [Camelina sativa]
Length=114

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 65/125 (52%), Gaps = 24/125 (19%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+     +RTTSM  IT++  +  +  QP              DH +    + P +
Sbjct  1    MVLGKRHGSLIKRTTSMNMITLETPTIYDASQPS-------------DHLT----IHPHH  43

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +       T+ D         L TCSLCNR L   RDI+MYRG+ AFCS ECRE+++K D
Sbjct  44   HNQTVVMATNYDDS-------LKTCSLCNRSLCHHRDIYMYRGNNAFCSLECREKQIKLD  96

Query  442  ERKER  456
            ERK +
Sbjct  97   ERKTK  101



>ref|NP_201309.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAA97316.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM63428.1| unknown [Arabidopsis thaliana]
 gb|AAO22606.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42353.1| unknown protein [Arabidopsis thaliana]
 gb|AED97989.1| uncharacterized protein AT5G65040 [Arabidopsis thaliana]
Length=113

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 63/126 (50%), Gaps = 24/126 (19%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK+     +RTTSM  IT+D  +  +  QP           + + H  M  M S   
Sbjct  1    MVLGKRHGSLIKRTTSMKMITLDTPTIYDASQP-----SDHLTFHQHPHNPMVVMAS---  52

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
                                FL TCSLCNR L   RDI+MYRG+ AFCS ECRE+++K D
Sbjct  53   ----------------NYDDFLKTCSLCNRSLCHHRDIYMYRGNNAFCSLECREKQIKLD  96

Query  442  ERKERS  459
            E+K ++
Sbjct  97   EKKAKT  102



>emb|CDX79243.1| BnaC06g20600D [Brassica napus]
Length=112

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 56/94 (60%), Gaps = 9/94 (10%)
 Frame = +1

Query  175  QPPAVEGQATAVPNGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRR  354
            +P    GQ  A     D R + AMVSPR    R +   S  G+      FL +CSLC R 
Sbjct  3    EPYVSNGQLVAA--AVDQR-LLAMVSPRGNLRRHSGDFSDAGH------FLRSCSLCERL  53

Query  355  LAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            L P RDI+MYRGDTAFCS +CR+Q+M QDE KE+
Sbjct  54   LVPGRDIYMYRGDTAFCSLDCRQQQMAQDEWKEK  87



>ref|XP_009133680.1| PREDICTED: uncharacterized protein LOC103858138 [Brassica rapa]
 emb|CDX83422.1| BnaA03g20840D [Brassica napus]
Length=94

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  310  ETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            E P FL +CSLC++ L P  DIFMYRGDTAFCS ECRE++++ DE KER   L
Sbjct  12   EEPHFLESCSLCSKHLGPNSDIFMYRGDTAFCSNECREEQIESDEAKERRWKL  64



>ref|NP_001237494.1| uncharacterized protein LOC100500658 [Glycine max]
 gb|ACU15798.1| unknown [Glycine max]
Length=188

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 78/168 (46%), Gaps = 47/168 (28%)
 Frame = +1

Query  82   MMLGKQSRPPF-RRTTSMTG-ITVDVGSGMEDGQ---------PPAVEGQATAVPNGY--  222
            M+LGK+ R P  +RTTSM+G + V+  +  E+            P V   A   PN    
Sbjct  1    MLLGKRPRAPIMKRTTSMSGGLAVETKTSKEEEVLMSDNMKLVDPHVNVVAMGTPNDQFV  60

Query  223  -DHRSMAAMVSPRY-YGGRTTTMTSGDGYHIETP--------------------------  318
             +H    +  +  Y YG R   M    G ++  P                          
Sbjct  61   PNHTKNVSQANGSYVYGDRLMGM----GVNMSMPLSPTTSNNHRHHMTHNHTTNTNNIHT  116

Query  319  --SFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
               FL TC LCN  LAP RDI+MYRGDTAFCS ECRE++MKQD+ KE+
Sbjct  117  TSHFLRTCGLCNCHLAPGRDIYMYRGDTAFCSLECREKQMKQDQGKEK  164



>ref|XP_003564065.1| PREDICTED: uncharacterized protein LOC100839281 [Brachypodium 
distachyon]
Length=140

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 71/130 (55%), Gaps = 21/130 (16%)
 Frame = +1

Query  88   LGKQSR--PPFRRTTSMTGITVDVGSGMEDGQPP---AVEGQATAVPNGYDHRSMAAMVS  252
            LGK+ R     RRTTSM+G   +V    E G+ P   A  G A   P      S AA+  
Sbjct  4    LGKRHRNDSSLRRTTSMSGF--EVPGAEEAGRQPTRAARGGSAAPTP------STAAVC-  54

Query  253  PRYYGGRTTTMTSGDGYH--IETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQ  426
                GG      SGD +H  +ET +FL  C LC+RRL P RD F+Y G+ AFCS ECR+Q
Sbjct  55   ----GGAVQRRHSGD-FHAAMETAAFLQACGLCSRRLGPGRDTFIYMGEVAFCSLECRQQ  109

Query  427  KMKQDERKER  456
            +M  DE K++
Sbjct  110  QMNLDELKDK  119



>ref|XP_008460479.1| PREDICTED: uncharacterized protein LOC103499283 [Cucumis melo]
Length=142

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 61/116 (53%), Gaps = 14/116 (12%)
 Frame = +1

Query  109  PFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRYYGGRTTTMT  288
            P +RTTS   I  DVG           E       + +DHR + +M+SPR    R +   
Sbjct  8    PIKRTTSQKEILFDVGGAA------VSELDNPTASSLFDHR-LLSMLSPRN-NRRHSDEF  59

Query  289  SGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
                +H      L  C LC RRL   RDI+MY+G++AFCS ECR+Q+M QDE KE+
Sbjct  60   PWSSHH------LRACCLCQRRLLAGRDIYMYKGESAFCSAECRQQQMNQDEAKEK  109



>gb|KDO47042.1| hypothetical protein CISIN_1g030226mg [Citrus sinensis]
Length=138

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 64/131 (49%), Gaps = 29/131 (22%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNG--------------  219
            M+LGK+ RPP +RTTSMTGITVD+ +   DG       Q                     
Sbjct  1    MLLGKRPRPPIKRTTSMTGITVDITNVESDGPSDHHHRQQQQQQQHQSAPAAAAATHHQM  60

Query  220  ------------YDHRSM-AAMVSPR--YYGGRTTTMTSGDGYHIETPSFLTTCSLCNRR  354
                        YDH+   AAMVSPR  Y   + +T+       IET  FL TC LCNRR
Sbjct  61   MNFGYDDDNNFMYDHQPFFAAMVSPRNNYQQQQRSTIGRSSNELIETAHFLRTCGLCNRR  120

Query  355  LAPCRDIFMYR  387
            LAP +DI+MYR
Sbjct  121  LAPGKDIYMYR  131



>ref|XP_004140318.1| PREDICTED: uncharacterized protein LOC101217585 [Cucumis sativus]
 ref|XP_004163111.1| PREDICTED: uncharacterized protein LOC101231689 [Cucumis sativus]
 gb|KGN51002.1| hypothetical protein Csa_5G396000 [Cucumis sativus]
Length=141

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 60/116 (52%), Gaps = 15/116 (13%)
 Frame = +1

Query  109  PFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRYYGGRTTTMT  288
            P +RTT+   I  D+G         AV        + +DHR + +M+SPR     +    
Sbjct  8    PIKRTTTQKEILFDLGGA-------AVSELDIPTSSLFDHR-LLSMLSPRNIRRHSDEFP  59

Query  289  SGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
                Y       L  C LC RRL   RDI+MY+G++AFCS ECR+Q+M QDE KE+
Sbjct  60   WSSHY-------LRACCLCQRRLLAGRDIYMYKGESAFCSAECRQQQMNQDEAKEK  108



>ref|XP_009401282.1| PREDICTED: uncharacterized protein LOC103985344 [Musa acuminata 
subsp. malaccensis]
Length=127

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 60/134 (45%), Gaps = 26/134 (19%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMT----GITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMV  249
            M +GKQ   P RR  S T     +  DVG                  P   DH ++   +
Sbjct  2    MFMGKQPGTPMRRAPSSTEFSPSVLFDVGG-----------------PRPSDHNAIVHYL  44

Query  250  SPRYYGGRTTTMTSGDGYHIE-----TPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQE  414
             PR      +  +   G H       T  FL  C LCN RL P RDI+MYRG+ AFCS E
Sbjct  45   QPREAAQVESIPSPRSGVHSGRSGDGTAPFLRACGLCNHRLGPGRDIYMYRGEIAFCSLE  104

Query  415  CREQKMKQDERKER  456
            CR+ +M  DE KE+
Sbjct  105  CRQLQMNLDEEKEK  118



>gb|EEC83556.1| hypothetical protein OsI_29199 [Oryza sativa Indica Group]
Length=199

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  289  SGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            S D   +ET +FL  C LCNRRL P RD FMY+GDTAFCS ECR+Q +  +E KE+
Sbjct  106  SADFSAVETAAFLRACGLCNRRLGPGRDTFMYKGDTAFCSLECRQQHITHEEWKEK  161



>gb|EAZ00205.1| hypothetical protein OsI_22207 [Oryza sativa Indica Group]
Length=142

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 67/142 (47%), Gaps = 13/142 (9%)
 Frame = +1

Query  88   LGKQSR--PPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            LGK+ R     RRTTSM+G  V         +    +G+              +      
Sbjct  4    LGKRHRNNSSMRRTTSMSGFAV--------AEEEEQQGRQPPARAARGGGGGGSAAPSPG  55

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +G       SGD    ET +FL  C +CNRRL P RD F+Y G+ AFCS ECR+Q+M  D
Sbjct  56   WGA-MQRRHSGDFAVAETAAFLKACGICNRRLGPGRDTFIYMGEVAFCSHECRQQQMNLD  114

Query  442  ERKERSTNLQIENNGGISDHLG  507
            E  E+    Q E+ GG SD  G
Sbjct  115  ELNEKKC-FQRESGGG-SDKSG  134



>ref|XP_010446542.1| PREDICTED: uncharacterized protein LOC104729302 isoform X3 [Camelina 
sativa]
Length=125

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 67/130 (52%), Gaps = 8/130 (6%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M++G + RP  +RTTS+T ITV+V      GQ   V        N YD R +  ++SP  
Sbjct  1    MLIGNRPRPQMQRTTSITRITVEVDDDQTSGQDSDVAMTVVDGGNNYDQRFL-GILSPTN  59

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +    +           + SFL  C LC RRLAP RDI+MY       + ECREQ+M+ D
Sbjct  60   HRRNESQDGGRSSPSSSSSSFLGNCGLCKRRLAPGRDIYMY-------NVECREQQMEHD  112

Query  442  ERKERSTNLQ  471
            E K R+  +Q
Sbjct  113  EGKTRNRAVQ  122



>ref|NP_001061776.1| Os08g0407600 [Oryza sativa Japonica Group]
 dbj|BAC98607.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23690.1| Os08g0407600 [Oryza sativa Japonica Group]
 dbj|BAG94362.1| unnamed protein product [Oryza sativa Japonica Group]
Length=199

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  289  SGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            S D   +ET +FL  C LCNRRL P RD FMY+GDTAFCS ECR+Q +  +E KE+
Sbjct  106  SADFSAVETAAFLRACGLCNRRLGPGRDTFMYKGDTAFCSLECRQQHITHEEWKEK  161



>ref|NP_001241641.1| uncharacterized protein LOC100775423 [Glycine max]
 gb|ACU20626.1| unknown [Glycine max]
 gb|KHN31356.1| hypothetical protein glysoja_023010 [Glycine soja]
Length=204

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  322  FLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            FL TC LCN  LAP RDI+MYRGD AFCS ECRE++MKQD+RKE+
Sbjct  136  FLRTCGLCNCHLAPGRDIYMYRGDAAFCSLECREKQMKQDQRKEK  180



>emb|CDY38416.1| BnaC01g10250D [Brassica napus]
Length=126

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  316  PSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            P FL +CSLC +RL   RDIFMYRGDT FCS+ECRE+++ +DE KE+  NL
Sbjct  41   PHFLDSCSLCKKRLGDNRDIFMYRGDTPFCSEECREEQINKDEVKEKKRNL  91



>ref|NP_001142433.1| uncharacterized protein LOC100274617 [Zea mays]
 gb|ACG23955.1| hypothetical protein [Zea mays]
Length=154

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 65/128 (51%), Gaps = 22/128 (17%)
 Frame = +1

Query  88   LGKQSRP-PFRRTTSMTGITVDVGSGMED---GQPPAVEGQATAVPNGYDHRSMAAMVSP  255
            LGK+ R     RT SM  +      G ++      P   G A A+P GY +         
Sbjct  13   LGKRPRSRALPRTPSMVTVPSAAKQGRQERRAASLPTGTGAAGAMPVGYCY---------  63

Query  256  RYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMK  435
             YYGG            +ET +FL  C  C+RRL P  D F+YRG+ AFCSQECRE++++
Sbjct  64   -YYGGSFAA--------VETAAFLKACGRCSRRLGPGHDTFIYRGEVAFCSQECREKRIE  114

Query  436  QDERKERS  459
             DER E++
Sbjct  115  YDERMEKT  122



>ref|XP_007163635.1| hypothetical protein PHAVU_001G250900g [Phaseolus vulgaris]
 gb|ESW35629.1| hypothetical protein PHAVU_001G250900g [Phaseolus vulgaris]
Length=256

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 80/159 (50%), Gaps = 34/159 (21%)
 Frame = +1

Query  82   MMLGKQSRPP-FRRTTSMTG-ITVDVGSGMEDGQPPAVEGQATAVPN-GYD---------  225
            M+LGK+ RPP  +RTTSM+G + V++ +  E+     +       PN   D         
Sbjct  70   MLLGKRPRPPTMKRTTSMSGGLAVELPTTDEELVSDPLLPHHDHHPNIKLDPLLDLVAMG  129

Query  226  -HRSMAAMVS----PRYYG--------------GRTTTMTSGDGYHI--ETPSFLTTCSL  342
             H  +   VS    P Y                 RTT+      +++   T  FL TC L
Sbjct  130  RHNELLENVSEAKAPSYEKYEQLLKGMATVIPLSRTTSNNPRHSHNLTSNTSHFLRTCGL  189

Query  343  CNRRLAP-CRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            C   LAP  RDI+MYRGDTAFCS ECRE++MKQD+RKE+
Sbjct  190  CKCLLAPDRRDIYMYRGDTAFCSLECREKQMKQDQRKEK  228



>ref|NP_001057184.1| Os06g0223700 [Oryza sativa Japonica Group]
 dbj|BAD38182.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19098.1| Os06g0223700 [Oryza sativa Japonica Group]
 gb|EAZ36322.1| hypothetical protein OsJ_20644 [Oryza sativa Japonica Group]
 dbj|BAG91834.1| unnamed protein product [Oryza sativa Japonica Group]
Length=142

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 66/142 (46%), Gaps = 13/142 (9%)
 Frame = +1

Query  88   LGKQSR--PPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            LGK+ R     RRTTSM+G  V         +    +G+              +      
Sbjct  4    LGKRHRNNSSMRRTTSMSGFAV--------AEEEEQQGRQPPARAARGGGGGGSAAPSPG  55

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            +G       SGD    ET +FL  C +CNRRL P RD F+Y G+ AFCS ECR+Q+M  D
Sbjct  56   WGA-MQRRHSGDFAVAETAAFLKACGICNRRLGPGRDTFIYMGEVAFCSHECRQQQMNLD  114

Query  442  ERKERSTNLQIENNGGISDHLG  507
            E  E+    Q E  GG SD  G
Sbjct  115  ELNEKKC-FQREGGGG-SDKSG  134



>ref|XP_009130866.1| PREDICTED: uncharacterized protein LOC103855611 [Brassica rapa]
 emb|CDX78788.1| BnaA01g08550D [Brassica napus]
Length=152

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  316  PSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            P FL +CSLC +RL   RDIFMYRGDT FCS+ECRE+++ +DE KE+  NL
Sbjct  67   PHFLDSCSLCKKRLGDNRDIFMYRGDTPFCSEECREEQINKDEVKEKKRNL  117



>ref|NP_001140205.1| hypothetical protein [Zea mays]
 gb|ACF81767.1| unknown [Zea mays]
 gb|ACG28585.1| hypothetical protein [Zea mays]
 gb|ACN36174.1| unknown [Zea mays]
 tpg|DAA61196.1| TPA: hypothetical protein ZEAMMB73_556811 [Zea mays]
Length=181

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 73/156 (47%), Gaps = 23/156 (15%)
 Frame = +1

Query  82   MMLGKQSRP---PFRRTTSMTGIT--VDVGSGMEDGQPPAVEGQATAVPNGYDHRS----  234
            MM+GK+ R    P RRTTSMT       + + MED + P +   ++      D  S    
Sbjct  1    MMVGKRERDCKNPMRRTTSMTEFAPPDALAAVMEDEEGPQLSDDSSRDGGQQDWLSALGG  60

Query  235  --------------MAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRD  372
                          +AA  +            S D   +ET +FL  C LC RRL P RD
Sbjct  61   GGGGVGGAAAQEDWLAAYHARAAPARAGLRRNSADYSAVETAAFLRACGLCRRRLGPGRD  120

Query  373  IFMYRGDTAFCSQECREQKMKQDERKERSTNLQIEN  480
             FMY+G+ AFCS ECRE+ M Q+E K++     I++
Sbjct  121  TFMYKGEAAFCSLECRERHMTQEEWKDKCAVTSIKD  156



>gb|ADK38581.1| hypothetical protein [Triticum aestivum]
Length=142

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 61/125 (49%), Gaps = 9/125 (7%)
 Frame = +1

Query  88   LGKQSR--PPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            LGK+ R     RRTTSM+G  V        G+PP    +  +          A+    R 
Sbjct  4    LGKRHRNSSSMRRTTSMSGFAVPPEEEAGAGRPPTRAARGASAAPAQTEWGAASAAFQRR  63

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
            + G            +ET +FL  C LC RRL P RD F+Y G+ AFCS ECR+Q+M  D
Sbjct  64   HSGDFNAA-------VETAAFLKACGLCCRRLGPGRDTFIYMGEVAFCSLECRQQQMNLD  116

Query  442  ERKER  456
            E KE+
Sbjct  117  ELKEK  121



>ref|XP_002445473.1| hypothetical protein SORBIDRAFT_07g020070 [Sorghum bicolor]
 gb|EES14968.1| hypothetical protein SORBIDRAFT_07g020070 [Sorghum bicolor]
Length=199

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  289  SGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            S D    ET +FL  C LCNRRL P RD FMYRGDTAFCS ECR+Q M  +E KE+
Sbjct  105  SADFSAAETAAFLRACGLCNRRLGPGRDTFMYRGDTAFCSLECRQQHMTIEEWKEK  160



>ref|XP_002868047.1| hypothetical protein ARALYDRAFT_329762 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44306.1| hypothetical protein ARALYDRAFT_329762 [Arabidopsis lyrata subsp. 
lyrata]
Length=156

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 3/84 (4%)
 Frame = +1

Query  220  YDHRSMAAMVSPRYYGGRTTTMTSGDGYHIE-TPSFLTTCSLCNRRLAPCRDIFMYRGDT  396
            Y H    ++ SPR   G+       + Y+ +  P FL +C LC +RL   RDIFMYRGDT
Sbjct  40   YYHHHQYSVSSPR--SGKFHDFRFDNSYYGQPLPHFLDSCFLCKKRLGDNRDIFMYRGDT  97

Query  397  AFCSQECREQKMKQDERKERSTNL  468
             FCS+ECRE+++++DE KE+  +L
Sbjct  98   PFCSEECREEQIERDEAKEKKQSL  121



>ref|XP_010481379.1| PREDICTED: uncharacterized protein LOC104760190 [Camelina sativa]
Length=186

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 7/102 (7%)
 Frame = +1

Query  172  GQPPAVEGQATAVPNGY--DHRSMAAMVSPRYY-GGRTTTMTSGDGYHIETPSFLTTCSL  342
            G+  ++       P GY  +H +  A+ SPR+   GR    +    +  + P FL  C L
Sbjct  53   GRLNSLRNHNNNYPQGYCYNHYNQYAVSSPRFVVSGRFHDFS----FDNQQPHFLDACFL  108

Query  343  CNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            C + L   RDI+MYRGDT FCS+ECR++++++DE KE+  NL
Sbjct  109  CKKPLGDNRDIYMYRGDTPFCSEECRQEQIERDEAKEKKQNL  150



>ref|XP_009413685.1| PREDICTED: uncharacterized protein LOC103994943 [Musa acuminata 
subsp. malaccensis]
Length=159

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 69/128 (54%), Gaps = 11/128 (9%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITV-DVGSGME--DGQPPAVEGQATAVPNGYDHRSMAAMVS  252
            ++LGK++R P RRTTSMT  ++ DV +  E  +G     + Q      G +      +V 
Sbjct  13   ILLGKRTRQPMRRTTSMTEFSLEDVAAAAEGREGIRRHHKCQHRERRRGPEDEGPPRIVQ  72

Query  253  PRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKM  432
             R+  G   TM +       T  FL  C  CNRRL P  D F+YRG+ AFCS ECR+ K+
Sbjct  73   -RWSFGDLGTMET-------TTKFLMACGFCNRRLGPGFDTFIYRGEIAFCSLECRQNKI  124

Query  433  KQDERKER  456
             QDE +++
Sbjct  125  NQDEIRDK  132



>gb|ABR17544.1| unknown [Picea sitchensis]
Length=132

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  307  IETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERS  459
            IE   FL  C LCNRRL+  RDI+MYRGDTAFCS ECR+ ++  DERKE+S
Sbjct  45   IEPAHFLDACRLCNRRLSNGRDIYMYRGDTAFCSVECRQHQIDMDERKEKS  95



>ref|XP_009403338.1| PREDICTED: uncharacterized protein LOC103986915 [Musa acuminata 
subsp. malaccensis]
Length=166

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 71/152 (47%), Gaps = 23/152 (15%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMA-------  240
            M+LGK+ RP  RRT S    +  V   +E  Q    +  A    N  + R  A       
Sbjct  1    MLLGKRPRPQVRRTPSSAEFSSAVVFDVEAAQTSNQDAIACHF-NPRETRWGAAEAAQIG  59

Query  241  -----AMVSPRYYGGRTTTMT------SGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYR  387
                    + R+ G      +      SGDG    T  FL  C LCNRRL P RD +MYR
Sbjct  60   AAGREGCWATRHVGSTLFLHSGVHCGNSGDG----TAPFLRACGLCNRRLGPGRDTYMYR  115

Query  388  GDTAFCSQECREQKMKQDERKERSTNLQIENN  483
            GD AFCS ECR+Q+M  DE+KE+     + +N
Sbjct  116  GDIAFCSLECRQQQMNSDEQKEKCYLTSMNDN  147



>ref|XP_006414201.1| hypothetical protein EUTSA_v10026417mg [Eutrema salsugineum]
 gb|ESQ55654.1| hypothetical protein EUTSA_v10026417mg [Eutrema salsugineum]
Length=167

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  316  PSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            P FL +C LC +RL   RDIFMYRGDT FCS+ECRE+++K+DE KE+  NL
Sbjct  82   PHFLDSCFLCKKRLGNNRDIFMYRGDTPFCSEECREEQIKRDEAKEKKQNL  132



>ref|XP_004241979.1| PREDICTED: uncharacterized protein LOC101246541 [Solanum lycopersicum]
Length=136

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = +1

Query  253  PRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKM  432
            PR+ GGR  + T+      + P FL  C LCN+ L   RDIFMYRGDT FCS+ECR++++
Sbjct  40   PRFAGGRNYSDTTR---FQQQPHFLDACFLCNKPLGFNRDIFMYRGDTPFCSEECRQEEI  96

Query  433  KQDERKERSTNLQIENNGGISDH  501
              DE KE+  NL         DH
Sbjct  97   DNDEAKEKKLNLSASKALREKDH  119



>ref|XP_010274555.1| PREDICTED: uncharacterized protein LOC104609853 [Nelumbo nucifera]
Length=153

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 66/135 (49%), Gaps = 20/135 (15%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHR------SMAA  243
            M L    RP F          +D+ +G     PP+++   ++   G+  R      S  +
Sbjct  1    MDLSSMRRPAFFDDDDGLASILDMEAGFSGSHPPSMK---SSRYGGFKRRGSYRALSSYS  57

Query  244  MVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECRE  423
              SPR+Y  R            E   FL  C LC + L   +DIFMYRGDT FCS+ECR+
Sbjct  58   CSSPRFYDAR-----------CEEHHFLEACFLCKKPLGDNKDIFMYRGDTPFCSEECRQ  106

Query  424  QKMKQDERKERSTNL  468
            ++++ DE KE++ NL
Sbjct  107  EQIEIDEAKEKNWNL  121



>ref|NP_001234971.1| uncharacterized protein LOC100527873 [Glycine max]
 gb|ACU17076.1| unknown [Glycine max]
 gb|KHN34882.1| hypothetical protein glysoja_004648 [Glycine soja]
Length=159

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 52/92 (57%), Gaps = 9/92 (10%)
 Frame = +1

Query  193  GQATAVPNGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRD  372
            G  T    G    S+ +  S R+Y  R         +    P FL  CSLC +RL    D
Sbjct  43   GYGTFYNRGVRSHSIFSPRSGRFYDAR---------FEDHQPHFLQACSLCKKRLGDNSD  93

Query  373  IFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            IFMY+GDT FCS+ECR+++M++DE KE++ NL
Sbjct  94   IFMYKGDTPFCSEECRQEQMERDEAKEKNNNL  125



>ref|NP_001140351.1| uncharacterized protein LOC100272399 [Zea mays]
 gb|ACF83643.1| unknown [Zea mays]
 tpg|DAA49094.1| TPA: hypothetical protein ZEAMMB73_857581 [Zea mays]
Length=189

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  289  SGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            S D    ET +FL  C LCNRRL P RD FMYRGDTAFCS ECR+Q +  +E KE+
Sbjct  99   SADFSAAETAAFLRACGLCNRRLGPGRDTFMYRGDTAFCSLECRQQHITIEEWKEK  154



>gb|ABD65149.1| hypothetical protein 40.t00027 [Brassica oleracea]
 emb|CDY09610.1| BnaC07g34510D [Brassica napus]
Length=168

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  313  TPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
             P FL +C LC +RL   +DIFMYRGDT FCS+ECRE+++K+DE KE+  NL
Sbjct  82   VPHFLDSCFLCKKRLGHNKDIFMYRGDTPFCSEECREEQIKRDESKEKKKNL  133



>ref|XP_004973402.1| PREDICTED: uncharacterized protein LOC101755318 [Setaria italica]
Length=192

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  289  SGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            S D    ET +FL  C LCNRRL P RD FMYRGDTAFCS ECR+Q +  +E KE+
Sbjct  102  SADFSAAETAAFLRACGLCNRRLGPGRDTFMYRGDTAFCSLECRQQHITIEEWKEK  157



>emb|CDX90460.1| BnaA03g43210D [Brassica napus]
Length=169

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  313  TPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
             P FL +C LC +RL   +DIFMYRGDT FCS+ECRE+++K+DE KE+  NL
Sbjct  83   VPHFLDSCFLCKKRLGHNKDIFMYRGDTPFCSEECREEQIKRDESKEKKKNL  134



>ref|XP_009136860.1| PREDICTED: uncharacterized protein LOC103860927 [Brassica rapa]
Length=169

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  313  TPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
             P FL +C LC +RL   +DIFMYRGDT FCS+ECRE+++K+DE KE+  NL
Sbjct  83   VPHFLDSCFLCRKRLGHNKDIFMYRGDTPFCSEECREEQIKRDESKEKKKNL  134



>emb|CDP09389.1| unnamed protein product [Coffea canephora]
Length=92

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  310  ETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNLQIENNGG  489
            E P FL +C LCNR LAP  DIFMYRG+T FCSQECR+++++ DE  ER  N     N  
Sbjct  13   EQPHFLDSCFLCNRPLAPNSDIFMYRGNTPFCSQECRQEQIEIDEANERRWNRSSNTNRK  72

Query  490  ISD  498
             +D
Sbjct  73   TAD  75



>gb|ABK23770.1| unknown [Picea sitchensis]
Length=166

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 74/147 (50%), Gaps = 31/147 (21%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGM--EDGQPPAVEGQATAVPNGYDHRSMAAMVSP  255
            M+LGK++RP  RRTTSM+ +  D    +  ++ Q P+            D  S+  M   
Sbjct  1    MLLGKRARPTMRRTTSMSSLGSDSSLELNPKEKQRPS-----------QDCSSIKGMALG  49

Query  256  RYYGGRTTTM-----------TSGDGY-------HIETPSFLTTCSLCNRRLAPCRDIFM  381
                G+T  M            +G G+       + E   FL  C LC RRL P RDI+M
Sbjct  50   ETAQGQTVAMGVPNKKGIWWPLNGFGFPRPNRRKNSEPAHFLHACFLCKRRLVPGRDIYM  109

Query  382  YRGDTAFCSQECREQKMKQDERKERST  462
            YRGD+AFCS ECR Q++  DERKE+ T
Sbjct  110  YRGDSAFCSIECRHQQIVLDERKEKRT  136



>ref|XP_004953940.1| PREDICTED: uncharacterized protein LOC101778044 [Setaria italica]
Length=162

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +1

Query  313  TPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            T +FL  C LCNRRL P  D F+YRG+ AFCSQECREQ+++ DER E++ +L
Sbjct  83   TAAFLKACGLCNRRLGPGHDTFIYRGEVAFCSQECREQQIEYDERMEQTCSL  134



>ref|NP_001143475.1| uncharacterized protein LOC100276146 [Zea mays]
 gb|ACG32436.1| hypothetical protein [Zea mays]
Length=157

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 58/116 (50%), Gaps = 15/116 (13%)
 Frame = +1

Query  112  FRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRYYGGRTTTMTS  291
             RRTTS++ +            PP + G+    P     R  A       +G   T   S
Sbjct  23   MRRTTSLSDL----------APPPDLSGR----PKTRAARGHAVAGPGTAWGAEITMTHS  68

Query  292  GDGY-HIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
             D    +ET +FL  C +CNRRL P RD F+Y G+ AFCSQECR+Q+M  DE  E+
Sbjct  69   ADFLPAMETAAFLKACGICNRRLGPGRDTFIYMGEVAFCSQECRQQQMNLDELMEK  124



>gb|ABK26039.1| unknown [Picea sitchensis]
Length=166

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 73/145 (50%), Gaps = 27/145 (19%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            M+LGK++RP  RRTTSM+ +  D          P +  +    P+  D  S+  M     
Sbjct  1    MLLGKRARPTMRRTTSMSSLGSDSS--------PELNPKEKQRPS-QDCSSIKGMALGET  51

Query  262  YGGRTTTM-----------TSGDGY-------HIETPSFLTTCSLCNRRLAPCRDIFMYR  387
              G+T  M            +G G+       + E   FL  C LC RRL P RDI+MYR
Sbjct  52   AQGQTVAMGVPNKKGIWWPLNGFGFPRPNRRKNSEPAHFLHACFLCKRRLVPGRDIYMYR  111

Query  388  GDTAFCSQECREQKMKQDERKERST  462
            G++AFCS ECR Q++  DERKE+ T
Sbjct  112  GNSAFCSIECRHQQIVLDERKEKRT  136



>emb|CDY71221.1| BnaUnng04250D [Brassica napus]
Length=96

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 52/83 (63%), Gaps = 3/83 (4%)
 Frame = +1

Query  214  NGYDHRSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGD  393
            + YD R   AM+SPR +  RT     G    + + SFL +C  C RRLAP RDI+MY+GD
Sbjct  8    DNYDQR-FFAMLSPRNHT-RTERKDCGKS-TLPSSSFLGSCGFCKRRLAPGRDIYMYKGD  64

Query  394  TAFCSQECREQKMKQDERKERST  462
             AFC  ECREQ+++QD +  + +
Sbjct  65   AAFCCMECREQQIEQDRQNSKQS  87



>gb|EPS69545.1| hypothetical protein M569_05223, partial [Genlisea aurea]
Length=66

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  322  FLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNLQIENNGG  489
            FL+ C LC RRL P RDI+MYRGDTAFCS ECR+ +M  DER+E+   L  +N+ G
Sbjct  3    FLSACFLCRRRLIPGRDIYMYRGDTAFCSLECRQYQMNHDERREKYA-LPSKNDAG  57



>ref|XP_004956677.1| PREDICTED: uncharacterized protein LOC101754400 [Setaria italica]
Length=182

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 72/154 (47%), Gaps = 20/154 (13%)
 Frame = +1

Query  82   MMLGKQSRP---PFRRTTSMTGITV-DVGSGM-EDGQPPAVEGQATAVPNGYDHRS----  234
            MM+GK+ R    P RRTTSMT     DV + + ED +    +        G D  S    
Sbjct  1    MMVGKRERDCKNPMRRTTSMTEFAPPDVLAAVAEDEEAQLPDNNHRGGAGGQDWLSAFDG  60

Query  235  -----------MAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFM  381
                       +AA  +            S D   +ET +FL  C LC RRL P RD FM
Sbjct  61   GAGGAAAQEDWLAAYRARAAPARAGLRRNSADYSVVETAAFLRACGLCCRRLGPGRDTFM  120

Query  382  YRGDTAFCSQECREQKMKQDERKERSTNLQIENN  483
            Y+G+ AFCS ECRE+ + Q+E K++ T   I N 
Sbjct  121  YKGEAAFCSLECRERHITQEEWKDKCTVKSINNK  154



>gb|AFW85265.1| hypothetical protein ZEAMMB73_571650 [Zea mays]
Length=157

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 61/118 (52%), Gaps = 19/118 (16%)
 Frame = +1

Query  112  FRRTTSMTGITVDVGSGMEDGQPPAVEGQ-ATAVPNGYDHRSMAAMVSPRYYGGRTTTMT  288
             RRTTS++ +            PP + G+  T    G+      A+  P    G   TMT
Sbjct  23   MRRTTSLSDL----------APPPDLSGRPKTRAARGH------AVAGPGTAWGAEMTMT  66

Query  289  SGDGY--HIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
                +   +ET +FL  C +CNRRL P RD F+Y G+ AFCSQECR+Q+M  DE  E+
Sbjct  67   HSADFLPAMETAAFLKACGICNRRLGPGRDTFIYMGEVAFCSQECRQQQMNLDELMEK  124



>ref|XP_009142277.1| PREDICTED: uncharacterized protein LOC103866151 [Brassica rapa]
 emb|CDY30481.1| BnaA04g25820D [Brassica napus]
Length=94

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  310  ETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            E P FL +CSLC + +    DIFMYRGD AFCS+ECRE++++ DE KERS  L
Sbjct  12   EEPHFLESCSLCRKHIGLNSDIFMYRGDKAFCSKECREEQIESDEAKERSWRL  64



>ref|XP_010055390.1| PREDICTED: uncharacterized protein LOC104443595 [Eucalyptus grandis]
 gb|KCW71847.1| hypothetical protein EUGRSUZ_E00328 [Eucalyptus grandis]
Length=152

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 8/71 (11%)
 Frame = +1

Query  256  RYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMK  435
            R+Y  R       + +H   P FL TC LC RRL   RDIFMYRG+ AFCS++CR+++++
Sbjct  56   RFYDARF------EDHH--QPHFLETCFLCRRRLGSNRDIFMYRGELAFCSEDCRQEQIE  107

Query  436  QDERKERSTNL  468
             +E KERS NL
Sbjct  108  MEETKERSWNL  118



>ref|NP_001144738.1| uncharacterized protein LOC100277785 [Zea mays]
 gb|ACG42668.1| hypothetical protein [Zea mays]
 gb|ACN27613.1| unknown [Zea mays]
 gb|AFW62153.1| hypothetical protein ZEAMMB73_183929 [Zea mays]
Length=185

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  289  SGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            S D    ET +FL  C LCNRRL P RD F+YRGDTAFCS ECR+Q +  +E KE+
Sbjct  95   SADFSAAETAAFLRACGLCNRRLGPGRDTFVYRGDTAFCSLECRQQHITIEEWKEK  150



>ref|XP_009150580.1| PREDICTED: uncharacterized protein LOC103873928 [Brassica rapa]
 ref|XP_009150581.1| PREDICTED: uncharacterized protein LOC103873929 [Brassica rapa]
 emb|CDY08827.1| BnaA06g23970D [Brassica napus]
Length=109

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 61/126 (48%), Gaps = 33/126 (26%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSM---AAMVS  252
            M+LGK+     +RTTSM  IT D  +     QP              DH ++     M+S
Sbjct  1    MVLGKRRGSLIKRTTSMRTITDDTATYHIASQPS-------------DHLTIHNPTVMIS  47

Query  253  PRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKM  432
                       T  D        FL TCSLCN+ L   RDI+MYRGD AFCS ECR +++
Sbjct  48   -----------TKNDN------DFLRTCSLCNQNLCHRRDIYMYRGDNAFCSLECRGKQI  90

Query  433  KQDERK  450
            K DERK
Sbjct  91   KLDERK  96



>gb|ABK23097.1| unknown [Picea sitchensis]
Length=132

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  307  IETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERS  459
            IE   FL  C LCNRRL   RDI+MYRGDTA CS ECR+Q++  DERKE++
Sbjct  45   IEPAHFLDACRLCNRRLNDGRDIYMYRGDTALCSVECRQQQIDMDERKEKN  95



>ref|XP_006361165.1| PREDICTED: uncharacterized protein LOC102600983 [Solanum tuberosum]
Length=133

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +1

Query  253  PRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKM  432
            PR+ GGR    T+      + P FL  C LCN+ L   RDIFMYRGDT FCS+ECR++++
Sbjct  35   PRFAGGRKYYDTTR-FQQQQQPHFLDACFLCNKPLGYNRDIFMYRGDTPFCSEECRQEQI  93

Query  433  KQDERKERSTNL  468
              DE KE+  NL
Sbjct  94   DMDEAKEKKINL  105



>ref|NP_001048135.1| Os02g0751300 [Oryza sativa Japonica Group]
 dbj|BAD15643.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF10049.1| Os02g0751300 [Oryza sativa Japonica Group]
Length=147

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 73/146 (50%), Gaps = 19/146 (13%)
 Frame = +1

Query  85   MLGKQSRP--PFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPR  258
            MLGK+ R      RTTSM      V +  + G+   VEG   A P         A  +  
Sbjct  5    MLGKRQRSQGTMHRTTSM----ASVPAAAKQGRRHVVEGPPRAPPASLLAGGGPATAAAA  60

Query  259  YYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQ  438
             +GG            +ET +FL  C+LC R L P +D ++YRG+ AFCS+ECRE  ++ 
Sbjct  61   DHGG------------VETAAFLKNCALCGRDLGPGKDTYIYRGEVAFCSKECRECVIEY  108

Query  439  DERKERSTNL-QIENNGGISDHLGKN  513
             ERKER+ +L  I++   +S   G +
Sbjct  109  YERKERNCSLTSIKDTPAVSGASGSD  134



>emb|CAB10547.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78770.1| hypothetical protein [Arabidopsis thaliana]
Length=144

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +1

Query  259  YYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQ  438
            YY            Y    P FL +C LC +RL   RDIFMYRGDT FCS+ECRE+++++
Sbjct  40   YYYNHHHHQFDNSYYGYGQPHFLDSCFLCKKRLGDNRDIFMYRGDTPFCSEECREEQIER  99

Query  439  DERKERSTNL  468
            DE KE+  +L
Sbjct  100  DEAKEKKQSL  109



>ref|NP_001143024.1| uncharacterized protein LOC100275491 [Zea mays]
 gb|ACG28377.1| hypothetical protein [Zea mays]
Length=190

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = +1

Query  235  MAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQE  414
            +  MV PR           G G H  + SFL  C LC R L+P +D++MYRGD  FCS+E
Sbjct  76   LKQMVRPRAAVAAAAGSRHGHGSHAFSCSFLKACYLCKRELSPDKDVYMYRGDQGFCSEE  135

Query  415  CREQKMKQDERKERSTNLQIENN  483
            CR Q++  DE +ER     + N 
Sbjct  136  CRWQQILVDEAREREAAAVMSNK  158



>ref|XP_006354644.1| PREDICTED: uncharacterized protein LOC102588165 [Solanum tuberosum]
Length=99

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  316  PSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            P FL TCSLC R LA   DIFMYRGDT FCSQECR+++++ DE  ER   +
Sbjct  16   PHFLDTCSLCQRTLAHNHDIFMYRGDTPFCSQECRQEQIEMDEANERKWKI  66



>gb|KGN60442.1| hypothetical protein Csa_3G911280 [Cucumis sativus]
Length=172

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 9/79 (11%)
 Frame = +1

Query  232  SMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQ  411
            S + ++SPR+Y  R       D +H     FL  C LC + L+  +DIFMYRGDT FCS+
Sbjct  69   SSSRIISPRFYDARFE-----DHHH----HFLKACFLCKKPLSDNKDIFMYRGDTPFCSE  119

Query  412  ECREQKMKQDERKERSTNL  468
            ECR++++  DE KE+  NL
Sbjct  120  ECRQRQIDMDEAKEKKMNL  138



>emb|CDY23451.1| BnaC04g49790D [Brassica napus]
Length=94

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  310  ETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERS  459
            E P FL +CSLC + +    DIFMYRGD AFCS+ECRE++++ DE KERS
Sbjct  12   EEPHFLESCSLCRKHIGLNSDIFMYRGDKAFCSKECREEQIESDEAKERS  61



>ref|XP_004508985.1| PREDICTED: uncharacterized protein LOC101505923 [Cicer arietinum]
Length=152

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  301  YHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            +  + P FL  CSLCN+ L   +DIFMYRGDT FCS+ECR+++++ DE KE++ NL
Sbjct  65   FEDQQPHFLEACSLCNKPLGDNKDIFMYRGDTPFCSEECRQEQIEIDELKEKNMNL  120



>ref|XP_003517388.1| PREDICTED: uncharacterized protein LOC100797178 [Glycine max]
 gb|KHN42643.1| hypothetical protein glysoja_018886 [Glycine soja]
Length=156

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  316  PSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            P FL  CSLC + L   RDIFMYRGDT FCS+ECR++++++DE KE++ NL
Sbjct  72   PHFLQACSLCKKPLGDNRDIFMYRGDTPFCSEECRQEQIERDEAKEKNKNL  122



>ref|XP_010677199.1| PREDICTED: M-phase inducer phosphatase [Beta vulgaris subsp. 
vulgaris]
Length=196

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  307  IETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNLQI  474
            + +P FL +CSLC + L   RDIFMYRGDT FCS+ECR++++  DE KE+  NL++
Sbjct  105  LHSPHFLESCSLCKKPLGGNRDIFMYRGDTPFCSEECRQEQIDIDETKEKKRNLKV  160



>ref|XP_004162419.1| PREDICTED: uncharacterized LOC101216261 [Cucumis sativus]
Length=175

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 9/79 (11%)
 Frame = +1

Query  232  SMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQ  411
            S + ++SPR+Y  R       D +H     FL  C LC + L+  +DIFMYRGDT FCS+
Sbjct  69   SSSRIISPRFYDARFE-----DHHH----HFLKACFLCKKPLSDNKDIFMYRGDTPFCSE  119

Query  412  ECREQKMKQDERKERSTNL  468
            ECR++++  DE KE+  NL
Sbjct  120  ECRQRQIDMDEAKEKKMNL  138



>ref|XP_010494916.1| PREDICTED: uncharacterized protein LOC104771979 [Camelina sativa]
Length=187

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 54/87 (62%), Gaps = 11/87 (13%)
 Frame = +1

Query  220  YDHRSMAAMVSPRYYGGRTTTMTSGDGYHI----ETPSFLTTCSLCNRRLAPCRDIFMYR  387
            Y+H +  A+ SPR       ++ SG  +      + P FL +C LC + L   RDI+MYR
Sbjct  72   YNHYNQYAVSSPR-------SVVSGRFHDFRFDNQQPHFLDSCFLCKKPLGDNRDIYMYR  124

Query  388  GDTAFCSQECREQKMKQDERKERSTNL  468
            GDT FCS+ECR++++++DE KE+  NL
Sbjct  125  GDTPFCSEECRQEQIERDEAKEKKQNL  151



>ref|NP_567534.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL36357.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51261.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83931.1| uncharacterized protein AT4G17670 [Arabidopsis thaliana]
Length=159

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  316  PSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            P FL +C LC +RL   RDIFMYRGDT FCS+ECRE+++++DE KE+  +L
Sbjct  74   PHFLDSCFLCKKRLGDNRDIFMYRGDTPFCSEECREEQIERDEAKEKKQSL  124



>ref|XP_006284649.1| hypothetical protein CARUB_v10005906mg [Capsella rubella]
 gb|EOA17547.1| hypothetical protein CARUB_v10005906mg [Capsella rubella]
Length=166

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  316  PSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            P FL +C LC +RL   RDIFMYRGDT FCS+ECRE+++++DE KE+  +L
Sbjct  81   PHFLDSCFLCKKRLGDNRDIFMYRGDTPFCSEECREEQIERDEAKEKKQSL  131



>gb|AAM65981.1| unknown [Arabidopsis thaliana]
Length=159

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  316  PSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            P FL +C LC +RL   RDIFMYRGDT FCS+ECRE+++++DE KE+  +L
Sbjct  74   PHFLDSCFLCKKRLGDNRDIFMYRGDTPFCSEECREEQIERDEAKEKKQSL  124



>ref|XP_010451414.1| PREDICTED: uncharacterized protein LOC104733541 [Camelina sativa]
Length=299

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  316  PSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            P FL +C LC +RL   RDIFMYRGDT FCS+ECRE+++++DE KE+  +L
Sbjct  214  PHFLDSCFLCKKRLGDNRDIFMYRGDTPFCSEECREEQIERDEAKEKKQSL  264



>ref|XP_004229715.1| PREDICTED: uncharacterized protein LOC101248137 [Solanum lycopersicum]
Length=99

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  316  PSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            P FL TCSLC R LA   DIFMYRGDT FCSQECR+++++ DE  ER   +
Sbjct  16   PHFLDTCSLCQRTLAHNHDIFMYRGDTPFCSQECRQEQIEMDEAIERKWKI  66



>dbj|BAJ86070.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=138

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 63/126 (50%), Gaps = 15/126 (12%)
 Frame = +1

Query  88   LGKQSR--PPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            LGK+ R     RRTTSM+G  V          PP  E      P      + AA     +
Sbjct  4    LGKRHRNSSSMRRTTSMSGFAV----------PPEEEEAGRQPPTRAARGASAAPAQTEW  53

Query  262  YGGRTTTMTSGD-GYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQ  438
              G +    SGD    +ET +FL  C LC RRL P RD F+Y G+ AFCS ECR+Q+M  
Sbjct  54   --GASQRRHSGDFNAAVETAAFLKACGLCCRRLGPGRDTFIYMGEVAFCSLECRQQQMNL  111

Query  439  DERKER  456
            DE K++
Sbjct  112  DELKDK  117



>gb|KHN01655.1| hypothetical protein glysoja_012966 [Glycine soja]
Length=178

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 8/79 (10%)
 Frame = +1

Query  232  SMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQ  411
            S+++  S R+Y  R       D +H   P FL+ C LC + L   RDIFMYRGDT FCS+
Sbjct  69   SVSSPRSARFYDARFE-----DQHH---PHFLSACFLCKKSLGDNRDIFMYRGDTPFCSE  120

Query  412  ECREQKMKQDERKERSTNL  468
            ECR+++++ DE KE++ NL
Sbjct  121  ECRQEQIEIDEAKEKNRNL  139



>gb|KFK31405.1| hypothetical protein AALP_AA6G107800 [Arabis alpina]
Length=155

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  310  ETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            + P FL +C LC +RL   RDI+MYRGD  FCS+ECR++++++DE KE+  NL
Sbjct  65   QQPHFLDSCFLCKKRLGDNRDIYMYRGDAPFCSEECRQEQIERDEEKEKKQNL  117



>dbj|BAD25910.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD33479.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEC84462.1| hypothetical protein OsI_31091 [Oryza sativa Indica Group]
Length=170

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  289  SGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            S D   +ET SFL +C LC RRL P RD FMY+G+ AFCS ECR+Q M Q+E +++
Sbjct  82   SADYCSVETASFLRSCGLCRRRLGPGRDTFMYKGEAAFCSLECRQQHMTQEEWQDK  137



>ref|XP_002444452.1| hypothetical protein SORBIDRAFT_07g022140 [Sorghum bicolor]
 gb|EES13947.1| hypothetical protein SORBIDRAFT_07g022140 [Sorghum bicolor]
Length=191

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +1

Query  235  MAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQE  414
            +  MV PR     T     G G H  + SFL  C LC R L+P +D++MYRGD  FCS+E
Sbjct  77   LKQMVRPRAVAVATAGSRHGHGGHAFSCSFLKACFLCKRELSPDKDVYMYRGDQGFCSEE  136

Query  415  CREQKMKQDERK  450
            CR Q++  DER+
Sbjct  137  CRWQQILVDERE  148



>gb|AFK39199.1| unknown [Medicago truncatula]
 gb|KEH31581.1| ethphon-induced protein [Medicago truncatula]
Length=157

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  316  PSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            P FL  CSLCN+ L   +DIFMYRGDT FCS+ECR+++++ DE KE++ NL
Sbjct  71   PHFLEACSLCNKPLGGNKDIFMYRGDTPFCSEECRQEQIEIDELKEKNMNL  121



>ref|XP_009391158.1| PREDICTED: uncharacterized protein LOC103977389 [Musa acuminata 
subsp. malaccensis]
Length=156

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 61/134 (46%), Gaps = 32/134 (24%)
 Frame = +1

Query  94   KQSRPPFRRTTSMTGITV-DVGSGMEDGQ------------PPAVEGQATAVPNGYDHRS  234
            K+ R P RRTTSM   +  D+ + +E G+               VE  A   P    HR 
Sbjct  17   KRPRAPIRRTTSMKEFSAEDLAAAVEGGEGIRRRHNDFLLRERRVEAAALDAPPRSIHRR  76

Query  235  MAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQE  414
              + V                     T  FL TC LCNRRL P  D F+YRG+ +FCS E
Sbjct  77   SFSDV-------------------WATTKFLMTCGLCNRRLGPGFDTFIYRGEMSFCSFE  117

Query  415  CREQKMKQDERKER  456
            CR+ KM QDE +++
Sbjct  118  CRQHKMNQDELRDK  131



>ref|XP_011032003.1| PREDICTED: uncharacterized protein LOC105130963 [Populus euphratica]
Length=157

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 62/130 (48%), Gaps = 8/130 (6%)
 Frame = +1

Query  82   MMLGKQSRPPFRRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMV-SPR  258
            M+     RP F           D+G+G      P V  ++         R+++++V SPR
Sbjct  1    MVFQSSKRPCFIEEDDGLASLADMGAGFSGNHHPFV-SRSLCYARRCSFRNLSSLVPSPR  59

Query  259  YYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQ  438
                R       D      P FL  C LC + L   RDIFMYRGD  FCS+ECR++++  
Sbjct  60   --SARFCDFRFDD----HQPHFLEACFLCKKPLGDNRDIFMYRGDIPFCSEECRQEQIDI  113

Query  439  DERKERSTNL  468
            DE KE++ NL
Sbjct  114  DEAKEKNWNL  123



>gb|KFK23378.1| hypothetical protein AALP_AAs60861U000400 [Arabis alpina]
Length=162

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  322  FLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            FL +C LC +RL   +DIFMYRGDT FCS+ECRE+++K+DE KE+  NL
Sbjct  79   FLDSCFLCKKRLGDNKDIFMYRGDTPFCSEECREEQIKRDETKEKKQNL  127



>ref|XP_010439966.1| PREDICTED: uncharacterized protein LOC104723321 [Camelina sativa]
Length=161

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  316  PSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            P FL +C LC +RL   RDIFMYRGDT FCS+ECRE+++++DE KE+  +L
Sbjct  76   PHFLDSCFLCKKRLGDNRDIFMYRGDTPFCSEECREEQIERDEAKEKKQSL  126



>ref|XP_010236109.1| PREDICTED: uncharacterized protein LOC100845407 [Brachypodium 
distachyon]
Length=146

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 66/129 (51%), Gaps = 8/129 (6%)
 Frame = +1

Query  85   MLGKQSRPPF-RRTTSMTGITVDVGSGMEDGQPPAVEGQATAVPNGYDHRSMAAMVSPRY  261
            MLGK+ R    RRTTSM  +      G ++G         +A   G    ++    SP  
Sbjct  1    MLGKRQRSLLMRRTTSMASMPSAPKQGRQEGGAAGPSSSVSAGAVGGTGPAVGGAPSPWR  60

Query  262  YGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQD  441
               R           ++T +FL  C LC++ L P +D ++YRG+ AFCS ECRE+++++D
Sbjct  61   ADARNLA-------GVKTAAFLMACGLCSKDLGPGKDTYIYRGEVAFCSHECRERQIEKD  113

Query  442  ERKERSTNL  468
            E  E++ +L
Sbjct  114  ELMEQNCSL  122



>gb|KFK28189.1| hypothetical protein AALP_AA8G483700 [Arabis alpina]
Length=99

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 4/68 (6%)
 Frame = +1

Query  256  RYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMK  435
            +++   T  M + + Y      FL TCS CNR L   RDI+MYRGD AFCS ECRE+++K
Sbjct  25   QHHHNPTVVMDTHNYY----DDFLRTCSFCNRDLCHTRDIYMYRGDNAFCSLECREKQIK  80

Query  436  QDERKERS  459
             DERK ++
Sbjct  81   LDERKVKN  88



>ref|NP_001183875.1| hypothetical protein [Zea mays]
 gb|ACR38623.1| unknown [Zea mays]
 tpg|DAA48837.1| TPA: hypothetical protein ZEAMMB73_483336 [Zea mays]
Length=186

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 46/83 (55%), Gaps = 4/83 (5%)
 Frame = +1

Query  235  MAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQE  414
            +  MV PR   G       G G H  + SFL  C LC R L+P +D++MYRGD  FCS+E
Sbjct  76   LKQMVRPRAAAGSR----HGHGSHAFSCSFLKACYLCKRELSPDKDVYMYRGDQGFCSEE  131

Query  415  CREQKMKQDERKERSTNLQIENN  483
            CR Q++  DE +ER     + N 
Sbjct  132  CRWQQILVDEAREREAAAVMSNK  154



>ref|XP_006296201.1| hypothetical protein CARUB_v10025366mg [Capsella rubella]
 gb|EOA29099.1| hypothetical protein CARUB_v10025366mg [Capsella rubella]
Length=93

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  310  ETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            E P FL +CSLC + L    DIFMYRGD AFCS+ECRE++++ DE KER
Sbjct  12   EEPHFLESCSLCRKHLGLNSDIFMYRGDKAFCSKECREEQIESDEAKER  60



>ref|XP_009592195.1| PREDICTED: uncharacterized protein LOC104089085 [Nicotiana tomentosiformis]
Length=175

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = +1

Query  253  PRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKM  432
            P+  GGR    T    +  + P FL +C LC ++L   +DIFMYRGDT FCS+ECR++++
Sbjct  72   PKLAGGRRFCETR---FEEQQPHFLESCFLCKKQLGSNKDIFMYRGDTPFCSEECRQEQI  128

Query  433  KQDERKERSTNL  468
            + DE KE+  NL
Sbjct  129  EIDEAKEKKLNL  140



>ref|XP_008670148.1| PREDICTED: uncharacterized protein LOC103647382 [Zea mays]
 tpg|DAA39965.1| TPA: hypothetical protein ZEAMMB73_138121 [Zea mays]
Length=177

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +1

Query  289  SGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            S D   +ET +FL  C LC RRL P RD F+Y+G+ AFCS ECRE+ + Q+E K++    
Sbjct  89   SADYSAVETAAFLRACGLCRRRLGPGRDTFVYKGEAAFCSLECRERHITQEEWKDKCAAT  148

Query  469  QIENNGG  489
             I++ G 
Sbjct  149  SIKDAGA  155



>ref|XP_006661172.1| PREDICTED: uncharacterized protein LOC102708743, partial [Oryza 
brachyantha]
Length=97

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  289  SGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            S D   +ET +FL  C LC RRL P RD FMY+G+ AFCS ECR+Q M Q+E  ++   L
Sbjct  11   SADYCAVETAAFLRACGLCRRRLGPGRDTFMYKGEAAFCSLECRQQHMTQEEWNDKCAVL  70



>ref|XP_009143055.1| PREDICTED: uncharacterized protein LOC103866822 [Brassica rapa]
 emb|CDX74676.1| BnaA05g04220D [Brassica napus]
Length=91

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  310  ETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            E P FL +CSLC + L    DIFMYRGD AFCS ECRE++++ DE KE+S  +
Sbjct  12   EEPHFLESCSLCRKHLGRNSDIFMYRGDKAFCSNECREEQIESDEAKEKSWKV  64



>ref|XP_010434632.1| PREDICTED: uncharacterized protein LOC104718567 [Camelina sativa]
Length=161

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  316  PSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            P FL +C LC +RL   RDIFMYRGDT FCS+ECRE+++++DE KE+  +L
Sbjct  76   PHFLDSCFLCKKRLGDNRDIFMYRGDTPFCSEECREEQIERDEAKEKKQSL  126



>ref|XP_006397648.1| hypothetical protein EUTSA_v10001797mg [Eutrema salsugineum]
 gb|ESQ39101.1| hypothetical protein EUTSA_v10001797mg [Eutrema salsugineum]
Length=94

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  301  YHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKERSTNL  468
            +  E P FL +CSLC + L    DIFMYRGD AFCS+ECRE++++ DE KE+S  +
Sbjct  9    FGCEEPHFLESCSLCRKPLGLNSDIFMYRGDKAFCSKECREEQIESDEAKEKSWKI  64



>ref|XP_009592194.1| PREDICTED: uncharacterized protein LOC104089084 [Nicotiana tomentosiformis]
Length=164

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = +1

Query  229  RSMAAMVSPRYYGGRTTTMTSGDGYHIETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCS  408
            ++++++ SPR   G+    T  D      P FL  C LC + L    DIFMYRGDT FCS
Sbjct  53   KNLSSITSPRLASGKRFYETRFDE---PQPHFLEACFLCKKALGDNTDIFMYRGDTPFCS  109

Query  409  QECREQKMKQDERKERSTNL  468
            +ECR+++++ DE KE+  NL
Sbjct  110  EECRQEQIEMDEAKEKKLNL  129



>ref|XP_010518071.1| PREDICTED: uncharacterized protein LOC104793416 [Camelina sativa]
Length=94

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  310  ETPSFLTTCSLCNRRLAPCRDIFMYRGDTAFCSQECREQKMKQDERKER  456
            E P FL +CSLC + L    DIFMYRGD AFCS+ECRE++++ DE KER
Sbjct  12   EEPHFLESCSLCRKHLGLNSDIFMYRGDKAFCSKECREEQIESDEAKER  60



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 606761303232