BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23984_g1_i2 len=2676 path=[9127:0-133 1078:134-322 1630:323-361
1668:362-601 709:602-630 1936:631-649 1955:650-675 9966:676-706
2012:707-738 247:739-935 444:936-967 2271:968-1175 1202:1176-2675]

Length=2676
                                                                      Score     E

ref|XP_009606824.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    957   0.0      
ref|XP_009757387.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    945   0.0      
ref|XP_004230750.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    928   0.0      
ref|XP_006346380.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    915   0.0      
emb|CDO97207.1|  unnamed protein product                                878   0.0      
ref|XP_002285306.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    869   0.0      Vitis vinifera
ref|XP_007042495.1|  Pten 2                                             867   0.0      
ref|XP_002298741.2|  hypothetical protein POPTR_0001s30940g             863   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006487024.1|  PREDICTED: formin-like protein 5-like isofor...    863   0.0      
ref|XP_011000143.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    862   0.0      
gb|KDP47126.1|  hypothetical protein JCGZ_22122                         857   0.0      
ref|XP_006422958.1|  hypothetical protein CICLE_v10028040mg             852   0.0      
gb|KDO59790.1|  hypothetical protein CISIN_1g037030mg                   850   0.0      
ref|XP_002518704.1|  phosphoprotein phosphatase, putative               842   0.0      Ricinus communis
ref|XP_008788497.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    840   0.0      
ref|XP_010107860.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-p...    840   0.0      
ref|XP_010246580.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    838   0.0      
ref|XP_011000932.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    838   0.0      
gb|KHG04310.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    837   0.0      
ref|XP_008786830.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    836   0.0      
gb|EYU37646.1|  hypothetical protein MIMGU_mgv1a003275mg                829   0.0      
ref|XP_011088219.1|  PREDICTED: uncharacterized protein LOC105169...    829   0.0      
ref|XP_010268474.1|  PREDICTED: uncharacterized protein LOC104605416    828   0.0      
ref|XP_002313137.2|  hypothetical protein POPTR_0009s10080g             828   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010065983.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    828   0.0      
ref|XP_010555987.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    825   0.0      
ref|XP_010922080.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    823   0.0      
gb|KHN06755.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    823   0.0      
ref|XP_011088222.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    821   0.0      
ref|XP_003536624.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    822   0.0      
ref|XP_009410466.1|  PREDICTED: uncharacterized protein LOC103992479    822   0.0      
ref|XP_004496964.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    821   0.0      
ref|XP_009381358.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    820   0.0      
ref|XP_009335014.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    820   0.0      
gb|KHG26348.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    817   0.0      
emb|CBI40281.3|  unnamed protein product                                815   0.0      
ref|XP_003555950.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    816   0.0      
gb|KEH44126.1|  phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    815   0.0      
ref|XP_008454975.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    813   0.0      
gb|KCW63728.1|  hypothetical protein EUGRSUZ_G01374                     812   0.0      
ref|XP_007143038.1|  hypothetical protein PHAVU_007G038300g             811   0.0      
ref|XP_004136966.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    808   0.0      
ref|XP_008236566.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    807   0.0      
ref|XP_002883181.1|  hypothetical protein ARALYDRAFT_479458             806   0.0      
ref|XP_007201726.1|  hypothetical protein PRUPE_ppa003014mg             806   0.0      
ref|XP_008342945.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    804   0.0      
ref|XP_004159902.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    802   0.0      
gb|AAO13749.1|AF268257_1  PTEN-like protein                             801   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_188573.1|  phosphatase PTEN2                                     800   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX95448.1|  BnaC01g33400D                                          797   0.0      
ref|XP_004304029.1|  PREDICTED: cyclin-G-associated kinase-like         798   0.0      
ref|XP_010487885.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    796   0.0      
ref|XP_010519293.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    795   0.0      
ref|XP_010507715.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    793   0.0      
ref|XP_009145793.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    792   0.0      
ref|XP_009111867.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    791   0.0      
ref|XP_003576651.1|  PREDICTED: uncharacterized protein LOC100846535    794   0.0      
ref|XP_006406503.1|  hypothetical protein EUTSA_v10020332mg             790   0.0      
ref|XP_009145794.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    790   0.0      
emb|CDY50153.1|  BnaA01g26130D                                          789   0.0      
ref|XP_006663975.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    790   0.0      
ref|XP_006855231.1|  hypothetical protein AMTR_s00051p00218610          788   0.0      
ref|XP_009145791.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    785   0.0      
ref|XP_010691716.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    785   0.0      
ref|NP_001066634.1|  Os12g0407500                                       786   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ96939.1|  predicted protein                                      785   0.0      
ref|XP_004957777.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    785   0.0      
emb|CDY46177.1|  BnaA05g20640D                                          780   0.0      
emb|CDY63391.1|  BnaCnng41960D                                          773   0.0      
gb|EPS74080.1|  hypothetical protein M569_00672                         769   0.0      
ref|XP_010908851.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    770   0.0      
ref|XP_008670992.1|  PREDICTED: uncharacterized protein LOC103648286    771   0.0      
emb|CDP02533.1|  unnamed protein product                                761   0.0      
ref|XP_002278436.1|  PREDICTED: uncharacterized protein LOC100259289    757   0.0      Vitis vinifera
gb|KDP31989.1|  hypothetical protein JCGZ_12450                         755   0.0      
ref|XP_007047377.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-p...    754   0.0      
ref|XP_006339853.1|  PREDICTED: putative tyrosine-protein phospha...    749   0.0      
ref|XP_009619625.1|  PREDICTED: uncharacterized protein LOC104111597    748   0.0      
ref|XP_006494490.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    749   0.0      
gb|KHG14004.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    744   0.0      
ref|XP_009761701.1|  PREDICTED: putative tyrosine-protein phospha...    744   0.0      
ref|XP_011099098.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    747   0.0      
ref|XP_002310706.1|  hypothetical protein POPTR_0007s10610g             739   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002524915.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-p...    741   0.0      Ricinus communis
ref|XP_004231877.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    737   0.0      
ref|XP_011005814.1|  PREDICTED: uncharacterized protein LOC105111981    733   0.0      
ref|XP_008440315.1|  PREDICTED: uncharacterized protein LOC103484800    729   0.0      
ref|XP_004141902.1|  PREDICTED: putative tyrosine-protein phospha...    728   0.0      
ref|XP_003516608.1|  PREDICTED: uncharacterized protein LOC100801622    719   0.0      
gb|KHG03642.1|  pten                                                    721   0.0      
gb|KHG03643.1|  pten                                                    721   0.0      
ref|XP_010679536.1|  PREDICTED: uncharacterized protein LOC104894880    717   0.0      
ref|XP_010028180.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    717   0.0      
gb|EEC69136.1|  hypothetical protein OsI_38062                          714   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_003538807.1|  PREDICTED: uncharacterized protein LOC100807702    712   0.0      
ref|XP_004511888.1|  PREDICTED: putative tyrosine-protein phospha...    712   0.0      
ref|XP_003611670.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-p...    710   0.0      
ref|XP_010095308.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-p...    709   0.0      
ref|XP_007156765.1|  hypothetical protein PHAVU_002G015700g             709   0.0      
gb|EYU44435.1|  hypothetical protein MIMGU_mgv1a003321mg                702   0.0      
gb|KHN36257.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    703   0.0      
gb|ADV04056.1|  tyrosine phosphatase                                    695   0.0      
ref|XP_002461327.1|  hypothetical protein SORBIDRAFT_02g000980          699   0.0      Sorghum bicolor [broomcorn]
gb|EPS66726.1|  hypothetical protein M569_08048                         687   0.0      
emb|CAN59799.1|  hypothetical protein VITISV_038871                     688   0.0      Vitis vinifera
ref|XP_002962229.1|  hypothetical protein SELMODRAFT_165134             681   0.0      
ref|XP_002965143.1|  hypothetical protein SELMODRAFT_167184             680   0.0      
ref|XP_006297600.1|  hypothetical protein CARUB_v10013622mg             672   0.0      
ref|XP_009399933.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    672   0.0      
ref|XP_007205033.1|  hypothetical protein PRUPE_ppa004114mg             665   0.0      
ref|XP_010558861.1|  PREDICTED: uncharacterized protein LOC104827383    669   0.0      
ref|XP_008238882.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    665   0.0      
ref|XP_010515377.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    663   0.0      
ref|XP_006404056.1|  hypothetical protein EUTSA_v10010193mg             662   0.0      
ref|XP_010503678.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    661   0.0      
ref|XP_010503679.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    660   0.0      
ref|XP_009367508.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    655   0.0      
ref|XP_004289204.1|  PREDICTED: putative tyrosine-protein phospha...    651   0.0      
ref|XP_006290734.1|  hypothetical protein CARUB_v10016830mg             655   0.0      
ref|XP_002877728.1|  hypothetical protein ARALYDRAFT_485369             654   0.0      
ref|XP_009372439.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    647   0.0      
emb|CBI21370.3|  unnamed protein product                                642   0.0      
ref|NP_566929.1|  protein PHOSPHATASE AND TENSIN HOMOLOG DELETED ...    650   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008338339.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    644   0.0      
emb|CDY23021.1|  BnaC07g31660D                                          646   0.0      
ref|XP_009136536.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    634   0.0      
emb|CAB62119.1|  putative tyrosine phosphatase                          634   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_001770087.1|  predicted protein                                  616   0.0      
gb|EAZ20239.1|  hypothetical protein OsJ_35839                          616   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_001774162.1|  predicted protein                                  603   0.0      
gb|KDO79081.1|  hypothetical protein CISIN_1g012952mg                   599   0.0      
emb|CDY02094.1|  BnaA03g40730D                                          603   0.0      
ref|XP_006425973.1|  hypothetical protein CICLE_v10025539mg             567   0.0      
ref|XP_010431198.1|  PREDICTED: uncharacterized protein LOC104715496    569   0.0      
gb|EMT22368.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    531   1e-173   
gb|EMS56895.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    464   4e-153   
ref|XP_001764914.1|  predicted protein                                  431   1e-132   
ref|XP_001785390.1|  predicted protein                                  380   9e-114   
emb|CDY65163.1|  BnaC03g73950D                                          318   7e-96    
ref|XP_008391503.1|  PREDICTED: uncharacterized protein LOC103453718    243   8e-70    
ref|XP_004988095.1|  hypothetical protein PTSG_10560                    227   3e-62    
ref|XP_003698646.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    226   2e-61    
ref|XP_006557297.1|  PREDICTED: phosphatase and tensin-like isofo...    227   3e-61    
ref|XP_001749050.1|  hypothetical protein                               224   3e-61    Monosiga brevicollis MX1
gb|KFD50012.1|  hypothetical protein M513_09105                         226   7e-61    
ref|NP_001155985.1|  phosphatase and tensin-like                        225   8e-61    Apis mellifera [bee]
ref|XP_006622015.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    228   9e-61    
ref|XP_006557293.1|  PREDICTED: phosphatase and tensin-like isofo...    228   1e-60    
ref|XP_006622014.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    227   1e-60    
ref|XP_003486173.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    224   1e-60    
gb|KHJ40971.1|  dual-specificity protein phosphatase PTEN family ...    221   2e-60    
ref|XP_003402814.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    224   2e-60    
ref|XP_006557292.1|  PREDICTED: phosphatase and tensin-like isofo...    227   2e-60    
ref|XP_006622018.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    225   2e-60    
ref|XP_006557296.1|  PREDICTED: phosphatase and tensin-like isofo...    225   2e-60    
ref|XP_001382218.2|  GA19047                                            223   3e-60    Drosophila pseudoobscura pseudoobscura
gb|ACR55737.1|  phosphatase and tensin-like C                           223   3e-60    Apis mellifera [bee]
ref|XP_006622017.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    225   3e-60    
gb|ACR55736.1|  phosphatase and tensin-like B                           223   3e-60    Apis mellifera [bee]
ref|XP_006557295.1|  PREDICTED: phosphatase and tensin-like isofo...    225   4e-60    
ref|XP_003402815.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    222   5e-60    
ref|XP_003486174.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    222   6e-60    
gb|EMT22367.1|  hypothetical protein F775_30443                         214   6e-60    
ref|XP_009022389.1|  hypothetical protein HELRODRAFT_120014             216   6e-60    
gb|EFW43384.2|  pten protein                                            219   7e-60    
ref|XP_006622016.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    224   9e-60    
gb|EMS62185.1|  hypothetical protein TRIUR3_20655                       214   1e-59    
ref|XP_006557294.1|  PREDICTED: phosphatase and tensin-like isofo...    224   1e-59    
gb|EZA50068.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    221   1e-59    
ref|XP_002065075.1|  GK15265                                            222   4e-59    Drosophila willistoni
ref|XP_002014403.1|  GL19174                                            219   2e-58    Drosophila persimilis
ref|XP_001625001.1|  predicted protein                                  213   4e-58    Nematostella vectensis
gb|ELU06519.1|  hypothetical protein CAPTEDRAFT_90711                   214   5e-58    
ref|NP_599147.1|  pten, isoform A                                       217   6e-58    Drosophila melanogaster
gb|AAF23236.1|AF201905_1  phosphatase and tensin homolog                217   8e-58    Drosophila melanogaster
gb|AAD45363.1|AF161258_1  PTEN2                                         217   9e-58    Drosophila melanogaster
ref|NP_477423.1|  pten, isoform B                                       217   9e-58    Drosophila melanogaster
ref|NP_001161638.1|  phosphatase and tensin homolog                     213   1e-57    Saccoglossus kowalevskii
ref|NP_477424.1|  pten, isoform C                                       214   1e-57    Drosophila melanogaster
ref|XP_003382733.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    215   1e-57    
gb|EFN90161.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    218   1e-57    
ref|XP_002677109.1|  predicted protein                                  215   1e-57    Naegleria gruberi strain NEG-M
ref|XP_005092511.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    207   2e-57    
gb|EFA07760.1|  hypothetical protein TcasGA2_TC005314                   214   2e-57    
ref|XP_007895108.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    213   3e-57    
ref|XP_003708160.1|  PREDICTED: phosphatidylinositol-3,4,5-trisph...    215   3e-57    
ref|XP_008197501.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    214   4e-57    
ref|XP_002036459.1|  GM11890                                            215   5e-57    Drosophila sechellia
ref|XP_008487688.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    212   7e-57    
ref|XP_004344005.1|  Protein-tyrosine-phosphatase                       221   9e-57    
ref|XP_002004101.1|  GI18266                                            216   9e-57    Drosophila mojavensis
ref|XP_009291324.1|  PREDICTED: phosphatase and tensin homolog A ...    212   1e-56    
ref|XP_002089058.1|  GE26252                                            214   1e-56    Drosophila yakuba
ref|XP_003723944.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    211   1e-56    
ref|XP_008340400.1|  PREDICTED: cyclin-G-associated kinase-like         202   1e-56    
ref|XP_008547428.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    209   1e-56    
gb|AAR04345.1|  phosphatase and tensin-like protein A long splice...    212   1e-56    Danio rerio [leopard danio]
ref|NP_957002.2|  phosphatase and tensin homolog A                      212   1e-56    Danio rerio [leopard danio]
gb|EFX81708.1|  phosphatase and tensin-like protein                     206   2e-56    
ref|XP_001963068.1|  GF14124                                            213   3e-56    Drosophila ananassae
ref|XP_974994.2|  PREDICTED: phosphatidylinositol 3,4,5-trisphosp...    213   3e-56    Tribolium castaneum [rust-red flour beetle]
ref|XP_001969427.1|  GG23962                                            212   4e-56    Drosophila erecta
gb|EKC26943.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    211   4e-56    
ref|NP_001128398.1|  phosphatase and tensin homolog                     211   5e-56    Nasonia vitripennis
dbj|GAM17605.1|  hypothetical protein SAMD00019534_007800               210   5e-56    
gb|AAH59457.1|  Phosphatase and tensin homolog A                        210   6e-56    Danio rerio [leopard danio]
ref|XP_637576.1|  protein tyrosine phosphatase                          212   6e-56    Dictyostelium discoideum AX4
ref|NP_001184205.1|  uncharacterized protein LOC100505440               208   7e-56    
gb|AAL99958.1|  PteN                                                    211   7e-56    Dictyostelium discoideum
ref|XP_001993525.1|  GH13854                                            210   8e-56    Drosophila grimshawi
ref|XP_002405586.1|  TPIP alpha lipid phosphatase, putative             207   8e-56    Ixodes scapularis [blacklegged tick]
ref|XP_002115205.1|  hypothetical protein TRIADDRAFT_28654              206   8e-56    Trichoplax adhaerens
ref|XP_003449455.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    208   9e-56    
ref|XP_002052397.1|  GJ17528                                            213   9e-56    Drosophila virilis
ref|NP_001116943.1|  phosphatase and tensin homolog                     207   1e-55    Xenopus tropicalis [western clawed frog]
ref|XP_004565290.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    207   2e-55    
ref|XP_009063523.1|  hypothetical protein LOTGIDRAFT_195725             205   2e-55    
ref|XP_005743477.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    207   3e-55    
ref|XP_008207909.1|  PREDICTED: phosphatase and tensin homolog is...    211   3e-55    
ref|XP_004565289.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    207   3e-55    
gb|EPZ34584.1|  Protein-tyrosine phosphatase domain-containing pr...    204   3e-55    
ref|XP_008207907.1|  PREDICTED: phosphatase and tensin homolog is...    211   3e-55    
ref|XP_008302817.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   4e-55    
dbj|GAM16849.1|  hypothetical protein SAMD00019534_000240               208   4e-55    
gb|EFN66467.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    211   6e-55    
ref|XP_006009982.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    206   6e-55    
ref|XP_008207911.1|  PREDICTED: phosphatase and tensin homolog is...    209   8e-55    
ref|XP_003964007.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    205   9e-55    
ref|XP_005406534.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    203   1e-54    
gb|AAL08419.1|  PTEN                                                    205   1e-54    Takifugu rubripes [tiger puffer]
ref|XP_008207910.1|  PREDICTED: phosphatase and tensin homolog is...    209   1e-54    
ref|XP_005810521.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    205   2e-54    
emb|CDQ60841.1|  unnamed protein product                                206   2e-54    
ref|XP_005743479.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    204   2e-54    
ref|XP_010750896.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    204   2e-54    
ref|XP_010868420.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    204   2e-54    
ref|XP_003224419.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    204   2e-54    
ref|XP_010868419.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    204   3e-54    
ref|XP_010564236.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   3e-54    
ref|XP_008320667.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    204   3e-54    
ref|XP_009492856.1|  hypothetical protein H696_00701                    209   3e-54    
ref|XP_007071643.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    203   3e-54    
ref|XP_005292555.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    203   4e-54    
ref|XP_004086824.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    203   4e-54    
ref|XP_008320666.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    204   4e-54    
ref|XP_008436305.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    203   4e-54    
gb|AAH93110.1|  Ptenb protein                                           199   4e-54    Danio rerio [leopard danio]
ref|XP_006273492.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    203   4e-54    
ref|XP_007541048.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    203   5e-54    
ref|XP_007433696.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    199   5e-54    
ref|XP_005406457.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    203   5e-54    
ref|XP_421555.2|  PREDICTED: phosphatidylinositol 3,4,5-trisphosp...    203   6e-54    Gallus gallus [bantam]
ref|XP_010564235.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    203   6e-54    
ref|XP_001363283.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    203   6e-54    Monodelphis domestica
ref|NP_113794.1|  phosphatidylinositol 3,4,5-trisphosphate 3-phos...    202   6e-54    Rattus norvegicus [brown rat]
ref|XP_005495952.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   7e-54    
gb|EFZ18116.1|  hypothetical protein SINV_09976                         207   7e-54    
ref|XP_007244646.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    204   8e-54    
ref|XP_005474271.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   9e-54    
ref|XP_007244645.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    204   9e-54    
pdb|1D5R|A  Chain A, Crystal Structure Of The Pten Tumor Suppressor     200   9e-54    
ref|XP_006755914.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
ref|XP_005727537.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
ref|XP_005474272.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
ref|NP_001001822.1|  phosphatidylinositol 3,4,5-trisphosphate 3-p...    202   1e-53    Danio rerio [leopard danio]
ref|XP_009243870.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
ref|XP_004701143.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
ref|XP_004409753.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
ref|NP_001277906.1|  phosphatase and tensin homolog                     202   1e-53    
ref|XP_003964008.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    203   1e-53    
ref|XP_003409298.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
gb|ADM26750.1|  phosphatase and tensin-like protein                     202   1e-53    
gb|AAR04346.1|  phosphatase and tensin-like protein B long splice...    202   1e-53    Danio rerio [leopard danio]
ref|XP_004680952.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
emb|CAF94889.1|  unnamed protein product                                202   1e-53    Tetraodon nigroviridis
ref|XP_005385943.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
ref|XP_004924449.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
gb|EAW50175.1|  phosphatase and tensin homolog (mutated in multip...    202   1e-53    
ref|XP_005875998.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
ref|XP_007520820.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
ref|XP_010603291.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
ref|XP_004464588.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
gb|ADM26749.1|  phosphatase and tensin-like protein                     202   1e-53    
ref|NP_001003192.1|  phosphatidylinositol 3,4,5-trisphosphate 3-p...    202   1e-53    
ref|XP_008836075.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
ref|XP_010863040.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
ref|XP_006831181.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   1e-53    
ref|NP_032986.1|  phosphatidylinositol 3,4,5-trisphosphate 3-phos...    202   1e-53    
ref|XP_006169808.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    198   1e-53    
ref|XP_004653255.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   2e-53    
ref|XP_005339247.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   2e-53    
ref|XP_003438317.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   2e-53    
ref|XP_010782489.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   2e-53    
ref|XP_005352208.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   2e-53    
ref|NP_001137168.1|  phosphatidylinositol-3,4,5-trisphosphate 3-p...    201   2e-53    
gb|AAX36413.1|  phosphatase and tensin-like                             201   2e-53    
ref|XP_006926039.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   2e-53    
ref|NP_001083831.1|  phosphatidylinositol 3,4,5-trisphosphate 3-p...    201   2e-53    
gb|ERE79056.1|  phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    202   2e-53    
ref|XP_010863046.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   2e-53    
ref|XP_010742537.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   2e-53    
emb|CDQ61574.1|  unnamed protein product                                202   2e-53    
ref|XP_004551621.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   2e-53    
ref|XP_010742529.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   2e-53    
ref|XP_008268354.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   2e-53    
ref|XP_010782488.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   2e-53    
ref|XP_008285018.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   2e-53    
gb|EAW50173.1|  phosphatase and tensin homolog (mutated in multip...    202   3e-53    
ref|XP_001326101.1|  phosphatidylinositol-3,4,5-trisphosphate 3-p...    198   3e-53    
ref|XP_004077141.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   3e-53    
gb|AAX36861.1|  phosphatase and tensin-like                             201   3e-53    
gb|AAX41578.1|  phosphatase and tensin-like                             201   3e-53    
ref|XP_005474270.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   3e-53    
gb|AAX43209.1|  phosphatase and tensin-like                             201   3e-53    
ref|XP_005804949.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   3e-53    
ref|XP_004551620.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   3e-53    
ref|XP_008285017.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   3e-53    
ref|XP_005914180.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   4e-53    
ref|XP_005474269.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   4e-53    
ref|XP_002610383.1|  hypothetical protein BRAFLDRAFT_209333             199   4e-53    
ref|XP_004551619.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   4e-53    
ref|XP_005804948.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   4e-53    
ref|XP_005727536.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    202   4e-53    
gb|ADM26748.1|  phosphatase and tensin-like protein                     200   4e-53    
ref|XP_008427604.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   4e-53    
ref|XP_004077142.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   5e-53    
ref|XP_008427603.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    201   5e-53    
tpg|DAA64599.1|  TPA: mitochondrial PTENalpha                           204   5e-53    
tpg|DAA64600.1|  TPA: mitochondrial PTENalpha                           204   6e-53    
ref|XP_008313193.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    200   6e-53    
gb|ADM26757.1|  phosphatase and tensin-like protein                     200   6e-53    
ref|XP_007545364.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    200   7e-53    
gb|EHH64853.1|  hypothetical protein EGM_18176                          199   8e-53    
tpg|DAA64601.1|  TPA: mitochondrial PTENalpha                           204   8e-53    
tpg|DAA64595.1|  TPA: mitochondrial PTENalpha                           204   8e-53    
ref|NP_001288689.1|  phosphatase and tensin homolog                     204   8e-53    
ref|XP_006121547.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    200   1e-52    
tpg|DAA64597.1|  TPA: mitochondrial PTENalpha                           204   1e-52    
ref|XP_004086825.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    199   1e-52    
ref|XP_004362272.1|  protein tyrosine phosphatase                       205   1e-52    
gb|KFO23280.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    203   1e-52    
gb|EKF29888.1|  tyrosine phosphatase, putative                          201   3e-52    
ref|XP_003262607.2|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    204   3e-52    
ref|XP_007251223.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   5e-52    
ref|XP_004367580.1|  dual specificity phosphatase, catalytic doma...    209   5e-52    
ref|XP_008313192.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    198   6e-52    
ref|XP_002130240.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    197   8e-52    
dbj|BAE28651.1|  unnamed protein product                                196   1e-51    
ref|NP_001124955.1|  phosphatidylinositol 3,4,5-trisphosphate 3-p...    196   1e-51    
ref|XP_004632175.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    195   1e-51    
ref|XP_009031594.1|  hypothetical protein HELRODRAFT_151946             189   1e-51    
ref|XP_001327946.1|  phosphatidylinositol-3,4,5-trisphosphate 3-p...    193   1e-51    
dbj|GAM20421.1|  hypothetical protein SAMD00019534_035960               204   1e-51    
ref|XP_004887384.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    196   1e-51    
ref|XP_009830137.1|  hypothetical protein, variant                      196   2e-51    
ref|XP_001455854.1|  hypothetical protein                               195   2e-51    
ref|XP_004035605.1|  phosphatase and tensin, putative                   197   2e-51    
gb|KFH66727.1|  hypothetical protein MVEG_07252                         201   2e-51    
ref|XP_009307625.1|  putative tyrosine phosphatase                      199   3e-51    
ref|XP_010487884.1|  PREDICTED: cell wall protein IFF6-like             189   3e-51    
ref|XP_005183453.1|  PREDICTED: dentin sialophosphoprotein-like i...    205   3e-51    
ref|XP_001427413.1|  hypothetical protein                               194   3e-51    
gb|AAC52017.1|  phosphatase and tensin homolog 2                        195   4e-51    
ref|XP_004521565.1|  PREDICTED: serine-rich adhesin for platelets...    205   6e-51    
gb|AAB70558.1|  putative protein tyrosine phosphatase homologue         192   6e-51    
emb|CDS07514.1|  hypothetical protein LRAMOSA01463                      191   8e-51    
ref|XP_003473590.2|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    186   1e-50    
ref|XP_008860955.1|  hypothetical protein H310_00098                    196   1e-50    
ref|XP_008860956.1|  hypothetical protein, variant                      194   1e-50    
ref|XP_009830136.1|  hypothetical protein H257_06564                    195   2e-50    
ref|XP_008610796.1|  hypothetical protein SDRG_06772                    193   3e-50    
ref|XP_002678142.1|  predicted protein                                  185   3e-50    
gb|AAP45145.1|  phosphatase TPTE delta isoform                          192   3e-50    
ref|XP_005819533.1|  hypothetical protein GUITHDRAFT_158972             185   3e-50    
ref|NP_954870.2|  putative tyrosine-protein phosphatase TPTE isof...    196   3e-50    
gb|AAC34574.1|  putative tyrosine phosphatase                           196   3e-50    
ref|NP_001277153.1|  putative tyrosine-protein phosphatase TPTE i...    192   3e-50    
ref|XP_009038041.1|  hypothetical protein AURANDRAFT_28007              185   3e-50    
ref|XP_003242877.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    193   3e-50    
gb|KDO29952.1|  hypothetical protein SPRG_05142                         193   3e-50    
ref|XP_007205840.1|  hypothetical protein PRUPE_ppa011039mg             187   4e-50    
sp|P56180.3|TPTE_HUMAN  RecName: Full=Putative tyrosine-protein p...    196   4e-50    
ref|XP_008180621.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    193   4e-50    
gb|AAH28719.1|  Transmembrane phosphatase with tensin homology          195   4e-50    
ref|NP_954868.1|  putative tyrosine-protein phosphatase TPTE isof...    195   5e-50    
gb|AAI21584.1|  LOC548705 protein                                       191   5e-50    
gb|AAP45144.1|  phosphatase TPTE gamma isoform                          194   5e-50    
ref|NP_954869.1|  putative tyrosine-protein phosphatase TPTE isof...    194   5e-50    
ref|XP_002680680.1|  predicted protein                                  184   5e-50    
emb|CDH53985.1|  phosphatase and tensin homolog                         189   8e-50    
emb|CDH53984.1|  isoform c                                              189   8e-50    
gb|AAI28147.1|  TPTE2 protein                                           191   9e-50    
ref|XP_009676868.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    194   9e-50    
ref|NP_001135440.1|  phosphatidylinositol 3,4,5-trisphosphate 3-p...    191   1e-49    
gb|KFV83220.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    193   1e-49    
ref|XP_006259938.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    193   1e-49    
ref|XP_006025846.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    193   1e-49    
ref|XP_010145052.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    193   2e-49    
dbj|GAM27881.1|  hypothetical protein SAMD00019534_110570               199   2e-49    
ref|NP_001267536.1|  voltage-sensitive phosphatase 2                    192   2e-49    
gb|KFV91304.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    192   2e-49    
gb|KFZ61090.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    192   2e-49    
ref|XP_005826984.1|  hypothetical protein GUITHDRAFT_75928              182   2e-49    
ref|XP_814678.1|  tyrosine phosphatase                                  191   2e-49    
gb|EKC43187.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    193   2e-49    
gb|ABM21567.1|  PTEN transcript variant 5                               184   2e-49    
ref|XP_009941074.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    192   3e-49    
gb|EKG05115.1|  tyrosine phosphatase, putative                          193   3e-49    
ref|XP_010164918.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    192   3e-49    
ref|XP_009880661.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    192   3e-49    
gb|EJY67579.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    192   3e-49    
ref|XP_005147697.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    192   3e-49    
ref|XP_011059004.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    194   3e-49    
emb|CCI39847.1|  unnamed protein product                                194   4e-49    
gb|KDR18177.1|  hypothetical protein L798_06927                         190   4e-49    
gb|KFZ56895.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    191   4e-49    
ref|XP_004711322.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   5e-49    
ref|XP_010022632.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    192   5e-49    
ref|XP_010195870.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    191   5e-49    
ref|NP_001015951.1|  transmembrane phosphoinositide 3-phosphatase...    191   5e-49    
ref|XP_007495440.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    194   6e-49    
gb|KFR17156.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    191   6e-49    
gb|KGL91120.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    191   6e-49    
gb|KFQ41554.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    191   6e-49    
emb|CCI39848.1|  unnamed protein product                                194   6e-49    
gb|AAI54862.1|  LOC548705 protein                                       190   8e-49    
emb|CAD13145.1|  TPIP beta                                              186   8e-49    
emb|CAG05033.1|  unnamed protein product                                189   8e-49    
ref|XP_417079.2|  PREDICTED: phosphatidylinositol 3,4,5-trisphosp...    191   8e-49    
gb|EAX08221.1|  transmembrane phosphoinositide 3-phosphatase and ...    186   8e-49    
emb|CAD13144.1|  TPIP alpha lipid phosphatase                           189   9e-49    
ref|XP_009948642.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   1e-48    
gb|KFP24722.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    190   1e-48    
ref|XP_004339130.1|  phosphatase, putative                              190   1e-48    
ref|NP_570141.3|  phosphatidylinositol 3,4,5-trisphosphate 3-phos...    189   1e-48    
gb|KFQ86492.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    190   1e-48    
gb|KFD64744.1|  hypothetical protein M514_09105                         189   2e-48    
ref|XP_001748597.1|  hypothetical protein                               194   2e-48    
dbj|BAO96085.1|  voltage-sensor containing phosphatase                  190   2e-48    
ref|XP_638022.2|  LIM-type zinc finger-containing protein               196   2e-48    
ref|XP_004938786.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   2e-48    
ref|XP_008629628.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   2e-48    
ref|XP_009977182.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   2e-48    
ref|XP_010398674.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   2e-48    
gb|KFP98330.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    189   2e-48    
gb|KFV10038.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    189   2e-48    
ref|XP_009461340.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   2e-48    
ref|XP_010287305.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   2e-48    
ref|XP_004938795.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    190   3e-48    
ref|XP_002676378.1|  predicted protein                                  179   3e-48    
gb|EAX08222.1|  transmembrane phosphoinositide 3-phosphatase and ...    191   3e-48    
gb|KFQ95421.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    189   3e-48    
ref|XP_009877520.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   3e-48    
ref|XP_005240290.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   3e-48    
ref|XP_010727063.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   3e-48    
ref|XP_001441833.1|  hypothetical protein                               187   3e-48    
gb|KFQ76880.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    188   3e-48    
ref|XP_001453274.1|  hypothetical protein                               187   3e-48    
ref|XP_009925120.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   4e-48    
ref|XP_009485544.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   4e-48    
ref|XP_009640915.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   4e-48    
gb|AAP45146.1|  phosphatase TPIP gamma isoform                          189   4e-48    
gb|KFP95246.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    189   4e-48    
ref|XP_009586137.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   4e-48    
ref|XP_001506371.2|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    183   4e-48    
gb|EAX08220.1|  transmembrane phosphoinositide 3-phosphatase and ...    189   4e-48    
gb|KFP19179.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    188   4e-48    
ref|XP_010398676.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    188   4e-48    
ref|XP_004341976.1|  mammalian PTEN tumor suppressorlike, putative      185   5e-48    
gb|ABM21566.1|  PTEN transcript variant 4                               183   5e-48    
gb|KFP73811.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    188   6e-48    
ref|XP_009318211.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   6e-48    
gb|KFV99213.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    188   6e-48    
gb|KFQ18929.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    187   6e-48    
ref|NP_954863.2|  phosphatidylinositol 3,4,5-trisphosphate 3-phos...    189   6e-48    
ref|XP_005516390.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    188   6e-48    
ref|XP_009288435.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    188   6e-48    
ref|XP_008940020.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    186   7e-48    
ref|XP_009424948.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    189   7e-48    
ref|XP_008927328.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    188   7e-48    
ref|XP_004035773.1|  lim-type zinc finger protein, putative             180   7e-48    
gb|KFQ63416.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    188   8e-48    
emb|CEJ01079.1|  hypothetical protein RMCBS344292_15117                 183   8e-48    
ref|XP_001427479.1|  hypothetical protein                               186   9e-48    
ref|XP_009081824.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    188   9e-48    
gb|KFO57358.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    187   9e-48    
ref|XP_005501909.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    188   1e-47    
emb|CCA19204.1|  phosphatidylinositol3 putative                         191   1e-47    
ref|XP_009996621.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   1e-47    
gb|KFM02299.1|  Phosphatidylinositol 3,4,5-trisphosphate 3-phosph...    187   1e-47    
gb|EMC87706.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-phosph...    187   1e-47    
gb|EAX08224.1|  transmembrane phosphoinositide 3-phosphatase and ...    190   1e-47    
ref|XP_002430280.1|  Phosphatidylinositol-3,4,5-trisphosphate 3-p...    186   1e-47    
gb|ESS68402.1|  tyrosine phosphatase                                    187   2e-47    
ref|XP_010869359.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   2e-47    
ref|XP_009498550.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   2e-47    
ref|XP_009906975.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   2e-47    
ref|XP_010116810.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   2e-47    
ref|XP_001917678.2|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    184   2e-47    
ref|XP_010133718.1|  PREDICTED: phosphatidylinositol 3,4,5-trisph...    187   2e-47    



>ref|XP_009606824.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Nicotiana 
tomentosiformis]
 ref|XP_009606825.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Nicotiana 
tomentosiformis]
Length=616

 Score =   957 bits (2474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/617 (76%), Positives = 519/617 (84%), Gaps = 15/617 (2%)
 Frame = +3

Query  141   MDTQLSNASNPQPSVTANMETSN-VNSVPAQ---DGPSKLST-----WAKSLKIPQPFTG  293
             MD+  ++ S+ QP   +N   S  V+S P Q   + PSKLST     WAK+LKIPQPFTG
Sbjct  1     MDSGSADVSDSQPVTASNAARSTAVDSAPGQSTEEVPSKLSTSGISSWAKNLKIPQPFTG  60

Query  294   SQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSK  473
             SQ+E++SGNAAKS FARFT GFGM  SPKSPTD+NSEGTST+P SSFIGTFTKGLVDSSK
Sbjct  61    SQDEQSSGNAAKSTFARFTGGFGMRMSPKSPTDENSEGTSTSP-SSFIGTFTKGLVDSSK  119

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             NAVKAV VKARHVVSQNKRRYQEGGFDLDLTYITEN+IAMGFPAGDMSSG FGYVEGFYR
Sbjct  120   NAVKAVQVKARHVVSQNKRRYQEGGFDLDLTYITENIIAMGFPAGDMSSGIFGYVEGFYR  179

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             NHMEEVIKFFETHHKDKYKVYNLCSERLYD SLFEGKVA FPFDDHNCPPIQLI+SFCQS
Sbjct  180   NHMEEVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPIQLIISFCQS  239

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
             AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEES++YYNQKRC+D KGLV
Sbjct  240   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESMDYYNQKRCVDGKGLV  299

Query  1014  LPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKK  1193
             LPSQIRYVKYFERILMYFNGENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFSTKK
Sbjct  300   LPSQIRYVKYFERILMYFNGENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTKK  359

Query  1194  HPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIE  1373
             HPRTKDL PED+WFSAPKKGV+VFALPGEPG+AELAGDFK+HF+D QGDFYCWLNTTMIE
Sbjct  360   HPRTKDLSPEDFWFSAPKKGVMVFALPGEPGLAELAGDFKIHFHDGQGDFYCWLNTTMIE  419

Query  1374  NRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpas  1553
             NRK+L T DLDGFDKRKLPSPGFQVE+VLVDYD AFP RPQ E A    +  +S+     
Sbjct  420   NRKVLTTGDLDGFDKRKLPSPGFQVEVVLVDYDAAFPARPQSETATKESADSSSANPAPG  479

Query  1554  gssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDG---VQAKVST  1724
              +     + AA +N+NQ  G+S+KDDVFSDNE+EETG  K  +   A++      AK   
Sbjct  480   SNPTSGGEPAARSNTNQHPGNSDKDDVFSDNESEETGMSKTRQTKAASEASAPADAKPLG  539

Query  1725  SGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSN--TEVSDFKIMA  1898
             S NN  S ++SSLT K EQVSLG +   H+E KRD +VGA S  EVSN    VSDFK++A
Sbjct  540   SKNNNDSDKLSSLTHKTEQVSLGGTSSIHSEPKRDGSVGATSGVEVSNPVGGVSDFKVVA  599

Query  1899  ADASVFTFGDEEDYESE  1949
             ADASVF+FGDEEDYESE
Sbjct  600   ADASVFSFGDEEDYESE  616



>ref|XP_009757387.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Nicotiana 
sylvestris]
Length=616

 Score =   945 bits (2443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/617 (75%), Positives = 513/617 (83%), Gaps = 15/617 (2%)
 Frame = +3

Query  141   MDTQLSNASNPQPSVTANMETSN-VNSVPAQ---DGPSKLST-----WAKSLKIPQPFTG  293
             MD+  ++ S+ QP   +N   S  V+S P Q   + PSKLST     WAK+LKIPQPFTG
Sbjct  1     MDSGSADVSDSQPVTASNAARSTAVDSAPGQSTEEVPSKLSTSGISSWAKNLKIPQPFTG  60

Query  294   SQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSK  473
             SQ+E++SGNA KS FARFT G GM  SPKSP  +NSEGTST+P SSFIGTFTKGLVDSSK
Sbjct  61    SQDEQSSGNATKSTFARFTGGLGMRLSPKSPAAENSEGTSTSP-SSFIGTFTKGLVDSSK  119

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             NAVKAV VKARHVVSQNKRRYQEGGFDLDLTYITEN+IAMGFPAGDMSSG FGYVEGFYR
Sbjct  120   NAVKAVQVKARHVVSQNKRRYQEGGFDLDLTYITENIIAMGFPAGDMSSGIFGYVEGFYR  179

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             NHMEEVIKFFETHHKDKYKVYNLCSERLYD SLFEGKVA FPFDDHNCPPIQLI+SFCQS
Sbjct  180   NHMEEVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPIQLIISFCQS  239

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
             AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEES++YYNQKRC+D KGLV
Sbjct  240   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESMDYYNQKRCVDGKGLV  299

Query  1014  LPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKK  1193
             LPSQIRYVKYFERILMYFNGENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFSTKK
Sbjct  300   LPSQIRYVKYFERILMYFNGENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTKK  359

Query  1194  HPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIE  1373
             HPRTKDL PED+WFSAPKKGV+VFALPGEPG+AELAGDFK+HF+D QGDFYCWLNTTMIE
Sbjct  360   HPRTKDLSPEDFWFSAPKKGVMVFALPGEPGLAELAGDFKIHFHDGQGDFYCWLNTTMIE  419

Query  1374  NRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpas  1553
             NRK+L T DLDGFDKRKLPSPGFQVE+VLVDYD AFP RPQ E      +  +S+     
Sbjct  420   NRKVLTTGDLDGFDKRKLPSPGFQVEVVLVDYDAAFPARPQSETTTRESADSSSANPAPG  479

Query  1554  gssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDG---VQAKVST  1724
              +     + AA +N+NQ  G+S+KDDVFSDNE+EETG  K  +   A++      AK   
Sbjct  480   SNPTSGGEPAARSNTNQHPGNSDKDDVFSDNESEETGMSKTRQTKAASEASAPADAKPLG  539

Query  1725  SGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSN--TEVSDFKIMA  1898
             S NN  S ++SSLT K EQVSLG +   H+E KRD + GA S  EVSN    VSDFK++A
Sbjct  540   SKNNNDSDKLSSLTHKTEQVSLGGTSSIHSEPKRDGSDGATSGVEVSNPVGGVSDFKVVA  599

Query  1899  ADASVFTFGDEEDYESE  1949
             ADASVF+FGDEEDYESE
Sbjct  600   ADASVFSFGDEEDYESE  616



>ref|XP_004230750.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Solanum 
lycopersicum]
 ref|XP_004230751.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Solanum 
lycopersicum]
 ref|XP_010315217.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Solanum 
lycopersicum]
 ref|XP_010315219.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Solanum 
lycopersicum]
 ref|XP_010315220.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Solanum 
lycopersicum]
Length=619

 Score =   928 bits (2399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/620 (74%), Positives = 512/620 (83%), Gaps = 18/620 (3%)
 Frame = +3

Query  141   MDTQLSNASNPQPSVTANMETSN-VNSVPAQ---DGPSKLST-----WAKSLKIPQPFTG  293
             MD+  ++ SN QP  T++   S  V S P Q   + PSK+ST     WAK+LKIPQPFTG
Sbjct  1     MDSGSADVSNSQPVTTSSAARSTAVESAPVQSTEEAPSKISTSGISSWAKNLKIPQPFTG  60

Query  294   SQEEENSGNAAKSPFARFTSGFGMLSSPKSPT---DDNSEGTSTTPQSSFIGTFTKGLVD  464
             SQ+E++SGNA KS FAR T G GM  SPKSPT   D++ +GTST+P S F GTFTKGLVD
Sbjct  61    SQDEQSSGNAPKSTFARLTGGLGMRLSPKSPTSPTDEHVDGTSTSPTSLF-GTFTKGLVD  119

Query  465   SSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEG  644
             SSKNAVKAV VKARHVVSQNKRRYQEGGFDLDLTYITEN+IAMGFPAGDMSSG FGYVEG
Sbjct  120   SSKNAVKAVQVKARHVVSQNKRRYQEGGFDLDLTYITENIIAMGFPAGDMSSGLFGYVEG  179

Query  645   FYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSF  824
             FYRNHMEEVIKFFETHHKDKYKVYNLC+ERLYD SLFEGKVASFPFDDHNCPPIQLI+SF
Sbjct  180   FYRNHMEEVIKFFETHHKDKYKVYNLCAERLYDASLFEGKVASFPFDDHNCPPIQLIISF  239

Query  825   CQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAK  1004
             CQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEES++YYNQKRC+D K
Sbjct  240   CQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESMDYYNQKRCVDGK  299

Query  1005  GLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFS  1184
             GLVLPSQIRYVKYFERILMYFNGENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFS
Sbjct  300   GLVLPSQIRYVKYFERILMYFNGENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFS  359

Query  1185  TKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTT  1364
             +KKHPRTKDL PED+WF+APKKGVVVFALPGEPG+AELAGDFK+HF+DRQGDFYCWLNTT
Sbjct  360   SKKHPRTKDLSPEDFWFNAPKKGVVVFALPGEPGLAELAGDFKIHFHDRQGDFYCWLNTT  419

Query  1365  MIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssan  1544
             MIENRK+L TSDLDGFDKRKLPSPGFQVE+VL DYD A P RPQ E A    +  +S+  
Sbjct  420   MIENRKVLMTSDLDGFDKRKLPSPGFQVEVVLADYDAALPARPQSETATKESADSSSANP  479

Query  1545  pasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATD---GVQAK  1715
                 +    ++ A   N NQ+ G+++KDDVFSDNE+EE G  K  +   A++      AK
Sbjct  480   APVSNPTSGSEPADGTNVNQQPGNNDKDDVFSDNESEEPGMSKARQSKAASEVSAPADAK  539

Query  1716  VSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNT--EVSDFK  1889
                S N   S +ISSLT K EQVSLGD+   H+E K+D +VG AS  +VSN    VSDFK
Sbjct  540   NPGSRNKDDSDKISSLTHKTEQVSLGDTSSVHSEPKKDASVGTASSVDVSNPVGGVSDFK  599

Query  1890  IMAADASVFTFGDEEDYESE  1949
             +MAADASVF+FGDEEDYES+
Sbjct  600   VMAADASVFSFGDEEDYESD  619



>ref|XP_006346380.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006346381.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006346382.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006346383.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X4 [Solanum tuberosum]
Length=614

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/617 (73%), Positives = 503/617 (82%), Gaps = 17/617 (3%)
 Frame = +3

Query  141   MDTQLSNASNPQPSVTANMETSN-VNSVPAQ---DGPSKLST-----WAKSLKIPQPFTG  293
             MD+  ++ SN QP  T+++  S  V S P Q   + PSK+ST     WAK+LKIPQPFTG
Sbjct  1     MDSGSADVSNSQPVTTSSVAKSTAVESAPVQSTEEAPSKISTSGISSWAKNLKIPQPFTG  60

Query  294   SQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSK  473
             SQ+E++SGNA KS FAR T G GM  SPKSPT    E    T  +S  GTFTKGLVDSSK
Sbjct  61    SQDEQSSGNAPKSTFARLTGGLGMRLSPKSPTSPTDEHLDGTSPTSLFGTFTKGLVDSSK  120

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             NAVKAV VKARHVVSQNKRRYQEGGFDLDLTYITEN+IAMGFPAGDMSSG FGYVEGFYR
Sbjct  121   NAVKAVQVKARHVVSQNKRRYQEGGFDLDLTYITENIIAMGFPAGDMSSGLFGYVEGFYR  180

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             NHMEEVIKFFETHHKDKYKVYNLC+ERLYD SLFEGKVASFPFDDHNCPPIQLI+SFCQS
Sbjct  181   NHMEEVIKFFETHHKDKYKVYNLCAERLYDASLFEGKVASFPFDDHNCPPIQLIISFCQS  240

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
             AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEES++YYNQKRC+D KGLV
Sbjct  241   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESMDYYNQKRCVDGKGLV  300

Query  1014  LPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKK  1193
             LPSQIRYVKYFERILMYFNGENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFS+KK
Sbjct  301   LPSQIRYVKYFERILMYFNGENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSSKK  360

Query  1194  HPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIE  1373
             HPRTKDL PED+WF+APKKGVVVFALPGEPG+AELAGDFK+HF+DRQGDFYCWLNTTMIE
Sbjct  361   HPRTKDLSPEDFWFNAPKKGVVVFALPGEPGLAELAGDFKIHFHDRQGDFYCWLNTTMIE  420

Query  1374  NRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpas  1553
             NRK+L  SDLDGFDKRKLPSPGFQVE+VL DYD A    PQ E A    +  +S+     
Sbjct  421   NRKVLMISDLDGFDKRKLPSPGFQVEVVLADYDAAL---PQSETATKESADSSSANTAPV  477

Query  1554  gssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATD---GVQAKVST  1724
              +    ++ A  +N NQ+ G+++KDDVFSDNE+EE G  K  +   A++      AK   
Sbjct  478   SNPTSGSEPADGSNMNQQPGNNDKDDVFSDNESEEPGMSKARQTKAASEVNAPADAKTPG  537

Query  1725  SGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSN--TEVSDFKIMA  1898
             S N   S +ISSLT K EQVSLGD+   H+E K+D +VGA S  +VSN    VSDFK+MA
Sbjct  538   SKNKNDSDKISSLTHKTEQVSLGDTSSVHSEPKKDASVGATSSVDVSNPVGGVSDFKVMA  597

Query  1899  ADASVFTFGDEEDYESE  1949
             ADASVF+FGDEEDYES+
Sbjct  598   ADASVFSFGDEEDYESD  614



>emb|CDO97207.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/619 (70%), Positives = 490/619 (79%), Gaps = 15/619 (2%)
 Frame = +3

Query  132   LSTMDTQLSNASNPQPS---VTANMETSNVNSVPAQDGPSK-----LSTWAKSLKIPQPF  287
             + +  ++LSN S+ Q S   V +  +++  NS   QD PS+     +S WAK+LKIPQ  
Sbjct  1     MESESSELSNTSHGQTSDVPVASATDSAQQNS--GQDAPSRASVSGISNWAKNLKIPQSL  58

Query  288   TGSQEEENSGNAAKSPFARFTSGFGMLSSPK-SPTDDNSEGTSTTPQSSFIGTFTKGLVD  464
              GSQ E  + ++ KS F+RFTSGFG+  SPK S   +NS+GT    QS FIGT TKG+VD
Sbjct  59    VGSQNESPTESSGKSSFSRFTSGFGLRLSPKASQQGENSDGTQPAAQSGFIGTITKGIVD  118

Query  465   SSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEG  644
             SSK+AVKAV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEG
Sbjct  119   SSKSAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEG  178

Query  645   FYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSF  824
             FYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPP+QLI+SF
Sbjct  179   FYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPVQLIISF  238

Query  825   CQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAK  1004
             C SAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYNQKRC D K
Sbjct  239   CHSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCFDGK  298

Query  1005  GLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFS  1184
              LVLPSQIRYVKYFERIL YFNGENQP RRCMLRGFRLH+CPYW+RP+IT+SDH+GVLFS
Sbjct  299   ALVLPSQIRYVKYFERILTYFNGENQPGRRCMLRGFRLHRCPYWVRPAITVSDHSGVLFS  358

Query  1185  TKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTT  1364
             T+KHPRTKDL PEDYWFSAPKKG++VFALPGEPG+ ELAGDFK+HF+DRQGDFYCWLNTT
Sbjct  359   TRKHPRTKDLAPEDYWFSAPKKGIMVFALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTT  418

Query  1365  MIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssan  1544
             MIENRKILNTSDLDGFDKRKLPSPGFQVE+VLVDYD A P     E A       + +  
Sbjct  419   MIENRKILNTSDLDGFDKRKLPSPGFQVEVVLVDYDAAVPPTRHSETANDKTVESSGADT  478

Query  1545  pasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETG--KPKVGKVTVATDGVQAKV  1718
              +  S     + A   +S++ SGS+EKDDVFSD+EAEETG  + +V     +   V   +
Sbjct  479   ASEPSPVAVHEAAVVESSDKNSGSNEKDDVFSDSEAEETGSSRREVSGAPESRKSVDKNI  538

Query  1719  STSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEV--SNTEVSDFKI  1892
               S   T   Q   LT++ E++SLG +G   NE ++D   G+   PEV  S   VS FK 
Sbjct  539   DGSDQKTSLDQSKHLTRETERLSLGSTGSVQNEPRKDAVKGSIPNPEVTSSTANVSQFKA  598

Query  1893  MAADASVFTFGDEEDYESE  1949
             MAADASVFTFGDEEDYESE
Sbjct  599   MAADASVFTFGDEEDYESE  617



>ref|XP_002285306.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Vitis vinifera]
Length=607

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/598 (71%), Positives = 476/598 (80%), Gaps = 16/598 (3%)
 Frame = +3

Query  174   QPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTS  353
             QPSV       N     A+D PS+LS+WAK+LKIPQ   G Q+E  +G  AKS FARFTS
Sbjct  20    QPSVATGSGPDNA----ARDAPSRLSSWAKNLKIPQSLAGGQDESPTGTTAKSSFARFTS  75

Query  354   GFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKR  530
             G G+  SPK+PT +D  +G+ TT Q    GTFTKG+VDSS+NAVKAV VKARHVVSQNKR
Sbjct  76    GIGLRLSPKTPTSEDGPDGSPTTAQPGLFGTFTKGIVDSSRNAVKAVQVKARHVVSQNKR  135

Query  531   RYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYK  710
             RYQEGGFDLD+TYITEN+IAMGFPAGDMSSGF GYVEGFYRNHMEEVIKFFETHHKDKYK
Sbjct  136   RYQEGGFDLDMTYITENIIAMGFPAGDMSSGFLGYVEGFYRNHMEEVIKFFETHHKDKYK  195

Query  711   VYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKA  890
             VYNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI  FCQSAYSWLKEDIENVVVVHCKA
Sbjct  196   VYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLITLFCQSAYSWLKEDIENVVVVHCKA  255

Query  891   GMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFN  1070
             GMARTGLMISSLLL+LKFFPTAEESI+YYNQKRC D KGLVLPSQIRYVKYFERIL YFN
Sbjct  256   GMARTGLMISSLLLFLKFFPTAEESIDYYNQKRCFDGKGLVLPSQIRYVKYFERILTYFN  315

Query  1071  GENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKK  1250
             GENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFSTKKHPRTKDL PE++WFSAPKK
Sbjct  316   GENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTKKHPRTKDLSPEEFWFSAPKK  375

Query  1251  GVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLP  1430
             G++VFALPGEPG+  LAGDFK+HF+DRQGDFYCWLNTTM+ENRK+LN  DLDGFDKRKLP
Sbjct  376   GIMVFALPGEPGLTPLAGDFKIHFHDRQGDFYCWLNTTMMENRKVLNPDDLDGFDKRKLP  435

Query  1431  SPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKS  1610
             SPGFQVE+VL+D+D + P  P+ E  V      + + + +   +       A  N ++  
Sbjct  436   SPGFQVEVVLIDHDGSVPPAPKTETDVKKSDGVSGTGSASVDGAN------ATPNPSKDP  489

Query  1611  GSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSL  1790
             GS +KDDVFSD E EE+G  K  +   A   V AK S+S   T   QI+S+T K EQVSL
Sbjct  490   GSKDKDDVFSDGEVEESGSSKSRQAQAAEGSVAAKTSSSETKTSPDQIASITHKTEQVSL  549

Query  1791  GDSGLK--HN--EQKRDTTVGAASVPEVSNTE-VSDFKIMAADASVFTFGDEEDYESE  1949
             G SG    H+  + K D   G  S  EV N E VS+FK MAADASVFTFGD+EDYESE
Sbjct  550   GASGTTPIHDAGKPKSDAVGGVTSGLEVPNPERVSEFKAMAADASVFTFGDDEDYESE  607



>ref|XP_007042495.1| Pten 2 [Theobroma cacao]
 gb|EOX98326.1| Pten 2 [Theobroma cacao]
Length=609

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/616 (70%), Positives = 494/616 (80%), Gaps = 20/616 (3%)
 Frame = +3

Query  141   MDTQLSNASNPQPSVTANMETSNVNSVPAQD-----GPSKLSTWAKSLKIPQPFTGSQEE  305
             MD+   + S+P P+  ++++T      P  D      PSKLS+WAK+LKIPQPF  SQE+
Sbjct  1     MDSGPVDLSSPPPAKASDVQTPAATD-PGPDNSTHEAPSKLSSWAKNLKIPQPFAASQED  59

Query  306   ENSGNAAKSPFARFTSGFGMLSSPKSP-TDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAV  482
               +GNA KS FARFTSG G+ SSPKSP  +D+S+GTST  QS  +GT TKG+VDSSKNAV
Sbjct  60    SPTGNAGKSTFARFTSGLGLRSSPKSPPANDSSDGTSTAAQSGLLGTITKGIVDSSKNAV  119

Query  483   KAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHM  662
             KAV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHM
Sbjct  120   KAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHM  179

Query  663   EEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYS  842
             EEVIKFFETHHKDKYKVYNLCSERLYD SLFEGKVASFPF+DHNCPPIQLI+SFCQSAYS
Sbjct  180   EEVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVASFPFNDHNCPPIQLIISFCQSAYS  239

Query  843   WLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPS  1022
             WLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEES++YYNQKRC+D KGLVLPS
Sbjct  240   WLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESVDYYNQKRCVDGKGLVLPS  299

Query  1023  QIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPR  1202
             QIRYVKYFER L YFNGENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLF TKKHPR
Sbjct  300   QIRYVKYFERTLTYFNGENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFFTKKHPR  359

Query  1203  TKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRK  1382
             TKDL  ED+WFSAPKKGV+VFALPGEPG+ ELAGDFK+HF+DRQGDFYCWLNTTMIENRK
Sbjct  360   TKDLSAEDFWFSAPKKGVMVFALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTMIENRK  419

Query  1383  ILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgss  1562
             ILNTSDLD FDKRKLPSPGFQVE+VLVDY+    T+PQPE A +     + S   ++   
Sbjct  420   ILNTSDLDWFDKRKLPSPGFQVEVVLVDYNGTVLTKPQPENAATKPDESSGSNAASADG-  478

Query  1563  phsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGK---VTVATDGVQAKVSTSGN  1733
                   AA +N N+  G ++KDDVFSD+EAEE+G  K  +    +       +  S    
Sbjct  479   -----GAASSNQNKDPGHNDKDDVFSDSEAEESGSSKSRRHKAASAEGAAAPSATSKPET  533

Query  1734  NTGSPQISSLTQKIEQVSLGDSGLKH----NEQKRDTTVGAASVPEVSNTEVSDFKIMAA  1901
             N+ S +++SL Q  EQVSLG++  +     +E ++D    AA+     ++  S+FK MAA
Sbjct  534   NSNSDKVASLVQSTEQVSLGNANAQQMHATSEPRKDAVGEAAAAGVQVSSSESEFKAMAA  593

Query  1902  DASVFTFGDEEDYESE  1949
             DASVFTFGD+EDYESE
Sbjct  594   DASVFTFGDDEDYESE  609



>ref|XP_002298741.2| hypothetical protein POPTR_0001s30940g [Populus trichocarpa]
 gb|EEE83546.2| hypothetical protein POPTR_0001s30940g [Populus trichocarpa]
Length=615

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/589 (72%), Positives = 474/589 (80%), Gaps = 20/589 (3%)
 Frame = +3

Query  222   PAQDGPSKLS-----TWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSP  386
             PA D PSKLS     +WAKSLKIPQP T S ++  +GNA KS FARFTSGFG+  SPKSP
Sbjct  34    PASDAPSKLSAAGITSWAKSLKIPQPLTSSPDDSPTGNAGKSTFARFTSGFGLRLSPKSP  93

Query  387   T-DDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDL  563
               DD+ EGTS T QS   GT TKGLVD+SKNAVKAV VKARH VSQNKRRYQEGGFDLD+
Sbjct  94    AADDSPEGTSATSQSGLFGTITKGLVDTSKNAVKAVQVKARHAVSQNKRRYQEGGFDLDM  153

Query  564   TYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYD  743
             TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLC ERLYD
Sbjct  154   TYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCCERLYD  213

Query  744   VSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISS  923
              SLFEGKVASFPFDDHNCPPIQLI SFCQSAY WLKEDIENVVVVHCKAGMARTGLMISS
Sbjct  214   ASLFEGKVASFPFDDHNCPPIQLITSFCQSAYLWLKEDIENVVVVHCKAGMARTGLMISS  273

Query  924   LLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCML  1103
             LLLYLKFFPTAEESI+YYNQKRC DAKGLVLPSQIRYVKYFERIL YFNGENQP RRCML
Sbjct  274   LLLYLKFFPTAEESIDYYNQKRCFDAKGLVLPSQIRYVKYFERILTYFNGENQPGRRCML  333

Query  1104  RGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEP  1283
             RGFRLH+CPYWIRPSITISDHNGVLFS+KKHPRTKDL PE+YWFSAPKKGV+VFALPGEP
Sbjct  334   RGFRLHRCPYWIRPSITISDHNGVLFSSKKHPRTKDLSPEEYWFSAPKKGVMVFALPGEP  393

Query  1284  GVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLV  1463
             G+ E+AGDFKVHF+DRQGDFY WLNT  +ENRKILNTSD+DGFDKRKLPSPGFQVE+VLV
Sbjct  394   GLTEVAGDFKVHFHDRQGDFYFWLNTQFMENRKILNTSDIDGFDKRKLPSPGFQVEVVLV  453

Query  1464  DYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADA-NSNQKSGSSEKDDVFS  1640
             DYD    TR   E       +    ++  S ++  S D    A N N+ S S++KDDVFS
Sbjct  454   DYDGTVSTRSNIE-------TAVKKSDEGSSTALASVDAGTTAPNQNKDSASNDKDDVFS  506

Query  1641  DNEAEETGKPKVGKVTVATDGVQAKVS---TSGNNTGSPQISSLTQKIEQVSLGDSGLKH  1811
             D+EAEE+   K  +   ++ G +   +   +SG +  + +++SLTQ  EQ SLG++G + 
Sbjct  507   DSEAEESVSSKQKQAQASSAGGETAATPAPSSGTDNKTEKVASLTQATEQFSLGNTGSQQ  566

Query  1812  NE---QKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             +    Q +   VG       +N   S+FK MAADASVFTFGD+EDYESE
Sbjct  567   SHAPAQPKIEAVGGTVSSLEANNAQSEFKAMAADASVFTFGDDEDYESE  615



>ref|XP_006487024.1| PREDICTED: formin-like protein 5-like isoform X1 [Citrus sinensis]
 ref|XP_006487025.1| PREDICTED: formin-like protein 5-like isoform X2 [Citrus sinensis]
Length=611

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/611 (71%), Positives = 490/611 (80%), Gaps = 24/611 (4%)
 Frame = +3

Query  153   LSNASNPQPSVTANMETSNVNSVPAQDGPSKLS-----TWAKSLKIPQPFTGSQEEENSG  317
             L+ AS  +PS T    T N     A D  SK+S     +WAK+LKIPQPF+GSQE+  +G
Sbjct  13    LTKASEVKPSPTTESATDN----SASDARSKISATGISSWAKNLKIPQPFSGSQEDSPTG  68

Query  318   NAAKSPFARFTSGFGMLSSPKSP-TDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVS  494
             N+ KS FAR TSG G+ SSPKSP +DD+SEGTST  Q  FIG+ TKGLVDSSK+AVKAV 
Sbjct  69    NSGKSTFARLTSGLGLRSSPKSPQSDDSSEGTSTAAQPGFIGSITKGLVDSSKSAVKAVQ  128

Query  495   VKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVI  674
             VKARHVVSQNKRRYQ+GGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVI
Sbjct  129   VKARHVVSQNKRRYQDGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVI  188

Query  675   KFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKE  854
             KFFET+HKDKYKVYNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI SFC SAYSWLKE
Sbjct  189   KFFETYHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLITSFCHSAYSWLKE  248

Query  855   DIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRY  1034
             DIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYNQKRC+D KGLVLPSQIRY
Sbjct  249   DIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCVDGKGLVLPSQIRY  308

Query  1035  VKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDL  1214
             VKYFERIL YFNGENQP RRCMLRGFRLH+CPYWIRP IT+SDHNGVLFS+KKHPRTKDL
Sbjct  309   VKYFERILTYFNGENQPGRRCMLRGFRLHRCPYWIRPHITVSDHNGVLFSSKKHPRTKDL  368

Query  1215  LPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNT  1394
              PED+WFSAPKKGV+VFALPGEPG+AELAGDFK+HF+DRQGDFYCWLNTTM+ENRK+LNT
Sbjct  369   SPEDFWFSAPKKGVMVFALPGEPGLAELAGDFKIHFHDRQGDFYCWLNTTMMENRKVLNT  428

Query  1395  SDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsa  1574
              DLDGFDKRKLPSPGFQVE+VL DY+        P  A ++  +     +  SGS+P S 
Sbjct  429   GDLDGFDKRKLPSPGFQVEVVLADYNG-------PVRAAANSETVAKKPDETSGSAPASV  481

Query  1575  DEAADANSNQK-SGSSEKDDVFSDNEAEETG-KPKVGKVTVATDGVQAKVSTSGNNTGSP  1748
              +  DA+   K SG+++KDDVFSDNE+EE G K K      A  G  +    S   T S 
Sbjct  482   GQGLDASKESKGSGNNDKDDVFSDNESEEAGSKRKKAPAASAAGGTVSAAPRSETKTESD  541

Query  1749  QISSLTQKIEQVSLGD--SGLKH--NEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVF  1916
             Q+++L +  + VSLG+  S   H   E K    VGA S  + SN E S+FK MAADASVF
Sbjct  542   QVANLARATKDVSLGNAVSQTTHAAGETKGGAVVGATSGLDASNRE-SEFKAMAADASVF  600

Query  1917  TFGDEEDYESE  1949
             +FGDE+DYES+
Sbjct  601   SFGDEDDYESD  611



>ref|XP_011000143.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Populus 
euphratica]
Length=613

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/622 (70%), Positives = 489/622 (79%), Gaps = 28/622 (5%)
 Frame = +3

Query  141   MDTQLSNASNPQPSVTAN------METSNVNSVPAQDGPSKLS-----TWAKSLKIPQPF  287
             MD++  +A  P PSV A            V   PA D PSKLS     +WAKSLKIPQP 
Sbjct  1     MDSE--SADTPPPSVKAPDTQHPPAAADPVPENPASDAPSKLSAAGITSWAKSLKIPQPL  58

Query  288   TGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVD  464
             T S ++  + NA KS FARFTSGFG+  SPKSP  DD+ EGTS T QS   GT TKGLVD
Sbjct  59    TSSPDDSPTSNAGKSTFARFTSGFGLRLSPKSPAADDSPEGTSATSQSGLFGTITKGLVD  118

Query  465   SSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEG  644
             +SKNAVKAV VKARH VSQNKRRYQEGGFDLD+TYITENVIAMGFPAGDMSSGFFGYVEG
Sbjct  119   TSKNAVKAVQVKARHAVSQNKRRYQEGGFDLDMTYITENVIAMGFPAGDMSSGFFGYVEG  178

Query  645   FYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSF  824
             FYRNHMEEVIKFFETHHKDKYKVYNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI SF
Sbjct  179   FYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLITSF  238

Query  825   CQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAK  1004
             CQSAY WLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYNQKRC DAK
Sbjct  239   CQSAYLWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCFDAK  298

Query  1005  GLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFS  1184
             GLVLPSQIRYVKYFERIL YFNGE+QP RRCMLRGFRLH+CPYWIRPSITISDHNGVLFS
Sbjct  299   GLVLPSQIRYVKYFERILTYFNGESQPGRRCMLRGFRLHRCPYWIRPSITISDHNGVLFS  358

Query  1185  TKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTT  1364
             +KKHPRTKDL PEDYWFSAPKKGV+VFALPGEPG+ E+ GDFKVHF+DRQGDFY WLNT 
Sbjct  359   SKKHPRTKDLSPEDYWFSAPKKGVMVFALPGEPGLTEVTGDFKVHFHDRQGDFYFWLNTQ  418

Query  1365  MIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssan  1544
              +ENRKILNTSD+DGFDKRKLPSPGFQVE+VLVDYD    TR   E AV      +S+A 
Sbjct  419   FMENRKILNTSDIDGFDKRKLPSPGFQVEVVLVDYDGTVSTRSNVETAVKKSDEGSSTAP  478

Query  1545  pasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVS-  1721
              +  +   +       N N+ S S++KDDVFSD+EAEE+   K  +   ++ G +   + 
Sbjct  479   ASVDAGTTA------PNQNKDSASNDKDDVFSDSEAEESVSSKQKQAQASSAGGETAATP  532

Query  1722  --TSGNNTGSPQISSLTQKIEQVSLGDSGLKHN----EQKRDTTVGAASVPEVSNTEVSD  1883
               +SG +  + +++SLTQ  EQ S+G++G + +    + K +   G  S  E +NT+ S+
Sbjct  533   APSSGTDNKTEKVASLTQATEQFSVGNTGSQQSHAPAQPKIEAVGGTVSSLEANNTQ-SE  591

Query  1884  FKIMAADASVFTFGDEEDYESE  1949
             FK MAADASVFTFGD+EDYESE
Sbjct  592   FKAMAADASVFTFGDDEDYESE  613



>gb|KDP47126.1| hypothetical protein JCGZ_22122 [Jatropha curcas]
Length=613

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/610 (70%), Positives = 491/610 (80%), Gaps = 17/610 (3%)
 Frame = +3

Query  156   SNASNPQPSVTANMETS-NVNSVPAQDGPSKLS-----TWAKSLKIPQPFTGSQEEENSG  317
             S +S   P V  +  T   V++ P +D P KLS     +WAKSLKIPQP   SQ +  +G
Sbjct  9     STSSVKAPDVQTHAATDPGVDNSP-RDAPPKLSAAGITSWAKSLKIPQPLAPSQGDSPTG  67

Query  318   NAAKSPFARFTSGFGMLSSPKSP-TDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVS  494
             +  KS FARFTSGF + SSPKSP TDD+SEG S+  Q  FIGT TKGLVD+SKNAVKAV 
Sbjct  68    SPGKSTFARFTSGFVLRSSPKSPVTDDSSEGPSSPSQPGFIGTITKGLVDTSKNAVKAVQ  127

Query  495   VKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVI  674
             VKARH VSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVI
Sbjct  128   VKARHAVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVI  187

Query  675   KFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKE  854
             KFFETHHK KYKVYNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI+SFCQSAYSWLKE
Sbjct  188   KFFETHHKGKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLIISFCQSAYSWLKE  247

Query  855   DIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRY  1034
             DIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYNQKRC D KGLVLPSQIRY
Sbjct  248   DIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCFDGKGLVLPSQIRY  307

Query  1035  VKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDL  1214
             VKYFER+L YFNGENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFSTKKHPRTK+L
Sbjct  308   VKYFERVLTYFNGENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTKKHPRTKEL  367

Query  1215  LPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNT  1394
              PEDYWFSAPKKG++VFALPGEPG+AE+AGDFKVHF+DRQGDFY WLNTTM+ENRK+LNT
Sbjct  368   SPEDYWFSAPKKGIMVFALPGEPGLAEVAGDFKVHFHDRQGDFYFWLNTTMMENRKVLNT  427

Query  1395  SDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsa  1574
              D+DGFDKRKLPSPGFQVE+VLVDY+   P+    EAA +  +  +S+A     +     
Sbjct  428   GDIDGFDKRKLPSPGFQVEVVLVDYNGTVPSSQDSEAAANKSNEGSSAAPGPVDTGVA--  485

Query  1575  DEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAK---VSTSGNNTGS  1745
               AA  N +++ GS++KDDVFSD EAEE+   K+ +   A+ G +      S+   NT S
Sbjct  486   --AAVPNQDKERGSNDKDDVFSDGEAEESVSSKLKQAQAASAGERTATTITSSEETNTKS  543

Query  1746  PQISSLTQKIEQVSLGDSGLKHNE-QKRDTTVGAASVPEVS-NTEVSDFKIMAADASVFT  1919
              Q++SLT+  EQ+SLG++G + +  Q +   VG A+V  +  N   S+FK MAAD SVFT
Sbjct  544   DQVASLTRATEQLSLGNTGSQPSATQPKSDAVGEAAVLGLGINNSESEFKAMAADVSVFT  603

Query  1920  FGDEEDYESE  1949
             FGD+EDYESE
Sbjct  604   FGDDEDYESE  613



>ref|XP_006422958.1| hypothetical protein CICLE_v10028040mg [Citrus clementina]
 ref|XP_006422959.1| hypothetical protein CICLE_v10028040mg [Citrus clementina]
 gb|ESR36198.1| hypothetical protein CICLE_v10028040mg [Citrus clementina]
 gb|ESR36199.1| hypothetical protein CICLE_v10028040mg [Citrus clementina]
Length=611

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/611 (70%), Positives = 487/611 (80%), Gaps = 24/611 (4%)
 Frame = +3

Query  153   LSNASNPQPSVTANMETSNVNSVPAQDGPSKLS-----TWAKSLKIPQPFTGSQEEENSG  317
             L+ AS  +PS T    T N     A D  SK+S     +WAKSLKIPQPF+GSQE+  +G
Sbjct  13    LTKASEVKPSPTTESATDN----SASDARSKISATGISSWAKSLKIPQPFSGSQEDSPTG  68

Query  318   NAAKSPFARFTSGFGMLSSPKSP-TDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVS  494
             N+ KS FAR TSG G+ SSPKSP +DD+SEGTST  Q  FIG+ TKGLVDSSK+AVKAV 
Sbjct  69    NSGKSTFARLTSGLGLRSSPKSPQSDDSSEGTSTAAQPGFIGSITKGLVDSSKSAVKAVQ  128

Query  495   VKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVI  674
             VKARHVVSQNKRRYQ+GGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVI
Sbjct  129   VKARHVVSQNKRRYQDGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVI  188

Query  675   KFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKE  854
             KFFET+HKDKYKVYNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI SFC SAYSWLKE
Sbjct  189   KFFETYHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLITSFCHSAYSWLKE  248

Query  855   DIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRY  1034
             DIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYNQKRC+D KGLVLPSQIRY
Sbjct  249   DIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCVDGKGLVLPSQIRY  308

Query  1035  VKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDL  1214
             VKYFERIL YFNGENQP RRCMLRGFRLH+CPYWIRP IT+SDHNGVLFS+KKHPRTKDL
Sbjct  309   VKYFERILTYFNGENQPGRRCMLRGFRLHRCPYWIRPHITVSDHNGVLFSSKKHPRTKDL  368

Query  1215  LPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNT  1394
              PED+WFSAPKKGV+VFALPGEPG+AELAGDFK+HF+DRQGDFYCWLNTTM+ENRK+LNT
Sbjct  369   SPEDFWFSAPKKGVMVFALPGEPGLAELAGDFKIHFHDRQGDFYCWLNTTMMENRKVLNT  428

Query  1395  SDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsa  1574
              DLDGFDKRKLPSPGFQVE+VL DY+        P  A ++  +     +  SGS+P S 
Sbjct  429   GDLDGFDKRKLPSPGFQVEVVLADYNG-------PVRAAANSETVAKKPDETSGSAPASV  481

Query  1575  DEAADANSNQK-SGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVS-TSGNNTGSP  1748
              +  DA+   K SG+++KDDVFSDNE+EE G         +  G     +  S   T S 
Sbjct  482   GQGLDASKESKDSGNNDKDDVFSDNESEEAGSKSKKAPAASAAGGTVSAAPRSETKTESD  541

Query  1749  QISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVP----EVSNTEVSDFKIMAADASVF  1916
             Q+++L    + VSLG++  +      +T  GA + P    + SN E S+FK MAADASVF
Sbjct  542   QVANLACATKDVSLGNAVSQPTHAAGETKGGAVAGPTSGLDTSNRE-SEFKAMAADASVF  600

Query  1917  TFGDEEDYESE  1949
             +FGDE+DYES+
Sbjct  601   SFGDEDDYESD  611



>gb|KDO59790.1| hypothetical protein CISIN_1g037030mg [Citrus sinensis]
Length=612

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/611 (70%), Positives = 481/611 (79%), Gaps = 23/611 (4%)
 Frame = +3

Query  153   LSNASNPQPSVTANMETSNVNSVPAQDGPSKLS-----TWAKSLKIPQPFTGSQEEENSG  317
             L+ AS  +PS T    T N     A D  SK+S     +WAK+LKIPQPF+GSQE+  +G
Sbjct  13    LTKASEVKPSPTTESATDN----SASDARSKISATGISSWAKNLKIPQPFSGSQEDSPTG  68

Query  318   NAAKSPFARFTSGFGMLSSPKSP-TDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVS  494
             N+ KS FAR TSG G+ SSPKSP +DD+SEGTST  Q  FIG+ TKGLVDSSK+AVKAV 
Sbjct  69    NSGKSTFARLTSGLGLRSSPKSPQSDDSSEGTSTAAQPGFIGSITKGLVDSSKSAVKAVQ  128

Query  495   VKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVI  674
             VKARHVVSQNKRRYQ+GGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVI
Sbjct  129   VKARHVVSQNKRRYQDGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVI  188

Query  675   KFFETHHKDKYKVYNLCSERLYDVSLFEGK-VASFPFDDHNCPPIQLIMSFCQSAYSWLK  851
             KFFET+HKDKYKVYNLCSERLYD SLFEG+ VASFPFDDHNCPPIQLI SFC SAYSWLK
Sbjct  189   KFFETYHKDKYKVYNLCSERLYDASLFEGRCVASFPFDDHNCPPIQLITSFCHSAYSWLK  248

Query  852   EDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIR  1031
             EDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYNQKRC+D KGLVLPSQIR
Sbjct  249   EDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCVDGKGLVLPSQIR  308

Query  1032  YVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKD  1211
             YVKYFERIL YFNGENQP RRCMLRGFRLH+CPYWIRP IT+SDHNGVLFS+KKHPRTKD
Sbjct  309   YVKYFERILTYFNGENQPGRRCMLRGFRLHRCPYWIRPHITVSDHNGVLFSSKKHPRTKD  368

Query  1212  LLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILN  1391
             L PED+WFSAPKKGV+VFALPGEPG+AELAGDFK+HF+DRQGDFYCWLNTTM+ENRK+LN
Sbjct  369   LSPEDFWFSAPKKGVMVFALPGEPGLAELAGDFKIHFHDRQGDFYCWLNTTMMENRKVLN  428

Query  1392  TSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphs  1571
             T DLDGFDKRKLPSPGFQVE+VL DY+         E         + S   + G    +
Sbjct  429   TGDLDGFDKRKLPSPGFQVEVVLADYNGPVRAAANSETVAKKPDETSGSVPASVGQGLDA  488

Query  1572  aDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVS-TSGNNTGSP  1748
             + E+ D      SG+++KDDVFSDNE+EE G         +  G     +  S   T S 
Sbjct  489   SKESKD------SGNNDKDDVFSDNESEEAGSKSKKAPAASAAGGTVSAAPRSETKTESD  542

Query  1749  QISSLTQKIEQVSLGD--SGLKH--NEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVF  1916
             Q+++L +  + VSLG+  S   H   E K    VGA S  + SN E S+FK MAADASVF
Sbjct  543   QVANLARATKDVSLGNAVSQTTHAAGETKGGAVVGATSGLDASNRE-SEFKAMAADASVF  601

Query  1917  TFGDEEDYESE  1949
             +FGDE+DYES+
Sbjct  602   SFGDEDDYESD  612



>ref|XP_002518704.1| phosphoprotein phosphatase, putative [Ricinus communis]
 gb|EEF43629.1| phosphoprotein phosphatase, putative [Ricinus communis]
Length=612

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/623 (69%), Positives = 490/623 (79%), Gaps = 34/623 (5%)
 Frame = +3

Query  123   VPSLSTMDTQLSNASNPQPSVTANMETSNVNSVPAQDGPSKLS-----TWAKSLKIPQPF  287
              PS+   D Q    ++P P  +             +D PSKLS     +WAKSLKIPQP 
Sbjct  10    TPSVKAPDIQPPTVADPGPDNSP------------RDAPSKLSAAGIASWAKSLKIPQPS  57

Query  288   TGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTS-TTPQSSFIGTFTKGLV  461
               SQ++  +GN  KS FARFTSG G+  SPKSP  DD+ EGTS T+ Q  FIGT TKGLV
Sbjct  58    AASQDDSPTGNTGKSTFARFTSGLGLRLSPKSPAADDSPEGTSPTSLQPGFIGTITKGLV  117

Query  462   DSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVE  641
             D+SKNAVKAV VKARH VSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVE
Sbjct  118   DTSKNAVKAVQVKARHAVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVE  177

Query  642   GFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMS  821
             GFYRNHMEEVIKFFETHHK KYKVYNLCSERLYD SLFEGK+ASFPFDDHNCPPIQLI+S
Sbjct  178   GFYRNHMEEVIKFFETHHKGKYKVYNLCSERLYDASLFEGKLASFPFDDHNCPPIQLIIS  237

Query  822   FCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDA  1001
             FCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYNQKRC DA
Sbjct  238   FCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCFDA  297

Query  1002  KGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLF  1181
             KGLVLPSQIRYVKYFER L YFNGENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLF
Sbjct  298   KGLVLPSQIRYVKYFERTLTYFNGENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLF  357

Query  1182  STKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNT  1361
             STKKHPRTKDL PEDYWFSAPKKGV+VFALPGEPG+AE+AGDFKVHF+DRQGDFY WLNT
Sbjct  358   STKKHPRTKDLSPEDYWFSAPKKGVMVFALPGEPGLAEVAGDFKVHFHDRQGDFYFWLNT  417

Query  1362  TMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssa  1541
             TM+ENRK+LNT+D+DGFDKRKLPSPGFQVE+VLVDY    P     E A +  +  +S+A
Sbjct  418   TMMENRKVLNTNDIDGFDKRKLPSPGFQVEVVLVDYSGTTPAGTNSETATNKSNEGSSAA  477

Query  1542  npasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVS  1721
                  +           + N+  GS+EKDDVFSD+EAEE+   K  +   A+ G ++  S
Sbjct  478   PAPDPAPAVR-------SQNKDRGSTEKDDVFSDSEAEESVSSKFRQAQAASAGGKSATS  530

Query  1722  TSGNNTGSP---QISSLTQKIEQVSLGDSGLK--HN--EQKRDTTVGAASVPEVSNTEVS  1880
             T+ ++  +    QI+SLT   E  S+G++G +  HN  + K D   G  S  EV+N+E S
Sbjct  531   TTSSSETNTKSDQIASLTHATEHFSIGNTGSQQMHNSGQPKSDAVGGVVSGVEVNNSE-S  589

Query  1881  DFKIMAADASVFTFGDEEDYESE  1949
             +FK+MAADASVFTFGD+EDYESE
Sbjct  590   EFKVMAADASVFTFGDDEDYESE  612



>ref|XP_008788497.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Phoenix 
dactylifera]
Length=611

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/597 (69%), Positives = 478/597 (80%), Gaps = 18/597 (3%)
 Frame = +3

Query  189   ANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGML  368
             +N + ++    P+    S +S+WA+SLKIPQP    QE+   GNA KSPFARFTSGFG+ 
Sbjct  23    SNGQDASARQPPSLFSASGISSWARSLKIPQPSV--QEDSQPGNAGKSPFARFTSGFGLH  80

Query  369   SSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEG  545
              SPKSP  D+++EGT+TT Q   +G+ TKGLVDSS+ AVKAV VKARH+VSQNKRRYQEG
Sbjct  81    LSPKSPQQDESAEGTTTTTQPGVLGSLTKGLVDSSRTAVKAVQVKARHIVSQNKRRYQEG  140

Query  546   GFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLC  725
             GFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHH  KYKVYNLC
Sbjct  141   GFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHTGKYKVYNLC  200

Query  726   SERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMART  905
             SERLYD SLFEGKVA FPFDDHNCPP+QLI+SFCQSAYSWLKEDIENVVVVHCKAGMART
Sbjct  201   SERLYDASLFEGKVACFPFDDHNCPPLQLIISFCQSAYSWLKEDIENVVVVHCKAGMART  260

Query  906   GLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQP  1085
             GLMISSLLLYLKFFPTAEESI YYNQKRCMD KGLVLPSQIRYVKYFERIL YFNGENQP
Sbjct  261   GLMISSLLLYLKFFPTAEESIEYYNQKRCMDGKGLVLPSQIRYVKYFERILTYFNGENQP  320

Query  1086  ARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVF  1265
              RRCMLRGFRLH+CPYWIRPSITIS+HNGV+FSTKKHPRTKDL+PED+WFSAPKKG++VF
Sbjct  321   GRRCMLRGFRLHRCPYWIRPSITISNHNGVVFSTKKHPRTKDLMPEDFWFSAPKKGIMVF  380

Query  1266  ALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQ  1445
             ALPGEPG+ ELAGDFK+HF+DRQGDFYCWLNTTM+ENRKIL+TSDLDGFDKRKLPSPGFQ
Sbjct  381   ALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTMMENRKILSTSDLDGFDKRKLPSPGFQ  440

Query  1446  VEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEK  1625
             VE+VLVDYD +  + P    A       ++++   + +S      + D      SGS +K
Sbjct  441   VEVVLVDYDESNSSGPTSLNAKKESDGSSTASTATNENSTVHPKPSGD------SGSQDK  494

Query  1626  DDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQ-ISSLTQKIEQVSL-GDS  1799
             DDVFSD+E+EET   K  +  VA +   +  +  G    +PQ  +++ Q +EQ+SL G+ 
Sbjct  495   DDVFSDSESEETSFSKSKRDKVAGNLGGSPSTAKGPELKAPQGAATIAQGVEQLSLKGEG  554

Query  1800  GLKHN----EQKRDTTVGAASV---PEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             G        E + D     A+V   PE+ +  VS+FK +AADASVF+FGDEEDYESE
Sbjct  555   GATKTPDTKEVRNDGNGKNATVSHPPELESNSVSEFKAIAADASVFSFGDEEDYESE  611



>ref|XP_010107860.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Morus notabilis]
 gb|EXC17260.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Morus notabilis]
Length=607

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/620 (68%), Positives = 491/620 (79%), Gaps = 30/620 (5%)
 Frame = +3

Query  141   MDTQLSNAS-NPQ---PSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEE  308
             MD + ++++ +PQ   P V  +  T +V+    ++ PSKL++WAKSLKIPQP  G+Q+  
Sbjct  1     MDKESADSTTSPQVTAPEVQPSAPTDSVSESSPRNAPSKLTSWAKSLKIPQPLVGTQDVS  60

Query  309   NSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVK  485
              + N+ KS F RFTSG G   SPK+P+  ++S+G ST  Q  FIGT TKGLVDSSK+AVK
Sbjct  61    PTENSGKSTFVRFTSGLGFRLSPKAPSPAESSDGISTETQPGFIGTITKGLVDSSKSAVK  120

Query  486   AVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHME  665
             AV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHME
Sbjct  121   AVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHME  180

Query  666   EVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSW  845
             EVIKFFETHHKDKYKVYNLCSERLYD SLFEGKVASFPFDDHNCPP +LI+SFCQSAYSW
Sbjct  181   EVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPTRLIISFCQSAYSW  240

Query  846   LKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQ  1025
             LKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEES++YYNQKRC D KGL+LPSQ
Sbjct  241   LKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESMDYYNQKRCFDGKGLILPSQ  300

Query  1026  IRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRT  1205
             IRYVKYFER+L YFNGEN P RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFSTKKHPRT
Sbjct  301   IRYVKYFERVLTYFNGENPPPRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTKKHPRT  360

Query  1206  KDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKI  1385
             KDL PEDYWFSAPKKGV+VFALPGEPG+AEL GDFK+HF+DRQGDFYCWLNTTM ENRK+
Sbjct  361   KDLSPEDYWFSAPKKGVMVFALPGEPGLAELNGDFKIHFHDRQGDFYCWLNTTMTENRKL  420

Query  1386  LNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssp  1565
             L+T+DLDGFDKRKLPSPGFQVE+VLVDY+   P  P  E+        + SA      + 
Sbjct  421   LSTADLDGFDKRKLPSPGFQVEVVLVDYNGTVPKTPNAESTTKISDEGSQSALSTVEGA-  479

Query  1566  hsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKV--STSGNNT  1739
                   A     + SG+ EKDDVFSD+EAE+ G  K  +   A   V  +V  +TS + T
Sbjct  480   -----PAALKPTKDSGTQEKDDVFSDSEAED-GSSKSRRAEAAASAVGERVIHTTSSSET  533

Query  1740  GSP--QISSLTQKIEQVSLGDSGLKHNEQKRDTTVG------AASVP--EVSNTEVSDFK  1889
              S   +I+ LT+  EQVS+G++G       + +T+G      AA+VP  EV  +E S+FK
Sbjct  534   KSKPDEIAGLTKATEQVSIGNTG-----SAQASTIGEPKSNVAANVPSAEVPISE-SEFK  587

Query  1890  IMAADASVFTFGDEEDYESE  1949
              MAADASVF+FGD+EDYES+
Sbjct  588   AMAADASVFSFGDDEDYESD  607



>ref|XP_010246580.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Nelumbo 
nucifera]
Length=596

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/598 (68%), Positives = 474/598 (79%), Gaps = 15/598 (3%)
 Frame = +3

Query  183   VTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFG  362
               A++  S+V   P+    S +S+WA+SL+ PQP    QEE  +G A KS FARFT G G
Sbjct  5     AAASIRESSVREAPSLFTASGISSWARSLRSPQPSVSGQEESQTGTAGKSTFARFTGGLG  64

Query  363   MLSSPKSP-TDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQ  539
             +  SPK P +D+N+EGTST  Q    G+ T+GLVDSS++AVKAV VKARH+VSQNKRRYQ
Sbjct  65    LRLSPKDPVSDENAEGTSTAAQPGVFGSITQGLVDSSRSAVKAVQVKARHIVSQNKRRYQ  124

Query  540   EGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYN  719
             EGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHK +YKVYN
Sbjct  125   EGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKGRYKVYN  184

Query  720   LCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMA  899
             LCSERLYD SLFEGKVA FPFDDHNCPPIQLI+SFCQSAYSWLKEDIENVVVVHCKAGMA
Sbjct  185   LCSERLYDASLFEGKVACFPFDDHNCPPIQLIISFCQSAYSWLKEDIENVVVVHCKAGMA  244

Query  900   RTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGEN  1079
             RTGLMISSLLLYLKFFPTAEESI+YYNQKRC+D KGLVLPSQIRYVKYFERIL Y NGEN
Sbjct  245   RTGLMISSLLLYLKFFPTAEESIDYYNQKRCLDGKGLVLPSQIRYVKYFERILTYSNGEN  304

Query  1080  QPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVV  1259
             QP RRCMLRGFRLH+CPYWIRPSITISDHNGVLFSTKKHPRTKDL PED+WFSAPKKG++
Sbjct  305   QPGRRCMLRGFRLHRCPYWIRPSITISDHNGVLFSTKKHPRTKDLSPEDFWFSAPKKGIM  364

Query  1260  VFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPG  1439
             VFALPGEPG+ E+AGDFK+HF+DRQGDFYCWLNTT+ ENRKIL+TSDLDGFDKRKLPSPG
Sbjct  365   VFALPGEPGLTEVAGDFKIHFHDRQGDFYCWLNTTLSENRKILDTSDLDGFDKRKLPSPG  424

Query  1440  FQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSS  1619
             FQVE+V++DY+   PT+ + E+     ++ + +    S         AA  + ++ SGS 
Sbjct  425   FQVEVVMIDYNGTIPTKTRTESENKESNAGSGTGPGPSDGG------AATPDKSKGSGSQ  478

Query  1620  EKDDVFSDNEAEETGKPKVGKVTVATDGVQ-AKVSTSGNNTGS--PQISSLTQKIEQVSL  1790
             +KDDVFSD++ E+    K  +    + G + A  +  G  TG+   QI+S+T+  EQ+SL
Sbjct  479   DKDDVFSDSDGEDNESSKNREARALSGGTETATTAARGPQTGTTPEQIASVTRGTEQLSL  538

Query  1791  GDSGLKH----NEQKRDTTVGAASVPEVS-NTEVSDFKIMAADASVFTFGDEEDYESE  1949
                G K     NE K D   G     ++S ++  +DFK +AADASVFTFGD+EDYESE
Sbjct  539   RSEGPKQAPAANEVKTDGGSGTGLGLDISKDSTTNDFKAIAADASVFTFGDDEDYESE  596



>ref|XP_011000932.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Populus 
euphratica]
 ref|XP_011000939.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Populus 
euphratica]
Length=611

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/618 (68%), Positives = 484/618 (78%), Gaps = 22/618 (4%)
 Frame = +3

Query  141   MDTQLSNASNPQPSVTANMETSNVNSVP---AQDGPSKLS-----TWAKSLKIPQPFTGS  296
             MD++ +++S P P  + + +    + VP   A D  SKLS     +WAKSLKIPQP T S
Sbjct  1     MDSETADSSLP-PVKSPDTQPPPHDPVPGNSASDATSKLSAAGITSWAKSLKIPQPLTSS  59

Query  297   QEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSK  473
              ++  +GNA KS FARFTSGFG+  SPKSP  DD+ EGTS+T Q    GT TKGLVD+SK
Sbjct  60    PDDSPTGNAGKSTFARFTSGFGLRMSPKSPAADDSPEGTSSTSQPGIFGTITKGLVDTSK  119

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             NAVKAV VKARH VSQNKRRYQEGGFDLD+TYITEN+IAMGFPAG+MSSGFFGYVEGFYR
Sbjct  120   NAVKAVQVKARHAVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGNMSSGFFGYVEGFYR  179

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             NHMEEVIKFFETHHKDKYKVYNLCSERLYD SLFEGKVASFPFDDHNCPP QLI+SFCQS
Sbjct  180   NHMEEVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPTQLIISFCQS  239

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
             AY WLKEDIENVVVVHCKAGMARTGLMIS LLLYLKFFPTAEESI+YYNQKRC DAKGLV
Sbjct  240   AYLWLKEDIENVVVVHCKAGMARTGLMISCLLLYLKFFPTAEESIDYYNQKRCFDAKGLV  299

Query  1014  LPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKK  1193
             LPSQIRYVKYFERIL YFNGENQP RR MLRGFRLH+CPYWIRPSITISDHNG+LFS+KK
Sbjct  300   LPSQIRYVKYFERILTYFNGENQPGRRSMLRGFRLHRCPYWIRPSITISDHNGILFSSKK  359

Query  1194  HPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIE  1373
             HPRTKDL PEDYWFSAPKKGV+VF LPGEPG+ E++GDFKVHF+DRQGDFY WLNTT +E
Sbjct  360   HPRTKDLPPEDYWFSAPKKGVMVFTLPGEPGLTEVSGDFKVHFHDRQGDFYFWLNTTFME  419

Query  1374  NRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpas  1553
             NR+ILNTSD+DGF KRKLPSPGFQVE+VLVD D +       E  V      +S+A  + 
Sbjct  420   NRQILNTSDIDGFIKRKLPSPGFQVEVVLVDNDGSVSRGSNAETDVKKSDEGSSTARASV  479

Query  1554  gssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVS---T  1724
              ++       A+ N N+  GS++KDDVFSD EA+E+   K  +   ++ G Q+  +   +
Sbjct  480   EAA------TAEPNQNKDPGSNDKDDVFSDGEADESVFSKRKQAQASSAGGQSAATPAPS  533

Query  1725  SGNNTGSPQISSLTQKIEQVSLGDSGLKHNE---QKRDTTVGAASVPEVSNTEVSDFKIM  1895
              G ++ S Q++SLTQ  EQ SLG+ G + +    Q +   VG       +N   S+FK M
Sbjct  534   PGTDSKSDQVASLTQATEQFSLGNRGSQQSHATSQLKSEVVGGTVSSLEANNSHSEFKAM  593

Query  1896  AADASVFTFGDEEDYESE  1949
             AADASVFTFGD+EDYES+
Sbjct  594   AADASVFTFGDDEDYESD  611



>gb|KHG04310.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
phosphatase PTEN [Gossypium arboreum]
Length=630

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/621 (68%), Positives = 482/621 (78%), Gaps = 42/621 (7%)
 Frame = +3

Query  177   PSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSG  356
             P+VT +  T+     P  D PSKLS+WAK+LKIPQPFT SQE   +GNA KS F+RFTSG
Sbjct  22    PAVTDSGSTN-----PTLDAPSKLSSWAKNLKIPQPFTTSQENSPTGNAGKSTFSRFTSG  76

Query  357   FGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRY  536
             FG+ SSPKSP  D+S+G S T QS F+GT TKG+VDSSKNAVKAV VKARHVVSQNKRRY
Sbjct  77    FGLRSSPKSPASDSSDGASATTQSGFLGTITKGIVDSSKNAVKAVQVKARHVVSQNKRRY  136

Query  537   QEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVY  716
             QEGGFDLD+TYITEN+IAMGFPAGD+SSGFFGYVEGFYRNHMEEVIKFFET+HKDKYKVY
Sbjct  137   QEGGFDLDMTYITENIIAMGFPAGDLSSGFFGYVEGFYRNHMEEVIKFFETYHKDKYKVY  196

Query  717   NLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGM  896
             NLCSERLYD SL EGKVASFPFDDHNCPPIQLI+SFC+SAYSWLKEDIENVVVVHCKAGM
Sbjct  197   NLCSERLYDASLLEGKVASFPFDDHNCPPIQLIISFCRSAYSWLKEDIENVVVVHCKAGM  256

Query  897   ARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGE  1076
             ARTGLMISSLLLYLKFFPTAEESI+YYNQKRC+D KGLVLPSQIRYVKYFER L YFNGE
Sbjct  257   ARTGLMISSLLLYLKFFPTAEESIDYYNQKRCVDGKGLVLPSQIRYVKYFERTLTYFNGE  316

Query  1077  NQPARRCMLRGFRLHKCPYWIRPSITISDHN----------GVLFSTKKHPRTKDLLPED  1226
             N P RRCMLRGFRLH+CPYWIRPSITISDHN          GVLFSTKKHPRTKDL PED
Sbjct  317   NPPGRRCMLRGFRLHRCPYWIRPSITISDHNDVLNTDKCLIGVLFSTKKHPRTKDLSPED  376

Query  1227  YWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLD  1406
             +WFSAPKKGV+VFALPGEPG+ +LAGDFKVHF+DRQGDFYCWLNTTMIENRK+LNTS+LD
Sbjct  377   FWFSAPKKGVMVFALPGEPGLTQLAGDFKVHFHDRQGDFYCWLNTTMIENRKVLNTSELD  436

Query  1407  GFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAA  1586
              FDKRKLPSPGFQVE+VLVDY+              ++++ N     +   +  +   AA
Sbjct  437   WFDKRKLPSPGFQVEVVLVDYNGTV------PTTPQTETTTNKPDESSGTGAASTDGGAA  490

Query  1587  DANSNQKSGSSEKDDVFSDNEAEETG--KPKVGKVT-VATDGVQAKVSTSGNNTGSPQIS  1757
              AN N+  G ++KDDVFSD EAEE+G  K +  K T V    + +  S    N  S Q++
Sbjct  491   PANENKDPGHNDKDDVFSDGEAEESGSSKSRQNKATSVEGIALNSAASKPETNDKSDQVA  550

Query  1758  SLTQKIEQVSLGDSG---LKHNEQKRDTTVGAASVP--------------EVSNTEVSDF  1886
             SL     QVSLG +    +    + R     AA+                +VS++E S+F
Sbjct  551   SLVHSTGQVSLGSASSQPMHGTSEPRKAAAAAAAAAAAAAAAAAPPAAGVQVSSSE-SEF  609

Query  1887  KIMAADASVFTFGDEEDYESE  1949
             + MAADASVF+FGD+EDYES+
Sbjct  610   RAMAADASVFSFGDDEDYESD  630



>ref|XP_008786830.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Phoenix 
dactylifera]
 ref|XP_008786831.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Phoenix 
dactylifera]
Length=612

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/616 (68%), Positives = 484/616 (79%), Gaps = 24/616 (4%)
 Frame = +3

Query  150   QLSNASNP------QPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEEN  311
             QL ++S+P        +  +N + ++    P+    S +S+WA+ LKIPQP    QE+  
Sbjct  5     QLQSSSSPPVVAPGNQNYASNGQDASARQTPSLFSASGISSWARRLKIPQP--SGQEDSQ  62

Query  312   SGNAAKSPFARFTSGFGMLSSPKSPTDDNS-EGTSTTPQSSFIGTFTKGLVDSSKNAVKA  488
              GNA KSPFARFTSGFG+ SSPKSP  D S EGTSTT Q   +G+ T+GLVDSS++AVKA
Sbjct  63    PGNAGKSPFARFTSGFGLHSSPKSPQQDESAEGTSTTTQPGVLGSLTRGLVDSSRSAVKA  122

Query  489   VSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEE  668
             V VKARH+VSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEE
Sbjct  123   VQVKARHIVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEE  182

Query  669   VIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWL  848
             VIKFFETHHK KYKVYNLCSERLYD SLFEGKVA FPFDDHNCPP QLI SFCQSAYSWL
Sbjct  183   VIKFFETHHKGKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPFQLITSFCQSAYSWL  242

Query  849   KEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQI  1028
             KEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI YYNQKRC+D KGLVLPSQI
Sbjct  243   KEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIEYYNQKRCIDGKGLVLPSQI  302

Query  1029  RYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTK  1208
             RYVKYFERIL YFNGENQP RRCMLRGFRLH+CPYWIRPSITIS+HNG+LFSTKKHPRTK
Sbjct  303   RYVKYFERILTYFNGENQPGRRCMLRGFRLHRCPYWIRPSITISNHNGILFSTKKHPRTK  362

Query  1209  DLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKIL  1388
             DL+PED+WFSAPKKG++VFALPGEPG+ ELAGDFK+HF+DRQGDFYCWLNTTMIENRKIL
Sbjct  363   DLMPEDFWFSAPKKGIMVFALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTMIENRKIL  422

Query  1389  NTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssph  1568
             +TSDLDGFDKRKLPSPGFQVE+VLV +D + P RP      +S +    S   +S S+  
Sbjct  423   STSDLDGFDKRKLPSPGFQVEVVLVGHDGSHPPRP------TSATVKKESDGSSSASTAA  476

Query  1569  saDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATD-GVQAKVSTSGNNTGS  1745
               +       ++  GS +KDDVFSD+E+EET   K  +  VA + G  A  +       S
Sbjct  477   HENNTPHPKPSKDRGSQDKDDVFSDSESEETSSSKSRRDKVARNVGGSASTANGPEMKAS  536

Query  1746  PQISSLTQKIEQVSLGDSGLK-----HNEQKRDTTVGAASV---PEVSNTEVSDFKIMAA  1901
              +  +LTQ +EQ+SL   G        NE +RD    +A+V   P++ +  +S+FK +AA
Sbjct  537   QEAGTLTQAVEQLSLKSEGQAAKASDANEVRRDGNSKSAAVSRPPDLESNSMSEFKAIAA  596

Query  1902  DASVFTFGDEEDYESE  1949
             DASVF+FGDEEDYESE
Sbjct  597   DASVFSFGDEEDYESE  612



>gb|EYU37646.1| hypothetical protein MIMGU_mgv1a003275mg [Erythranthe guttata]
Length=595

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/620 (68%), Positives = 486/620 (78%), Gaps = 42/620 (7%)
 Frame = +3

Query  141   MDTQLSNASNPQPS------VTANMETSNVNS---VPAQDGPSKLSTWAKSLKIPQPFTG  293
             M ++  ++SNP  +      ++  ME++  NS    P++   S +STWAK+LKIPQPF G
Sbjct  1     MSSETPDSSNPLDTKSRDIKISTPMESAPDNSEQVAPSKFSASGISTWAKNLKIPQPFVG  60

Query  294   SQEEENSGNAAKSPFARFTSGFGMLSSPKSP-TDDNSEGTSTTPQSSFIGTFTKGLVDSS  470
             +QE   S N+ KSPF+R TSGFG+ +SPKSP ++++S G S T Q  F+GT TKG+VD+S
Sbjct  61    TQEVSPSANSGKSPFSRITSGFGLRASPKSPQSEESSGGASPTTQPGFLGTITKGIVDTS  120

Query  471   KNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFY  650
             KNAVKAV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGD+SSGFFGYVEGFY
Sbjct  121   KNAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDISSGFFGYVEGFY  180

Query  651   RNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQ  830
             RNHMEEVI+FFET+HK KYKVYNLCSERLYD SL EGKVA FPFDDHNCPPIQLI+SFCQ
Sbjct  181   RNHMEEVIRFFETYHKGKYKVYNLCSERLYDASLLEGKVACFPFDDHNCPPIQLIISFCQ  240

Query  831   SAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGL  1010
             SAYSWLKEDI+NVVVVHCKAGMARTGLMISSLLL+LKFFPTAEESI++YNQKRC+D KGL
Sbjct  241   SAYSWLKEDIDNVVVVHCKAGMARTGLMISSLLLFLKFFPTAEESIDFYNQKRCVDGKGL  300

Query  1011  VLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTK  1190
             VLPSQIRYVKYFERIL YFNGENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFSTK
Sbjct  301   VLPSQIRYVKYFERILAYFNGENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTK  360

Query  1191  KHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMI  1370
             KHPRTKDL PEDYWFSAPKKG++VFALPGEPG+ EL+GDFKVHF+D QGDFYCWLNTTMI
Sbjct  361   KHPRTKDLSPEDYWFSAPKKGIMVFALPGEPGLTELSGDFKVHFHDGQGDFYCWLNTTMI  420

Query  1371  ENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYD--TAFPTRPQPEaavsskssdnssan  1544
             ENRK+LNT DLDGFDKRKLPSPGFQVE+VLVDYD  T  P     E   +S+S+ N  AN
Sbjct  421   ENRKVLNTGDLDGFDKRKLPSPGFQVEVVLVDYDAATVLPATSPSETTTASESTQNPGAN  480

Query  1545  pasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVST  1724
               S  +P   +EA+ A ++ K G  + DD  SDNE               TD   AK   
Sbjct  481   TGSRQNPGPVEEASVAKNSNKEG--KDDDELSDNE---------------TDVKAAK---  520

Query  1725  SGNNTGSPQISSLTQKIEQVSLGD----SGLKHNEQKRDTTVGAASVPEVSNT-EVSDFK  1889
                   S QI++LT K EQVSLG+    S     E K+  +V + S   V +  EVS+FK
Sbjct  521   -----SSGQIANLTHKAEQVSLGNTSASSSTAQTEVKKKESVASGSDVAVGSVGEVSEFK  575

Query  1890  IMAADASVFTFGDEEDYESE  1949
              MAADAS+F+FGD+ED ESE
Sbjct  576   AMAADASIFSFGDDEDDESE  595



>ref|XP_011088219.1| PREDICTED: uncharacterized protein LOC105169515 isoform X1 [Sesamum 
indicum]
 ref|XP_011088220.1| PREDICTED: uncharacterized protein LOC105169515 isoform X1 [Sesamum 
indicum]
Length=613

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/620 (69%), Positives = 487/620 (79%), Gaps = 24/620 (4%)
 Frame = +3

Query  141   MDTQLSNASNPQPSVTANMETS-NVNSVP---AQDGPSK-----LSTWAKSLKIPQPFTG  293
             M  +  ++SNPQ   +A+++ S +V S P     D PSK     +STWAK+LKIPQPF G
Sbjct  1     MSLESPDSSNPQDIKSADVKMSTSVESAPHNSEHDAPSKFSASGISTWAKNLKIPQPFGG  60

Query  294   SQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTST-TPQSSFIGTFTKGLVDSS  470
             S E   S N  KS F+R TSG G+ +SPKSP  + S G S+ T QS FIG+ TKGLVDSS
Sbjct  61    SPEVSPSENPGKSTFSRLTSGLGLRASPKSPQSEESSGGSSPTQQSGFIGSITKGLVDSS  120

Query  471   KNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFY  650
             KNAVKAV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFY
Sbjct  121   KNAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFY  180

Query  651   RNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQ  830
             RNHMEEVI+FFET+HKDKYKVYNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI+SFCQ
Sbjct  181   RNHMEEVIRFFETYHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLIISFCQ  240

Query  831   SAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGL  1010
             SAYSWLK+DI+NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYNQKRC+D KGL
Sbjct  241   SAYSWLKQDIDNVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCIDGKGL  300

Query  1011  VLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTK  1190
             VLPSQIRYVKYFER+L YFNGENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFSTK
Sbjct  301   VLPSQIRYVKYFERVLAYFNGENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTK  360

Query  1191  KHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMI  1370
             KH RTKDL PED+WFSAPKKG++VFALPGEPG+ ELAGDFKVHF+DRQGDFYCWLNTTMI
Sbjct  361   KHSRTKDLSPEDFWFSAPKKGIMVFALPGEPGLTELAGDFKVHFHDRQGDFYCWLNTTMI  420

Query  1371  ENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpa  1550
             ENRK+LNTSDLDGFDKRKLPSPGFQVE+V+VDYD +  T      + S   S  +S    
Sbjct  421   ENRKVLNTSDLDGFDKRKLPSPGFQVEVVVVDYDGS--TVSSRPPSGSPSESSGNSGANT  478

Query  1551  sgssphsaDEAADANSNQKSGSSEKDDVF-------SDNEAEETGKPKVGKVTVATDGVQ  1709
                   +  E A A +     S +K+D F       S + + +TG    G  TVA     
Sbjct  479   VSGPSPAPVEEAAAATAAAKNSKKKEDEFSDSEAEESVSSSRQTGISSHGSGTVA-----  533

Query  1710  AKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNTEVSDFK  1889
             AK +   NN  S QI+ LT+K EQVSLG S   H E K++T  G+ +    S  EVS+FK
Sbjct  534   AKDAVPYNNVDSNQIADLTRKTEQVSLGTSPSPHTEVKKETAGGSGTDFSNSVGEVSEFK  593

Query  1890  IMAADASVFTFGDEEDYESE  1949
             +MAADASVF+FGD++DYES+
Sbjct  594   VMAADASVFSFGDDDDYESD  613



>ref|XP_010268474.1| PREDICTED: uncharacterized protein LOC104605416 [Nelumbo nucifera]
Length=615

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/610 (66%), Positives = 480/610 (79%), Gaps = 20/610 (3%)
 Frame = +3

Query  156   SNASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKS--LKIPQPFTGSQEEENSGNAAK  329
             + A + QP V +  + S  ++ P     S +S+WA+S  L+IP+     QEE ++ ++AK
Sbjct  14    AKAPDVQPPVASAQDNSARDTPPLLSA-SAISSWARSFSLRIPKTSVSGQEESHTSSSAK  72

Query  330   SPFARFTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKAR  506
             +  ARFTSG G+  SPK+P  D+N+EG ST PQ+  + + TKGLVDSS++AVKAV VKAR
Sbjct  73    ATLARFTSGLGLRLSPKAPVADENAEGVSTAPQTGVLESLTKGLVDSSRSAVKAVQVKAR  132

Query  507   HVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFE  686
             H+VSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFE
Sbjct  133   HIVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFE  192

Query  687   THHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIEN  866
             THHK KYKVYNLCSERLYD SLFEGKVA FPFDDHNCPPIQLI+SFCQSAYSWLKEDIEN
Sbjct  193   THHKGKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPIQLIVSFCQSAYSWLKEDIEN  252

Query  867   VVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYF  1046
             VVVVHCKAGMARTGLMISSLLL+LKFFPTAEESI+YYN+KRC+D KGLVLPSQIRYVKYF
Sbjct  253   VVVVHCKAGMARTGLMISSLLLFLKFFPTAEESIDYYNKKRCVDGKGLVLPSQIRYVKYF  312

Query  1047  ERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPED  1226
             ERIL YFNGENQP RRCMLRGFRLHKCPYWIRPSIT+SDHNGVLFSTKKHPRTKDL+PED
Sbjct  313   ERILTYFNGENQPGRRCMLRGFRLHKCPYWIRPSITVSDHNGVLFSTKKHPRTKDLMPED  372

Query  1227  YWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLD  1406
             +WF+APKKG++VFALPGE G+ E++GDFK+HF+DRQGDFYCWLNTTM ENRKILNTSDLD
Sbjct  373   FWFNAPKKGIIVFALPGETGLTEVSGDFKIHFHDRQGDFYCWLNTTMTENRKILNTSDLD  432

Query  1407  GFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAA  1586
             GFDKRKLPSPGFQVE+V++DY+   PT+P+ E+A     +   +    S         AA
Sbjct  433   GFDKRKLPSPGFQVEVVIIDYNGTIPTKPRTESASRKSDASPGTGPVPSDGG------AA  486

Query  1587  DANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGS--PQISS  1760
               ++N+ SGS +KDDVFSD+E EE+G  K  +    +    A  +  G  TG+   Q+++
Sbjct  487   TPSANKDSGSPDKDDVFSDSEGEESGSSKNREAQEVSGVGPASTTAGGPQTGTTQEQVAA  546

Query  1761  LTQKIEQVSLGDSGLKH----NEQKRDTTVGAA---SVPEVSNTEVSDFKIMAADASVFT  1919
             LT   E+ SL   G       NE   D+   +     +P+ S T  +DFK +AADASVF+
Sbjct  547   LTHGTEKFSLRSEGPTQQPSANESNTDSDSRSGLSVDIPKDSTTS-NDFKAIAADASVFS  605

Query  1920  FGDEEDYESE  1949
             FGD+EDYESE
Sbjct  606   FGDDEDYESE  615



>ref|XP_002313137.2| hypothetical protein POPTR_0009s10080g [Populus trichocarpa]
 gb|EEE87092.2| hypothetical protein POPTR_0009s10080g [Populus trichocarpa]
Length=609

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/618 (68%), Positives = 481/618 (78%), Gaps = 24/618 (4%)
 Frame = +3

Query  141   MDTQLSNASNPQPSVTANMETSNVNSVP---AQDGPSKLS-----TWAKSLKIPQPFTGS  296
             MD++ +++S P P  + + +    + VP   A D  SKLS     +WAKSLKIPQP T S
Sbjct  1     MDSETADSS-PPPVKSPDTQPPPHDPVPGNSASDATSKLSAAGITSWAKSLKIPQPLTSS  59

Query  297   QEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSK  473
              ++  +GNA KS FARFTSGFG+  SPKSP  DD+ EGTS+T Q    GT TKGLVD+SK
Sbjct  60    PDDSPTGNAGKSTFARFTSGFGLRMSPKSPAADDSPEGTSSTSQPGIFGTITKGLVDTSK  119

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             NAVKAV VKARH VSQNKRRYQEGGFDLD+TYITEN+IAMGFPAG+MSSGFFGYVEGFYR
Sbjct  120   NAVKAVQVKARHAVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGNMSSGFFGYVEGFYR  179

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             NHMEEVIKFFETHHKDKYKVYNLCSERLYD SLFEGKVASFPFDDHNCPP QLI+SFCQS
Sbjct  180   NHMEEVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPTQLIISFCQS  239

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
             AY WLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYNQKRC DAKGLV
Sbjct  240   AYLWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCFDAKGLV  299

Query  1014  LPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKK  1193
             LPSQIRYVKYFERIL YFNGENQP R    RGFRLH+CPYWIRPSITISDHNGVLFS+KK
Sbjct  300   LPSQIRYVKYFERILTYFNGENQPGR----RGFRLHRCPYWIRPSITISDHNGVLFSSKK  355

Query  1194  HPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIE  1373
             HPRTKDL PEDYWFSAP KGV+VF LPGEPG+ E++GDFKVHF+DRQGDFY WLNTT +E
Sbjct  356   HPRTKDLPPEDYWFSAPNKGVMVFTLPGEPGLTEVSGDFKVHFHDRQGDFYFWLNTTFME  415

Query  1374  NRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpas  1553
             NR+ILNTSD+DGF KRKLPSPGFQVE+VLVD D +  +    E  V      +S+A    
Sbjct  416   NRQILNTSDIDGFIKRKLPSPGFQVEVVLVDNDGSVSSGSNAETDVKKSDEGSSTAPAPV  475

Query  1554  gssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVS---T  1724
              ++       A+ N N+  GS++KDDVFSD EA+E+   K  +   ++ G Q+  +   +
Sbjct  476   EAATA----TAEPNQNKDPGSNDKDDVFSDGEADESVFSKRKQAQASSAGGQSAATPAPS  531

Query  1725  SGNNTGSPQISSLTQKIEQVSLGDSGLKHNE---QKRDTTVGAASVPEVSNTEVSDFKIM  1895
              G ++ S Q++SLTQ  EQ SLG+ G + +    Q +   VG       +N   S+FK M
Sbjct  532   PGTDSKSDQVASLTQATEQFSLGNRGSQQSHATSQPKSEVVGGTVSSLEANNSHSEFKAM  591

Query  1896  AADASVFTFGDEEDYESE  1949
             AADASVFTFGD+EDYES+
Sbjct  592   AADASVFTFGDDEDYESD  609



>ref|XP_010065983.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Eucalyptus 
grandis]
Length=610

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/613 (67%), Positives = 482/613 (79%), Gaps = 21/613 (3%)
 Frame = +3

Query  141   MDTQLSNASNPQ-------PSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQ  299
             MD + ++AS P        PS T     S+      +   + +S+WAK+L+IPQ  + +Q
Sbjct  9     MDKESTDASIPAAANHVEPPSATDPAPDSSARDGSPRISAAGISSWAKNLRIPQSLSTAQ  68

Query  300   EEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNA  479
             ++  + N  KSPFARFTSG G+  SP+SP  + S G+ +  Q    GT TKGLVDSSK+A
Sbjct  69    DDSTTSNGGKSPFARFTSGLGLKLSPRSPPAEESIGSPSAAQPGLFGTITKGLVDSSKSA  128

Query  480   VKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNH  659
             VKAV V+ARHVVSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNH
Sbjct  129   VKAVQVRARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNH  188

Query  660   MEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAY  839
             MEEVIKFFET HKDKYKVYNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI+SFC+SAY
Sbjct  189   MEEVIKFFETQHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLIISFCKSAY  248

Query  840   SWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLP  1019
              WLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYNQKRC+D KGLVLP
Sbjct  249   GWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCVDGKGLVLP  308

Query  1020  SQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHP  1199
             SQIRYVKYFER+L YFNGENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNG+LF+TKKHP
Sbjct  309   SQIRYVKYFERVLTYFNGENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGILFTTKKHP  368

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENR  1379
             RTKDL PEDYWFSAPKKG++VFALPGEPG+ ELAGDFKVHF+DRQGDFYCWLNTT +ENR
Sbjct  369   RTKDLSPEDYWFSAPKKGIMVFALPGEPGLTELAGDFKVHFHDRQGDFYCWLNTTFMENR  428

Query  1380  KILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgs  1559
             K+LNT+DLDGFDKRKLPSPGFQVEIV VDYD A PT P  ++  ++ S+ +     +  S
Sbjct  429   KVLNTNDLDGFDKRKLPSPGFQVEIVQVDYDGAPPTPPFAQSGTTTSSATSDPPPASVAS  488

Query  1560  sphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVAT---DGVQAKVSTSG  1730
             +  ++D     + ++  GS++KDDVFSD+EAEE G  K  +   A+   + V +   TS 
Sbjct  489   TAATSDH----HESKVPGSNDKDDVFSDSEAEEAGSSKSKRRQPASSTGETVTSTTPTSE  544

Query  1731  NNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADAS  1910
             N + + Q++++T+  EQVSLG+SG      K D            +T  S+FK MAADAS
Sbjct  545   NKSNADQVANVTRATEQVSLGNSGPA--PPKSDVISSTE-----FSTSESEFKAMAADAS  597

Query  1911  VFTFGDEEDYESE  1949
             VFTFGDEEDYES+
Sbjct  598   VFTFGDEEDYESD  610



>ref|XP_010555987.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Tarenaya 
hassleriana]
 ref|XP_010555988.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Tarenaya 
hassleriana]
 ref|XP_010555989.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Tarenaya 
hassleriana]
 ref|XP_010555990.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Tarenaya 
hassleriana]
Length=598

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/607 (68%), Positives = 480/607 (79%), Gaps = 20/607 (3%)
 Frame = +3

Query  156   SNASNPQPSVTANMETSNVNS---VPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAA  326
             S AS+ QPS  A +E  + NS     ++   S LSTWAK+L++ QPF+  + +    ++ 
Sbjct  3     SGASDGQPS--AALEAGSNNSPGEATSKLSASGLSTWAKNLRVTQPFSSPRNDSEVLSSE  60

Query  327   KSPFARFTSGFGMLSSPKSP-TDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKA  503
             KS FARFTSG G+  SPKSP +D+++EGTS   QS FIGT TKGLVDSS++AVKAV VKA
Sbjct  61    KSTFARFTSGLGLRLSPKSPQSDESNEGTSNAAQSGFIGTITKGLVDSSRSAVKAVQVKA  120

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKF 
Sbjct  121   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFL  180

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ETHHK KYKVYNLCSERLYDVSL EGKVASFPFDDHNCPPIQLI SFCQSAYSWLKEDIE
Sbjct  181   ETHHKGKYKVYNLCSERLYDVSLLEGKVASFPFDDHNCPPIQLITSFCQSAYSWLKEDIE  240

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEE +++YNQKRC+D KGLVLPSQIRYVKY
Sbjct  241   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEECMDFYNQKRCVDGKGLVLPSQIRYVKY  300

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPE  1223
             FERIL YFNGENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFSTKKHPRTKDL PE
Sbjct  301   FERILTYFNGENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTKKHPRTKDLSPE  360

Query  1224  DYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDL  1403
             D+WF+APKKGV+VFALPGEPG+ ELAGDFK+HF+DRQGDFYCWLNTTM+ENRKILNT DL
Sbjct  361   DFWFTAPKKGVMVFALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTMMENRKILNTGDL  420

Query  1404  DGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEA  1583
             DGFDKRKL SPGFQVE+VL D  +  P  P  ++   +    +SS  P++ +     +  
Sbjct  421   DGFDKRKLSSPGFQVEVVLADISSTIPVTPSSQSETETPKEPSSSHFPSAENIVTGQE--  478

Query  1584  ADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGS-PQISS  1760
                   +++ + +KDDVFSD+E E++G  K  K  +   G     ++S N  GS  Q++ 
Sbjct  479   ----PKKETENPDKDDVFSDSEVEDSGSSKHRKPQLGVTGPSE--TSSKNPKGSLDQVAD  532

Query  1761  LTQKIEQVSLGDSGLKHNEQKRDTTVGAASVP----EVSNTEVSDFKIMAADASVFTFGD  1928
             + +K E+VS+ +S      +   TT G AS      E SN E S+FK+MAADASVF+FGD
Sbjct  533   IAKKTEKVSILESVGSQVVKGTSTTNGEASEKTSGLEASNAE-SEFKVMAADASVFSFGD  591

Query  1929  EEDYESE  1949
             EEDYESE
Sbjct  592   EEDYESE  598



>ref|XP_010922080.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Elaeis 
guineensis]
Length=612

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/599 (68%), Positives = 484/599 (81%), Gaps = 22/599 (4%)
 Frame = +3

Query  189   ANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGML  368
             +N + ++    P+    + +S+WA+SLKIPQP   +QE+   GNA KSPFARFTSGFG+ 
Sbjct  24    SNGQDASARQTPSLFSATGISSWARSLKIPQP--SAQEDSQPGNAGKSPFARFTSGFGLH  81

Query  369   SSPKSP-TDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEG  545
              SPKSP  D+++EGTSTT Q   +G+ T+GLVDSSK+AVKAV VKARH+VSQNKRRYQEG
Sbjct  82    LSPKSPRQDESAEGTSTTTQPGVLGSLTRGLVDSSKSAVKAVQVKARHIVSQNKRRYQEG  141

Query  546   GFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLC  725
             GFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFE+HHK KYKVYNLC
Sbjct  142   GFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFESHHKGKYKVYNLC  201

Query  726   SERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMART  905
             SERLYD SLFEGKVA FPFDDHNCPP+QLI+SFCQSAYSWLKEDIENVVV+HCKAGMART
Sbjct  202   SERLYDASLFEGKVACFPFDDHNCPPLQLIISFCQSAYSWLKEDIENVVVIHCKAGMART  261

Query  906   GLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQP  1085
             GLMISSLLLYLKFFPTAEESI YYNQKRC+D KGLVLPSQIRYVKYFERIL YFNGENQP
Sbjct  262   GLMISSLLLYLKFFPTAEESIEYYNQKRCIDGKGLVLPSQIRYVKYFERILTYFNGENQP  321

Query  1086  ARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVF  1265
              RRCMLRGFRLH+CPYWIRPSI+IS+HNGVLFSTKKHPRTKDL+PED+WFSAPKKG++VF
Sbjct  322   GRRCMLRGFRLHRCPYWIRPSISISNHNGVLFSTKKHPRTKDLMPEDFWFSAPKKGIMVF  381

Query  1266  ALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQ  1445
             ALPGEPG+ ELAGDFK+HF+DRQGDFYCWLNTTM+ENRKIL+TSDLDGFDKRKLPSPGFQ
Sbjct  382   ALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTMMENRKILSTSDLDGFDKRKLPSPGFQ  441

Query  1446  VEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEK  1625
             VE+VLVDYD +   RP      +S + +  S   ++ S+  + +       ++ SGS +K
Sbjct  442   VEVVLVDYDGSHSPRP------TSLNVNKESDGSSTASTATNDNSTPHPKPSRDSGSQDK  495

Query  1626  DDVFSDNEAEETGKPKVGKVTVATD-GVQAKVSTSGNNTGSPQISSLTQKIEQVSL-GDS  1799
             DDVFSD+E+EET   K  +  VA + G  A  +       S + ++  Q +EQ+SL G+ 
Sbjct  496   DDVFSDSESEETSSSKSKRDKVARNLGGSASTAKGPELKASQEAATTAQGVEQLSLKGEG  555

Query  1800  GL---------KHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             G          +++  +++ TV   S  E+ +  VS+FK +AADASVF+FGD+EDYESE
Sbjct  556   GATKTPDTTEERNDGNRKNETVSQPS--ELESNSVSEFKAIAADASVFSFGDDEDYESE  612



>gb|KHN06755.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Glycine soja]
Length=622

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/578 (70%), Positives = 469/578 (81%), Gaps = 13/578 (2%)
 Frame = +3

Query  237   PSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTST  416
             P+ +S+WAK+LKI QPF+GSQ++ +SGN  KS FAR TS FG+  SPKSP +D+S  + T
Sbjct  51    PTGISSWAKNLKISQPFSGSQDDSSSGNVGKSTFARITSNFGLRLSPKSPVEDDS-SSET  109

Query  417   TPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMG  596
               QS+  GT TKGLVDSSKNAVKAV VKARHVVSQNKRRYQEGGFDLD+TYITENVIAMG
Sbjct  110   AGQSNLFGTITKGLVDSSKNAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENVIAMG  169

Query  597   FPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASF  776
             FPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYD SLFEGKVASF
Sbjct  170   FPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVASF  229

Query  777   PFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTA  956
             PFDDHNCPPIQLI+SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLL++LKFFPTA
Sbjct  230   PFDDHNCPPIQLIISFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLVFLKFFPTA  289

Query  957   EESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYW  1136
             EES++YYNQKRC+D KGLVLPSQIRYVKYFER+L YFNGEN PARRCMLRGFRLH+CPYW
Sbjct  290   EESMDYYNQKRCVDGKGLVLPSQIRYVKYFERVLTYFNGENPPARRCMLRGFRLHRCPYW  349

Query  1137  IRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKV  1316
             IRPSIT+SDH+GVLFSTKKHPRTKDLLPED+WF APKKGV+VFALPGEPG+ ELAGDFK+
Sbjct  350   IRPSITVSDHSGVLFSTKKHPRTKDLLPEDFWFGAPKKGVMVFALPGEPGLTELAGDFKI  409

Query  1317  HFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQ  1496
             HF+DRQGDFYCWLNTTM ENRK+LNT DLDGFDKRKLPSPGF VE+VLVDY+    T   
Sbjct  410   HFHDRQGDFYCWLNTTMTENRKVLNTGDLDGFDKRKLPSPGFMVEVVLVDYNGNVVT---  466

Query  1497  PEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKV  1676
                  ++    + S++    S           N++++S S +KDDVFSD EAE++   + 
Sbjct  467   -SKIETTTKKSDESSSNNPASPTPVERSTPAQNADKESDSHDKDDVFSDGEAEQSASSRS  525

Query  1677  GKVTV---ATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSG---LKHNEQKRDTTV  1838
              +      A + V+     S ++  S +I++L+   EQVSLG+     ++H  + R    
Sbjct  526   KQTKAPSQAVEKVKNDTRVSESSRVSNEIANLSHATEQVSLGNKSSTPIRHASEPRTNVE  585

Query  1839  G-AASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             G   S  EV +TE S+FK MAADASVFTFGD+EDYES+
Sbjct  586   GKTVSSLEVPSTE-SEFKAMAADASVFTFGDDEDYESD  622



>ref|XP_011088222.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
TPTE2 isoform X2 [Sesamum indicum]
Length=593

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/599 (70%), Positives = 475/599 (79%), Gaps = 23/599 (4%)
 Frame = +3

Query  201   TSNVNSVP---AQDGPSK-----LSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSG  356
             +++V S P     D PSK     +STWAK+LKIPQPF GS E   S N  KS F+R TSG
Sbjct  2     STSVESAPHNSEHDAPSKFSASGISTWAKNLKIPQPFGGSPEVSPSENPGKSTFSRLTSG  61

Query  357   FGMLSSPKSPTDDNSEGTST-TPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRR  533
              G+ +SPKSP  + S G S+ T QS FIG+ TKGLVDSSKNAVKAV VKARHVVSQNKRR
Sbjct  62    LGLRASPKSPQSEESSGGSSPTQQSGFIGSITKGLVDSSKNAVKAVQVKARHVVSQNKRR  121

Query  534   YQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKV  713
             YQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVI+FFET+HKDKYKV
Sbjct  122   YQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIRFFETYHKDKYKV  181

Query  714   YNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAG  893
             YNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI+SFCQSAYSWLK+DI+NVVVVHCKAG
Sbjct  182   YNLCSERLYDASLFEGKVASFPFDDHNCPPIQLIISFCQSAYSWLKQDIDNVVVVHCKAG  241

Query  894   MARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNG  1073
             MARTGLMISSLLLYLKFFPTAEESI+YYNQKRC+D KGLVLPSQIRYVKYFER+L YFNG
Sbjct  242   MARTGLMISSLLLYLKFFPTAEESIDYYNQKRCIDGKGLVLPSQIRYVKYFERVLAYFNG  301

Query  1074  ENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKG  1253
             ENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFSTKKH RTKDL PED+WFSAPKKG
Sbjct  302   ENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTKKHSRTKDLSPEDFWFSAPKKG  361

Query  1254  VVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPS  1433
             ++VFALPGEPG+ ELAGDFKVHF+DRQGDFYCWLNTTMIENRK+LNTSDLDGFDKRKLPS
Sbjct  362   IMVFALPGEPGLTELAGDFKVHFHDRQGDFYCWLNTTMIENRKVLNTSDLDGFDKRKLPS  421

Query  1434  PGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSG  1613
             PGFQVE+V+VDYD +  T      + S   S  +S          +  E A A +     
Sbjct  422   PGFQVEVVVVDYDGS--TVSSRPPSGSPSESSGNSGANTVSGPSPAPVEEAAAATAAAKN  479

Query  1614  SSEKDDVF-------SDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQK  1772
             S +K+D F       S + + +TG    G  TVA     AK +   NN  S QI+ LT+K
Sbjct  480   SKKKEDEFSDSEAEESVSSSRQTGISSHGSGTVA-----AKDAVPYNNVDSNQIADLTRK  534

Query  1773  IEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
              EQVSLG S   H E K++T  G+ +    S  EVS+FK+MAADASVF+FGD++DYES+
Sbjct  535   TEQVSLGTSPSPHTEVKKETAGGSGTDFSNSVGEVSEFKVMAADASVFSFGDDDDYESD  593



>ref|XP_003536624.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Glycine max]
 ref|XP_006589637.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Glycine max]
Length=622

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/578 (70%), Positives = 469/578 (81%), Gaps = 13/578 (2%)
 Frame = +3

Query  237   PSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTST  416
             P+ +S+WAK+LKI QPF+GSQ++ +SGN  KS FAR TS FG+  SPKSP +D+S  + T
Sbjct  51    PTGISSWAKNLKISQPFSGSQDDSSSGNVGKSTFARITSNFGLRLSPKSPVEDDS-SSET  109

Query  417   TPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMG  596
               QS+  GT TKGLVDSSKNAVKAV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMG
Sbjct  110   AGQSNLFGTITKGLVDSSKNAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMG  169

Query  597   FPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASF  776
             FPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYD SLFEGKVASF
Sbjct  170   FPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVASF  229

Query  777   PFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTA  956
             PFDDHNCPPIQLI+SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLL++LKFFPTA
Sbjct  230   PFDDHNCPPIQLIISFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLVFLKFFPTA  289

Query  957   EESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYW  1136
             EES++YYNQKRC+D KGLVLPSQIRYVKYFER+L YFNGEN PARRCMLRGFRLH+CPYW
Sbjct  290   EESMDYYNQKRCVDGKGLVLPSQIRYVKYFERVLTYFNGENPPARRCMLRGFRLHRCPYW  349

Query  1137  IRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKV  1316
             IRPSIT+SDH+GVLFSTKKHPRTKDLLPED+WF APKKGV+VFALPGEPG+ ELAGDFK+
Sbjct  350   IRPSITVSDHSGVLFSTKKHPRTKDLLPEDFWFGAPKKGVMVFALPGEPGLTELAGDFKI  409

Query  1317  HFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQ  1496
             HF+DRQGDFYCWLNTTM ENRK+LNT DLDGFDKRKLPSPGF VE+VLVDY+    T   
Sbjct  410   HFHDRQGDFYCWLNTTMTENRKVLNTGDLDGFDKRKLPSPGFMVEVVLVDYNGNVVT---  466

Query  1497  PEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKV  1676
                  ++    + S++    S           N++++S S +KDDVFSD EAE++   + 
Sbjct  467   -SKIETTTKKSDESSSNNPASPTPVERSTPAQNADKESDSHDKDDVFSDGEAEQSASSRS  525

Query  1677  GKVTV---ATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSG---LKHNEQKRDTTV  1838
              +      A + V+     S ++  S +I++L+   EQVSLG+     ++H  + R    
Sbjct  526   KQTKAPSQAVEKVKNDTRVSESSRVSNEIANLSHATEQVSLGNKSSTPIRHASEPRTNVE  585

Query  1839  G-AASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             G   S  EV +TE S+FK MAADASVFTFGD+EDYES+
Sbjct  586   GKTVSSLEVPSTE-SEFKAMAADASVFTFGDDEDYESD  622



>ref|XP_009410466.1| PREDICTED: uncharacterized protein LOC103992479 [Musa acuminata 
subsp. malaccensis]
Length=613

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/612 (67%), Positives = 478/612 (78%), Gaps = 25/612 (4%)
 Frame = +3

Query  147   TQLSNASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAA  326
             T   N S+  P   A++ET ++ S       S +S+WA++LK PQ  +  QE+  SGNA 
Sbjct  16    TSPGNQSSASPRQDASVETQSMFST------SGISSWARNLKFPQ--SSGQEDLQSGNAG  67

Query  327   KSPFARFTSGFGMLSSPKSPT--DDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVK  500
             KS F+R TSGFG   SPKS    DD +EG+STT Q   +G+ TKG VD+S++AVKAV VK
Sbjct  68    KSTFSRITSGFGFRLSPKSSQSEDDVAEGSSTTTQPGVLGSLTKGFVDTSRSAVKAVQVK  127

Query  501   ARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKF  680
             ARH+VSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKF
Sbjct  128   ARHIVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKF  187

Query  681   FETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDI  860
             FETHHK KYKVYNLCSERLYD SLFEGKVA FPFDDHNCPPIQLI SFCQSAYSWLKEDI
Sbjct  188   FETHHKGKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPIQLITSFCQSAYSWLKEDI  247

Query  861   ENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVK  1040
             ENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEES+ YYNQKRC+D KGLVLPSQIRYVK
Sbjct  248   ENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESMEYYNQKRCIDGKGLVLPSQIRYVK  307

Query  1041  YFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLP  1220
             YFERIL YFNGENQP RRCML+GFRLH+CPYWIRPSIT+S+HNGVLFSTKKH RTKDL+P
Sbjct  308   YFERILTYFNGENQPNRRCMLKGFRLHRCPYWIRPSITVSNHNGVLFSTKKHSRTKDLMP  367

Query  1221  EDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSD  1400
             ED+WFSAPKKG++VFALPGEPG+ E+AGDFK+HF+DRQGDFYCWLNTT  ENRKILNTSD
Sbjct  368   EDFWFSAPKKGIMVFALPGEPGLTEVAGDFKIHFHDRQGDFYCWLNTTFTENRKILNTSD  427

Query  1401  LDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDE  1580
             LDGFDKRKLPSPGFQ+EIVLVDYD +    P+   + ++K S   + +  +     +   
Sbjct  428   LDGFDKRKLPSPGFQIEIVLVDYDAS--NSPRQIGSNANKESAPDTTSATATKEIRTPPS  485

Query  1581  AADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSP--QI  1754
               D++S     S +KDDVFSD+EAEETG  K  +  VA D   + V+  G    S   + 
Sbjct  486   KVDSDSR----SQDKDDVFSDSEAEETGSSKRRRDKVAGDTDGSTVTAKGAEMKSSKEEA  541

Query  1755  SSLTQKIEQVSL-GDSGLKHNEQKRDTTVGAAS------VPEVSNTEVSDFKIMAADASV  1913
             +++ Q I QV+L  ++G K+     D  +  +S       PE+ +T +S+FK +AADASV
Sbjct  542   TAIAQAIGQVTLKNEAGAKNVPDSSDVKIEGSSKSLPVETPELGSTTMSEFKAIAADASV  601

Query  1914  FTFGDEEDYESE  1949
             F+FGD+EDYESE
Sbjct  602   FSFGDDEDYESE  613



>ref|XP_004496964.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Cicer 
arietinum]
Length=622

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/627 (66%), Positives = 478/627 (76%), Gaps = 20/627 (3%)
 Frame = +3

Query  90    ALSPPATFRTLVPSLSTMDTQLSNASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSL  269
             ++ PP    +  P     D Q S A        A+ + ++    P++  P+ +S+WAK+L
Sbjct  9     SIPPPVKVPSTAPHAKEADGQASAA-------VASGQDNSGREAPSRLSPTGISSWAKNL  61

Query  270   KIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTF  446
             K+ Q F+GSQ++ +SGN  KS FAR TS  G+  SPKSP  DDNS   +   QS+  G+ 
Sbjct  62    KLSQSFSGSQDDPSSGNVGKSAFARITSNLGLRLSPKSPAADDNSNEPAA--QSNLFGSI  119

Query  447   TKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGF  626
             TKGLVDSSKNAVKAV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGF
Sbjct  120   TKGLVDSSKNAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGF  179

Query  627   FGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPI  806
             FGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYD SLFEGKVASFPFDDHNCPPI
Sbjct  180   FGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPI  239

Query  807   QLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQK  986
             QL++SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLL+LKFFPTAEES++YYNQK
Sbjct  240   QLVISFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLFLKFFPTAEESMDYYNQK  299

Query  987   RCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDH  1166
             RC+D KGLVLPSQIRYVKYFERIL YFNGE  PARRCMLRGFRLH+CPYWIRPSIT+SDH
Sbjct  300   RCIDGKGLVLPSQIRYVKYFERILTYFNGECPPARRCMLRGFRLHRCPYWIRPSITVSDH  359

Query  1167  NGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFY  1346
             +GVLFSTKKHPRTKDLLPED+WFSAPKKGV+VFALPGEPG+ ELAGDFK+HF+DRQGDFY
Sbjct  360   SGVLFSTKKHPRTKDLLPEDFWFSAPKKGVMVFALPGEPGLTELAGDFKIHFHDRQGDFY  419

Query  1347  CWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskss  1526
             CWLNTTM ENRK+LNT DLDGFDKRKLPSPGFQVE+VL+D +    T   PE    S  S
Sbjct  420   CWLNTTMTENRKVLNTGDLDGFDKRKLPSPGFQVEVVLLDNNGNVVTS-NPEITKKSDES  478

Query  1527  dnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGV  1706
              ++S  PA            +A+     G  +KDDVFSD EA+        +    ++ V
Sbjct  479   SSTSPAPAPVEVNT---PTPNADKESGDGDHDKDDVFSDGEADNPASSTSKQTKAPSEAV  535

Query  1707  QAKVSTSGN---NTGSPQISSLTQKIEQVSLGD--SGLKHNEQKRDTTVGAASVPEVSN-  1868
             +   S S     N  S QI+++T   EQVSLG   S   H+  +  + VG  +V  +   
Sbjct  536   KTVASASRESEANKISNQITNITHATEQVSLGSKTSMPSHSTSEPKSDVGGRTVSNLDEP  595

Query  1869  TEVSDFKIMAADASVFTFGDEEDYESE  1949
             +  S+FK MAADASVFTFGD+EDYES+
Sbjct  596   SSESEFKAMAADASVFTFGDDEDYESD  622



>ref|XP_009381358.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Musa 
acuminata subsp. malaccensis]
Length=613

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/621 (65%), Positives = 480/621 (77%), Gaps = 33/621 (5%)
 Frame = +3

Query  150   QLSNASNPQPSVTANMETSNVNSVPAQDGPSK----------LSTWAKSLKIPQPFTGSQ  299
             QL   S+P  +   N  +++    P QD  ++          +S+WA+++K PQ  +  Q
Sbjct  5     QLEQTSSPPVTSPVNQSSTS----PRQDASARDTQSIFSTSGISSWARNIKFPQ--SSGQ  58

Query  300   EEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNS--EGTSTTPQSSFIGTFTKGLVDSSK  473
             ++  S NA KS F+R TSG G  SSPKSP  + +  EGTSTT Q    G+ TKGLVD+S+
Sbjct  59    DDVQSVNAGKSTFSRLTSGIGFRSSPKSPQSEETVAEGTSTTTQPGVFGSLTKGLVDTSR  118

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             +AVKAV VKARH+VSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYR
Sbjct  119   SAVKAVQVKARHMVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYR  178

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             NHMEEVIKFFETHHK KYKVYNLCSERLYD SLFEGKVA FPFDDHNCPPIQLI+SFCQS
Sbjct  179   NHMEEVIKFFETHHKGKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPIQLIISFCQS  238

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
             AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEES+ YYNQKRC+D KGLV
Sbjct  239   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESMEYYNQKRCIDGKGLV  298

Query  1014  LPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKK  1193
             LPSQIRYVKYFERIL YF+GENQP RRCMLRGFRLH+CPYWIRPSIT+S+HNGVLFSTKK
Sbjct  299   LPSQIRYVKYFERILTYFDGENQPGRRCMLRGFRLHRCPYWIRPSITVSNHNGVLFSTKK  358

Query  1194  HPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIE  1373
             HPRTKDL+PED+WFSAPKKG++VFALPGEPG+ ELAGDFK+HF+DRQGDFYCWLNTT +E
Sbjct  359   HPRTKDLMPEDFWFSAPKKGIMVFALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTFME  418

Query  1374  NRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpas  1553
             +RKIL+TSDLDGFDKRKLPSPGFQVE+VLV+YD + P R       SS +++  SA   +
Sbjct  419   DRKILSTSDLDGFDKRKLPSPGFQVEVVLVNYDGSNPPR------QSSSNANKESAGGTT  472

Query  1554  gssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGN  1733
               +         + +++ SG+ +KDDVFSD+EAEETG  K  +  +  D     ++  G 
Sbjct  473   SVTATKESSTPPSTADRDSGNQDKDDVFSDSEAEETGSSKSKRDRMVGDKDGTTITAKGI  532

Query  1734  NTGSP--QISSLTQKIEQVSLGDSG-LKHNEQKRDTTVGAAS------VPEVSNTEVSDF  1886
                S   + ++++Q I Q+SL D    K N    D  +  +S       PE+ +T +S+F
Sbjct  533   EIKSSKEEAATISQDISQISLKDEADSKKNPDAADAKIEGSSKSSITETPELESTTMSEF  592

Query  1887  KIMAADASVFTFGDEEDYESE  1949
             K +AADASVF+FGD+EDYESE
Sbjct  593   KAIAADASVFSFGDDEDYESE  613



>ref|XP_009335014.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Pyrus x 
bretschneideri]
 ref|XP_009335015.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Pyrus x 
bretschneideri]
Length=612

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/591 (70%), Positives = 467/591 (79%), Gaps = 25/591 (4%)
 Frame = +3

Query  225   AQDGPSK----LSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSP-T  389
             + D P+K    LS+WAK+LK+PQP   +Q+   SGN  +S F+RFTSG G+  SPK+P +
Sbjct  31    SHDAPTKQSSGLSSWAKNLKLPQPLAPTQDSSQSGNGGQSSFSRFTSGLGLRLSPKAPPS  90

Query  390   DDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTY  569
             DD S  + TT Q  FIGT TKG+VDSSK+AVKAV VKARHVVSQNKRRYQEGGFDLD+TY
Sbjct  91    DDISNESPTTLQPGFIGTITKGIVDSSKSAVKAVQVKARHVVSQNKRRYQEGGFDLDMTY  150

Query  570   ITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVS  749
             ITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYD S
Sbjct  151   ITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDAS  210

Query  750   LFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLL  929
             LFEGKVASFPFDDHNCPPI LI  FC+SAY+WLKEDIENVVVVHCKAGMARTGLMISSLL
Sbjct  211   LFEGKVASFPFDDHNCPPIHLITLFCRSAYAWLKEDIENVVVVHCKAGMARTGLMISSLL  270

Query  930   LYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRG  1109
             LYLKFFPTAEESI+YYNQKRC D KGLVLPSQIRYVKYFERIL YFNGEN P RRCMLRG
Sbjct  271   LYLKFFPTAEESIDYYNQKRCFDGKGLVLPSQIRYVKYFERILTYFNGENPPGRRCMLRG  330

Query  1110  FRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGV  1289
             FRLH+CPYWIRP+IT+SDH GVLFSTK+HPRTK L PEDYWFSAPKKGV+VFALPGE G+
Sbjct  331   FRLHRCPYWIRPTITVSDHTGVLFSTKEHPRTKGLSPEDYWFSAPKKGVMVFALPGELGL  390

Query  1290  AELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDY  1469
              EL GDFKVHF+DRQGDFYCWLNTTM ENRK+L  +DLDGFDKRKLPSPGFQVE+VLVDY
Sbjct  391   TELVGDFKVHFHDRQGDFYCWLNTTMTENRKVLTNNDLDGFDKRKLPSPGFQVEVVLVDY  450

Query  1470  DTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKS---GSSEKDDVFS  1640
                 PT P  E         ++     S  +  S+DE   A + Q+S   GS +KDDVFS
Sbjct  451   SGNVPTTPNTE--------TSAKKPDESSGTKPSSDEGGAAAAPQESKSPGSQDKDDVFS  502

Query  1641  DNEAEETG--KPKVGKVTVATDGVQ-AKVSTSGNNTGSP-QISSLTQKIEQVSLGDSGLK  1808
             D+EAEE G  K +  + T    GV  A  STS  +   P QISSLT   +QVS+G++  K
Sbjct  503   DSEAEEGGSAKSRQAEATSPPAGVPVASTSTSSESDTKPDQISSLTNATKQVSIGNTDSK  562

Query  1809  H----NEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                  +E K   + G A   E S+TE S+FK MAADASVF+FGD+ED ESE
Sbjct  563   QAAAASEPKSSVSGGNAPGLEASSTE-SEFKAMAADASVFSFGDDEDSESE  612



>gb|KHG26348.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
phosphatase PTEN [Gossypium arboreum]
Length=562

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/584 (70%), Positives = 456/584 (78%), Gaps = 65/584 (11%)
 Frame = +3

Query  228   QDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSP-TDDNSE  404
              D PSKLS+WAK+LKIPQPF  SQE+  +  A KSP ARFTSG G+ SSPKSP  +D++E
Sbjct  34    HDSPSKLSSWAKNLKIPQPFAASQEDSQTETAGKSPLARFTSGIGLHSSPKSPPANDSNE  93

Query  405   GTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENV  584
             G S T Q  F GT T G+V++SKNAVKAV VKARHVVSQNKRR+QEGGFDLD+TYITEN+
Sbjct  94    GNSPTAQPGFFGTITNGIVNTSKNAVKAVQVKARHVVSQNKRRFQEGGFDLDMTYITENI  153

Query  585   IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGK  764
             IAMGFPAGDMSSGFFGYVEGFYRNHMEEVI+FFET+HKDKYKVYNLCSERLYD SLFEGK
Sbjct  154   IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIRFFETNHKDKYKVYNLCSERLYDASLFEGK  213

Query  765   VASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKF  944
             VASFPFDDHNCPPI+LI+SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKF
Sbjct  214   VASFPFDDHNCPPIRLIISFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKF  273

Query  945   FPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHK  1124
             FPTAEESI+YYNQKRC+D KGLVLPSQIRYVKYFER L+YFNGENQP RRCMLRGFRLH 
Sbjct  274   FPTAEESIDYYNQKRCVDGKGLVLPSQIRYVKYFERALIYFNGENQPGRRCMLRGFRLHH  333

Query  1125  CPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAG  1304
             CPYW RPSIT+SDHNGVLFSTKKHPRTKDL PED+WFSAPKKGV+VFALPGE G+ ELAG
Sbjct  334   CPYWTRPSITVSDHNGVLFSTKKHPRTKDLSPEDFWFSAPKKGVMVFALPGESGLTELAG  393

Query  1305  DFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFP  1484
             DFKVHFNDRQGDFYCWLNTTMIENRK+L+T DLDGFDKRKLPSPGFQVEIVLVDY+   P
Sbjct  394   DFKVHFNDRQGDFYCWLNTTMIENRKLLSTGDLDGFDKRKLPSPGFQVEIVLVDYNGTAP  453

Query  1485  TRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETG  1664
              + QPE   +                            ++ SG+SE              
Sbjct  454   PKSQPETPTN--------------------------KQDESSGTSE--------------  473

Query  1665  KPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKH----NEQKRDT  1832
                      + +G  +K  T    T S Q++SL +  E+VSLG +  +H    NE ++DT
Sbjct  474   ---------SAEGATSKSKT----TNSDQVASLVKSTEKVSLGSTDTQHKHAINEPRKDT  520

Query  1833  TVGAAS-----VPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                AA      VP +S++E S FK MAADASVF+FGDEED++SE
Sbjct  521   VQQAADAADARVP-ISSSE-SQFKAMAADASVFSFGDEEDFDSE  562



>emb|CBI40281.3| unnamed protein product [Vitis vinifera]
Length=548

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/537 (72%), Positives = 435/537 (81%), Gaps = 11/537 (2%)
 Frame = +3

Query  174   QPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTS  353
             QPSV       N     A+D PS+LS+WAK+LKIPQ   G Q+E  +G  AKS FARFTS
Sbjct  20    QPSVATGSGPDNA----ARDAPSRLSSWAKNLKIPQSLAGGQDESPTGTTAKSSFARFTS  75

Query  354   GFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKR  530
             G G+  SPK+PT +D  +G+ TT Q    GTFTKG+VDSS+NAVKAV VKARHVVSQNKR
Sbjct  76    GIGLRLSPKTPTSEDGPDGSPTTAQPGLFGTFTKGIVDSSRNAVKAVQVKARHVVSQNKR  135

Query  531   RYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYK  710
             RYQEGGFDLD+TYITEN+IAMGFPAGDMSSGF GYVEGFYRNHMEEVIKFFETHHKDKYK
Sbjct  136   RYQEGGFDLDMTYITENIIAMGFPAGDMSSGFLGYVEGFYRNHMEEVIKFFETHHKDKYK  195

Query  711   VYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKA  890
             VYNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI  FCQSAYSWLKEDIENVVVVHCKA
Sbjct  196   VYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLITLFCQSAYSWLKEDIENVVVVHCKA  255

Query  891   GMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFN  1070
             GMARTGLMISSLLL+LKFFPTAEESI+YYNQKRC D KGLVLPSQIRYVKYFERIL YFN
Sbjct  256   GMARTGLMISSLLLFLKFFPTAEESIDYYNQKRCFDGKGLVLPSQIRYVKYFERILTYFN  315

Query  1071  GENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKK  1250
             GENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFSTKKHPRTKDL PE++WFSAPKK
Sbjct  316   GENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTKKHPRTKDLSPEEFWFSAPKK  375

Query  1251  GVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLP  1430
             G++VFALPGEPG+  LAGDFK+HF+DRQGDFYCWLNTTM+ENRK+LN  DLDGFDKRKLP
Sbjct  376   GIMVFALPGEPGLTPLAGDFKIHFHDRQGDFYCWLNTTMMENRKVLNPDDLDGFDKRKLP  435

Query  1431  SPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKS  1610
             SPGFQVE+VL+D+D + P  P+ E  V      + + + +   +       A  N ++  
Sbjct  436   SPGFQVEVVLIDHDGSVPPAPKTETDVKKSDGVSGTGSASVDGAN------ATPNPSKDP  489

Query  1611  GSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQ  1781
             GS +KDDVFSD E EE+G  K  +   A   V AK S+S   T   QI+S+T K EQ
Sbjct  490   GSKDKDDVFSDGEVEESGSSKSRQAQAAEGSVAAKTSSSETKTSPDQIASITHKTEQ  546



>ref|XP_003555950.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Glycine max]
 ref|XP_006605967.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Glycine max]
 gb|KHN42378.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Glycine soja]
Length=623

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/578 (70%), Positives = 471/578 (81%), Gaps = 12/578 (2%)
 Frame = +3

Query  237   PSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTST  416
             P+ +S+WAK+LKI QPF+G+Q++ +SGN  KS F+R TS FG+  SPKSP  D+S    T
Sbjct  51    PTGISSWAKNLKISQPFSGNQDDSSSGNVGKSTFSRITSNFGLRLSPKSPVADDS-SNET  109

Query  417   TPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMG  596
               QS+  GT TKGLVDSSKNAVKAV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMG
Sbjct  110   AGQSNLFGTITKGLVDSSKNAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMG  169

Query  597   FPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASF  776
             FPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYD SLFEGKVASF
Sbjct  170   FPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVASF  229

Query  777   PFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTA  956
             PFDDHNCPPIQLI+SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLL++LKFFPTA
Sbjct  230   PFDDHNCPPIQLIISFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLVFLKFFPTA  289

Query  957   EESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYW  1136
             EES++YYNQKRC+D KGLVLPSQIRYVKYFER+L YFNGEN PARRCMLRGFRL +CPYW
Sbjct  290   EESMDYYNQKRCVDGKGLVLPSQIRYVKYFERVLTYFNGENPPARRCMLRGFRLLRCPYW  349

Query  1137  IRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKV  1316
             IRPSIT+SDH+GVLFSTKKH RT++LLPED+WFSAPKKGV+VFALPGEPG+ ELAGDFK+
Sbjct  350   IRPSITVSDHSGVLFSTKKHLRTRELLPEDFWFSAPKKGVMVFALPGEPGLTELAGDFKI  409

Query  1317  HFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQ  1496
             HF+DRQGDFYCWLNTTM ENRK+LNTSDLDGFDKRKLPSPGF VE+VLVDY+        
Sbjct  410   HFHDRQGDFYCWLNTTMTENRKVLNTSDLDGFDKRKLPSPGFMVEVVLVDYNG---NDVT  466

Query  1497  PEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKV  1676
              +   ++K SD SS+N  + S+P         N++++S S +KDDVFSD EAE++   + 
Sbjct  467   SKTETTTKKSDESSSNNPASSAPVERSTTPAQNADKESDSHDKDDVFSDGEAEQSASSRS  526

Query  1677  GKVTVATDGVQA---KVSTSGNNTGSPQISSLTQKIEQVSLGDSG---LKHNEQKRDTTV  1838
              +    ++ V+        S +N  S +I++L+   EQVSLG+     ++H  +      
Sbjct  527   KQTKAPSEAVETVTNDTRISESNRVSNEIANLSHATEQVSLGNKSSTPIRHASEPGSNVD  586

Query  1839  G-AASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             G   S  EV + E S+FK MAADASVFTFGD+EDYES+
Sbjct  587   GKTVSSLEVPSAE-SEFKAMAADASVFTFGDDEDYESD  623



>gb|KEH44126.1| phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase [Medicago 
truncatula]
Length=621

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/625 (67%), Positives = 482/625 (77%), Gaps = 24/625 (4%)
 Frame = +3

Query  99    PPATFRTLVPSLSTMDTQLSNASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIP  278
             PP    ++ P     D Q S +        A+ + ++    P++  P+ +S+WAK+LKI 
Sbjct  13    PPVKVPSMTPPSKEDDGQTSAS-------IASGQDNSAREAPSKLSPTGISSWAKNLKIS  65

Query  279   QPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKG  455
             QPF+GSQ++ +SGNA KS FAR TS  GM  SPKSP  DDNS   +   QS+  GT TKG
Sbjct  66    QPFSGSQDDSSSGNAGKSAFARITSNLGMRLSPKSPVADDNSNELAA--QSNLFGTITKG  123

Query  456   LVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGY  635
             LVDSSKNAVKAV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGY
Sbjct  124   LVDSSKNAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGY  183

Query  636   VEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLI  815
             VEGFYRNHMEEVI+FFETHHK+KYKVYNLC ERLYD SLFEGKVASFPFDDHNCPPIQLI
Sbjct  184   VEGFYRNHMEEVIQFFETHHKNKYKVYNLCLERLYDASLFEGKVASFPFDDHNCPPIQLI  243

Query  816   MSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCM  995
             +SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLL+LKFFPTAEES++YYNQKRC+
Sbjct  244   ISFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLFLKFFPTAEESMDYYNQKRCV  303

Query  996   DAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGV  1175
             D KGLVLPSQIRYVKYFERIL YFNGE  P RRCMLRGFRLH+CPYWIRPSIT+SDH+GV
Sbjct  304   DGKGLVLPSQIRYVKYFERILTYFNGECPPPRRCMLRGFRLHRCPYWIRPSITVSDHSGV  363

Query  1176  LFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWL  1355
             LFSTKKHPRTKDLL ED+WF+APKKGV+VFALPGEPG+ ELAGDFK+HF+DRQGDFYCWL
Sbjct  364   LFSTKKHPRTKDLLSEDFWFAAPKKGVMVFALPGEPGLTELAGDFKIHFHDRQGDFYCWL  423

Query  1356  NTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdns  1535
             NTTM ENRKILNTSDLDGFDKRKLPSPGFQVE+VLVD++    T           +  + 
Sbjct  424   NTTMTENRKILNTSDLDGFDKRKLPSPGFQVEVVLVDHNGDVVTSKH------EVTKKSD  477

Query  1536  sanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTV---ATDGV  1706
              ++ AS +   ++  A +A+     G  +KDDVFSD EAE     +  +      A D V
Sbjct  478   ESSSASPAPVEASTPAPNADKESGDGDHDKDDVFSDGEAEHPASSRSKQTKAPSEAVDTV  537

Query  1707  QAKVSTSGNNTGSPQISSLTQKIEQVSLGD--SGLKHN--EQKRDTTVGAASVPEVSNTE  1874
              +    S  N  S QI+++T   EQVSLG   S   H+  E K DT    AS  +V ++E
Sbjct  538   ASNTKESEANKISNQITNITHATEQVSLGSKISMPSHSTGEPKSDTGGRTASSLDVPSSE  597

Query  1875  VSDFKIMAADASVFTFGDEEDYESE  1949
              S+FK MAADASVFTFGD+EDYES+
Sbjct  598   -SEFKAMAADASVFTFGDDEDYESD  621



>ref|XP_008454975.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Cucumis 
melo]
Length=612

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/629 (66%), Positives = 487/629 (77%), Gaps = 27/629 (4%)
 Frame = +3

Query  93    LSPPATFRTLVPSLSTMDTQLSNASNPQPSVTANMETSNV-NSVPAQDGPSKLSTWAKSL  269
             + P +T   + P++++ +T+     +PQ  VT  M  +NV    P++  PS L++WAK+L
Sbjct  1     MDPNSTDSPISPTVNSSETKPPEV-HPQAPVTPGM--NNVARDAPSKLSPSGLTSWAKNL  57

Query  270   KIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTF  446
             KI QP + SQ+     NA KS FARFTSG G+  SPKSP   D+ +G S   Q SF+G+ 
Sbjct  58    KISQPQSSSQDGATE-NAGKSAFARFTSGLGLNLSPKSPAPSDSPDGNSKPAQPSFVGSI  116

Query  447   TKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGF  626
             TKGLVDSSK+AVKAV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGF
Sbjct  117   TKGLVDSSKSAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGF  176

Query  627   FGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPI  806
             FGYVEGFYRNHMEEVIKFFETHHK KYKVYNLCSERLYD SLFEGKVA FPFDDHNCPP+
Sbjct  177   FGYVEGFYRNHMEEVIKFFETHHKGKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPV  236

Query  807   QLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQK  986
             QLI+SFCQSAYSWLK+DIENVVVVHCKAGMARTGLMISSLLL+LKFFPTAEESI YYNQ+
Sbjct  237   QLIISFCQSAYSWLKDDIENVVVVHCKAGMARTGLMISSLLLFLKFFPTAEESIEYYNQR  296

Query  987   RCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDH  1166
             RC D KGL+LPSQIRYVKYFERIL YFNGEN P+RRC+LRGFRLH+CPYWIRPSIT+SDH
Sbjct  297   RCFDGKGLILPSQIRYVKYFERILTYFNGENPPSRRCVLRGFRLHRCPYWIRPSITVSDH  356

Query  1167  NGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFY  1346
             NGVLFSTK HPRTK L PED+WF+APKKG++VFALPGEPG+AEL GDFKVHF+DRQGDFY
Sbjct  357   NGVLFSTKVHPRTKSLSPEDFWFTAPKKGIMVFALPGEPGLAELCGDFKVHFHDRQGDFY  416

Query  1347  CWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskss  1526
             CWLNTTM ENRK+L T+DLDGFDKRKLPSPGFQVE+VLVD      T P  +        
Sbjct  417   CWLNTTMTENRKMLYTNDLDGFDKRKLPSPGFQVEVVLVD------TSPNTDNTTKKSDE  470

Query  1527  dnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGV  1706
              + S  P +  S          N N+KSG+++KDDVFSD+E+E        + T  T   
Sbjct  471   SSGSKPPTADGSE------VSENQNRKSGTNDKDDVFSDSESEGGSSKSKKEATSGTGVE  524

Query  1707  QAKVSTSGNN----TGSPQISSLTQKIEQVSLGDSGLKH----NEQKRDTTVGAASVPEV  1862
              + V+T+  +    T S  ++SL+   +QVSLGD G K     +E+K D    + S+PEV
Sbjct  525   GSAVNTTTKSQTSMTSSDDVASLSHATKQVSLGDGGAKQTATASERKGDGVGRSDSLPEV  584

Query  1863  SNTEVSDFKIMAADASVFTFGDEEDYESE  1949
              N+E S+FK MAADASVFTFGD+EDYESE
Sbjct  585   PNSE-SEFKAMAADASVFTFGDDEDYESE  612



>gb|KCW63728.1| hypothetical protein EUGRSUZ_G01374 [Eucalyptus grandis]
Length=633

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/636 (64%), Positives = 478/636 (75%), Gaps = 44/636 (7%)
 Frame = +3

Query  141   MDTQLSNASNPQ-------PSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQ  299
             MD + ++AS P        PS T     S+      +   + +S+WAK+L+IPQ  + +Q
Sbjct  9     MDKESTDASIPAAANHVEPPSATDPAPDSSARDGSPRISAAGISSWAKNLRIPQSLSTAQ  68

Query  300   EEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNA  479
             ++  + N  KSPFARFTSG G+  SP+SP  + S G+ +  Q    GT TKGLVDSSK+A
Sbjct  69    DDSTTSNGGKSPFARFTSGLGLKLSPRSPPAEESIGSPSAAQPGLFGTITKGLVDSSKSA  128

Query  480   VKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNH  659
             VKAV V+ARHVVSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNH
Sbjct  129   VKAVQVRARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNH  188

Query  660   MEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAY  839
             MEEVIKFFET HKDKYKVYNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI+SFC+SAY
Sbjct  189   MEEVIKFFETQHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLIISFCKSAY  248

Query  840   SWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLP  1019
              WLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYNQKRC+D KGLVLP
Sbjct  249   GWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCVDGKGLVLP  308

Query  1020  SQIRYVKYFERILMYFNGENQPAR-----------------------RCMLRGFRLHKCP  1130
             SQIRYVKYFER+L YFNGENQP R                       RCMLRGFRLH+CP
Sbjct  309   SQIRYVKYFERVLTYFNGENQPGRRYVADPGYCFCGFPTDSEDQLFCRCMLRGFRLHRCP  368

Query  1131  YWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDF  1310
             YWIRPSIT+SDHNG+LF+TKKHPRTKDL PEDYWFSAPKKG++VFALPGEPG+ ELAGDF
Sbjct  369   YWIRPSITVSDHNGILFTTKKHPRTKDLSPEDYWFSAPKKGIMVFALPGEPGLTELAGDF  428

Query  1311  KVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTR  1490
             KVHF+DRQGDFYCWLNTT +ENRK+LNT+DLDGFDKRKLPSPGFQVEIV VDYD A PT 
Sbjct  429   KVHFHDRQGDFYCWLNTTFMENRKVLNTNDLDGFDKRKLPSPGFQVEIVQVDYDGAPPTP  488

Query  1491  PQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKP  1670
             P  ++  ++ S+ +     +  S+  ++D     + ++  GS++KDDVFSD+EAEE G  
Sbjct  489   PFAQSGTTTSSATSDPPPASVASTAATSDH----HESKVPGSNDKDDVFSDSEAEEAGSS  544

Query  1671  KVGKVTVAT---DGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVG  1841
             K  +   A+   + V +   TS N + + Q++++T+  EQVSLG+SG      K D    
Sbjct  545   KSKRRQPASSTGETVTSTTPTSENKSNADQVANVTRATEQVSLGNSGPA--PPKSDVISS  602

Query  1842  AASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                    S       K MAADASVFTFGDEEDYES+
Sbjct  603   TEFSTSESEF-----KAMAADASVFTFGDEEDYESD  633



>ref|XP_007143038.1| hypothetical protein PHAVU_007G038300g [Phaseolus vulgaris]
 gb|ESW15032.1| hypothetical protein PHAVU_007G038300g [Phaseolus vulgaris]
Length=621

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/584 (70%), Positives = 468/584 (80%), Gaps = 12/584 (2%)
 Frame = +3

Query  222   PAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNS  401
             P+   P  +S+WAKSLKI Q F+GSQ++ +SGN  KS FARFTS  G+  SPKSP  D S
Sbjct  42    PSVLSPPGISSWAKSLKISQSFSGSQDDSSSGNVGKSTFARFTSNLGLRMSPKSPVADES  101

Query  402   EGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITEN  581
                 T  QS+  G+ TKGLVD+SKNAVKAV VKARHVVSQNKRRYQEGGFDLD+TYITEN
Sbjct  102   -SNETAVQSNLFGSITKGLVDTSKNAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITEN  160

Query  582   VIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEG  761
             +IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET HKDKYKVYNLCSERLYD SLFEG
Sbjct  161   IIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETQHKDKYKVYNLCSERLYDASLFEG  220

Query  762   KVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLK  941
             KVASFPFDDHNCPPIQLI+SFCQSAYSWLK+DIENVVVVHCKAGMARTGLMISSLLL+LK
Sbjct  221   KVASFPFDDHNCPPIQLIISFCQSAYSWLKQDIENVVVVHCKAGMARTGLMISSLLLFLK  280

Query  942   FFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLH  1121
             FFPTAEES++YYNQKRC+D KGLVLPSQIRYVKYFER+L YFNGEN PARRCMLRGFRLH
Sbjct  281   FFPTAEESMDYYNQKRCVDGKGLVLPSQIRYVKYFERVLTYFNGENPPARRCMLRGFRLH  340

Query  1122  KCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELA  1301
             +CPYWIRPS+TISDH+GVLFSTKKHPRTK+LLPED+WFSAPKKGV+VFALPGEPG+ ELA
Sbjct  341   RCPYWIRPSVTISDHSGVLFSTKKHPRTKELLPEDFWFSAPKKGVMVFALPGEPGLTELA  400

Query  1302  GDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAF  1481
             GDFK+ F+DRQGDFYCWLNTTM ENRK+LNT DLDGFDKRKLPSPGF VEIVL DY+   
Sbjct  401   GDFKIQFHDRQGDFYCWLNTTMTENRKVLNTGDLDGFDKRKLPSPGFVVEIVLADYNGNV  460

Query  1482  PTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEET  1661
                 QPE   +     +S++         S   A +A    +S +++KDDVFSD EAE++
Sbjct  461   -VSSQPETTTTKSDESSSNSPAGPAPVERST-PAENAAKESESHNNDKDDVFSDGEAEQS  518

Query  1662  GKPKVGKVTVATDGVQ-AKVSTSGNNTG--SPQISSLTQKIEQVSLGD----SGLKHNEQ  1820
                K  +  V ++ V+  K  T G+++   S QI++L+   EQVSLG+    + + H  +
Sbjct  519   ASSKTKQTKVPSEAVETVKNDTRGSDSNRISNQIANLSHATEQVSLGNKNSSTSIHHASE  578

Query  1821  KRDTTVG-AASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
              R    G   S  EV + E S+FK MAADASVFTFGD+EDYES+
Sbjct  579   PRSNVDGKTVSSIEVPSAE-SEFKAMAADASVFTFGDDEDYESD  621



>ref|XP_004136966.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Cucumis 
sativus]
 gb|KGN43903.1| hypothetical protein Csa_7G073390 [Cucumis sativus]
Length=612

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/618 (66%), Positives = 474/618 (77%), Gaps = 24/618 (4%)
 Frame = +3

Query  126   PSLSTMDTQLSNASNPQPSVTANMETSNV-NSVPAQDGPSKLSTWAKSLKIPQPFTGSQE  302
             P  ST+++  +      P       T+NV    P++  PS +++WAK+LKI QP + SQ+
Sbjct  9     PISSTVNSSETKPPEVHPQAPVTTGTNNVARDAPSKLSPSGITSWAKNLKISQPQSASQD  68

Query  303   EENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSKNA  479
                  NA KS FARFTSG G+  SPKSP   D+ +G S   Q SF+G+ T+GLVDSSK+A
Sbjct  69    GATE-NAGKSAFARFTSGLGLNLSPKSPAPSDSPDGNSKPAQPSFVGSITRGLVDSSKSA  127

Query  480   VKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNH  659
             VKAV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNH
Sbjct  128   VKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNH  187

Query  660   MEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAY  839
             MEEVIKFFETHHK KYKVYNLCSERLYD SLFEGKVA FPFDDHNCPP+QLI+SFCQSAY
Sbjct  188   MEEVIKFFETHHKGKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPVQLIISFCQSAY  247

Query  840   SWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLP  1019
             SWLK+DIENVVVVHCKAGMARTGLMISSLLL+LKFFPTAEESI YYNQ+RC D KGL+LP
Sbjct  248   SWLKDDIENVVVVHCKAGMARTGLMISSLLLFLKFFPTAEESIEYYNQRRCFDGKGLILP  307

Query  1020  SQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHP  1199
             SQIRYVKYFERIL YFNGEN P+RRC+LRGFRLH+CPYWIRPSIT+SDHNGVLFSTK HP
Sbjct  308   SQIRYVKYFERILTYFNGENPPSRRCVLRGFRLHRCPYWIRPSITVSDHNGVLFSTKVHP  367

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENR  1379
             RTK L PED+WF+APKKG++VFALPGEPG+AEL GDFKVHF+DRQGDFYCWLNTTM ENR
Sbjct  368   RTKSLSPEDFWFTAPKKGIMVFALPGEPGLAELCGDFKVHFHDRQGDFYCWLNTTMTENR  427

Query  1380  KILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgs  1559
             K+L T+DLDGFDKRKLPSPGFQVE+VLVD      T P  +         + S  P +  
Sbjct  428   KMLYTNDLDGFDKRKLPSPGFQVEVVLVD------TSPNMDNTTKKSDESSGSKPPTADG  481

Query  1560  sphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVT----VATDGVQAKVSTS  1727
             S          N N+KSG+++KDDVFSD+E+E        + T    V    V     + 
Sbjct  482   SE------VSENQNRKSGTNDKDDVFSDSESEGGSSKSRKEATSGSGVEGSAVNPTTKSQ  535

Query  1728  GNNTGSPQISSLTQKIEQVSLGDSGLKH----NEQKRDTTVGAASVPEVSNTEVSDFKIM  1895
              + T S  ++SL+   +QVSLGD G K     +E+K D    + S+PEV N+E S+FK M
Sbjct  536   TSMTSSDNVASLSHATKQVSLGDGGAKQTATASERKGDGGGRSDSLPEVPNSE-SEFKAM  594

Query  1896  AADASVFTFGDEEDYESE  1949
             AADASVFTFGD+EDYESE
Sbjct  595   AADASVFTFGDDEDYESE  612



>ref|XP_008236566.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Prunus mume]
Length=612

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/619 (66%), Positives = 478/619 (77%), Gaps = 23/619 (4%)
 Frame = +3

Query  141   MDTQLSNASN------PQPSVTANMET-SNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQ  299
             MD++ +++S       PQ    A  ++ S+   VP +   S LS+WAK+LKIPQP   +Q
Sbjct  1     MDSESADSSTAPQTKAPQAQPPAATDSGSDSQDVPNKPFSSGLSSWAKNLKIPQPLAPTQ  60

Query  300   EEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSKN  476
             +   +GNA +SPFARFTSG G+  SPK+P+ D+ S G+ TT Q  FIGT TKG+ DSSK+
Sbjct  61    DSSTTGNAGQSPFARFTSGLGLRLSPKAPSADEGSSGSPTTQQPGFIGTITKGIADSSKS  120

Query  477   AVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRN  656
              VKAV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGF GYVEGFYRN
Sbjct  121   VVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFLGYVEGFYRN  180

Query  657   HMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSA  836
             HMEEVIKFFETHH+ KYKVYNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI  FC+SA
Sbjct  181   HMEEVIKFFETHHQGKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLITLFCRSA  240

Query  837   YSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVL  1016
             YSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYNQKRC+D KGL+L
Sbjct  241   YSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCIDGKGLIL  300

Query  1017  PSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKH  1196
             PSQIRYVKYFERIL YFNGEN P RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFSTK+H
Sbjct  301   PSQIRYVKYFERILTYFNGENPPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTKEH  360

Query  1197  PRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIEN  1376
             PRTK L PEDYWFSAPKKGV+VFALPGE G+ EL GDFK+HF+DRQGDFYCWLNTTM EN
Sbjct  361   PRTKGLSPEDYWFSAPKKGVMVFALPGELGLTELVGDFKIHFHDRQGDFYCWLNTTMTEN  420

Query  1377  RKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasg  1556
             RK+L  +DLDGFDKRKLPSPGFQVE+VLVDY+   PT P  E +       + +   +  
Sbjct  421   RKVLTNNDLDGFDKRKLPSPGFQVEVVLVDYNGNVPTTPNTETSTKKPDESSGTNPSSDD  480

Query  1557  ssphsaDEAADANSNQKSGSSEKDDVF--SDNEAEETGKPKVGKVTVATDG--VQAKVST  1724
                 +  E+      +  G+ +KDDVF  S+ E   + K +  + T AT G  V +  ++
Sbjct  481   GGTAAPQES------KSPGNQDKDDVFSDSEAEESSSSKSRQAEATSATAGGTVASTTTS  534

Query  1725  SGNNTGSPQISSLTQKIEQVSLG--DSGLKHNEQKRDTTVGAASVP--EVSNTEVSDFKI  1892
             S +NT   QI+SLT   +QVS+G  DS       +   +VG  +VP  E  N+E S+FK 
Sbjct  535   SESNTKPDQIASLTHATKQVSIGNVDSKQVPPASEPKGSVGGGNVPGLEAPNSE-SEFKA  593

Query  1893  MAADASVFTFGDEEDYESE  1949
             MAADASVFTFGD++DYESE
Sbjct  594   MAADASVFTFGDDDDYESE  612



>ref|XP_002883181.1| hypothetical protein ARALYDRAFT_479458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59440.1| hypothetical protein ARALYDRAFT_479458 [Arabidopsis lyrata subsp. 
lyrata]
Length=599

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/576 (68%), Positives = 455/576 (79%), Gaps = 22/576 (4%)
 Frame = +3

Query  246   LSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTSTTP  422
             +STWAK+LK+PQPF  +Q +    N  KS FA+FTSG G+  SPKSP  ++ +EGTS+  
Sbjct  38    ISTWAKNLKVPQPFASTQNDSGVENTEKSAFAKFTSGLGIRLSPKSPQPNETTEGTSSGT  97

Query  423   QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFP  602
             +SSFIGT TKGLVD+SKNAVKAV VKARH VSQNKRRYQEGGFDLDLTYITEN+IAMGFP
Sbjct  98    ESSFIGTITKGLVDTSKNAVKAVQVKARHAVSQNKRRYQEGGFDLDLTYITENIIAMGFP  157

Query  603   AGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPF  782
             AGDMSSGFFGYVEGFYRN MEEVI F ET HK KYKVYNLCSERLYDVSLFEGKVASFPF
Sbjct  158   AGDMSSGFFGYVEGFYRNQMEEVINFLETQHKGKYKVYNLCSERLYDVSLFEGKVASFPF  217

Query  783   DDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEE  962
             DDHNCPPI L+ SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMI SLLLYLKFFPTAEE
Sbjct  218   DDHNCPPIHLVTSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMICSLLLYLKFFPTAEE  277

Query  963   SINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIR  1142
              +++YNQKRC+D KGLVLPSQIRYVKYFERIL YFNGENQP RRCMLRGFRLH+CPYWIR
Sbjct  278   CMDFYNQKRCVDGKGLVLPSQIRYVKYFERILTYFNGENQPGRRCMLRGFRLHRCPYWIR  337

Query  1143  PSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHF  1322
             PSITISDHNGVLF+TKKHPRTKDL PED+WFSAPKKGV+VFALPGEPG+ ELAGDFK+HF
Sbjct  338   PSITISDHNGVLFTTKKHPRTKDLSPEDFWFSAPKKGVMVFALPGEPGLTELAGDFKIHF  397

Query  1323  NDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPE  1502
             +DRQGDFYCWLNTTM+ENR IL TS+LDGF+KRKLPSPGF VE+VL D +   PT P  E
Sbjct  398   HDRQGDFYCWLNTTMMENRVILKTSELDGFEKRKLPSPGFMVEVVLADINATIPTNPSSE  457

Query  1503  aavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGK  1682
              A  +    +++ +     S      A+    N+++   +KDDVFSDNE + TG P    
Sbjct  458   TASKTPEETSAANSSPVDGS------ASVPGPNKETEDPDKDDVFSDNEGDATG-PTKTT  510

Query  1683  VTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSL-GDSGLKHNEQKRDTTVGAAS---  1850
              + ++   +AK S         + S+LT+  E+VS+ G+ G     Q    + G A+   
Sbjct  511   SSASSQTPEAKQSAD-------ETSALTKATEKVSISGNKGSSQPVQGGTVSKGEATEKP  563

Query  1851  ---VPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                V   S++  S+FK+MAADASVF+FGDE+D+ES+
Sbjct  564   SGAVVNASSSSESEFKVMAADASVFSFGDEDDFESD  599



>ref|XP_007201726.1| hypothetical protein PRUPE_ppa003014mg [Prunus persica]
 gb|EMJ02925.1| hypothetical protein PRUPE_ppa003014mg [Prunus persica]
Length=612

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/619 (66%), Positives = 475/619 (77%), Gaps = 23/619 (4%)
 Frame = +3

Query  141   MDTQLSNASN------PQPSVTANMET-SNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQ  299
             MD++ +++S       PQ    A  ++ S+   VP +   S LS+WAK+LKIPQP   +Q
Sbjct  1     MDSESADSSTAPQTKAPQAQPPAATDSGSDSQDVPNKPFSSGLSSWAKNLKIPQPLAPTQ  60

Query  300   EEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSKN  476
             +   +GNA +SPFARFTSG G+  SPK+P+ D+ S G+ TT Q  FIGT TKG+ DSSK+
Sbjct  61    DSSTTGNAGQSPFARFTSGLGLRLSPKAPSADEGSSGSPTTQQPGFIGTITKGIADSSKS  120

Query  477   AVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRN  656
              VKAV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGF GYVEGFYRN
Sbjct  121   VVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFLGYVEGFYRN  180

Query  657   HMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSA  836
             HMEEVIKFFETHH+ KYKVYNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI  FC+SA
Sbjct  181   HMEEVIKFFETHHQGKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLITLFCRSA  240

Query  837   YSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVL  1016
             YSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYNQKRC+D KGLVL
Sbjct  241   YSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCIDGKGLVL  300

Query  1017  PSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKH  1196
             PSQIRYVKYFERIL YFNGEN P RRCMLRGFRLH+CPYWIRPSIT+ DHNGVLFSTK+H
Sbjct  301   PSQIRYVKYFERILTYFNGENPPGRRCMLRGFRLHRCPYWIRPSITVFDHNGVLFSTKEH  360

Query  1197  PRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIEN  1376
             PRTK L PEDYWFSAPKKGV+VFALPGE G+ EL GDFK+HF+DRQGDFYCWLNTTM EN
Sbjct  361   PRTKGLSPEDYWFSAPKKGVMVFALPGELGLTELVGDFKIHFHDRQGDFYCWLNTTMTEN  420

Query  1377  RKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasg  1556
             RK+L  +DLDGFDKRKLPSPGFQVE+VLVDY+   PT P  E +       + +   +  
Sbjct  421   RKVLTNNDLDGFDKRKLPSPGFQVEVVLVDYNGNVPTAPNTETSTKKPDESSGTNPSSDD  480

Query  1557  ssphsaDEAADANSNQKSGSSEKDDVF--SDNEAEETGKPKVGKVT-VATDGVQAKVSTS  1727
                 +  E+      +  G+ +KDDVF  S+ E   + K + G+ T  A  G  A  +TS
Sbjct  481   GGTAAPQES------KSPGNQDKDDVFSDSEAEESSSSKSRQGEATSAAAGGTVASTTTS  534

Query  1728  GNNTGSP-QISSLTQKIEQVSLG--DSGLKHNEQKRDTTVGAASVP--EVSNTEVSDFKI  1892
               +   P QI+SLT   +QVS+G  DS       +   +VG  +VP  E  N+E S+FK 
Sbjct  535   SESNTKPDQIASLTHATKQVSIGNVDSKQVPAASEPKGSVGGGNVPGLEAPNSE-SEFKA  593

Query  1893  MAADASVFTFGDEEDYESE  1949
             MAADASVFTFGD++DYESE
Sbjct  594   MAADASVFTFGDDDDYESE  612



>ref|XP_008342945.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Malus domestica]
 ref|XP_008342946.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Malus domestica]
Length=612

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/609 (69%), Positives = 473/609 (78%), Gaps = 23/609 (4%)
 Frame = +3

Query  159   NASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPF  338
             NA   QP   A    S+ +  P +   S LS+WAK+LK+ QP   +Q+   SGN+ +S F
Sbjct  15    NAPESQPP-PATDSGSDSHGAPTKQS-SGLSSWAKNLKLHQPLAPTQDXSQSGNSGQSSF  72

Query  339   ARFTSGFGMLSSPKSP-TDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVV  515
             +RFTSG G+  SPK+P +DD S  + TT Q  FIGT TKG+VDSSK+AVKAV VKARHVV
Sbjct  73    SRFTSGLGLRLSPKAPPSDDISNESPTTLQPGFIGTITKGIVDSSKSAVKAVQVKARHVV  132

Query  516   SQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHH  695
             SQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET H
Sbjct  133   SQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETXH  192

Query  696   KDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVV  875
             KDKYKVYNLCSERLYD SLFEGKVASFPFDDHNCPPI LI  FC+SAY+WLKEDIENVVV
Sbjct  193   KDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIHLITLFCRSAYAWLKEDIENVVV  252

Query  876   VHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERI  1055
             VHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYNQKRC D KGLVLPSQIRYVKYFERI
Sbjct  253   VHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCFDGKGLVLPSQIRYVKYFERI  312

Query  1056  LMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWF  1235
             L YFNGEN P RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFSTK+HPRTK L PEDYWF
Sbjct  313   LTYFNGENPPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTKEHPRTKGLSPEDYWF  372

Query  1236  SAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFD  1415
             SAPKKGV+VFALPGE G+ EL GDFKVHF+DRQGDFYCWLNTTM ENRK+L  +DLDGFD
Sbjct  373   SAPKKGVMVFALPGELGLTELVGDFKVHFHDRQGDFYCWLNTTMTENRKVLTNNDLDGFD  432

Query  1416  KRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADAN  1595
             KRKLPSPGFQVE+VLVDY    PT P  E         ++     S  +  S+DE   A 
Sbjct  433   KRKLPSPGFQVEVVLVDYSGNVPTTPNTE--------TSAKKPDESSGTKPSSDEGGAAA  484

Query  1596  SNQKS---GSSEKDDVFSDNEAEETG--KPKVGKVTVATDGVQ-AKVSTSGNNTGSP-QI  1754
             + Q+S   GS +KDDVFSD+EAEE G  K +  + T    GV  A  STS  +   P QI
Sbjct  485   APQESKSPGSQDKDDVFSDSEAEEGGSAKSRQAEATSPPTGVPVASTSTSSESDTKPDQI  544

Query  1755  SSLTQKIEQVSLGDS----GLKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTF  1922
             SSLT   +QVS+G++    G   +E K   + G A   E S+TE S+FK MAADASVF+F
Sbjct  545   SSLTNVTKQVSIGNTDSKQGAAASEPKSSVSGGNAPGLEASSTE-SEFKAMAADASVFSF  603

Query  1923  GDEEDYESE  1949
             GD+ED ESE
Sbjct  604   GDDEDSESE  612



>ref|XP_004159902.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Cucumis 
sativus]
Length=612

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/618 (66%), Positives = 474/618 (77%), Gaps = 24/618 (4%)
 Frame = +3

Query  126   PSLSTMDTQLSNASNPQPSVTANMETSNV-NSVPAQDGPSKLSTWAKSLKIPQPFTGSQE  302
             P  ST+++  +      P       T+NV    P++  PS +++WAK+LKI QP + SQ+
Sbjct  9     PISSTVNSSETKPPEVHPQAPVTTGTNNVARDAPSKLSPSGITSWAKNLKISQPQSASQD  68

Query  303   EENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSKNA  479
                  NA KS FARFTSG G+  SPKSP   D+ +G S   Q SF+G+ T+GLVDSSK+A
Sbjct  69    GATE-NAGKSAFARFTSGLGLNLSPKSPAPSDSPDGNSKPAQPSFVGSITRGLVDSSKSA  127

Query  480   VKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNH  659
             VKAV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNH
Sbjct  128   VKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNH  187

Query  660   MEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAY  839
             MEEVIKFFETHHK KYKVYNLCSERLYD SLFEGKVA FPFDDHNCPP+QLI+SFCQSAY
Sbjct  188   MEEVIKFFETHHKGKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPVQLIISFCQSAY  247

Query  840   SWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLP  1019
             SWLK+DIENVVVVHCKAGMARTGLMISSLLL+LKFFPTAEESI YYNQ+RC D KGL+LP
Sbjct  248   SWLKDDIENVVVVHCKAGMARTGLMISSLLLFLKFFPTAEESIEYYNQRRCFDGKGLILP  307

Query  1020  SQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHP  1199
             SQIRYVKYFERIL YFNGEN P+RRC+LRGFRLH+CPYWIRPSIT+SDHNGVLFSTK HP
Sbjct  308   SQIRYVKYFERILTYFNGENPPSRRCVLRGFRLHRCPYWIRPSITVSDHNGVLFSTKVHP  367

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENR  1379
             RTK L PED+WF+APKKG++VFALPGEPG+AEL GDFKVHF+DRQGDFYCWLNTTM ENR
Sbjct  368   RTKSLSPEDFWFTAPKKGIMVFALPGEPGLAELCGDFKVHFHDRQGDFYCWLNTTMTENR  427

Query  1380  KILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgs  1559
             K+L T+DLDGFDKRKLPSPGFQVE+VLVD      T P  +         + S  P +  
Sbjct  428   KMLYTNDLDGFDKRKLPSPGFQVEVVLVD------TSPNMDNTTKKSDESSGSKPPTADG  481

Query  1560  sphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVT----VATDGVQAKVSTS  1727
             S          N N+KSG+++KDDVFSD+E+E        + T    V    V     + 
Sbjct  482   SE------VSENQNRKSGTNDKDDVFSDSESEGGSSKSRKEATSGSGVEGSAVNPTTKSQ  535

Query  1728  GNNTGSPQISSLTQKIEQVSLGDSGLKH----NEQKRDTTVGAASVPEVSNTEVSDFKIM  1895
              + T S  ++SL+   +QVSLGD G K     +E+K D    + S+PEV N+E S+FK M
Sbjct  536   TSTTSSDNVASLSHATKQVSLGDGGAKQTATASERKGDGGGRSDSLPEVPNSE-SEFKAM  594

Query  1896  AADASVFTFGDEEDYESE  1949
             AADASVFTFGD+EDYESE
Sbjct  595   AADASVFTFGDDEDYESE  612



>gb|AAO13749.1|AF268257_1 PTEN-like protein [Arabidopsis thaliana]
Length=611

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/589 (67%), Positives = 450/589 (76%), Gaps = 47/589 (8%)
 Frame = +3

Query  246   LSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSP--TDDNSEGTSTT  419
             +S WAK+LK+PQPF  +Q +    N  KS FA+FTSG G+  SPKSP   D  +EGTS+ 
Sbjct  49    ISNWAKNLKVPQPFASTQNDSGVENTEKSAFAKFTSGLGIRLSPKSPQTNDTTTEGTSSA  108

Query  420   PQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGF  599
              +SSFIGT TKGLVD+SKNAVKAV VKARH VSQNKRRYQEGGFDLDLTYITEN+IAMGF
Sbjct  109   TESSFIGTITKGLVDTSKNAVKAVQVKARHAVSQNKRRYQEGGFDLDLTYITENIIAMGF  168

Query  600   PAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFP  779
             PAGDMSSGFFGYVEGFYRN MEEVI F ET HK KYKVYNLCSERLYDVSLFEGKVASFP
Sbjct  169   PAGDMSSGFFGYVEGFYRNQMEEVINFLETQHKGKYKVYNLCSERLYDVSLFEGKVASFP  228

Query  780   FDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAE  959
             FDDHNCPPI L+ SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMI SLLLYLKFFPTAE
Sbjct  229   FDDHNCPPIHLVTSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMICSLLLYLKFFPTAE  288

Query  960   ESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWI  1139
             E +++YNQKRC+D KGLVLPSQIRYVKYFERIL YFNGENQP RRCMLRGFRLH+CPYWI
Sbjct  289   ECMDFYNQKRCVDGKGLVLPSQIRYVKYFERILTYFNGENQPGRRCMLRGFRLHRCPYWI  348

Query  1140  RPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVH  1319
             RPSITISDHNGVLF+TKKHPRTKDL PED+WFSAPKKGV+VFALPGEPG+ ELAGDFK+ 
Sbjct  349   RPSITISDHNGVLFTTKKHPRTKDLSPEDFWFSAPKKGVMVFALPGEPGLTELAGDFKIQ  408

Query  1320  FNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQP  1499
             F+DRQGDFYCWLNTTM+ENR IL TS+LDGFDKRKLPSPGF VE+VL D +   PT P  
Sbjct  409   FHDRQGDFYCWLNTTMMENRVILKTSELDGFDKRKLPSPGFMVEVVLADINATIPTNPSS  468

Query  1500  EaavsskssdnssanpasgssphsaDEAADANSNQKSGSS------------EKDDVFSD  1643
             E                  ++  + +E + ANS+   GS+            +KDDVFSD
Sbjct  469   E------------------TASKTPEETSAANSSPVDGSASVPGPDKETENPDKDDVFSD  510

Query  1644  NEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSL-GDSGLKHNEQ  1820
             NE + TG P     + ++   +AK S         + + LT+  E+VS+ G+ G     Q
Sbjct  511   NEGDSTG-PTKTTSSASSQTPEAKKSAD-------ETAVLTKATEKVSISGNKGSSQPVQ  562

Query  1821  KRDTTVGAASVP------EVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                 + G A+          S++  S+FK+MAADASVF+FGDE+D+ES+
Sbjct  563   GVTVSKGEATEKPSGAGVNASSSSESEFKVMAADASVFSFGDEDDFESD  611



>ref|NP_188573.1| phosphatase PTEN2 [Arabidopsis thaliana]
 dbj|BAB02466.1| tyrosine phosphatase-like protein [Arabidopsis thaliana]
 gb|AAL49799.1| putative tyrosine phosphatase [Arabidopsis thaliana]
 gb|AEE76238.1| protein phosphatase and tensin homolog deleted on chromosome 
ten 2A [Arabidopsis thaliana]
Length=611

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/589 (67%), Positives = 450/589 (76%), Gaps = 47/589 (8%)
 Frame = +3

Query  246   LSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSP--TDDNSEGTSTT  419
             +S WAK+LK+PQPF  +Q +    N  KS FA+FTSG G+  SPKSP   D  +EGTS+ 
Sbjct  49    ISNWAKNLKVPQPFASTQNDSGVENTEKSAFAKFTSGLGIRLSPKSPQTNDTTTEGTSSA  108

Query  420   PQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGF  599
              +SSFIGT TKGLVD+SKNAVKAV VKARH VSQNKRRYQEGGFDLDLTYITEN+IAMGF
Sbjct  109   TESSFIGTITKGLVDTSKNAVKAVQVKARHAVSQNKRRYQEGGFDLDLTYITENIIAMGF  168

Query  600   PAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFP  779
             PAGDMSSGFFGYVEGFYRN MEEVI F ET HK KYKVYNLCSERLYDVSLFEGKVASFP
Sbjct  169   PAGDMSSGFFGYVEGFYRNQMEEVINFLETQHKGKYKVYNLCSERLYDVSLFEGKVASFP  228

Query  780   FDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAE  959
             FDDHNCPPI L+ SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMI SLLLYLKFFPTAE
Sbjct  229   FDDHNCPPIHLVTSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMICSLLLYLKFFPTAE  288

Query  960   ESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWI  1139
             E +++YNQKRC+D KGLVLPSQIRYVKYFERIL YFNGENQP RRCMLRGFRLH+CPYWI
Sbjct  289   ECMDFYNQKRCVDGKGLVLPSQIRYVKYFERILTYFNGENQPGRRCMLRGFRLHRCPYWI  348

Query  1140  RPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVH  1319
             RPSITISDHNGVLF+TKKHPRTKDL PED+WFSAPKKGV+VFALPGEPG+ ELAGDFK+ 
Sbjct  349   RPSITISDHNGVLFTTKKHPRTKDLSPEDFWFSAPKKGVMVFALPGEPGLTELAGDFKIQ  408

Query  1320  FNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQP  1499
             F+DRQGDFYCWLNTTM+ENR IL TS+LDGFDKRKLPSPGF VE+VL D +   PT P  
Sbjct  409   FHDRQGDFYCWLNTTMMENRVILKTSELDGFDKRKLPSPGFMVEVVLADINATIPTNPSS  468

Query  1500  EaavsskssdnssanpasgssphsaDEAADANSNQKSGSS------------EKDDVFSD  1643
             E                  ++  + +E + ANS+   GS+            +KDDVFSD
Sbjct  469   E------------------TASKTPEETSAANSSPVDGSASVPGPDKETENPDKDDVFSD  510

Query  1644  NEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSL-GDSGLKHNEQ  1820
             NE + TG P     + ++   +AK S         + + LT+  E+VS+ G+ G     Q
Sbjct  511   NEGDSTG-PTKTTSSASSQTPEAKKSAD-------ETAVLTKATEKVSISGNKGSSQPVQ  562

Query  1821  KRDTTVGAASVP------EVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                 + G A+          S++  S+FK+MAADASVF+FGDE+D+ES+
Sbjct  563   GVTVSKGEATEKPSGAGVNASSSSESEFKVMAADASVFSFGDEDDFESD  611



>emb|CDX95448.1| BnaC01g33400D [Brassica napus]
Length=592

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/607 (66%), Positives = 457/607 (75%), Gaps = 44/607 (7%)
 Frame = +3

Query  171   PQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFT  350
             P  +V A     +   V ++   S +STWAKSLK+PQPF+ ++ + +  N  KS FA+FT
Sbjct  16    PPAAVEAGTTDDSPKGVASKLSASGISTWAKSLKVPQPFSSARTDSDVENNEKSAFAKFT  75

Query  351   SGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNK  527
             SG G+  SPKSP  D+  EGTS   Q  FIGT TKGLVD+SKNAVKAV VKARH VSQNK
Sbjct  76    SGLGLRLSPKSPQPDETGEGTS---QPGFIGTITKGLVDTSKNAVKAVQVKARHAVSQNK  132

Query  528   RRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKY  707
             RRYQEGGFDLDLTYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVI F ET HK KY
Sbjct  133   RRYQEGGFDLDLTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVINFLETQHKGKY  192

Query  708   KVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCK  887
             KVYNLCSERLYDVSLFEGKVASFPFDDHNCPPI LI SFCQSAYSWLKEDIENVV VHCK
Sbjct  193   KVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIHLITSFCQSAYSWLKEDIENVVAVHCK  252

Query  888   AGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYF  1067
             AGMARTGLMI SLLLYLKFFPTAEE +++YNQKRC+DAKGLVLPSQIRYVKYFERIL YF
Sbjct  253   AGMARTGLMICSLLLYLKFFPTAEECMDFYNQKRCVDAKGLVLPSQIRYVKYFERILTYF  312

Query  1068  NGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPK  1247
             NGENQP R+CMLRGFRLH+CPYWIRPSITISDHNGVLF+TKKHPRTKDL PED+WFSAPK
Sbjct  313   NGENQPGRKCMLRGFRLHRCPYWIRPSITISDHNGVLFTTKKHPRTKDLSPEDFWFSAPK  372

Query  1248  KGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKL  1427
             KGV+VFALPGEPG+ ELAGDFK+HF+  QGDFYCW+NTTM+ENR IL TS+LDGFDKRKL
Sbjct  373   KGVMVFALPGEPGLTELAGDFKIHFHANQGDFYCWMNTTMMENRVILKTSELDGFDKRKL  432

Query  1428  PSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANS---  1598
             PSPGF VE+VL D DT     P  E                   +  + +E + ANS   
Sbjct  433   PSPGFMVEVVLADIDTTIAANPSSE------------------PASKAPEETSGANSSPA  474

Query  1599  ---------NQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQ  1751
                      N+++ + +KDDVFSDNE E TG  K    + ++   +AK S         +
Sbjct  475   EGVTPVPGPNKETENPDKDDVFSDNETESTGATKT-TPSASSQNPEAKHSAD-------E  526

Query  1752  ISSLTQKIEQVSL-GDSGLKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGD  1928
              S+L    ++V+L G+ G      K + T     V   S++E S+FK+MAADASVF+FGD
Sbjct  527   TSALASATKKVTLSGNKGPSQPVSKAEATEKPTGV-NASSSESSEFKVMAADASVFSFGD  585

Query  1929  EEDYESE  1949
             E+DYES+
Sbjct  586   EDDYESD  592



>ref|XP_004304029.1| PREDICTED: cyclin-G-associated kinase-like [Fragaria vesca subsp. 
vesca]
Length=617

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/593 (68%), Positives = 454/593 (77%), Gaps = 26/593 (4%)
 Frame = +3

Query  225   AQDGPSKLST-----WAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPT  389
             +++ PSKLST     WAK+LKIPQP   SQ+      + +S FARFTSG G+  SPK+P 
Sbjct  33    SREAPSKLSTSGLTSWAKNLKIPQPMAPSQDSPT--GSGQSSFARFTSGLGLRLSPKAPV  90

Query  390   -DDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLT  566
              DD+  G+S   Q     T TKG+VDSSK+AVKAV VKARHVVSQNKRRYQEGGFDLD+T
Sbjct  91    EDDDPSGSSKAMQPGIFDTITKGIVDSSKSAVKAVQVKARHVVSQNKRRYQEGGFDLDMT  150

Query  567   YITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDV  746
             YITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHK KYKVYNLCSERLYD 
Sbjct  151   YITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKGKYKVYNLCSERLYDA  210

Query  747   SLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSL  926
             SLFEGKVASFPFDDHNCPPI LI  FC+SAYSWLKEDIENVVVVHCKAGMARTGLMISSL
Sbjct  211   SLFEGKVASFPFDDHNCPPIHLISLFCRSAYSWLKEDIENVVVVHCKAGMARTGLMISSL  270

Query  927   LLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLR  1106
             LLYLKFFPTAEESI+YYNQKRC D KGLVLPSQIRYVKYFERIL YFNGE  P RRCMLR
Sbjct  271   LLYLKFFPTAEESIDYYNQKRCFDGKGLVLPSQIRYVKYFERILTYFNGETPPGRRCMLR  330

Query  1107  GFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPG  1286
             GFRLH+CPYW+RP+IT+SDHNGVLFSTK HPRTK L PED+WFSAPKKGV+VFALPGE G
Sbjct  331   GFRLHRCPYWVRPTITVSDHNGVLFSTKDHPRTKGLSPEDFWFSAPKKGVMVFALPGELG  390

Query  1287  VAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVD  1466
             + EL GDFK+HF+DRQGDFYCWLNTTM ENRK L T+DLDGFDKRKLPSPGFQ+E+VLVD
Sbjct  391   LTELVGDFKIHFHDRQGDFYCWLNTTMTENRKTLTTNDLDGFDKRKLPSPGFQLEVVLVD  450

Query  1467  YDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSG-----SSEKDD  1631
             Y+   P  P P       +   +     S  +   +D++A A ++  S      S +KDD
Sbjct  451   YNGNVPATPTPN------TDTTAKKPDESSGTKPPSDDSAAATADPPSHHANPESQDKDD  504

Query  1632  VFSDNEAEETGKPKVGKV---TVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSG  1802
             VFSDNE +ETG  KV +    + A   V +   +S + T S Q++SL Q  +QVS+G + 
Sbjct  505   VFSDNELDETGSSKVQRAEGTSPAGGTVASTTFSSSSTTKSDQVASLMQATKQVSIGSTD  564

Query  1803  LKHNEQKRDTTVGAASVPEVSNTEV----SDFKIMAADASVFTFGDEEDYESE  1949
              K      D    AA V  V   E     S+FK MAADASVFTFGDEEDYESE
Sbjct  565   SKQVPAASDDPKSAAVVGNVPGLETQNPESEFKAMAADASVFTFGDEEDYESE  617



>ref|XP_010487885.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Camelina 
sativa]
Length=617

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/603 (66%), Positives = 462/603 (77%), Gaps = 28/603 (5%)
 Frame = +3

Query  177   PSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSG  356
             P+V      ++   V ++   S +STWAK+LK+PQPF  +  +       KS FA+FTSG
Sbjct  31    PAVVEAGSDNSPKGVASKLSASGISTWAKNLKVPQPFASTHNDSAVETNEKSAFAKFTSG  90

Query  357   FGMLSSPKSPT-DDNSEGTSTTP-QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKR  530
              G+  SPKSP  ++ ++GTS+T  +SSFIGT TKGLVD+SKNAVKAV VKARH VSQNKR
Sbjct  91    LGLRLSPKSPQPNETTDGTSSTATESSFIGTITKGLVDTSKNAVKAVQVKARHAVSQNKR  150

Query  531   RYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYK  710
             RYQEGGFDLDLTYITEN+IAMGFPAGDMSSGFFGYVEGFYRN MEEVI F ET HK KYK
Sbjct  151   RYQEGGFDLDLTYITENIIAMGFPAGDMSSGFFGYVEGFYRNQMEEVINFLETQHKAKYK  210

Query  711   VYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKA  890
             VYNLCSERLYDVSLFEGKVASFPFDDHNCPPI LI SFCQSAYSWLKEDIENVVVVHCKA
Sbjct  211   VYNLCSERLYDVSLFEGKVASFPFDDHNCPPIHLITSFCQSAYSWLKEDIENVVVVHCKA  270

Query  891   GMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFN  1070
             GMARTGLMI SLLLYLKFFPTAEE +++YNQKRC+D KGLVLPSQIRYVKYFERIL YFN
Sbjct  271   GMARTGLMICSLLLYLKFFPTAEECMDFYNQKRCVDGKGLVLPSQIRYVKYFERILTYFN  330

Query  1071  GENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKK  1250
             GENQP RRCMLRGFRLH+CPYWIRPSITISDHNGVLF+TKKHPRTKDL PED+WFSAPKK
Sbjct  331   GENQPGRRCMLRGFRLHRCPYWIRPSITISDHNGVLFTTKKHPRTKDLSPEDFWFSAPKK  390

Query  1251  GVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLP  1430
             GV+VFALPGEPG+ ELAGDFK+HF+DRQGDFYCWLNTTM+ENR IL TS+LD FDKRKLP
Sbjct  391   GVMVFALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTMMENRVILKTSELDAFDKRKLP  450

Query  1431  SPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKS  1610
             SPGF VE+VL D +   PT P  E      ++  +     + ++      A+    N+++
Sbjct  451   SPGFMVEVVLADINATIPTNPSSE------TASTTPEETPAANASPVDGSASVPGPNKET  504

Query  1611  GSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSL  1790
              + +KDDVFSDNE + TG P     + ++   +AK S         + S L +  E+VSL
Sbjct  505   ENPDKDDVFSDNEGDSTG-PTKTTSSASSQTPEAKRSAD-------ETSVLAKATEKVSL  556

Query  1791  GDSGLKHNEQ--KRDTTVGAASVPEV--------SNTEVSDFKIMAADASVFTFGDEEDY  1940
               SG K + Q  +  TTV  A   E         S++  S+FK+MAADASVF+FGDE+D+
Sbjct  557   --SGNKGSSQPVQGGTTVSKAEATEKPSGAGVNPSSSSESEFKVMAADASVFSFGDEDDF  614

Query  1941  ESE  1949
             ES+
Sbjct  615   ESD  617



>ref|XP_010519293.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Tarenaya 
hassleriana]
 ref|XP_010519294.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Tarenaya 
hassleriana]
 ref|XP_010519295.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Tarenaya 
hassleriana]
Length=585

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/573 (68%), Positives = 451/573 (79%), Gaps = 23/573 (4%)
 Frame = +3

Query  240   SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTT  419
             S LS+WA++LK+PQPF+  + +    +  KS FARFTSG G+  SPKS +DD+S+G S  
Sbjct  33    SGLSSWARNLKVPQPFSSMRNDSEVESMEKSTFARFTSGLGLRLSPKSQSDDSSDGASNA  92

Query  420   PQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGF  599
              Q  FIGT TKGLVDSS +AVKAV VKARH VSQNKRRYQEGGFDLDLTYITEN+IAMGF
Sbjct  93    AQFGFIGTITKGLVDSSMSAVKAVQVKARHAVSQNKRRYQEGGFDLDLTYITENIIAMGF  152

Query  600   PAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFP  779
             PAGDMSSGFFGYVEG YRNHMEEVIKF ET H+ KYKVYNLCSERLYDVSLFEGKVASFP
Sbjct  153   PAGDMSSGFFGYVEGLYRNHMEEVIKFLETRHQGKYKVYNLCSERLYDVSLFEGKVASFP  212

Query  780   FDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAE  959
             FDDHNCPP+ LI SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAE
Sbjct  213   FDDHNCPPVHLISSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAE  272

Query  960   ESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWI  1139
             E +++YNQKRC+D KGLVLPSQIRYVKYFERIL YFNGENQP RR MLRGFRLH+CPYW+
Sbjct  273   ECMDFYNQKRCVDGKGLVLPSQIRYVKYFERILTYFNGENQPGRRSMLRGFRLHRCPYWV  332

Query  1140  RPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVH  1319
             RPSIT+SDHNGVLFSTKKH RTKDL PED+WFSAPKKG++VFALPGEPG+ ELAGDFKVH
Sbjct  333   RPSITVSDHNGVLFSTKKHTRTKDLSPEDFWFSAPKKGIMVFALPGEPGLTELAGDFKVH  392

Query  1320  FNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFP-TRPQ  1496
             F+DRQGDFYCWLNT M+ENRKILNT DLDGFDKRKLPSPGFQ+E+VL D  +  P T P+
Sbjct  393   FHDRQGDFYCWLNTGMMENRKILNTDDLDGFDKRKLPSPGFQIEVVLADICSTSPATTPR  452

Query  1497  PEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKV  1676
              +    +    +S+  P            AD  S +++G+S KDDVFSD+E  +      
Sbjct  453   SQTKTETPKETSSNCPPVENIE-------ADPESKKETGNSNKDDVFSDSEHRKRHSGSC  505

Query  1677  GKVTVATDGVQAKVSTSGNNTGSP-QISSLTQKIEQVSL-GDSGLKHNEQKRDTTVGAAS  1850
             G            ++ +  +  SP Q+S +TQ  E VS+ G  G     +K+ +++ AA 
Sbjct  506   GPSET------PPITQTTESKRSPDQVSKVTQAFENVSISGIPGNAEAAEKKTSSLDAA-  558

Query  1851  VPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                  N+E S+FK+MAADASVFTFGDEE+YESE
Sbjct  559   -----NSE-SEFKVMAADASVFTFGDEEEYESE  585



>ref|XP_010507715.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Camelina 
sativa]
 ref|XP_010507720.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Camelina 
sativa]
 ref|XP_010507725.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Camelina 
sativa]
Length=619

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/582 (68%), Positives = 454/582 (78%), Gaps = 28/582 (5%)
 Frame = +3

Query  240   SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTST  416
             S +STWAK+LK+PQPF  +  +       KS FA+FTSG G+  SPKSP  ++ +EGTS+
Sbjct  54    SGISTWAKNLKVPQPFASTHNDSAVETNEKSAFAKFTSGLGLRLSPKSPQPNEATEGTSS  113

Query  417   TP-QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAM  593
             +  +SSF+GT TKGLVD+SKNAVKAV VKARH VSQNKRRYQEGGFDLDLTYITEN+IAM
Sbjct  114   SATESSFLGTITKGLVDTSKNAVKAVQVKARHAVSQNKRRYQEGGFDLDLTYITENIIAM  173

Query  594   GFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVAS  773
             GFPAGDMSSGFFGYVEGFYRN MEEVI F ET HK KYKVYNLCSERLYDVSLFEGKVAS
Sbjct  174   GFPAGDMSSGFFGYVEGFYRNQMEEVINFLETQHKAKYKVYNLCSERLYDVSLFEGKVAS  233

Query  774   FPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPT  953
             FPFDDHNCPPI LI SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMI SLLLYLKFFPT
Sbjct  234   FPFDDHNCPPIHLITSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMICSLLLYLKFFPT  293

Query  954   AEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPY  1133
             AEE +++YNQKRC+D KGLVLPSQIRYVKYFERIL YFNGENQP RRCMLRGFRLH+CPY
Sbjct  294   AEECMDFYNQKRCVDGKGLVLPSQIRYVKYFERILTYFNGENQPGRRCMLRGFRLHRCPY  353

Query  1134  WIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFK  1313
             WIRPSITISDHNGVLF+TKKHPRTKDL PED+WFSAPKKGV+VFALPGEPG+ ELAGDFK
Sbjct  354   WIRPSITISDHNGVLFTTKKHPRTKDLSPEDFWFSAPKKGVMVFALPGEPGLTELAGDFK  413

Query  1314  VHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRP  1493
             +HF+DRQGDFYCWLNTTM+ENR IL TS+LD FDKRKLPSPGF VE+VL D +   PT P
Sbjct  414   IHFHDRQGDFYCWLNTTMMENRVILKTSELDAFDKRKLPSPGFMVEVVLADINATIPTNP  473

Query  1494  QPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPK  1673
               E      ++  +     + +S      A+    N+++ + +KDDVFSDNE + TG P 
Sbjct  474   SSE------TASTTPEETPAANSSPVDGSASVPGPNKETENPDKDDVFSDNEGDSTG-PT  526

Query  1674  VGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQ--KRDTTVGAA  1847
                 + ++   +AK S         + S L +  E+VS+  SG K + Q  +  TTV  A
Sbjct  527   KTTSSASSQTPEAKRSAD-------ETSVLAKATEKVSI--SGNKGSSQPVQGGTTVSKA  577

Query  1848  SVPEV--------SNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                E         S++  S+FK+MAADASVF+FGDE+D+ES+
Sbjct  578   EATEKPSGAGVNPSSSSESEFKVMAADASVFSFGDEDDFESD  619



>ref|XP_009145793.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Brassica rapa]
Length=602

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/591 (66%), Positives = 451/591 (76%), Gaps = 50/591 (8%)
 Frame = +3

Query  240   SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTST  416
             S +STWAKSLK+PQPF  + + +NS    KS FA+FTSG G+  SPKSP  D+ ++G S+
Sbjct  41    SGISTWAKSLKVPQPFASTSDVDNS---EKSAFAKFTSGLGLRLSPKSPQPDETTDGASS  97

Query  417   TPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMG  596
             + Q    G  TKGLVD+SKNAVKAV VKARH VSQNKRRYQEGGFDLDLTYITEN+IAMG
Sbjct  98    SAQPGLFGAITKGLVDTSKNAVKAVQVKARHAVSQNKRRYQEGGFDLDLTYITENIIAMG  157

Query  597   FPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASF  776
             FPAGDMSSGFFGYVEGFYRN MEEVI F ET HK KYKVYNLCSERLYDVSLFEGKVASF
Sbjct  158   FPAGDMSSGFFGYVEGFYRNQMEEVINFLETQHKGKYKVYNLCSERLYDVSLFEGKVASF  217

Query  777   PFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTA  956
             PFDDHNCPPI LI SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMI SLLLYLKFFPTA
Sbjct  218   PFDDHNCPPIHLITSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMICSLLLYLKFFPTA  277

Query  957   EESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYW  1136
             EE +++YNQKRC+DAKGLVLPSQIRYVKYFERIL YFNGENQP R+CMLRGFRLH+CPYW
Sbjct  278   EECMDFYNQKRCVDAKGLVLPSQIRYVKYFERILTYFNGENQPGRKCMLRGFRLHRCPYW  337

Query  1137  IRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKV  1316
             IRPSITISDHNGVLF+TKKH RTKDL PED+WFSAPKKGV+VFALPGEPG+ ELAGDFK+
Sbjct  338   IRPSITISDHNGVLFTTKKHLRTKDLSPEDFWFSAPKKGVMVFALPGEPGLTELAGDFKI  397

Query  1317  HFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQ  1496
             HF+DRQGDFYCWLNTTM+ENR IL TS+LDGFDKRKLPSPGF VE+VL D D+  P +P 
Sbjct  398   HFHDRQGDFYCWLNTTMMENRVILKTSELDGFDKRKLPSPGFMVEVVLADIDSTIPPKPS  457

Query  1497  PEaavsskssdnssanpasgssphsaDEAADANSNQKSGSS------------EKDDVFS  1640
              E                   +  + +E + ANS+   G +            +KDDVFS
Sbjct  458   SE------------------PASKAPEETSAANSSPAEGVTPVPAPKKETQNPDKDDVFS  499

Query  1641  DNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQ  1820
             DNEA+ TG P     +V++   +AK S       S + S L +  E+VS+  +    + Q
Sbjct  500   DNEADSTG-PNKTTSSVSSQTPEAKQS-------SDETSGLARATEKVSISGNKGSSSSQ  551

Query  1821  KRDTTVGAASVPE--------VSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                 TV  A   E        V ++E S+FK+MAADASVF+FGDE++++S+
Sbjct  552   PVQGTVSKAEATEKPTGSGVNVPSSESSEFKVMAADASVFSFGDEDEFDSD  602



>ref|XP_009111867.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Brassica 
rapa]
Length=590

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/606 (65%), Positives = 450/606 (74%), Gaps = 45/606 (7%)
 Frame = +3

Query  171   PQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFT  350
             P  ++ A     +   V ++   S +STWAKSLK+PQPF+ ++ + +  N  KS FA+FT
Sbjct  17    PAAAIEAGTTDDSPKGVASKLSASGISTWAKSLKVPQPFSSARTDSDVDNTEKSAFAKFT  76

Query  351   SGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKR  530
             SG G+  SP+   D+  +GTS   Q  FIGT TKGLVD+SKNAVKAV VKARH VSQNKR
Sbjct  77    SGLGLRLSPQP--DETGKGTS---QPGFIGTITKGLVDTSKNAVKAVQVKARHAVSQNKR  131

Query  531   RYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYK  710
             RYQEGGFDLDLTYITEN+IAMGFPAGDMSSGFFGYVEGFYRN MEEVI F ET HK KYK
Sbjct  132   RYQEGGFDLDLTYITENIIAMGFPAGDMSSGFFGYVEGFYRNQMEEVISFLETQHKGKYK  191

Query  711   VYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKA  890
             VYNLCSERLYDVSLFEGKVASFPFDDHNCPPI LI SFCQSAYSWLKEDIENVV VHCKA
Sbjct  192   VYNLCSERLYDVSLFEGKVASFPFDDHNCPPIHLITSFCQSAYSWLKEDIENVVAVHCKA  251

Query  891   GMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFN  1070
             GMARTGLMI SLLLYLKFFPTAEE +++YNQKRC+DAKGLVLPSQIRYVKYFERIL YFN
Sbjct  252   GMARTGLMICSLLLYLKFFPTAEECMDFYNQKRCVDAKGLVLPSQIRYVKYFERILTYFN  311

Query  1071  GENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKK  1250
             GENQP R+CMLRGFRLH+CPYWIRPSITISDHNGVLF+TKKHPRTKDL PED+WFSAPKK
Sbjct  312   GENQPGRKCMLRGFRLHRCPYWIRPSITISDHNGVLFTTKKHPRTKDLSPEDFWFSAPKK  371

Query  1251  GVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLP  1430
             GV+VFALPGEPG+ ELAGDFK+HF+  QGDFYCW+NTTM+ENR IL TS+LDGFDKRKLP
Sbjct  372   GVMVFALPGEPGLTELAGDFKIHFHANQGDFYCWMNTTMMENRVILKTSELDGFDKRKLP  431

Query  1431  SPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANS----  1598
             SPGF VE+VL D DTA P  P  E                   +  + +E + ANS    
Sbjct  432   SPGFMVEVVLADIDTAIPANPSSE------------------PTSKAHEETSGANSSPAE  473

Query  1599  --------NQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQI  1754
                     N+++ + +KDDVFSDNE E TG  K            A   T        + 
Sbjct  474   GVTPVPGPNKETENHDKDDVFSDNETESTGATKTTP--------SASSQTPEAKHIEDET  525

Query  1755  SSLTQKIEQVSL-GDSGLKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDE  1931
             S L    E+VS+ G+ G      K + T     V   S++E S+FK+MAADASVF+FGDE
Sbjct  526   SGLASATEKVSISGNKGPSQPVSKAEATEKPTGV-NASSSESSEFKVMAADASVFSFGDE  584

Query  1932  EDYESE  1949
             +DYES+
Sbjct  585   DDYESD  590



>ref|XP_003576651.1| PREDICTED: uncharacterized protein LOC100846535 [Brachypodium 
distachyon]
Length=654

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/620 (63%), Positives = 473/620 (76%), Gaps = 28/620 (5%)
 Frame = +3

Query  147   TQLSNASNPQPSVTANMETSNVNSVPAQDGPSK------LSTWAKSLKIPQPFTGSQEEE  308
             TQ+++ S+  PS      ++       ++ PS       LS+WAK+LKIPQP +G  +E 
Sbjct  44    TQVASISHVTPSSPQASNSATTQDAAGRESPSSMFSTSGLSSWAKNLKIPQPSSG--QES  101

Query  309   NSGNAAKSPFARFTSGFGMLSSPK-SPTDDNSEGTST--TPQSSFIGTFTKGLVDSSKNA  479
              +G   K+ F+R TSG G+ SSPK    DD++EG+ST  T Q+   G+ TKG+VDSSKNA
Sbjct  102   PTG---KNTFSRLTSGLGLRSSPKDQQQDDSAEGSSTPTTAQAGVFGSLTKGIVDSSKNA  158

Query  480   VKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNH  659
             VKAV VKARH+VSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGD+SSG FGY EGFYRNH
Sbjct  159   VKAVQVKARHMVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDLSSGIFGYFEGFYRNH  218

Query  660   MEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAY  839
             MEEVI+FFE HHK KYKVYNLCSERLYD SLFEGKVA FPFDDHNCPPIQL++SFCQSAY
Sbjct  219   MEEVIRFFEMHHKGKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPIQLVISFCQSAY  278

Query  840   SWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLP  1019
             SWLKEDIENVVVVHCKAG ARTGLMISSLL+YLKFFPTAEESI YYNQKRC+D KGL+LP
Sbjct  279   SWLKEDIENVVVVHCKAGKARTGLMISSLLVYLKFFPTAEESIEYYNQKRCVDGKGLILP  338

Query  1020  SQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHP  1199
             SQIRYVKYFERIL YFNGENQP RRCMLRGFRLH+CPYWIRPSIT+S+HNGVLFSTKKHP
Sbjct  339   SQIRYVKYFERILTYFNGENQPPRRCMLRGFRLHRCPYWIRPSITVSNHNGVLFSTKKHP  398

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENR  1379
             RTK+L+PED+WF+APKKG++VFALPGEPG+AE+AGDFK+ F+DRQGDFYCWLNTTM+ENR
Sbjct  399   RTKELMPEDFWFTAPKKGIMVFALPGEPGLAEVAGDFKIQFHDRQGDFYCWLNTTMMENR  458

Query  1380  KILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgs  1559
               LNT+D D FDKRKLPSPGFQVE+VLVDYD   P + +P    ++ S+D      +S S
Sbjct  459   VTLNTTDFDDFDKRKLPSPGFQVEVVLVDYDGTLPPKQKP----AAGSADKKPDANSSAS  514

Query  1560  sphsaDEAADANSNQKSGSSEKDDVFSDNEAEE-TGKPKVGKVTVATDGVQAKVSTSGNN  1736
             +    + AA A SN++ G+ +KDDVFSDNEAE+ + K +  KV+    G       S  +
Sbjct  515   TGTKENSAAPAESNKEVGTDDKDDVFSDNEAEDGSSKGRKEKVSSHNQGTANAAKPSVTS  574

Query  1737  TGSPQISSLTQKIEQVSLG---------DSGLKHNEQKRDTTVGAASVPEVSNTEVSDFK  1889
                   S+    IE++++          D+     E    ++      P + ++ +S+FK
Sbjct  575   AAEKVASAAASGIEKMTISSDQGTSRAPDATSLKTEASNQSSSTTEQPPAMESSSMSEFK  634

Query  1890  IMAADASVFTFGDEEDYESE  1949
              +AADASVF+FGDE+DYESE
Sbjct  635   AIAADASVFSFGDEDDYESE  654



>ref|XP_006406503.1| hypothetical protein EUTSA_v10020332mg [Eutrema salsugineum]
 gb|ESQ47956.1| hypothetical protein EUTSA_v10020332mg [Eutrema salsugineum]
Length=603

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/614 (66%), Positives = 461/614 (75%), Gaps = 50/614 (8%)
 Frame = +3

Query  171   PQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFT  350
             P  SV A  E S    V ++   S +STWAK+LK+PQPF+ ++ + +  N  KS FA+FT
Sbjct  19    PPASVEAGSEDSP-KGVASKLSASGISTWAKNLKVPQPFSSTRADSDVDNTEKSAFAKFT  77

Query  351   SGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNK  527
             SG G+  SPKSP  D+ +EGTST  Q  FIGT TKGLVD+SKNAVKAV VKARH VSQNK
Sbjct  78    SGLGLRLSPKSPQPDETTEGTSTGTQPGFIGTITKGLVDTSKNAVKAVQVKARHAVSQNK  137

Query  528   RRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKY  707
             RRYQEGGFDLDLTYITEN+IAMGFPAGDMSSGFFGYVEGFYRN MEEVI F ET HK KY
Sbjct  138   RRYQEGGFDLDLTYITENIIAMGFPAGDMSSGFFGYVEGFYRNQMEEVINFLETQHKGKY  197

Query  708   KVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCK  887
             KVYNLCSERLYDVSLFEGKVASFPFDDHNCPPI LI SFCQSAYSWLKEDIENVVVVHCK
Sbjct  198   KVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIHLITSFCQSAYSWLKEDIENVVVVHCK  257

Query  888   AGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYF  1067
             AGMARTGLMI SLLLYLKFFPTAEE +++YNQKRC+D KGLVLPSQIRYVKYFERIL YF
Sbjct  258   AGMARTGLMICSLLLYLKFFPTAEECMDFYNQKRCVDGKGLVLPSQIRYVKYFERILTYF  317

Query  1068  NGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPK  1247
             NGENQP R+CMLRGFRLH+CPYWIRPSITISDHNGVLF+TKKHPRTKDL PED+WFSAPK
Sbjct  318   NGENQPGRKCMLRGFRLHRCPYWIRPSITISDHNGVLFTTKKHPRTKDLSPEDFWFSAPK  377

Query  1248  KGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKL  1427
             KGV+VFALPGEPG+ ELAGDFK+HF+DRQGDFYCWLNTTM+ENR IL TS+LDGFDKRKL
Sbjct  378   KGVMVFALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTMMENRVILKTSELDGFDKRKL  437

Query  1428  PSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQK  1607
             PSPGF VE+VL D +   P  P  E                  ++    DE + ANS+  
Sbjct  438   PSPGFMVEVVLADINQTIPANPSSE------------------TASKPPDETSAANSSPV  479

Query  1608  SG------------SSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQ  1751
              G            + +KDDVFSDNE + TG P     + ++   Q+K S         +
Sbjct  480   EGVIPAPGPSKETENPDKDDVFSDNETDSTG-PTKTTSSASSQTPQSKQSAD-------E  531

Query  1752  ISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPE--------VSNTEVSDFKIMAADA  1907
              S LT   E+VS+  SG K + +    TV  A   E         S++E S+FK++AADA
Sbjct  532   TSGLTLATEKVSI--SGNKGSSEPVQGTVSKAEATEKPTGSGVNASSSESSEFKVVAADA  589

Query  1908  SVFTFGDEEDYESE  1949
             SVF+FGDE+D+ES+
Sbjct  590   SVFSFGDEDDFESD  603



>ref|XP_009145794.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Brassica rapa]
Length=607

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/596 (66%), Positives = 455/596 (76%), Gaps = 55/596 (9%)
 Frame = +3

Query  240   SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTST  416
             S +STWAKSLK+PQPF  + + +NS    KS FA+FTSG G+  SPKSP  D+ ++G S+
Sbjct  41    SGISTWAKSLKVPQPFASTSDVDNS---EKSAFAKFTSGLGLRLSPKSPQPDETTDGASS  97

Query  417   TPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMG  596
             + Q    G  TKGLVD+SKNAVKAV VKARH VSQNKRRYQEGGFDLDLTYITEN+IAMG
Sbjct  98    SAQPGLFGAITKGLVDTSKNAVKAVQVKARHAVSQNKRRYQEGGFDLDLTYITENIIAMG  157

Query  597   FPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASF  776
             FPAGDMSSGFFGYVEGFYRN MEEVI F ET HK KYKVYNLCSERLYDVSLFEGKVASF
Sbjct  158   FPAGDMSSGFFGYVEGFYRNQMEEVINFLETQHKGKYKVYNLCSERLYDVSLFEGKVASF  217

Query  777   PFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTA  956
             PFDDHNCPPI LI SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMI SLLLYLKFFPTA
Sbjct  218   PFDDHNCPPIHLITSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMICSLLLYLKFFPTA  277

Query  957   EESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYW  1136
             EE +++YNQKRC+DAKGLVLPSQIRYVKYFERIL YFNGENQP R+CMLRGFRLH+CPYW
Sbjct  278   EECMDFYNQKRCVDAKGLVLPSQIRYVKYFERILTYFNGENQPGRKCMLRGFRLHRCPYW  337

Query  1137  IRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKV  1316
             IRPSITISDHNGVLF+TKKH RTKDL PED+WFSAPKKGV+VFALPGEPG+ ELAGDFK+
Sbjct  338   IRPSITISDHNGVLFTTKKHLRTKDLSPEDFWFSAPKKGVMVFALPGEPGLTELAGDFKI  397

Query  1317  HFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQ  1496
             HF+DRQGDFYCWLNTTM+ENR IL TS+LDGFDKRKLPSPGF VE+VL D D+  P +P 
Sbjct  398   HFHDRQGDFYCWLNTTMMENRVILKTSELDGFDKRKLPSPGFMVEVVLADIDSTIPPKPS  457

Query  1497  PEaavsskssdnssanpasgssphsaDEAADANSNQKSGSS------------EKDDVFS  1640
              E                   +  + +E + ANS+   G +            +KDDVFS
Sbjct  458   SE------------------PASKAPEETSAANSSPAEGVTPVPAPKKETQNPDKDDVFS  499

Query  1641  DNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSL-GDSGLKHNE  1817
             DNEA+ TG P     +V++   +AK S       S + S L +  E+VS+ G+ G   ++
Sbjct  500   DNEADSTG-PNKTTSSVSSQTPEAKQS-------SDETSGLARATEKVSISGNKGSSSSQ  551

Query  1818  QKRDT----TVGAASVPE--------VSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
               + T    TV  A   E        V ++E S+FK+MAADASVF+FGDE++++S+
Sbjct  552   PVQGTPVQGTVSKAEATEKPTGSGVNVPSSESSEFKVMAADASVFSFGDEDEFDSD  607



>emb|CDY50153.1| BnaA01g26130D [Brassica napus]
Length=591

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/583 (67%), Positives = 446/583 (77%), Gaps = 45/583 (8%)
 Frame = +3

Query  240   SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTT  419
             S +STWAKSLK+PQPF+ ++ + +  N  KS FA+FTSG G+  SP+   D+  EGTS  
Sbjct  41    SGISTWAKSLKVPQPFSSARTDSDVDNTEKSAFAKFTSGLGLRLSPQP--DETGEGTS--  96

Query  420   PQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGF  599
              Q  FIGT TKGLVD+SKNAVKAV VKARH VSQNKRRYQEGGFDLDLTYITEN+IAMGF
Sbjct  97    -QPGFIGTITKGLVDTSKNAVKAVQVKARHAVSQNKRRYQEGGFDLDLTYITENIIAMGF  155

Query  600   PAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFP  779
             PAGDMSSGFFGYVEGFYRN MEEVI F ET HK KYKVYNLCSERLYDVSLFEGKVASFP
Sbjct  156   PAGDMSSGFFGYVEGFYRNQMEEVISFLETQHKGKYKVYNLCSERLYDVSLFEGKVASFP  215

Query  780   FDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAE  959
             FDDHNCPPI LI SFCQSAYSWLKEDIENVV VHCKAGMARTGLMI SLLLYLKFFPTAE
Sbjct  216   FDDHNCPPIHLITSFCQSAYSWLKEDIENVVAVHCKAGMARTGLMICSLLLYLKFFPTAE  275

Query  960   ESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWI  1139
             E +++YNQKRC+DAKGLVLPSQIRYVKYFERIL YFNGENQP R+CMLRGFRLH+CPYWI
Sbjct  276   ECMDFYNQKRCVDAKGLVLPSQIRYVKYFERILTYFNGENQPGRKCMLRGFRLHRCPYWI  335

Query  1140  RPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVH  1319
             RPSITISDHNGVLF+TKKHPRTKDL PED+WFSAPKKGV+VFALPGEPG+ ELAGDFK+H
Sbjct  336   RPSITISDHNGVLFTTKKHPRTKDLSPEDFWFSAPKKGVMVFALPGEPGLTELAGDFKIH  395

Query  1320  FNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQP  1499
             F+  QGDFYCW+NTTM+ENR IL TS+LDGFDKRKLPSPGF VE+VL D DT  P  P  
Sbjct  396   FHANQGDFYCWMNTTMMENRVILKTSELDGFDKRKLPSPGFMVEVVLADIDTTAPANPSS  455

Query  1500  EaavsskssdnssanpasgssphsaDEAADANS------------NQKSGSSEKDDVFSD  1643
             E                   +  + +E + ANS            N+++ + +KDDVFSD
Sbjct  456   E------------------PASKAPEETSGANSSPAEGVTPVPGPNKETENPDKDDVFSD  497

Query  1644  NEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSL-GDSGLKHNEQ  1820
             NE E T  P     + ++   +AK S         + S L +  E+VS+ G+ G      
Sbjct  498   NETEST-NPTKTTPSASSQNPEAKHSAD-------ETSGLARATEKVSISGNKGPSQPVS  549

Query  1821  KRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             K + T     V   S++E S+FK+MAADASVF+FGDE+DYES+
Sbjct  550   KAEATEKPTGV-NASSSESSEFKVMAADASVFSFGDEDDYESD  591



>ref|XP_006663975.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Oryza 
brachyantha]
Length=654

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/660 (63%), Positives = 489/660 (74%), Gaps = 70/660 (11%)
 Frame = +3

Query  126   PSLST-MDTQLSNAS-----NPQPSVTANMETSNVNS--------------VPAQDGP--  239
             P+LST +D+Q S  S     +P P  T+N  +++V S              VP QD    
Sbjct  13    PTLSTPVDSQDSTVSSIRTPDPVPQATSNDFSTHVASTDHVAPSPAPAPVVVPTQDSAGR  72

Query  240   ---------SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTD  392
                      S LS+WAK+LKI QP  G  +E  +G   K+ F+R TSG G+  SPKSP  
Sbjct  73    EGSSSIFSTSGLSSWAKNLKISQPSPG--QESPTG---KNTFSRLTSGLGLRLSPKSPQQ  127

Query  393   DNSEGTSTTP---QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDL  563
             D S   STTP   QS   G+FTKG+VDSSKNAVKAV VKARH+VSQNKRRYQEGGFDLD+
Sbjct  128   DESAEGSTTPTTAQSGVFGSFTKGIVDSSKNAVKAVQVKARHMVSQNKRRYQEGGFDLDM  187

Query  564   TYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYD  743
             TYITEN+IAMGFPAGD+SSG FGY EGFYRNHMEEVI+FFE HHK KYKVYNLCSERLYD
Sbjct  188   TYITENIIAMGFPAGDLSSGLFGYFEGFYRNHMEEVIRFFEMHHKGKYKVYNLCSERLYD  247

Query  744   VSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISS  923
              SLFEGKVA FPFDDHNCPPIQL++SFC SAYSWLKEDIENVVVVHCKAG ARTGLMISS
Sbjct  248   ASLFEGKVACFPFDDHNCPPIQLVISFCHSAYSWLKEDIENVVVVHCKAGKARTGLMISS  307

Query  924   LLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCML  1103
             LLLYLKFFPTAEESI YYNQKRC+D KGL+LPSQIRYVKYFERIL YFNGENQP RRCML
Sbjct  308   LLLYLKFFPTAEESIEYYNQKRCVDGKGLILPSQIRYVKYFERILTYFNGENQPPRRCML  367

Query  1104  RGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEP  1283
             RGFRLH+CPYWIRPSIT+S+HNGVLFSTKKHPRTK+L+PED+WFSAPKKG++VFALPGEP
Sbjct  368   RGFRLHRCPYWIRPSITVSNHNGVLFSTKKHPRTKELMPEDFWFSAPKKGIMVFALPGEP  427

Query  1284  GVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLV  1463
             G+ E+AGDFK+ F+DRQGDFYCWLNTTM+ENR  LN +DLD FDKRKLPSPGFQVE+VLV
Sbjct  428   GLTEVAGDFKIQFHDRQGDFYCWLNTTMMENRVTLNPTDLDDFDKRKLPSPGFQVEVVLV  487

Query  1464  DYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSD  1643
             DYD + P + +P    +S S+D  S   +S  +    + +A + SN++S S++KDDVFSD
Sbjct  488   DYDGSQPPKTKP----ASASADKKSEADSSTGTVAKENSSAASESNKESASNDKDDVFSD  543

Query  1644  NEAEE-TGKPKVGKVTVATDGVQ-AKVS-TSGNNTGSPQISSLTQKIEQVSLGDSGLKHN  1814
             +EAE+ + + +  KV    +G   AKVS TS   T   + S+   +IE+ S        N
Sbjct  544   SEAEDGSSRGRREKVPKNVEGTNAAKVSETSAVQT---EASAAATRIEKASTA------N  594

Query  1815  EQKRDTTVGAASVP-EVSN--------------TEVSDFKIMAADASVFTFGDEEDYESE  1949
             EQ    T  AA +  EV++              + +S+FK +AADASVF+FGDE+DYESE
Sbjct  595   EQGTARTADAAPLKGEVTSKSSSATAPPAAADSSSMSEFKAIAADASVFSFGDEDDYESE  654



>ref|XP_006855231.1| hypothetical protein AMTR_s00051p00218610 [Amborella trichopoda]
 gb|ERN16698.1| hypothetical protein AMTR_s00051p00218610 [Amborella trichopoda]
Length=634

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/614 (64%), Positives = 464/614 (76%), Gaps = 29/614 (5%)
 Frame = +3

Query  183   VTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFG  362
              +A+ E SN    P++   S +S+WA+SL+I QP  G  +E  S N+ K  F+RFTSGFG
Sbjct  25    ASASSEDSNAKENPSKLSASAISSWARSLRITQPVLG--DETQSNNSGKLTFSRFTSGFG  82

Query  363   MLSSPKS-PTDDNSEGTS-TTP---QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNK  527
             + +SPK+   D+ SEGTS TTP   QS   G+ TKGLVDSS+NAVKAV VKARH+VSQNK
Sbjct  83    LRTSPKAFAADEGSEGTSATTPTMTQSGVFGSITKGLVDSSRNAVKAVQVKARHIVSQNK  142

Query  528   RRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKY  707
             RRYQE GFDLD+TYITENVIAMGFPAGD+SSG  GYVEGFYRNHMEEVIKFFETHHK KY
Sbjct  143   RRYQEDGFDLDMTYITENVIAMGFPAGDLSSGILGYVEGFYRNHMEEVIKFFETHHKGKY  202

Query  708   KVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCK  887
             KVYNLC ERLYD SLFEGKVA FPFDDHNCPPIQLI+SFCQSAY WLKEDIENVVVVHCK
Sbjct  203   KVYNLCLERLYDASLFEGKVACFPFDDHNCPPIQLIISFCQSAYLWLKEDIENVVVVHCK  262

Query  888   AGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYF  1067
             AGMARTGLMISSLLLYLKFFPTAEESI YYNQKRC+D KGLVLPSQIRYVKYFERIL YF
Sbjct  263   AGMARTGLMISSLLLYLKFFPTAEESIAYYNQKRCVDGKGLVLPSQIRYVKYFERILTYF  322

Query  1068  NGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPK  1247
             NGENQP RRCMLRGFRLH+CPYWIRPSIT+SDHNGVLFSTK+HPRTKD++PED+WFSAP+
Sbjct  323   NGENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTKRHPRTKDMMPEDFWFSAPR  382

Query  1248  KGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKL  1427
             KG++VFALPGE G+ E+AGDFK+HF+DRQGDFYCWLNTTM+ENRK+L T DLDGFDKRKL
Sbjct  383   KGIMVFALPGERGLTEVAGDFKIHFHDRQGDFYCWLNTTMMENRKMLTTPDLDGFDKRKL  442

Query  1428  PSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADAN----  1595
             PSPGFQVE+VL+DYD +    P+ E       S+ +  +  + +S  +       +    
Sbjct  443   PSPGFQVEVVLMDYDASILANPKAENNTKESDSNTNIGSGGTTTSSTTTTATPLGDGGEP  502

Query  1596  ----SNQKSGSSE-KDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISS  1760
                 SN+++   + KDD+FSD+EAEE G  K  +  V     +     +     S ++ +
Sbjct  503   IPNLSNEEATRMQVKDDIFSDSEAEEIGSSKGRQSRVGRQ--ERGGPAAPAARPSAELPT  560

Query  1761  LTQKIEQVSLGDS---GLKHNEQKRDTTVG----AASVP----EVSNTEVSDFKIMAADA  1907
               + +  V+  +     L  NE     + G      SVP    ++ + E SDFK MAADA
Sbjct  561   QKETVANVTNAEGTKQSLVRNEAAVHVSSGEPKMEESVPFEAAKMDSVEGSDFKAMAADA  620

Query  1908  SVFTFGDEEDYESE  1949
             SVFTFGD+EDYESE
Sbjct  621   SVFTFGDDEDYESE  634



>ref|XP_009145791.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Brassica 
rapa]
Length=602

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/591 (66%), Positives = 448/591 (76%), Gaps = 50/591 (8%)
 Frame = +3

Query  240   SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTST  416
             S +STWAKSLK+PQPF  + + +NS    KS FA+FTSG G+  SPKSP  D+ ++G S+
Sbjct  41    SGISTWAKSLKVPQPFASTSDVDNS---EKSAFAKFTSGLGLRLSPKSPQPDETTDGASS  97

Query  417   TPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMG  596
             + Q    G  TKGLVD+SKNAVKAV VKARH VSQNKRRYQEGGFDLDLTYITEN+IAMG
Sbjct  98    SAQPGLFGAITKGLVDTSKNAVKAVQVKARHAVSQNKRRYQEGGFDLDLTYITENIIAMG  157

Query  597   FPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASF  776
             FPAGDMSSGFFGYVEGFYRN MEEVI F ET HK KYKVYNLCSERLYDVSLFEGKVASF
Sbjct  158   FPAGDMSSGFFGYVEGFYRNQMEEVINFLETQHKGKYKVYNLCSERLYDVSLFEGKVASF  217

Query  777   PFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTA  956
             PFDDHNCPPI LI SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMI SLLLYLKFFPTA
Sbjct  218   PFDDHNCPPIHLITSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMICSLLLYLKFFPTA  277

Query  957   EESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYW  1136
             EE +++YNQKRC+D KGLVLPSQIRYVKYFERIL YFNGENQP R+CMLRGFRLH+CPYW
Sbjct  278   EECMDFYNQKRCVDGKGLVLPSQIRYVKYFERILTYFNGENQPGRKCMLRGFRLHRCPYW  337

Query  1137  IRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKV  1316
             IRPSITISDHNGVLF+TKKH RTKDL PED+WFSAPKKGV+VFALPG P + ELAGDFK+
Sbjct  338   IRPSITISDHNGVLFTTKKHLRTKDLSPEDFWFSAPKKGVMVFALPGAPDLTELAGDFKI  397

Query  1317  HFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQ  1496
             HF+DRQGDFYCWLNTTM+ENR IL TS+LDGFDKRKLPSPGF VE+VL D D+  P +P 
Sbjct  398   HFHDRQGDFYCWLNTTMMENRVILKTSELDGFDKRKLPSPGFMVEVVLADIDSTIPPKPS  457

Query  1497  PEaavsskssdnssanpasgssphsaDEAADANSNQKSGSS------------EKDDVFS  1640
              E                   +  + +E + ANS+   G +            +KDDVFS
Sbjct  458   SE------------------PASKAPEETSAANSSPAEGVTPVPAPKKETQNPDKDDVFS  499

Query  1641  DNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQ  1820
             DNEA+ TG P     +V++   +AK S       S + S L +  E+VS+  +    + Q
Sbjct  500   DNEADSTG-PNKTTSSVSSQTPEAKQS-------SDETSGLARATEKVSISGNKGSSSSQ  551

Query  1821  KRDTTVGAASVPE--------VSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                 TV  A   E        V ++E S+FK+MAADASVF+FGDE++++S+
Sbjct  552   PVQGTVSKAEATEKPTGSGVNVPSSESSEFKVMAADASVFSFGDEDEFDSD  602



>ref|XP_010691716.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691717.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Beta vulgaris 
subsp. vulgaris]
Length=608

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/610 (65%), Positives = 461/610 (76%), Gaps = 27/610 (4%)
 Frame = +3

Query  156   SNASNPQPSVTANMETSNVNSVPAQDGP-SKLSTWAKSLKIPQPFTGSQEEENSGNAAKS  332
             + AS+ QP+  A    ++  S  +   P S +S+WA++LKIPQP  G Q E  + N+ KS
Sbjct  14    AKASDVQPAPAAEAGVNSATSDASSKQPISGISSWARNLKIPQPMAGGQVESPAENSPKS  73

Query  333   PFARFTSGFGMLSSPK--SPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKAR  506
              FARFTSG     SP+  +P      G+S   QS+FIGT TKGLVDSSK+A +AVSVKAR
Sbjct  74    AFARFTSGITSRLSPRESAPEQVADAGSS---QSNFIGTITKGLVDSSKSAARAVSVKAR  130

Query  507   HVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFE  686
             HVVSQNKRRYQE G+DLD+TYITEN++AMGFPAGDMSSGFFGY+EG YRNHMEEVI F E
Sbjct  131   HVVSQNKRRYQEDGYDLDMTYITENILAMGFPAGDMSSGFFGYLEGLYRNHMEEVISFLE  190

Query  687   THHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIEN  866
             +HHK KYKVYNLCSERLYD SLFEGKVAS PFDDHNCPPIQLI+SFCQSAYSWLKEDIEN
Sbjct  191   SHHKGKYKVYNLCSERLYDASLFEGKVASCPFDDHNCPPIQLIISFCQSAYSWLKEDIEN  250

Query  867   VVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYF  1046
             VVVVHCKAGMARTGLMISSLLLYLKFFPTAEESI+YYN KRC D K LVLPSQIRYVKYF
Sbjct  251   VVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNLKRCFDGKALVLPSQIRYVKYF  310

Query  1047  ERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPED  1226
             ER L YFNGENQP RRCMLRGFRLH+CPYWIRP IT+SDHNGVLFSTKKH RTKDL  ED
Sbjct  311   ERTLTYFNGENQPGRRCMLRGFRLHRCPYWIRPHITVSDHNGVLFSTKKHARTKDLSTED  370

Query  1227  YWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLD  1406
             +WFSAPKKG++VFALPGEPG+ EL+GDFKV F+DRQGDFY WLNTTM+ENRKILNT D+D
Sbjct  371   FWFSAPKKGIMVFALPGEPGLTELSGDFKVTFHDRQGDFYFWLNTTMVENRKILNTGDMD  430

Query  1407  GFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAA  1586
             GFDKRKLPSPGFQVEIVLVDYD   P +PQP           +            ++   
Sbjct  431   GFDKRKLPSPGFQVEIVLVDYDDTLP-QPQP----------VNVTQKPDEKPAAPSEPVI  479

Query  1587  DANSNQKSGSSE---KDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSP-QI  1754
             +A+S  K+  SE   KDDVFSD+EA+ +G  +  K   A   V++    S   T S  ++
Sbjct  480   EASSTAKASESEQEDKDDVFSDDEADGSGNGRSRK-GQADSFVKSTAPPSETKTPSDHKV  538

Query  1755  SSLTQKIEQVSLGDSGLKH----NEQKRDTTVGAASVPEVSNTE-VSDFKIMAADASVFT  1919
              SLT+ +E+VS+   G       N+ K +T  G  +     N++ VSDFK MAADASVF+
Sbjct  539   DSLTRGVEKVSVSKGGSTEGRSVNDSKSETATGTGTGLATPNSDGVSDFKAMAADASVFS  598

Query  1920  FGDEEDYESE  1949
             FGD+EDYES+
Sbjct  599   FGDDEDYESD  608



>ref|NP_001066634.1| Os12g0407500 [Oryza sativa Japonica Group]
 gb|ABA97561.1| PTEN, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29653.1| Os12g0407500 [Oryza sativa Japonica Group]
 dbj|BAG94549.1| unnamed protein product [Oryza sativa Japonica Group]
Length=658

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/612 (65%), Positives = 468/612 (76%), Gaps = 48/612 (8%)
 Frame = +3

Query  213   NSVPAQDGP-----------SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGF  359
             N+VP QD             S LS+WAK+LKIPQP +G  +E  +G   K+ F+R TSG 
Sbjct  62    NAVPIQDAAGREAQSSIFSTSGLSSWAKNLKIPQPSSG--QESPTG---KNTFSRLTSGL  116

Query  360   GMLSSPKSPTDDNSEGTSTTP---QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKR  530
             G+  SPK P  D S   STTP   QS   G+FTKG+VDSSKNAVKAV VKARH+VSQNKR
Sbjct  117   GLRLSPKGPQQDESAEGSTTPTTAQSGVFGSFTKGIVDSSKNAVKAVQVKARHMVSQNKR  176

Query  531   RYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYK  710
             RYQEGGFDLD+TYITEN+IAMGFPAGD+SSG FGY EGFYRNHMEEVI+FFE HHK KYK
Sbjct  177   RYQEGGFDLDMTYITENIIAMGFPAGDLSSGLFGYFEGFYRNHMEEVIRFFEMHHKGKYK  236

Query  711   VYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKA  890
             VYNLCSERLYD SLFEGKVA FPFDDHNCPPIQL++SFC SAYSWLKEDIENVVVVHCKA
Sbjct  237   VYNLCSERLYDASLFEGKVACFPFDDHNCPPIQLVISFCHSAYSWLKEDIENVVVVHCKA  296

Query  891   GMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFN  1070
             G ARTGLMISSLLLYLKFFPTAEESI YYNQKRC+D KGL+LPSQIRYVKYFERIL YFN
Sbjct  297   GKARTGLMISSLLLYLKFFPTAEESIEYYNQKRCVDGKGLILPSQIRYVKYFERILTYFN  356

Query  1071  GENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKK  1250
             GENQP RRCMLRGFRLH+CPYWIRPSIT+S+HNGVLF+TKKHPRTK+L+PED+WFSAPKK
Sbjct  357   GENQPPRRCMLRGFRLHRCPYWIRPSITVSNHNGVLFTTKKHPRTKELMPEDFWFSAPKK  416

Query  1251  GVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLP  1430
             G++VFALPGEPG+ E+AGDFK+ F+DRQGDFYCWLNTTM+ENR  LN +DLD FDKRKLP
Sbjct  417   GIMVFALPGEPGLTEVAGDFKIQFHDRQGDFYCWLNTTMMENRVTLNPTDLDDFDKRKLP  476

Query  1431  SPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADAN-SNQK  1607
             SPGFQVE+VLVDYD + P +P+P    ++ S+D  S   +S  +    + A+ A  SN++
Sbjct  477   SPGFQVEVVLVDYDGSQPPKPKP----AAASTDQKSEADSSTGTVAKGNNASSAEVSNKE  532

Query  1608  SGSSEKDDVFSDNEAEE-TGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQV  1784
             S  ++KDDVFSD+EAE+ + K +  KV+   +G       S  ++   + S+   +IE+V
Sbjct  533   SARNDKDDVFSDSEAEDGSSKGRREKVSRNVEGTTNAAKASETSSVQKEASAAASRIEKV  592

Query  1785  SLGDSGLKHNEQKRDTTVGAASV-----------------PEVSNTEVSDFKIMAADASV  1913
             S+       +EQ    T  AA +                 P  +++ +S+FK +AADASV
Sbjct  593   SIT------SEQGSARTPDAAPLKSGVSSKSSSTTAPPPPPAAADSSMSEFKAIAADASV  646

Query  1914  FTFGDEEDYESE  1949
             F+FGDE+DYESE
Sbjct  647   FSFGDEDDYESE  658



>dbj|BAJ96939.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/643 (62%), Positives = 476/643 (74%), Gaps = 36/643 (6%)
 Frame = +3

Query  96    SPPATFRTL--VPSLSTMD--TQLSNASNPQPSVTANMETSNVNSVPAQDGPSK------  245
             SPP    T   VP     D  TQ+++ +   PS  +   ++       ++ PS       
Sbjct  23    SPPPAVTTADPVPRAPANDSATQVASPNPVAPSSPSAPTSATTQDAAGRETPSSMFSTSG  82

Query  246   LSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTP-  422
             LS+WAK+LKIPQP +G  +E  +G   K+  +R  SG G+  SPK P  D +   STTP 
Sbjct  83    LSSWAKNLKIPQPSSG--QESPTG---KNTVSRLASGLGLRLSPKDPQQDETAEGSTTPT  137

Query  423   --QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMG  596
               Q+   G+ T+G+VDSSKNAVKAV VKARH+VSQNKRRYQEGGFDLD+TYITEN+IAMG
Sbjct  138   TAQAGVFGSLTRGIVDSSKNAVKAVQVKARHMVSQNKRRYQEGGFDLDMTYITENIIAMG  197

Query  597   FPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASF  776
             FPAGD+SSG FGY EGFYRNHMEEVI+FFE HHK KYKVYNLCSERLYD SLFEGKVA F
Sbjct  198   FPAGDLSSGIFGYFEGFYRNHMEEVIRFFEMHHKGKYKVYNLCSERLYDASLFEGKVACF  257

Query  777   PFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTA  956
             PFDDHNCPPIQL++SFCQSAYSWLKEDIENVVVVHCKAG ARTGLMISSLL+YLKFFPTA
Sbjct  258   PFDDHNCPPIQLVISFCQSAYSWLKEDIENVVVVHCKAGKARTGLMISSLLVYLKFFPTA  317

Query  957   EESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYW  1136
             EESI YYNQKRC+D KGL+LPSQIRYVKYFERIL YFNGENQP RRCMLRGFRLH+CPYW
Sbjct  318   EESIEYYNQKRCVDGKGLILPSQIRYVKYFERILTYFNGENQPPRRCMLRGFRLHRCPYW  377

Query  1137  IRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKV  1316
             IRPSIT+S+HNGVLFSTKKHPRTK+L+PED+WF+APKKG++VFALPGEPG+ E+AGDFK+
Sbjct  378   IRPSITVSNHNGVLFSTKKHPRTKELMPEDFWFTAPKKGIMVFALPGEPGLTEVAGDFKI  437

Query  1317  HFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQ  1496
              F+DRQGDFYCWLNTTM+ENR  LN +D D FDKRKLPSPGFQVEIVLVDY  + P + +
Sbjct  438   QFHDRQGDFYCWLNTTMMENRVTLNPTDFDDFDKRKLPSPGFQVEIVLVDYSGSQPPKQK  497

Query  1497  PEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEE-TGKPK  1673
             P    +  S+D      +S SS      AA A SN+++GS +KDDVFSDNEAE+ + K +
Sbjct  498   P----ADGSADKKCDADSSTSSNAKDSNAAPAESNKETGSDDKDDVFSDNEAEDGSSKGR  553

Query  1674  VGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSL-GDSGLK----------HNEQ  1820
                V+ +  G   +      +    + S+    IE++++ GD G+               
Sbjct  554   KEDVSSSGQGGANRAKAPETSVAQQEPSAAASGIEKITISGDQGIATAPDGISLKTEASS  613

Query  1821  KRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             K D+T   A  P + ++ +S+FK +AADASVF+FGDE+DYESE
Sbjct  614   KSDST--KAQPPAMESSSLSEFKTIAADASVFSFGDEDDYESE  654



>ref|XP_004957777.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Setaria 
italica]
Length=649

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/642 (62%), Positives = 486/642 (76%), Gaps = 36/642 (6%)
 Frame = +3

Query  90    ALSPPATFRTLVPSLSTMDTQLSNASNPQPSVTANMETSNVNSVPAQDGP------SKLS  251
             A +PP T    V   ++ D+  S  +   P+V +    +       ++ P      S LS
Sbjct  22    AATPPVTTVDPVRPAASTDSS-SQVAGVDPAVISAPTAAPAKDAAGREAPASMFSTSGLS  80

Query  252   TWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDN-SEGTS--TTP  422
             +WAK+LKIPQP +G  +E  +G   K+ FARFTSGFG+  SPK+   D  +EG++  TT 
Sbjct  81    SWAKNLKIPQPSSG--QESPTG---KNTFARFTSGFGLRLSPKAAQQDEIAEGSTSPTTG  135

Query  423   QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFP  602
             Q    G+ TKG+VDSSKNAVKAV VKARH+VSQNKRRYQEGGFDLD+TYITEN+IAMGFP
Sbjct  136   QPGVFGSLTKGIVDSSKNAVKAVQVKARHMVSQNKRRYQEGGFDLDMTYITENIIAMGFP  195

Query  603   AGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPF  782
             AGD+SSG FGY EGFYRNHMEEVI+FFE HHK KYKVYNLCSERLYD SLFEGKVA FPF
Sbjct  196   AGDLSSGLFGYFEGFYRNHMEEVIRFFEMHHKGKYKVYNLCSERLYDASLFEGKVACFPF  255

Query  783   DDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEE  962
             DDHNCPPIQL++SFC SAYSWLKEDIENVVVVHCKAG ARTGLMISSLLL+LKFFPTAEE
Sbjct  256   DDHNCPPIQLVISFCHSAYSWLKEDIENVVVVHCKAGKARTGLMISSLLLFLKFFPTAEE  315

Query  963   SINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIR  1142
             SI YYNQKRC+D KGL+LPSQIRYVKYFERIL YFNGE+QP RRCMLRGFRLH+CPYWIR
Sbjct  316   SIEYYNQKRCVDGKGLILPSQIRYVKYFERILTYFNGESQPPRRCMLRGFRLHRCPYWIR  375

Query  1143  PSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHF  1322
             PSIT+S+HNGVLFSTKKHPRTK+L+PED+WFSAPKKG++VFALPGEPG+AE++GDFK+ F
Sbjct  376   PSITVSNHNGVLFSTKKHPRTKELMPEDFWFSAPKKGIMVFALPGEPGLAEVSGDFKIQF  435

Query  1323  NDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPE  1502
             +DRQGDFYCWLNTTM+ENR  LN +DLD FDKRKLPSPGFQVE+VLVDYD +   +P+P 
Sbjct  436   HDRQGDFYCWLNTTMMENRVTLNPTDLDDFDKRKLPSPGFQVEVVLVDYDGSQAPKPKP-  494

Query  1503  aavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGK  1682
                 +  SDN +   +SGS+      AA   SN+ +GS++KD+VFSD+E E+ G  K G+
Sbjct  495   ----AAGSDNKTDADSSGSTVAKESNAAPPESNKGTGSNDKDEVFSDSEGED-GSSK-GR  548

Query  1683  VTVATDGVQAKVST---SGNNTGSPQISSLTQKIEQVSLGD----------SGLKHNEQK  1823
                A+ G Q+  +    S  +T   + S+   ++E+V++            + LK     
Sbjct  549   KEKASSGGQSNANAAKPSETSTVQEEASAAASRLEKVAITSEQGAAKAPDATSLKTEVSS  608

Query  1824  RDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             + ++  A S P V ++ +S+FK +AADASVF+FGDE+DYESE
Sbjct  609   KSSSTTAPS-PAVDSSSMSEFKAIAADASVFSFGDEDDYESE  649



>emb|CDY46177.1| BnaA05g20640D [Brassica napus]
Length=590

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/608 (64%), Positives = 452/608 (74%), Gaps = 46/608 (8%)
 Frame = +3

Query  165   SNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFAR  344
             ++P P         +   V ++   S +STWAKSLK+PQPF  + + +NS    KS FA+
Sbjct  16    AHPPPVAVEAGNDDSPKGVASKLSASGISTWAKSLKVPQPFASTSDVDNS---EKSAFAK  72

Query  345   FTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQ  521
             FTSG G+  SPKSP  D+ ++G S++ Q    G  TKGLVD+SKNAVKAV VKARH VSQ
Sbjct  73    FTSGLGLRLSPKSPQPDETTDGASSSAQPGLFGAITKGLVDTSKNAVKAVQVKARHAVSQ  132

Query  522   NKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKD  701
             NKRRYQEGGFDLDLTYITEN+IAMGFPAGDMSSGFFGYVEGFYRN MEEVI F ET HK 
Sbjct  133   NKRRYQEGGFDLDLTYITENIIAMGFPAGDMSSGFFGYVEGFYRNQMEEVINFLETQHKG  192

Query  702   KYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVH  881
             KYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPI LI SFCQSAYSWLKEDIENVVVVH
Sbjct  193   KYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIHLITSFCQSAYSWLKEDIENVVVVH  252

Query  882   CKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILM  1061
             CKAGMARTGLMI SLLLYLKFFPTAEE +++YNQKRC+D KGLVLPSQIRYVKYFERIL 
Sbjct  253   CKAGMARTGLMICSLLLYLKFFPTAEECMDFYNQKRCVDGKGLVLPSQIRYVKYFERILT  312

Query  1062  YFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSA  1241
             YFNGENQP R+CMLRGFRLH+CPYWIRPSITISDHNGVLF+TKKH RTKDL PED+WFSA
Sbjct  313   YFNGENQPGRKCMLRGFRLHRCPYWIRPSITISDHNGVLFTTKKHLRTKDLSPEDFWFSA  372

Query  1242  PKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKR  1421
             PKKGV+VFALPGEPG+ ELAGDFK+HF+DRQGDFYCWLNTTM+ENR IL TS+LDGFDKR
Sbjct  373   PKKGVMVFALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTMMENRVILKTSELDGFDKR  432

Query  1422  KLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSN  1601
             KLPSPGF VE+VL D D+  P +P  E                   +  + +E + ANS+
Sbjct  433   KLPSPGFMVEVVLADIDSTIPPKPSSE------------------PASKAPEETSAANSS  474

Query  1602  QKSGSS------------EKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGS  1745
                G +            +KDDVFSDNEA+ TG P     +V++   +AK S       S
Sbjct  475   PAEGVTPVPAPKKETQNPDKDDVFSDNEADSTG-PNKTTSSVSSQTPEAKQS-------S  526

Query  1746  PQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFG  1925
              + S L +  E+VS+  +    + Q    TV  A   E    + +   +MAADASVF+FG
Sbjct  527   DETSGLARATEKVSISGNKGSSSSQPVQGTVSKAEATE----KPTGSGVMAADASVFSFG  582

Query  1926  DEEDYESE  1949
             DE++++S+
Sbjct  583   DEDEFDSD  590



>emb|CDY63391.1| BnaCnng41960D [Brassica napus]
Length=592

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/609 (64%), Positives = 455/609 (75%), Gaps = 46/609 (8%)
 Frame = +3

Query  165   SNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFAR  344
             ++P P+        +   V ++   S +STWAKSLK+PQPF  + ++ +  N  KS FA+
Sbjct  16    AHPPPAAVEAGSDDSPKGVASKLSASGISTWAKSLKVPQPFASTSDDGD--NTEKSAFAK  73

Query  345   FTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQ  521
             FTSG G+  SPKSP  D+ ++G S++ Q    G  TKGLVD+SKNAVKAV VKARH VSQ
Sbjct  74    FTSGLGLRLSPKSPQPDETTDGASSSAQPGLFGAITKGLVDTSKNAVKAVQVKARHAVSQ  133

Query  522   NKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKD  701
             NKRRYQEGGFDLDLTYITEN+IAMGFPAGDMSSGFFGYVEGFYRN MEEVI F ET HK 
Sbjct  134   NKRRYQEGGFDLDLTYITENIIAMGFPAGDMSSGFFGYVEGFYRNQMEEVINFLETQHKG  193

Query  702   KYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVH  881
             KYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPI LI SFCQSAYSWLKEDIENVVVVH
Sbjct  194   KYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIHLITSFCQSAYSWLKEDIENVVVVH  253

Query  882   CKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILM  1061
             CKAGMARTGLMI SLLLYLKFFPTAEE +++YNQKRC+D KGLVLPSQIRYVKYFERIL 
Sbjct  254   CKAGMARTGLMICSLLLYLKFFPTAEECMDFYNQKRCVDGKGLVLPSQIRYVKYFERILT  313

Query  1062  YFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSA  1241
             YFNGENQP R+CMLRGFRLH+CPYWIRPS+TISDHNGVLF+TKKH RTKDL PED+WFSA
Sbjct  314   YFNGENQPGRKCMLRGFRLHRCPYWIRPSVTISDHNGVLFTTKKHLRTKDLSPEDFWFSA  373

Query  1242  PKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKR  1421
             PKKGV+VFALPGEPG+ ELAGDFK+HF+DRQGDFYCWLNTTM+ENR IL TS+LDGFDKR
Sbjct  374   PKKGVMVFALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTMMENRVILKTSELDGFDKR  433

Query  1422  KLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSN  1601
             KLPSPGF VE+VL D D+  P +P  E                   +  + +E + ANS+
Sbjct  434   KLPSPGFMVEVVLADIDSTIPPKPSSE------------------PASKAPEETSAANSS  475

Query  1602  ------------QKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGS  1745
                         +++ + +KDDVFSDNEA+ TG P     +V++   +AK S        
Sbjct  476   PAEVVTPVPAPKKETENPDKDDVFSDNEADSTG-PTKTTSSVSSQTPEAKQSAD------  528

Query  1746  PQISSLTQKIEQV-SLGDSGLKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTF  1922
              + + LT+  E+V   G+ G   + Q    TV  A   E    + +   +MAADASVF+F
Sbjct  529   -ETAGLTRATEKVSISGNKGSSSSSQPVQGTVSKAEAAE----KPTGSGVMAADASVFSF  583

Query  1923  GDEEDYESE  1949
             GDE+++ES+
Sbjct  584   GDEDEFESD  592



>gb|EPS74080.1| hypothetical protein M569_00672, partial [Genlisea aurea]
Length=549

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/571 (68%), Positives = 440/571 (77%), Gaps = 44/571 (8%)
 Frame = +3

Query  240   SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKS-PTDDNSEGTST  416
             S ++ WAK+LKI QP   S+E+  S N+ KSP +R T G G+  +PKS P ++NS G S+
Sbjct  22    SGITNWAKNLKISQPLVASEEDSASENSVKSPLSRLTGGLGLRLNPKSSPLEENSAGASS  81

Query  417   TPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMG  596
               Q   IGT TKGLVDSSKNAVKAV VKARHVVSQNKRRYQEGGFDLD+TYITEN+IAMG
Sbjct  82    PTQPGLIGTITKGLVDSSKNAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENIIAMG  141

Query  597   FPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASF  776
             FP+GDMSSG  GYVEGFYRNHMEEVI+FFETHHKDKYKVYNLCSERLY+ SLFEGKVASF
Sbjct  142   FPSGDMSSGLLGYVEGFYRNHMEEVIRFFETHHKDKYKVYNLCSERLYEPSLFEGKVASF  201

Query  777   PFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTA  956
             PFDDHNCPPIQLI+SFCQSAYSWLK+DIENVVVVHCKAGMARTGLMISSLLL+LKFFPTA
Sbjct  202   PFDDHNCPPIQLIISFCQSAYSWLKQDIENVVVVHCKAGMARTGLMISSLLLFLKFFPTA  261

Query  957   EESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYW  1136
             EESI +YNQ+RC+D KGLVLPSQIRYVKY ERIL YFNGENQPARRCMLRGFRLH+CPYW
Sbjct  262   EESIEFYNQRRCLDGKGLVLPSQIRYVKYLERILAYFNGENQPARRCMLRGFRLHRCPYW  321

Query  1137  IRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKV  1316
             IRPSITISDHNGVLFSTKKH RTKD  PED+WF+APKKG++VFALPGEPG+ ELAGDFKV
Sbjct  322   IRPSITISDHNGVLFSTKKHQRTKDQSPEDFWFAAPKKGIMVFALPGEPGLTELAGDFKV  381

Query  1317  HFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQ  1496
             HF+DRQGDFYCWLNTTM+ENRKILNT DLDGFDKRKLPSPGFQVE+VLVD+D   P+R  
Sbjct  382   HFHDRQGDFYCWLNTTMVENRKILNTGDLDGFDKRKLPSPGFQVEVVLVDHD---PSR--  436

Query  1497  PEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKV  1676
                     S   +     + +SP S   +A+ N+++K   S K D FSD+EA++      
Sbjct  437   -------ASISRNPTATNATTSPSSPAPSAEVNASEKDSKSSKHDEFSDSEADDAAAAAA  489

Query  1677  GKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVP  1856
              K    +  +Q   +   N   +      TQ              NE K+D         
Sbjct  490   SK----SRALQQPEAGPDNKQANAAAGPPTQ--------------NEAKKDA--------  523

Query  1857  EVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                  EVS+FK MAADASVF+FGD EDYESE
Sbjct  524   ----GEVSEFKAMAADASVFSFGD-EDYESE  549



>ref|XP_010908851.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Elaeis 
guineensis]
Length=607

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/614 (61%), Positives = 450/614 (73%), Gaps = 18/614 (3%)
 Frame = +3

Query  141   MDTQLSNASNPQPSVTANMETSNVNSVPA--QDGPSKLSTWAKSLKIPQPFTGSQEEENS  314
             M+ Q  ++S+    +T +++ S  N   A  Q+ P+ L +WA+SLKIP P    QE+   
Sbjct  1     MEPQQDDSSSSTTVITPDIQHSASNGQDATVQETPTILFSWARSLKIPLPQQSDQEDSQP  60

Query  315   GNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAV  491
             GN  KS F RFTSG G+  SP SP  D+++E  ST  QS  +G+FTKG+VDSS NA+KAV
Sbjct  61    GNLGKSTFERFTSGLGLRLSPNSPMKDESAESNSTALQSGGLGSFTKGIVDSSMNAIKAV  120

Query  492   SVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEV  671
              VK RH+VSQNKRRYQEG FDLD+TYI +N+IAMGFPAG +SSG FGY EGFYRNHMEEV
Sbjct  121   QVKTRHIVSQNKRRYQEGEFDLDMTYIMKNIIAMGFPAGHISSGLFGYFEGFYRNHMEEV  180

Query  672   IKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLK  851
             IKFFETHH+ KYKVYNLCSERLYD SLFEGKVA FPFDDHNCPPIQLI  FCQSAYSWLK
Sbjct  181   IKFFETHHQGKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPIQLITLFCQSAYSWLK  240

Query  852   EDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIR  1031
             ED EN+VVVHCKAGMARTGLMISSLLLYLK FPT EESINYYNQKRC+D KGLVLPSQIR
Sbjct  241   EDTENIVVVHCKAGMARTGLMISSLLLYLKLFPTTEESINYYNQKRCVDGKGLVLPSQIR  300

Query  1032  YVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKD  1211
             YVKYFE IL  FNGEN PARRCMLRG RLHKCPYWIRPSITIS+HNGVLFSTKKHP+TK+
Sbjct  301   YVKYFECILKNFNGENPPARRCMLRGLRLHKCPYWIRPSITISNHNGVLFSTKKHPKTKN  360

Query  1212  LLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILN  1391
             L+PED+WFS+ KKG+++F LPGEPG+ ELAGDFK+HF+DRQGDFYCWLNTTMIENR  L+
Sbjct  361   LMPEDFWFSSKKKGILLFGLPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTMIENRISLS  420

Query  1392  TSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphs  1571
             T++ D FDKRKLPSPGFQV+IV++DYD + P +P         +  + +       S   
Sbjct  421   TTEFDDFDKRKLPSPGFQVDIVMIDYDGSLPQKP-------PSTDVSRAGGSLVTESASR  473

Query  1572  aDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGS-P  1748
                     +N+  GS +KDD+FSD++AE+TG          +DG    +     +  S  
Sbjct  474   ESSKPSPKANEDLGSHDKDDIFSDSDAEDTGSSSSRHAQTGSDGRGPAIFGGSKSKASVK  533

Query  1749  QISSLTQKIEQVSLGDSGLKH-------NEQKRDTTVGAASVPEVSNTEVSDFKIMAADA  1907
             + + + + I+QVSL + G+         NE   D +        + +T  S  K +AADA
Sbjct  534   ETTDIAKGIKQVSLKNEGVNQTPDARVRNEGNSDRSSSMLEAHSLDSTSASVIKAIAADA  593

Query  1908  SVFTFGDEEDYESE  1949
             SVF+FGDE+DYESE
Sbjct  594   SVFSFGDEDDYESE  607



>ref|XP_008670992.1| PREDICTED: uncharacterized protein LOC103648286 [Zea mays]
 tpg|DAA42664.1| TPA: hypothetical protein ZEAMMB73_468766 [Zea mays]
Length=652

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/587 (65%), Positives = 456/587 (78%), Gaps = 27/587 (5%)
 Frame = +3

Query  240   SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTS-  413
             S LS+WAK+LKIPQP  G  +E  +G   K+ FAR TSG G+  SPK+   D+ +EG++ 
Sbjct  76    SGLSSWAKNLKIPQPSPG--QESPTG---KNTFARLTSGLGLRLSPKAAQQDEGAEGSTS  130

Query  414   -TTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIA  590
              TT Q    G+ TKG+VDSSKNAVKAV VKARH+VSQNKRRYQEGGFDLD+TYITEN+IA
Sbjct  131   PTTGQPGVFGSLTKGIVDSSKNAVKAVQVKARHMVSQNKRRYQEGGFDLDMTYITENIIA  190

Query  591   MGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVA  770
             MGFPAGD+SSG FGY EGFYRNHMEEVI+FFE HHK KYKVYNLCSERLYD SLFEGKVA
Sbjct  191   MGFPAGDLSSGLFGYFEGFYRNHMEEVIRFFEMHHKGKYKVYNLCSERLYDASLFEGKVA  250

Query  771   SFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFP  950
              FPFDDHNCPPIQL++SFC SAYSWLKEDIENVVVVHCKAG ARTGLMISSLLL+LKFFP
Sbjct  251   CFPFDDHNCPPIQLVISFCHSAYSWLKEDIENVVVVHCKAGKARTGLMISSLLLFLKFFP  310

Query  951   TAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCP  1130
             TAEESI YYNQKRC+D KGL+LPSQIRYVKYFERIL YFNGENQP RRCMLRGFRLH+CP
Sbjct  311   TAEESIEYYNQKRCVDGKGLILPSQIRYVKYFERILTYFNGENQPPRRCMLRGFRLHRCP  370

Query  1131  YWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDF  1310
             YWIRPSIT+S+HNGVLFSTKKHPRTK+L+PED+WFSAPKKG++VFALPGEPG+AE+AGDF
Sbjct  371   YWIRPSITVSNHNGVLFSTKKHPRTKELMPEDFWFSAPKKGIMVFALPGEPGLAEVAGDF  430

Query  1311  KVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTR  1490
             K+ F+DRQGDFYCWLNTTM+ENR  LN +DLD FDKRKLPSPGFQ+E+VLVDYD + P +
Sbjct  431   KIQFHDRQGDFYCWLNTTMMENRVTLNPTDLDDFDKRKLPSPGFQIEVVLVDYDGSQPAK  490

Query  1491  PQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGS-SEKDDVFSDNEAEETGK  1667
             P+P     +  + + S   +S S+    + AA   SN+ +GS +++D+VFSD++ E+ G 
Sbjct  491   PKP----GAGPAADKSHADSSASTVAKENSAAPEESNKGTGSNNDRDEVFSDSDGED-GS  545

Query  1668  PKVGKVTVATDG---VQAKVSTSGNNTGSPQISSLTQKIEQVSLGD----------SGLK  1808
                 K   A  G   V A   +   N      S+   ++++V++            + LK
Sbjct  546   SNGRKEKTAGGGQSSVNAAKPSQTGNMEEAAASAAASRLDKVAISSEQGTTKAPDGTSLK  605

Query  1809  HNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                  + ++  A   P   ++ +S+FK +AADASVF+FGDE+DYESE
Sbjct  606   TEVSSKASSTTAPPPPAADSSSMSEFKAIAADASVFSFGDEDDYESE  652



>emb|CDP02533.1| unnamed protein product [Coffea canephora]
Length=606

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/620 (61%), Positives = 449/620 (72%), Gaps = 31/620 (5%)
 Frame = +3

Query  141   MDTQLSNASNPQPSVTANMETSNVNSVPAQDGP---------SKLSTWAKSLKIPQPFTG  293
             MDT   +++NP  S  +++E   V +      P         S +S+WAK LK+PQP   
Sbjct  1     MDTNSGDSANPHSSEGSDVEPRVVTATAVDSSPRGSSSMLSTSAISSWAKGLKLPQPLAP  60

Query  294   SQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSK  473
             +     +GNA KS F+R  SGFG L+ P  P +D+S  +S   QS    + TKG+VDSS 
Sbjct  61    ATPNSQAGNAPKSAFSRLASGFG-LNFPLKP-NDSSGDSSAAAQSGVFESLTKGIVDSSF  118

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             +AVKAV VKARH+VSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFG+VEG YR
Sbjct  119   SAVKAVQVKARHIVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGFVEGLYR  178

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             NHMEEVIKFFETHHK KYKVYNLCSERLYD SLF+GKVASFPFDDHNCPPI LI  FCQS
Sbjct  179   NHMEEVIKFFETHHKGKYKVYNLCSERLYDASLFQGKVASFPFDDHNCPPIHLIKLFCQS  238

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
             AYSWLKEDI NVVVVHCKAGMARTGLMI SLLL+LKFFPTAEE I+YYNQKRC+D KGL+
Sbjct  239   AYSWLKEDILNVVVVHCKAGMARTGLMICSLLLFLKFFPTAEECIDYYNQKRCVDGKGLI  298

Query  1014  LPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKK  1193
             LP QIRYVKYFERIL +FNGE  P RRCMLRGFRLHKCPYWIRP+ITIS+H+GVLFSTKK
Sbjct  299   LPGQIRYVKYFERILTHFNGETPPGRRCMLRGFRLHKCPYWIRPAITISNHSGVLFSTKK  358

Query  1194  HPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIE  1373
             HP+TKDL+PED+W  A KKG+VVFALPGEPG+ ELAGDFK+HF DRQGDFYCWLNTTM+E
Sbjct  359   HPKTKDLMPEDFWLRAAKKGIVVFALPGEPGLTELAGDFKIHFQDRQGDFYCWLNTTMME  418

Query  1374  NRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpas  1553
             NR +L++SDLDGFDKRKLPSPGFQVEIV++DYD    ++ + +           S   +S
Sbjct  419   NRVLLDSSDLDGFDKRKLPSPGFQVEIVMIDYDGTISSKFKADQVAKGSDGRVGSQASSS  478

Query  1554  gssphsaDEAADANSNQKSGSSEK---DDVFSDNEAEET--GKPKVGKVTVATDGVQAKV  1718
                     +  DAN+ Q   + ++   DDVFSD++ E +   K  V   + A        
Sbjct  479   --------DRNDANTAQVEVTPKRDNDDDVFSDSDGEGSVPSKRSVDNTSSAVGTTSPLE  530

Query  1719  STSGNNTGSPQISSLTQKIEQVSLGDSGLKH---NEQKRDTTVGAASVPEVSNTEVSDFK  1889
             S S +N    QI+S T + +Q+SLG     H   N  K     G   V  + N    D K
Sbjct  531   SGSKDN----QITSFTDQTKQLSLGSKESAHFQTNTSKETKFDGVERVDSIPNLGSGDIK  586

Query  1890  IMAADASVFTFGDEEDYESE  1949
              +AADASVF+FGD+EDYESE
Sbjct  587   AIAADASVFSFGDDEDYESE  606



>ref|XP_002278436.1| PREDICTED: uncharacterized protein LOC100259289 [Vitis vinifera]
 ref|XP_010652784.1| PREDICTED: uncharacterized protein LOC100259289 [Vitis vinifera]
Length=600

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/601 (65%), Positives = 464/601 (77%), Gaps = 24/601 (4%)
 Frame = +3

Query  162   ASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFA  341
             A +P P+V A  + S  +S P     S +S+WAK+LKIPQP   +Q++  +G+  KS F+
Sbjct  19    AESPTPAV-ATQDRSTHDSPPLLSA-SGISSWAKNLKIPQPLAATQDDSQTGDGGKSTFS  76

Query  342   RFTSGFGMLSSPKSPTDDNSE-GTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVS  518
             RFTSGFG+  SP +P    S   TSTT Q   + +FTKGLVDSSK+AVKAV VKARH+VS
Sbjct  77    RFTSGFGLRLSPAAPMPAESVVSTSTTTQPGVLESFTKGLVDSSKSAVKAVQVKARHIVS  136

Query  519   QNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHK  698
             QNKRRYQEG FDLD+TYITEN+IAMGFPAGDMSSGF G++EGFYRNHMEEVIKFFETHHK
Sbjct  137   QNKRRYQEGEFDLDMTYITENIIAMGFPAGDMSSGFLGFIEGFYRNHMEEVIKFFETHHK  196

Query  699   DKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVV  878
              KYKVYNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI SFCQSAYSWLK+DIENVVVV
Sbjct  197   GKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLITSFCQSAYSWLKQDIENVVVV  256

Query  879   HCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERIL  1058
             HCKAGMARTGLM+SSLLL+LKFFPTAEESINYYNQKRC+D KGLVLPSQIRYVKYFERIL
Sbjct  257   HCKAGMARTGLMLSSLLLFLKFFPTAEESINYYNQKRCLDGKGLVLPSQIRYVKYFERIL  316

Query  1059  MYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFS  1238
              +FNG+N P RRCMLRGFRLH+CP W RPSIT+SDHNG+LFST+KHP+TKDL+PED+W S
Sbjct  317   THFNGQNPPGRRCMLRGFRLHRCPSWFRPSITVSDHNGILFSTRKHPKTKDLMPEDFWIS  376

Query  1239  APKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDK  1418
             A KKG+VVFALP EPG+AELAGDFK HF+D +GDFYCWLNTTM ENRKIL+T DLDGF+K
Sbjct  377   AAKKGIVVFALPREPGLAELAGDFKFHFHDSEGDFYCWLNTTMTENRKILSTYDLDGFEK  436

Query  1419  RKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANS  1598
             RKLPSPGFQVE+V++DYD    TR + +++ +    ++      SG        AA +N 
Sbjct  437   RKLPSPGFQVEVVMIDYDGTIQTRFKSDSSRNGSDGNSGYVPAPSGGV------AATSNQ  490

Query  1599  NQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIE  1778
             ++ S S + DDVFSD+E EE         T ++   QA+ +TSG   G+P   S +  +E
Sbjct  491   SKVSESQDNDDVFSDSEGEE---------TESSTRKQAQ-TTSGTGHGAPGPKSGS-TVE  539

Query  1779  QVSLGDSGLKH----NEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYES  1946
             Q++    G +H    +EQ            + +  EVSDFK +AADASVF+FGDEEDYES
Sbjct  540   QIAGIKHGTEHLSLVSEQPSQINPSKEPKSDGALQEVSDFKAIAADASVFSFGDEEDYES  599

Query  1947  E  1949
             E
Sbjct  600   E  600



>gb|KDP31989.1| hypothetical protein JCGZ_12450 [Jatropha curcas]
Length=616

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/629 (59%), Positives = 456/629 (72%), Gaps = 36/629 (6%)
 Frame = +3

Query  99    PPATFRTLVPSLSTMDTQLSNASNPQPSVTANMETSNVNSVPAQD----GPSKLSTWAKS  266
             PPA   ++ P +     ++SN+ +P  +  AN E +  N+    D     P+   +  +S
Sbjct  12    PPAQASSIEPPV-----KVSNSGSP--AKAANTEPAAQNATRHDDTVGESPASSVSSQRS  64

Query  267   LKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTSTTPQSSFIGT  443
               +PQP     ++  S ++  S F+R TSGFG+  +  +P  +++S+G + + Q+    +
Sbjct  65    SNLPQPTRPPTDQ--SASSGISAFSRLTSGFGLHFASAAPGPNESSKGNAASEQAGVFES  122

Query  444   FTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSG  623
              TKGLVDSS++AVKA+ VKARH VSQNKRRYQEGGFDLD+ YITEN+IAMGFPAGD+SSG
Sbjct  123   LTKGLVDSSRSAVKAMQVKARHAVSQNKRRYQEGGFDLDMAYITENIIAMGFPAGDLSSG  182

Query  624   FFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPP  803
              FG++EGFYRNHMEEVI F ETHHK KYKVYNLCSERLYD + F GKVA FPFDDHNCPP
Sbjct  183   LFGFIEGFYRNHMEEVISFLETHHKGKYKVYNLCSERLYDAAKFGGKVACFPFDDHNCPP  242

Query  804   IQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQ  983
             I LI+SFC+SAYSWLKEDIENVVVVHCKAGM RTG+MI SLLL+LKFFPTA E+I+Y+NQ
Sbjct  243   IHLIISFCKSAYSWLKEDIENVVVVHCKAGMGRTGVMICSLLLFLKFFPTANEAIDYFNQ  302

Query  984   KRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISD  1163
             KRC+D K + LPSQIRYVKYFERIL YFNGENQP RRCMLRGFRLHKCPYWIRPSITIS+
Sbjct  303   KRCIDGKAITLPSQIRYVKYFERILTYFNGENQPGRRCMLRGFRLHKCPYWIRPSITISN  362

Query  1164  HNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDF  1343
             H+GVLFSTKKHP+TKDL+PED+W SAPKKG++VFALPGEPG+ EL GDFK+ F+DRQGDF
Sbjct  363   HSGVLFSTKKHPKTKDLMPEDFWISAPKKGILVFALPGEPGLTELMGDFKIQFHDRQGDF  422

Query  1344  YCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavssks  1523
             YCWLNTTM ENRK L+ S+LD FDKRKLPSPGFQVE+V++DYD   P RP+ +       
Sbjct  423   YCWLNTTMTENRKTLDASELDCFDKRKLPSPGFQVEVVMIDYDGT-PPRPKAD-------  474

Query  1524  sdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDG  1703
                  +   S  S   +++   ANSNQ+  S  +DDVFSD++ EE G PK  K   +  G
Sbjct  475   -----SASTSLGSISKSNDGVAANSNQRKFSENEDDVFSDSDGEENGAPKSSKADAS--G  527

Query  1704  VQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAA-------SVPEV  1862
             V +  S   +N    QI SLTQ  EQ+S G     H      T+ G          +P +
Sbjct  528   VGSPQSGQTSNITEEQIKSLTQGTEQLSTGSREPSHVNASEGTSSGGIKKPVSGLEIPNL  587

Query  1863  SNTEVSDFKIMAADASVFTFGDEEDYESE  1949
              + E SD K +AADASVFTFGDEEDYESE
Sbjct  588   GSVEASDIKAIAADASVFTFGDEEDYESE  616



>ref|XP_007047377.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN isoform 1 [Theobroma 
cacao]
 ref|XP_007047378.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN isoform 1 [Theobroma 
cacao]
 gb|EOX91534.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN isoform 1 [Theobroma 
cacao]
 gb|EOX91535.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN isoform 1 [Theobroma 
cacao]
Length=650

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/617 (61%), Positives = 457/617 (74%), Gaps = 23/617 (4%)
 Frame = +3

Query  126   PSLSTMDTQLSNASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEE  305
             P    +D +   AS+  P+VTA   +S  +S P+    + +S+WA++LK PQP   SQ  
Sbjct  48    PPARAVDVEPPKASDNPPTVTAKTNSS-YDSPPSVLSSTAISSWARNLKFPQPVAPSQGS  106

Query  306   ENSGNAAKSPFARFTSGFGM-LSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAV  482
             + +GNA  S FARFTSG G+ L S   P DD++E TST  Q+  + +F KG+VDSS++AV
Sbjct  107   Q-AGNAGTSAFARFTSGLGLRLQSMSLPPDDSAEHTSTATQA-VLESFKKGIVDSSRSAV  164

Query  483   KAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHM  662
             KAV VKARH+VSQNKRRYQEG FDLD+TYITEN+IAMGFPAGD+SSG FG+ EGFYRNHM
Sbjct  165   KAVQVKARHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDLSSGLFGFFEGFYRNHM  224

Query  663   EEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYS  842
             EEVIKFFETHHK +YKVYNLCSERLYD SLF+GKVASFPFDDHNCP +QLI SFCQSAYS
Sbjct  225   EEVIKFFETHHKGRYKVYNLCSERLYDASLFQGKVASFPFDDHNCPQLQLIKSFCQSAYS  284

Query  843   WLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPS  1022
             WLKEDIENVVVVHCKAGM RTGLMI SLLL+LKFFPTAEE+I+Y+NQKRC+D K LVLPS
Sbjct  285   WLKEDIENVVVVHCKAGMGRTGLMICSLLLFLKFFPTAEEAIDYFNQKRCIDGKALVLPS  344

Query  1023  QIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPR  1202
             QIRYVKYFE IL +FNGENQP RRCMLRGFRLHKCPYWIRPSITIS+H+G LFS +KHP+
Sbjct  345   QIRYVKYFECILRHFNGENQPGRRCMLRGFRLHKCPYWIRPSITISNHSGTLFSARKHPK  404

Query  1203  TKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRK  1382
             TKDL+PED+W  APKKG+VVFALPG+PG+ EL GDFK+ F+DRQGDFYCWLNTTMIENR 
Sbjct  405   TKDLMPEDFWIKAPKKGIVVFALPGQPGLTELVGDFKIQFHDRQGDFYCWLNTTMIENRT  464

Query  1383  ILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgss  1562
             IL+TSDLDGFDK  +P PGF+VE+V+VDYD      PQ  +  +S + +    +  +   
Sbjct  465   ILDTSDLDGFDKITVPYPGFKVELVMVDYDGI----PQSNSNTNSVNEETQGNSSYTKDG  520

Query  1563  phsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTG  1742
                    A +  ++ SG+ + DDVFSD++ EE+G  +  +   A  G    VS+   N  
Sbjct  521   V-----TARSKHSKVSGNEDNDDVFSDSDGEESGASRSRQTQAA--GAGPAVSSHLTNPA  573

Query  1743  SPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAAS-------VPEVSNTEVSDFKIMAA  1901
             + QI + T    Q+S+ +     +   +D +V           +P + +   SD K +AA
Sbjct  574   AEQIGTSTHGTHQLSVKNQERALSNASKDVSVNGVGKPCSGLEIPNLDSMGASDIKAIAA  633

Query  1902  DASVFTFGD-EEDYESE  1949
             DASVF+FGD EEDYESE
Sbjct  634   DASVFSFGDEEEDYESE  650



>ref|XP_006339853.1| PREDICTED: putative tyrosine-protein phosphatase TPTE-like [Solanum 
tuberosum]
Length=602

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/604 (62%), Positives = 450/604 (75%), Gaps = 24/604 (4%)
 Frame = +3

Query  156   SNASNPQPSVTANMETS-NVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKS  332
             S+A  P+P  + N  ++ N +  PA    S +S+WAK+L  PQP    Q+    G+A  S
Sbjct  17    SDAEAPKPIASQNNNSAQNTSKTPA----STISSWAKTLNFPQPVAPGQQGSTVGDAGTS  72

Query  333   PFARFTSGFGM-LSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARH  509
              F+RF SG G+  +S  S  +D + G S T QS    + TKGL+D+S NAVKAV VKARH
Sbjct  73    SFSRFASGLGLSFTSKASAANDCAGGNSPTTQSGVFESITKGLIDTSLNAVKAVQVKARH  132

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
              VSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET
Sbjct  133   AVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  192

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
             HH+ KYKVYNLCSERLYD SLF GKVASFPFDDHNCPPI LI  FC SAYSWLKEDI NV
Sbjct  193   HHQGKYKVYNLCSERLYDASLFGGKVASFPFDDHNCPPIHLIKLFCLSAYSWLKEDILNV  252

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
             VVVHCKAGMARTGLMI SLLL+LKFFPTAEE INYYNQKRC+D K L+LPSQIRYVKYFE
Sbjct  253   VVVHCKAGMARTGLMICSLLLFLKFFPTAEECINYYNQKRCIDGKALILPSQIRYVKYFE  312

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDY  1229
             RIL  F GE  P RRCMLRGFR HKC  WIRPSITIS H+G+LFSTKKHP+TKDL+PED+
Sbjct  313   RILTQFGGEAPPGRRCMLRGFRFHKCSSWIRPSITISSHSGILFSTKKHPKTKDLMPEDF  372

Query  1230  WFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDG  1409
             W    +KG++VFALPGEPG+ ELAGDFK++F+D QGDFYCWLNT+M+ENR IL+ S+LDG
Sbjct  373   WIRTQRKGIMVFALPGEPGLTELAGDFKIYFHDHQGDFYCWLNTSMMENRLILDVSELDG  432

Query  1410  FDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAAD  1589
             FDKRKLPSPGF+VEIV+VDYD + P + + + A   K     + + +S  +       A+
Sbjct  433   FDKRKLPSPGFKVEIVMVDYDGSVPVKSKTDGASKGKDLRQVNISSSSEGTK------AN  486

Query  1590  ANSNQKS-GSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGS--PQISS  1760
              N N+ S G +  DDVFSD+E E+ G P     +  +    ++ + +G ++GS   QI++
Sbjct  487   LNKNKVSRGQNRGDDVFSDSEGED-GTPS----STRSQTRASQTAAAGVDSGSQKEQIAN  541

Query  1761  LTQKIEQVSLGDSGLKHN-EQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEED  1937
             LT   EQ+SL +S  K+   + +  TV  A++P   N   SD K +AADASVF+FGD+ED
Sbjct  542   LTHNTEQLSLRNSDTKNGANENKSVTVERAAIP---NLGSSDIKAIAADASVFSFGDDED  598

Query  1938  YESE  1949
             YESE
Sbjct  599   YESE  602



>ref|XP_009619625.1| PREDICTED: uncharacterized protein LOC104111597 [Nicotiana tomentosiformis]
Length=602

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/605 (61%), Positives = 444/605 (73%), Gaps = 22/605 (4%)
 Frame = +3

Query  150   QLSNASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAK  329
             + S+   P+P  +   +  N     ++   S +S+WAK+L  PQP    Q+   +G+   
Sbjct  15    KCSDTEAPKPVAS---QKDNAAQHTSKSPTSAISSWAKTLNFPQPVAPGQQGSATGDTGT  71

Query  330   SPFARFTSGFGM-LSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKAR  506
             S F+RF SG G+  +S  S  +D++ G S T QS    + TKGL+D+S NAVKAV VKAR
Sbjct  72    STFSRFASGLGLPFTSKASEANDSAGGNSPTTQSGVFESITKGLIDTSLNAVKAVQVKAR  131

Query  507   HVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFE  686
             H VSQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFE
Sbjct  132   HAVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFE  191

Query  687   THHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIEN  866
             THHK KYKVYNLCSERLYD SLF GKVASFPFDDHNCPPI LI  FCQSAYSWLKEDI N
Sbjct  192   THHKGKYKVYNLCSERLYDASLFGGKVASFPFDDHNCPPIHLIKLFCQSAYSWLKEDILN  251

Query  867   VVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYF  1046
             VVVVHCKAGMARTGLMI SLLL+LKFFPTAEE INYYNQKRC+D K L+LPSQIRYVKYF
Sbjct  252   VVVVHCKAGMARTGLMICSLLLFLKFFPTAEECINYYNQKRCVDGKALILPSQIRYVKYF  311

Query  1047  ERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPED  1226
             ERIL  F GE  P RRCMLRGFR HKC  WIRPSITIS H+G+LFSTKKHP+TKDL+PED
Sbjct  312   ERILTQFGGETPPGRRCMLRGFRFHKCSSWIRPSITISSHSGILFSTKKHPKTKDLMPED  371

Query  1227  YWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLD  1406
             +W    +KG++VFALPGEPG+ ELAGDFK++F+DRQGDFYCWLNT+M+ENR IL  S+LD
Sbjct  372   FWIRTQRKGIMVFALPGEPGLTELAGDFKIYFHDRQGDFYCWLNTSMMENRLILGVSELD  431

Query  1407  GFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAA  1586
             GFDKRKLPSPGFQVEIV+VDYD + P + + + A   K     +++ +S           
Sbjct  432   GFDKRKLPSPGFQVEIVMVDYDGSVPEKSKADGAAKGKDPRQGNSSSSSERIK------G  485

Query  1587  DANSNQKSGSSEK-DDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGS--PQIS  1757
             + N N  SG   + DDVFSD++ EE         T A+     + + +G ++GS   QI+
Sbjct  486   NLNKNTVSGGQNRGDDVFSDSDGEEAAPSSTKSRTSAS-----QTAAAGVDSGSQKEQIA  540

Query  1758  SLTQKIEQVSLGDSGLKHNEQK-RDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEE  1934
             +LT   EQ+SL  S  K    + +D TV  A++P   N   SD K +AADASVF+FGD++
Sbjct  541   NLTHNAEQLSLRSSDPKSGASEIKDETVERAAIP---NLGSSDIKAIAADASVFSFGDDD  597

Query  1935  DYESE  1949
             DYESE
Sbjct  598   DYESE  602



>ref|XP_006494490.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Citrus 
sinensis]
Length=674

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/581 (64%), Positives = 437/581 (75%), Gaps = 20/581 (3%)
 Frame = +3

Query  237   PSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNS-EGTS  413
             PS +S+WAK+LK PQP    Q+   +G+   SPFARFTS  G+     +P  D S EGTS
Sbjct  104   PSNISSWAKTLKFPQPVPPPQDNMQTGSPRMSPFARFTSELGLRLPSMTPVADKSAEGTS  163

Query  414   TTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAM  593
             TT  +  + + TKGLVDSS++AVKAV VKARH+VSQNKRRYQEG FDLD+TYITEN+IAM
Sbjct  164   TTNPTGVLESLTKGLVDSSRSAVKAVQVKARHIVSQNKRRYQEGEFDLDMTYITENIIAM  223

Query  594   GFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVAS  773
             GFPAGD+SSGFFGY EG YRNHMEEVIKFFETHHK KYKVYNLCSERLYD +LF+GKVA 
Sbjct  224   GFPAGDISSGFFGYFEGLYRNHMEEVIKFFETHHKGKYKVYNLCSERLYDAALFQGKVAC  283

Query  774   FPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPT  953
             FPFDDHNCPPIQLI SFC+SAYSWLKEDI NVVVVHCKAGMARTGLMI SLLL+LKFFPT
Sbjct  284   FPFDDHNCPPIQLIASFCRSAYSWLKEDILNVVVVHCKAGMARTGLMICSLLLFLKFFPT  343

Query  954   AEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPY  1133
             AEE+I+YYNQKRC+D K LVLPSQIRYVKYFERIL Y NGE QPARRCMLRGFRL +CPY
Sbjct  344   AEEAIDYYNQKRCVDGKALVLPSQIRYVKYFERILTYSNGEIQPARRCMLRGFRLLQCPY  403

Query  1134  WIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFK  1313
             WIRPSI I +H+G+LFST+KHP+TKDL+PED+W  APKKG+VVFALPGEPG+ EL GDFK
Sbjct  404   WIRPSIAIFNHSGILFSTRKHPKTKDLMPEDFWIKAPKKGIVVFALPGEPGLTELVGDFK  463

Query  1314  VHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRP  1493
             V F+DRQGDFYCWLNTTM ENRKIL+ SDLDGFDKRK+PSPGFQVEIV++DYD   PT+ 
Sbjct  464   VLFHDRQGDFYCWLNTTMTENRKILDGSDLDGFDKRKVPSPGFQVEIVMIDYDGILPTKT  523

Query  1494  QPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPK  1673
             + ++A   +      A+  +G +          N  + + S + DDVFSD++ EE    K
Sbjct  524   KSDSANRRQDCSTDYASVPTGGATIG------PNHRKVTKSEDNDDVFSDSDGEEADTSK  577

Query  1674  VGKVTVATDGVQAKVSTSGNNTGS--PQISSLTQKIEQVSLGDSGLK-HNEQKRDTTVG-  1841
               +   A+ G  A      N+     PQ    +Q+   +SL +   K  N  K  TT G 
Sbjct  578   SRQADAASGGESAPHGILSNSMADNVPQ----SQRSGHLSLSNEKPKVKNVSKEPTTDGV  633

Query  1842  -----AASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                  +  +P + +   SD K MAADASVF+FGD+EDYESE
Sbjct  634   REPASSLPMPNLDSMGASDIKSMAADASVFSFGDDEDYESE  674



>gb|KHG14004.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
phosphatase PTEN [Gossypium arboreum]
Length=592

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/592 (65%), Positives = 439/592 (74%), Gaps = 41/592 (7%)
 Frame = +3

Query  228   QDGPSKLSTWAKSLKIPQPFTGSQEEEN-SGNAAKSPFARFTSGFGMLSSPKSPT-DDNS  401
             +D PSKLS+W ++LKIPQPF  SQEE   +G A KS F+RFTSG G+ S  KS T D N+
Sbjct  24    EDAPSKLSSWTRNLKIPQPFAASQEELTPTGIAGKSTFSRFTSGLGLRSPSKSTTADGNA  83

Query  402   EGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITEN  581
             +G STT Q  F+GT TKG+VDSSKNAVKAV VKARHVVSQNKRRYQEGGFDLDL+YITEN
Sbjct  84    DGASTTTQPGFLGTITKGIVDSSKNAVKAVQVKARHVVSQNKRRYQEGGFDLDLSYITEN  143

Query  582   VIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEG  761
             +IAMGFPAGDMSSGFFGYVEGFYRNHMEEVI+FFETHHKDKYKVYNLCSERLYD SLFEG
Sbjct  144   IIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIQFFETHHKDKYKVYNLCSERLYDASLFEG  203

Query  762   KVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLK  941
             KVASFPFDDHNCPPIQLI+SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLK
Sbjct  204   KVASFPFDDHNCPPIQLILSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLK  263

Query  942   FFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQ-PARRCML-RGFR  1115
             FFPTAE+S+ YYNQKRC+D KGLVLPSQIRYVKYFER L Y   +    A  C    GF 
Sbjct  264   FFPTAEKSMGYYNQKRCVDGKGLVLPSQIRYVKYFERTLTYLMVKTSLGAGACFEDSGFF  323

Query  1116  L----HKCPYWIRPSITISDHN------GVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVF  1265
             +       P        + +H+      GVLFSTKKH RTKDL PEDYWFSAPKKGV+VF
Sbjct  324   VVLIGSGPPLQCLIITPLHNHHELPLSAGVLFSTKKHKRTKDLSPEDYWFSAPKKGVMVF  383

Query  1266  ALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQ  1445
             ALPGEPG+ ELAGDFK+HF+DRQGDFYCWLNTTM+ENRKILNTSDLD FDKRKLPSPGFQ
Sbjct  384   ALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTMMENRKILNTSDLDWFDKRKLPSPGFQ  443

Query  1446  VEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEK  1625
             VE+VL DY+   P+ P  +                  ++ +  DE++  ++   S ++ K
Sbjct  444   VEVVLADYNDPVPSNPPTK------------------TTANKPDESSGTSAAPSSNNNNK  485

Query  1626  DDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGL  1805
             DDVFSD E EE+      +   A      K  TS N     Q++SL    E+VSLG +  
Sbjct  486   DDVFSDVEEEESATSTNRQQKPAASSATTKSETSTN---PDQVTSLVHSTEKVSLGSANS  542

Query  1806  KHNEQKRDTTVGAASVPEVSNTEV----SDFKIMAADASVFTFGDEEDYESE  1949
             +      + T  AA+   V+ TEV    S+FK+MAAD SVF+FGDEEDYESE
Sbjct  543   QQTHTTGNPTKDAAAA--VAGTEVSSLESEFKVMAADTSVFSFGDEEDYESE  592



>ref|XP_009761701.1| PREDICTED: putative tyrosine-protein phosphatase TPTE [Nicotiana 
sylvestris]
Length=602

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/602 (62%), Positives = 443/602 (74%), Gaps = 22/602 (4%)
 Frame = +3

Query  159   NASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPF  338
             +A  P+P  +   +  N     ++   S +S+WAK+L  PQP    Q+    G+   S F
Sbjct  18    DAEAPKPVAS---QKDNAAQDTSKSHTSAISSWAKTLNFPQPVAPGQQGSAIGDTGTSTF  74

Query  339   ARFTSGFGM-LSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVV  515
             +RF SG G+  +S  S  +D++ G S T QS    + TKGL+D+S NAVKAV VKARH V
Sbjct  75    SRFASGLGLPFTSKASEANDSAGGNSPTTQSGVFESITKGLIDTSLNAVKAVQVKARHAV  134

Query  516   SQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHH  695
             SQNKRRYQEGGFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHH
Sbjct  135   SQNKRRYQEGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHH  194

Query  696   KDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVV  875
             K KYKVYNLCSERLYD SLF GKVASFPFDDHNCPPI LI  FCQSAYSWLKEDI NVVV
Sbjct  195   KGKYKVYNLCSERLYDASLFGGKVASFPFDDHNCPPIHLIKLFCQSAYSWLKEDILNVVV  254

Query  876   VHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERI  1055
             VHCKAGMARTGLMI SLLL+LKFFPTAEE INYYNQKRC+D K L+L SQIRYVKYFERI
Sbjct  255   VHCKAGMARTGLMICSLLLFLKFFPTAEECINYYNQKRCVDGKALILLSQIRYVKYFERI  314

Query  1056  LMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWF  1235
             L  F GE  P RRCMLRGFR HKC  WIRPSITIS H+G+LFSTKKHP+T+DL+PED+W 
Sbjct  315   LTQFGGETPPGRRCMLRGFRFHKCSSWIRPSITISSHSGILFSTKKHPKTRDLMPEDFWI  374

Query  1236  SAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFD  1415
              A +KG++VFALPGEPG+ ELAGDFK++F+DRQGDFYCWLNT+M+ENR IL  S+LDGFD
Sbjct  375   RAQRKGIMVFALPGEPGLTELAGDFKIYFHDRQGDFYCWLNTSMMENRLILGVSELDGFD  434

Query  1416  KRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADAN  1595
             KRKLPSPGFQVEIV+VDYD + P + + + A   K     +++ +S           + N
Sbjct  435   KRKLPSPGFQVEIVMVDYDGSVPVKSKADGAAKGKDPRQGNSSSSSEGIK------GNLN  488

Query  1596  SNQKSGS-SEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGS--PQISSLT  1766
              N+ SG  +  DDVFSD++ EE         T A+     + + +G ++GS   QI++LT
Sbjct  489   KNKVSGGQNHGDDVFSDSDGEEAAPSSTKSQTSAS-----QTAAAGVDSGSQKEQIANLT  543

Query  1767  QKIEQVSLGDSGLKHNEQK-RDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYE  1943
                EQ+SL  S  K    + +D TV  A++P   N   SD K +AADASVF+FGD++DYE
Sbjct  544   HNAEQLSLRSSDPKSGASEIKDETVERAAIP---NLGSSDIKAIAADASVFSFGDDDDYE  600

Query  1944  SE  1949
             SE
Sbjct  601   SE  602



>ref|XP_011099098.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Sesamum 
indicum]
Length=677

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/587 (63%), Positives = 437/587 (74%), Gaps = 21/587 (4%)
 Frame = +3

Query  213   NSVPAQDGPSKLST-----WAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGM-LSS  374
             N    QD  S LST     WAKSLK+PQ     Q++  S N  K  F+R  SG G+ +SS
Sbjct  104   NKSSTQDSSSMLSTSTISSWAKSLKLPQ----IQQDSESANPGKFTFSRLASGIGLQISS  159

Query  375   PKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFD  554
               S + +++  +S + QS  I +FTKG+VDSS NAVKAV VKARH+VSQNKRRYQEGGFD
Sbjct  160   KASASTESANNSSASAQSGAIESFTKGIVDSSLNAVKAVQVKARHIVSQNKRRYQEGGFD  219

Query  555   LDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSER  734
             LD+TYITEN+IAMGFPAGD+SSG FG+ EGFYRNHMEEVIKFFETHHK KYKVYNLCSER
Sbjct  220   LDMTYITENIIAMGFPAGDLSSGLFGFFEGFYRNHMEEVIKFFETHHKGKYKVYNLCSER  279

Query  735   LYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLM  914
             LYD SLFEGKVASFPF+DHNCPPI LI  FCQSAYSWLKEDI NVVVVHCKAG ARTGLM
Sbjct  280   LYDASLFEGKVASFPFEDHNCPPIHLIKLFCQSAYSWLKEDILNVVVVHCKAGKARTGLM  339

Query  915   ISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARR  1094
             I SLLL+LKFFPTAEE I+YYNQKRC+D+KGL+LPSQIRYVKYFERIL  FNGE  P RR
Sbjct  340   ICSLLLFLKFFPTAEECIDYYNQKRCVDSKGLILPSQIRYVKYFERILTQFNGETPPGRR  399

Query  1095  CMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALP  1274
             CMLRGFRLH CPYW+RP+ITIS+HNG LFSTKKHP+TK+L+PED+W  A KKG+VVFALP
Sbjct  400   CMLRGFRLHNCPYWVRPAITISNHNGELFSTKKHPKTKNLMPEDFWIRAQKKGIVVFALP  459

Query  1275  GEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEI  1454
             GEPG+ EL GDFKVHF+DRQGDFYCW+NTTM+ENR IL  SDLDGFD RKLPSPGFQVEI
Sbjct  460   GEPGLTELVGDFKVHFHDRQGDFYCWMNTTMMENRVILEGSDLDGFDNRKLPSPGFQVEI  519

Query  1455  VLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDV  1634
             V++DYD   P + + +       + N+    +  +   S ++A    SN     + +DDV
Sbjct  520   VMIDYDGTIPPKMKTD------RNKNNGDGKSRDAPSSSENKANSQQSNTSRKQNNEDDV  573

Query  1635  FSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLG-DSGLKH  1811
             FSD+E EE         T++  G  A+ S SG  T    I +++ + EQ+SLG +S    
Sbjct  574   FSDSEGEEPASRSTMNQTLSAAGT-ARHSESG--TKDEHIPTISHQTEQLSLGRESTSSQ  630

Query  1812  NEQKRDTTVGAAS-VPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             +   R+  +      P + + + +D K +AADASVF+F D+EDYESE
Sbjct  631   SRNSREMKINVVERAPTIPDLDTTDIKAIAADASVFSFADDEDYESE  677



>ref|XP_002310706.1| hypothetical protein POPTR_0007s10610g [Populus trichocarpa]
 gb|EEE91156.1| hypothetical protein POPTR_0007s10610g [Populus trichocarpa]
Length=581

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/548 (66%), Positives = 422/548 (77%), Gaps = 22/548 (4%)
 Frame = +3

Query  330   SPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARH  509
             S F+RFTSGFG L      T+++S+G +T+ QS    +FTKGLVDSS+NAVKA+ VKARH
Sbjct  48    SAFSRFTSGFGSL---LPNTEESSQGNATSTQSGVFESFTKGLVDSSRNAVKAMQVKARH  104

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             VVSQNKRRYQEGGFDLD+ YITEN+IAMGFPAGD+SSG FG+ EGFYRNHMEEVIKFFET
Sbjct  105   VVSQNKRRYQEGGFDLDMAYITENIIAMGFPAGDISSGLFGFFEGFYRNHMEEVIKFFET  164

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
             HHK KYKVYNLCSERLYD S F GKVA FPFDDHNCPP+QLI SFCQSAYSWLKEDI+NV
Sbjct  165   HHKGKYKVYNLCSERLYDASRFGGKVACFPFDDHNCPPLQLITSFCQSAYSWLKEDIQNV  224

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
             VVVHCKAGM RTGLMI SLLL+LKFFPTAEE+I+Y+NQKRC+D K LVLPSQIRYVKYFE
Sbjct  225   VVVHCKAGMGRTGLMICSLLLFLKFFPTAEEAIDYFNQKRCVDGKALVLPSQIRYVKYFE  284

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDY  1229
             RIL YFNGENQP RRCMLRGFRLH+CPYWIRPSITIS+++G+LFST+ HP+TKDL+PED+
Sbjct  285   RILTYFNGENQPERRCMLRGFRLHQCPYWIRPSITISNNSGILFSTRNHPKTKDLMPEDF  344

Query  1230  WFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDG  1409
             W  APKK +VVFALP E G+ ELAGDFK+HF+DRQGDFYCWLNTTM ENRKILN SDLDG
Sbjct  345   WIRAPKKKMVVFALPMELGLTELAGDFKIHFHDRQGDFYCWLNTTMTENRKILNGSDLDG  404

Query  1410  FDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAAD  1589
             FDKRKLPSPGFQVE+V++DYD   P R + ++A       +S    A+        +   
Sbjct  405   FDKRKLPSPGFQVEVVMIDYDGTLPARSEVDSACKGSDVTSSGHVAAT--------DGGV  456

Query  1590  ANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQ  1769
             A  + +S  +E DDVFSD+E EETG  K  +   A+ G+        +NT + Q+ +LTQ
Sbjct  457   AGHSNRSDIAENDDVFSDSEGEETGVSKSRQAQAAS-GIGLAHPDHASNTTTEQMRNLTQ  515

Query  1770  KIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNTEV--------SDFKIMAADASVFTFG  1925
               EQ+SL           ++ T G A  P    TE+        SD K +AADASVFTFG
Sbjct  516   GAEQLSLRSHEPSQINASKEPTAGGAGNP-APGTEIRHLDSGGASDIKAIAADASVFTFG  574

Query  1926  DEEDYESE  1949
             D EDYESE
Sbjct  575   D-EDYESE  581



>ref|XP_002524915.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN, putative [Ricinus communis]
 gb|EEF37412.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN, putative [Ricinus communis]
Length=636

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/614 (60%), Positives = 454/614 (74%), Gaps = 26/614 (4%)
 Frame = +3

Query  135   STMDTQLSNASNPQPSV-TANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEEN  311
             S  ++QL   +N +P+  TA+     V   P+    S +S+ ++   +PQP T    +  
Sbjct  40    SNSESQL--PANAEPAANTASRADDKVGETPS----SGISSHSRGSNLPQP-TRPLTDSQ  92

Query  312   SGNAAKSPFARFTSGFGMLSSPKSP-TDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKA  488
             +G+   S FAR TSG G+  S  +P  +++S+G+ ++ Q+  + + TKGLVDSS++AVKA
Sbjct  93    TGSFG-STFARLTSGLGLNFSSIAPGLNESSQGSISSAQTGVLESLTKGLVDSSRSAVKA  151

Query  489   VSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEE  668
             V VKARHVVSQNKRRYQEGG+DLD+ YITEN+IAMGFPAGD+SSG FG+ EGFYRNHMEE
Sbjct  152   VQVKARHVVSQNKRRYQEGGYDLDMAYITENIIAMGFPAGDLSSGLFGFFEGFYRNHMEE  211

Query  669   VIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWL  848
             VI FFETHHK KYKVYNLCSERLYD S FEGKVA FPFDDHNCPP+ LI +FC S++SWL
Sbjct  212   VINFFETHHKGKYKVYNLCSERLYDASKFEGKVACFPFDDHNCPPLHLITAFCLSSFSWL  271

Query  849   KEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQI  1028
             KEDI+NVVVVHCKAGM RTG+MI SLLL+LKFFPTA+++I+Y+NQKRC+D K LVLPSQI
Sbjct  272   KEDIQNVVVVHCKAGMGRTGVMICSLLLFLKFFPTADQAIDYFNQKRCVDGKALVLPSQI  331

Query  1029  RYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTK  1208
             RYVKYF+RIL YFNGENQP RRCMLRGFRLHKCPYWIRPSITIS+H+GVLFSTK HP+TK
Sbjct  332   RYVKYFDRILTYFNGENQPGRRCMLRGFRLHKCPYWIRPSITISNHSGVLFSTKNHPKTK  391

Query  1209  DLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKIL  1388
             DL+PED+W  APKKG+VVFALPGEPG+ EL GDFK+HF+DR GDFYCWLNTTM ENRKIL
Sbjct  392   DLMPEDFWIRAPKKGIVVFALPGEPGLTELVGDFKIHFHDRHGDFYCWLNTTMTENRKIL  451

Query  1389  NTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssph  1568
             +TSDLDGFDKRKLPSPGFQ+E+V++DYD   P R + ++      S  +S      SS  
Sbjct  452   DTSDLDGFDKRKLPSPGFQIEVVMIDYDGTSPARSKVDSLNKGSDSTRNSEYGPKPSSRV  511

Query  1569  saDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSP  1748
             +        SNQ+  S  +DDVFSD+E EE+  PK  + T +  GV +  S   +N  + 
Sbjct  512   TV-------SNQRKVSENEDDVFSDSEGEESSAPKSRQATAS--GVGSTQSDHTSNITAE  562

Query  1749  QISSLTQKIEQVSLGDSGLKH-NEQKRDTTVGAASVP------EVSNTEVSDFKIMAADA  1907
             Q+ SLT   EQ+SLG     H N  K  +  G    P       + +   SD K +AADA
Sbjct  563   QMRSLTHGTEQMSLGSRESSHFNASKGPSRDGNEKPPSGHGIRNLDSVGASDIKAIAADA  622

Query  1908  SVFTFGDEEDYESE  1949
             SVF+FGDEEDYESE
Sbjct  623   SVFSFGDEEDYESE  636



>ref|XP_004231877.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
TPTE2-like [Solanum lycopersicum]
Length=602

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/602 (61%), Positives = 441/602 (73%), Gaps = 20/602 (3%)
 Frame = +3

Query  156   SNASNPQPSVTANMETS-NVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKS  332
             S+A  P+P  + N  ++ N +  PA    S +S+WAK+L  PQP    Q+    G+A  S
Sbjct  17    SDAEAPKPIASQNNSSAQNTSKTPA----STISSWAKTLNFPQPVAPGQQGSTVGDAGTS  72

Query  333   PFARFTSGFGM-LSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARH  509
              F+RF SG G+  +S    T+D + G + T QS    + TKGL+D+S NAVKAV VKARH
Sbjct  73    SFSRFASGLGLSFTSKAFVTNDRAGGNAPTTQSGVFESITKGLIDTSLNAVKAVQVKARH  132

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
              VSQNKRRYQE GFDLD+TYITEN+IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET
Sbjct  133   AVSQNKRRYQEDGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  192

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
             HH+ KYKVYNLCSERLYD SLF GKVASFPFDDHNCPPI LI  FC SAYSWLKEDI NV
Sbjct  193   HHQGKYKVYNLCSERLYDASLFGGKVASFPFDDHNCPPIHLIKLFCLSAYSWLKEDILNV  252

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
             VVVHCKAGMARTGLMI SLLL+LKFFPTAEE INYYNQKRC+D K L+LPSQIRYVKYFE
Sbjct  253   VVVHCKAGMARTGLMICSLLLFLKFFPTAEECINYYNQKRCIDGKALILPSQIRYVKYFE  312

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDY  1229
             RIL  F GE  P RRCMLRGFR HKC  WIRPSITIS H+G+LFSTKKH +TKDL+PED+
Sbjct  313   RILTQFGGEAPPGRRCMLRGFRFHKCSSWIRPSITISSHSGILFSTKKHRKTKDLMPEDF  372

Query  1230  WFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDG  1409
             W    +KG++VFALPGEPG+ ELAGDFK++F+D QGDFYCWLNT+M+ENR IL+ S+LDG
Sbjct  373   WIRTQRKGIMVFALPGEPGLTELAGDFKIYFHDHQGDFYCWLNTSMMENRLILDVSELDG  432

Query  1410  FDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAAD  1589
             F+KRKLPSPGF+VEIV+VDYD + P +P+ + A   K     + + +S  +        +
Sbjct  433   FEKRKLPSPGFKVEIVMVDYDGSVPLKPKADGASKGKDPRQGNISSSSEGTKD------N  486

Query  1590  ANSNQKSGSSEK-DDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLT  1766
              N N+ SG   + DDVFSD+E E+         T A+    A V +S       QI++LT
Sbjct  487   LNKNKVSGGQNRGDDVFSDSEGEDGTPSSRRSQTRASQTAAAGVDSSSQKE---QIANLT  543

Query  1767  QKIEQVSLGDSGLKHNEQK-RDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYE  1943
                EQ+SL +S  K    + +  TV  A++P   N   +D K +AADASVF+FGD+EDYE
Sbjct  544   HNTEQLSLRNSDPKKGASEIKSETVERAAIP---NLGSNDIKAIAADASVFSFGDDEDYE  600

Query  1944  SE  1949
             SE
Sbjct  601   SE  602



>ref|XP_011005814.1| PREDICTED: uncharacterized protein LOC105111981 [Populus euphratica]
Length=581

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/547 (66%), Positives = 421/547 (77%), Gaps = 20/547 (4%)
 Frame = +3

Query  330   SPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARH  509
             S F+RFTSGFG+L      T+++S+G +T+ QS    +FTKGLVDSS+NAVKA+ VKARH
Sbjct  48    SAFSRFTSGFGLL---LPNTEESSQGNATSTQSGVFESFTKGLVDSSRNAVKAMQVKARH  104

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             VVSQNKRRYQEGGFDLD+ YITEN+IAMGFPAGD+SSG FG+ EGFYRNHMEEVIKFFE 
Sbjct  105   VVSQNKRRYQEGGFDLDMAYITENIIAMGFPAGDISSGLFGFFEGFYRNHMEEVIKFFEI  164

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
             HHK KYKVYNLCSERLYD S F GKVA FPFDDH+CPP+QLI SFCQSAYSWLKEDI+NV
Sbjct  165   HHKGKYKVYNLCSERLYDASRFGGKVACFPFDDHSCPPLQLITSFCQSAYSWLKEDIQNV  224

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
             VVVHCKAGM RTGLMI SLLL+LKFFPTAEE+I+Y+NQKRC+D K LVLPSQIRYVKYFE
Sbjct  225   VVVHCKAGMGRTGLMICSLLLFLKFFPTAEEAIDYFNQKRCVDGKALVLPSQIRYVKYFE  284

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDY  1229
             RIL YFNGENQP RRCMLRGFRLH+CPYWIRPSITIS+++GVLFST+KHP+TKDL+PED+
Sbjct  285   RILTYFNGENQPERRCMLRGFRLHQCPYWIRPSITISNNSGVLFSTRKHPKTKDLMPEDF  344

Query  1230  WFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDG  1409
             W  APKK +VVFALP E G+ ELAGDFK+HF+DR GDFYCWLNTTM ENRKILN SDLDG
Sbjct  345   WIRAPKKKMVVFALPMELGLTELAGDFKIHFHDRHGDFYCWLNTTMTENRKILNGSDLDG  404

Query  1410  FDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAAD  1589
             FDKRKLPSPGFQVE+V++DYD   P R + ++A       +S    A+        +   
Sbjct  405   FDKRKLPSPGFQVEVVMIDYDGTLPARSEVDSASKGSDVTSSVHVAAT--------DGGV  456

Query  1590  ANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQ  1769
             A  + +S  +E DDVFSD+E EETG  K  +   A+ G+        +NT + Q+ +LTQ
Sbjct  457   AGHSNRSDIAENDDVFSDSEGEETGVSKSRQAHAAS-GIGLAHPDHASNTTTEQMRNLTQ  515

Query  1770  KIEQVSLGDSGLKHNEQKRDTTVGAASVP----EVSNTE---VSDFKIMAADASVFTFGD  1928
               EQ+SL            + T   A  P    E+ + +    SD K +AADASVFTFGD
Sbjct  516   GAEQLSLRSHEPSQINASDEPTASGAGNPAPGIEIRHLDSGGASDIKAIAADASVFTFGD  575

Query  1929  EEDYESE  1949
              EDYESE
Sbjct  576   -EDYESE  581



>ref|XP_008440315.1| PREDICTED: uncharacterized protein LOC103484800 [Cucumis melo]
Length=605

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/617 (59%), Positives = 447/617 (72%), Gaps = 26/617 (4%)
 Frame = +3

Query  141   MDTQLSNAS------NPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQE  302
             MD   SN+S      N  P+V  + ++S V+++ +    S  S+WAKS + PQP   ++ 
Sbjct  1     MDNGTSNSSTQSAVNNSAPTV--DNQSSKVDNLTSILSTSGFSSWAKSFRNPQP-EAAKN  57

Query  303   EENSGNAAKSPFARFTSGFGMLSSPK--SPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKN  476
             + N+GN+  S  ARF+SGFG L  PK  S   D +  T++  +S    + TKGLVD+S+N
Sbjct  58    DSNAGNSGMSAIARFSSGFG-LQIPKMSSVQGDGAADTNSGMKSGVFESLTKGLVDTSQN  116

Query  477   AVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRN  656
             AVKA+ VKARH+VSQNKRRYQEG FDLDLTYITENVIAMGFPAG MSSG FG++EGFYRN
Sbjct  117   AVKAMQVKARHMVSQNKRRYQEGEFDLDLTYITENVIAMGFPAGHMSSGIFGFLEGFYRN  176

Query  657   HMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSA  836
             HMEEVIKFFETHHK KYKVYNLCSERLYD SLFEGKVA FPFDDHNCPPI LI SFCQSA
Sbjct  177   HMEEVIKFFETHHKGKYKVYNLCSERLYDASLFEGKVAHFPFDDHNCPPIHLIKSFCQSA  236

Query  837   YSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVL  1016
             Y+WLKEDIENVVVVHCKAGMARTGLMI SLLL+LKFF T+ E+++YYNQKRC+D K LVL
Sbjct  237   YAWLKEDIENVVVVHCKAGMARTGLMICSLLLFLKFFQTSPEAVDYYNQKRCVDGKALVL  296

Query  1017  PSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKH  1196
             PSQIRYVKYFERIL  FNG   P RRCMLRGFRLHKCPYW+RPSITIS+H+ +LFST+KH
Sbjct  297   PSQIRYVKYFERILTQFNGNTPPGRRCMLRGFRLHKCPYWVRPSITISNHSEILFSTRKH  356

Query  1197  PRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIEN  1376
              +TKDL+PED+W  AP+KG VVFALPGEPG+ EL+GDFK+HF+DR GDFYCWLNTTM EN
Sbjct  357   QKTKDLMPEDFWIRAPRKGFVVFALPGEPGLTELSGDFKIHFHDRHGDFYCWLNTTMTEN  416

Query  1377  RKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasg  1556
             + +L+ +DLDGFDKRKLP+PGFQVE+V++DYD   P R + ++A       +     +  
Sbjct  417   KVLLSDTDLDGFDKRKLPTPGFQVEVVMIDYDGTLPARLKTDSAGKGSDRRSIHNRASGH  476

Query  1557  ssphsaDEAADANSNQKSGSSEKDD-VFSDNEAEETG--KPKVGKVTVATDGVQAKVSTS  1727
                    EA  +NSN+ S   E DD VFSD++ EE G  K  + + T       +K   S
Sbjct  477   -------EAGQSNSNKMSEGEENDDNVFSDSD-EENGDIKTSLTQSTSGNGNGNSKTDHS  528

Query  1728  GNNTGSPQISSLTQKIEQVSLG-DSGLKHNEQKRDTTV--GAASVPEVSNTEVSDFKIMA  1898
                  S +I SL  +   +S G +   + N  K    +      +P + +   SDFK +A
Sbjct  529   STIIFSERIGSLAHETSHLSFGNEKNSQPNAPKEPAAIQPSGLEIPNLDSVRASDFKAIA  588

Query  1899  ADASVFTFGDEEDYESE  1949
             ADASVFTFGDEED++SE
Sbjct  589   ADASVFTFGDEEDFDSE  605



>ref|XP_004141902.1| PREDICTED: putative tyrosine-protein phosphatase TPTE-like [Cucumis 
sativus]
 ref|XP_004165717.1| PREDICTED: putative tyrosine-protein phosphatase TPTE-like [Cucumis 
sativus]
 gb|KGN48550.1| hypothetical protein Csa_6G491620 [Cucumis sativus]
Length=607

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/617 (59%), Positives = 446/617 (72%), Gaps = 24/617 (4%)
 Frame = +3

Query  141   MDTQLSNAS------NPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQE  302
             MD   SN+S      N  P+V  + ++S V+++ +    S +S+WAKS + PQP   ++ 
Sbjct  1     MDNGTSNSSTQSAVNNSAPTV--DNQSSKVDNLTSILSTSGISSWAKSFRNPQPPEAAKN  58

Query  303   EE-NSGNAAKSPFARFTSGFGM-LSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKN  476
             ++ N GN+  S  ARF+SGFG  + +  S   D +  T +  +S    + TKGLVD+S+N
Sbjct  59    DDSNPGNSGMSAIARFSSGFGFQIPTMSSVQGDGAADTKSGMKSGVFESLTKGLVDTSQN  118

Query  477   AVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRN  656
             AVKA+ VKARH+VSQNKRRYQEG FDLDLTYITEN+IAMGFPAG MSSG FG++EGFYRN
Sbjct  119   AVKAMQVKARHMVSQNKRRYQEGEFDLDLTYITENIIAMGFPAGHMSSGLFGFLEGFYRN  178

Query  657   HMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSA  836
             HMEEVIKFFETHHK KYKVYNLCSERLYD SLFEGKVA FPFDDHNCPPI LI SFCQSA
Sbjct  179   HMEEVIKFFETHHKGKYKVYNLCSERLYDASLFEGKVAHFPFDDHNCPPIHLIKSFCQSA  238

Query  837   YSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVL  1016
             Y+WLKEDIENVVVVHCKAGMARTGLMI SLLL+LKFF T+ E+I+YYNQKRC+D K LVL
Sbjct  239   YTWLKEDIENVVVVHCKAGMARTGLMICSLLLFLKFFQTSPEAIDYYNQKRCVDGKALVL  298

Query  1017  PSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKH  1196
             PSQIRYVK+FERIL  FNG+  P RRCMLRGFRLHKCPYW+RPSITIS+H+ +LFSTKKH
Sbjct  299   PSQIRYVKHFERILTQFNGKTPPGRRCMLRGFRLHKCPYWVRPSITISNHSEILFSTKKH  358

Query  1197  PRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIEN  1376
              +TKDL+PED+W  AP+KG VVFALPGEPG+ EL+GDFK+HF++R GDFYCWLNTTM EN
Sbjct  359   QKTKDLMPEDFWIRAPRKGFVVFALPGEPGLTELSGDFKIHFHERHGDFYCWLNTTMTEN  418

Query  1377  RKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasg  1556
             + +L+ +DLDGFDKRKLP+PGFQVE+V++DYD + P R + ++A       +     +  
Sbjct  419   KVLLSDTDLDGFDKRKLPTPGFQVEVVMIDYDGSLPARLKTDSAGKGSDRRSIHNRASDH  478

Query  1557  ssphsaDEAADANSNQKSGSSEKDD-VFSDNEAEETG--KPKVGKVTVATDGVQAKVSTS  1727
                    EA  +NSN+ S   E DD VFSD++ EE G  K  + + T       +K   S
Sbjct  479   -------EAGQSNSNKMSEGEENDDNVFSDSD-EENGDIKTSLTRSTSGNGNGNSKADHS  530

Query  1728  GNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTV---GAASVPEVSNTEVSDFKIMA  1898
                  S +I SL  +   +S G+         +   V       +P + +   SDFK +A
Sbjct  531   STTISSERIGSLAHETSHLSFGNEKNSQPNASKGPAVIQPSGLEIPNLDSVRASDFKAIA  590

Query  1899  ADASVFTFGDEEDYESE  1949
             ADASVFTFGDEED++SE
Sbjct  591   ADASVFTFGDEEDFDSE  607



>ref|XP_003516608.1| PREDICTED: uncharacterized protein LOC100801622 [Glycine max]
Length=606

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/616 (58%), Positives = 440/616 (71%), Gaps = 36/616 (6%)
 Frame = +3

Query  159   NASNPQPSVTANMETSNVNSVPAQDG----------PSKLSTWAKSLKIPQPF-TGSQEE  305
             ++S P P  + N E  +   V  Q G           S +S+WA++LK PQ    G+Q+ 
Sbjct  8     SSSQPTPPAS-NTEEQHSTKVSGQPGNAHDSQLSSPTSGISSWARNLKFPQALGLGAQQN  66

Query  306   ENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVK  485
               + NA  S FAR T G G+    ++P+++ +   S   QS+ I + TKGLVDSSK+AVK
Sbjct  67    SQTENAGMSAFARLTGGLGL----RTPSNETAPVKSGAEQSNLIESVTKGLVDSSKSAVK  122

Query  486   AVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHME  665
             AV VKARH+VSQNKRRYQEGGFDLD+TYITEN+IAMGFP GD SSG FGY+EGFYRNHM+
Sbjct  123   AVQVKARHIVSQNKRRYQEGGFDLDMTYITENIIAMGFPGGDFSSGIFGYIEGFYRNHMD  182

Query  666   EVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSW  845
             EVIKFFETHHK KYKVYNLCSERLYD SLF+GKVA+FPF DHNCPPIQLI SFCQSAYSW
Sbjct  183   EVIKFFETHHKGKYKVYNLCSERLYDGSLFQGKVATFPFSDHNCPPIQLIASFCQSAYSW  242

Query  846   LKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQ  1025
             LKEDI+NVVVVHCKAGM RTGLMI SLLL+LKFFPTAEE+I+Y+N KRC+D K LVLPSQ
Sbjct  243   LKEDIQNVVVVHCKAGMGRTGLMICSLLLFLKFFPTAEEAIDYFNHKRCVDGKALVLPSQ  302

Query  1026  IRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRT  1205
             IRYVKYFER L +FNGE QP RRCMLRGFRLHKCPYW+RPSITISDH G+LF+T+KHP+T
Sbjct  303   IRYVKYFERTLTHFNGEVQPGRRCMLRGFRLHKCPYWVRPSITISDHTGILFTTRKHPKT  362

Query  1206  KDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKI  1385
             KDL+PED+W S PKKG+VVFALPGEPG+AEL GDFK+ F DRQGDFYCW+NTTM ENRK 
Sbjct  363   KDLMPEDFWISVPKKGIVVFALPGEPGLAELVGDFKIQFQDRQGDFYCWMNTTMTENRKF  422

Query  1386  LNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssp  1565
             L+ SD DGFDKRK+P+PGF+VE+V++DY+   P   +   A      + S+A P   S+ 
Sbjct  423   LDGSDFDGFDKRKIPAPGFKVEVVMIDYNGTLPANTKSNPASKGSDGNTSNALPGPKSTT  482

Query  1566  hsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQ-AKVSTSGNNTG  1742
              ++ E+       K   +  DDVFSD++ EET   +  K       +   +VS + N+  
Sbjct  483   SNSSES-------KVPRNGDDDVFSDSDEEETRDTQSNKAAAEYKFMAPHQVSEATND--  533

Query  1743  SPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNTE-------VSDFKIMAA  1901
                +  LTQK +Q+SL     K N+   ++           N          SD K +AA
Sbjct  534   --HVGMLTQKSDQLSLQHEECKQNDASEESPTDKLHKNHTGNKSTNMGSVGASDIKAIAA  591

Query  1902  DASVFTFGDEEDYESE  1949
             DASVF+FGD ED++S+
Sbjct  592   DASVFSFGD-EDFDSD  606



>gb|KHG03642.1| pten [Gossypium arboreum]
Length=652

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/618 (58%), Positives = 441/618 (71%), Gaps = 29/618 (5%)
 Frame = +3

Query  126   PSLSTMDTQLSNASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEE  305
             P L T D +    ++   +VT    +S  NS  +    + +S+WA++LK+PQP    QE 
Sbjct  54    PPLKTYDIEPPKPADNASTVTVKTISSQ-NSTASALPSTGISSWARNLKLPQPIAPRQES  112

Query  306   ENSGNAAKSPFARFTSGFGM-LSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAV  482
             + +GN   S  ARFTSG G+ L S     DD +   ST PQ+ F  +F KG+VDSS NAV
Sbjct  113   Q-AGNDGTSALARFTSGLGLRLQSMTLSPDDRAAHASTAPQAVF-ESFKKGIVDSSLNAV  170

Query  483   KAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHM  662
             KAV VKARH+VSQN RRYQEG FDLD+TYITEN+IAMGFPAGD+SSG FG+ EGFYRN M
Sbjct  171   KAVQVKARHMVSQNNRRYQEGEFDLDMTYITENIIAMGFPAGDLSSGLFGFFEGFYRNKM  230

Query  663   EEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYS  842
             EEVIKFFETHHK +YKVYNLCSERLYD SLF+GKVASFPF+DHNCPP  LI SFCQSAYS
Sbjct  231   EEVIKFFETHHKGRYKVYNLCSERLYDASLFQGKVASFPFNDHNCPPFHLIKSFCQSAYS  290

Query  843   WLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPS  1022
             WLKEDIENVVVVHCKAGM RTGLMI SLLL+LKFFPTAEE+I+Y+NQKRC+D K LVLPS
Sbjct  291   WLKEDIENVVVVHCKAGMGRTGLMICSLLLFLKFFPTAEEAIDYFNQKRCIDGKALVLPS  350

Query  1023  QIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPR  1202
             QIRYVKYFERIL  FNGE+QP RRCM+RGFRLHKCPYWIRPSITISDH+G LFST KHP+
Sbjct  351   QIRYVKYFERILTRFNGEDQPGRRCMIRGFRLHKCPYWIRPSITISDHSGTLFSTSKHPK  410

Query  1203  TKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRK  1382
             TK+L+PED+W  APKKG+V+FALP EPG+AE+ GDFK+HF+DRQGDFYCWLNTTMIENR 
Sbjct  411   TKNLMPEDFWIKAPKKGIVIFALPREPGLAEVVGDFKIHFHDRQGDFYCWLNTTMIENRM  470

Query  1383  ILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgss  1562
             ILN SDLDGFDKR +P  GF++E+V++DYD       + +          S+ N   G+S
Sbjct  471   ILNASDLDGFDKRNVPYHGFKIELVMIDYDGPLKMNSKSD----------SANNGTEGNS  520

Query  1563  phsaDEAADANSNQKSGS--SEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNN  1736
              +  D    ANS Q + S   + DD+FSD++ EE+G     + T    G    +S++  N
Sbjct  521   GYVKDRVVGANSKQSNASETEDNDDIFSDSDGEESGASP-NRPTQPAAGAGPTISSNLLN  579

Query  1737  TGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAAS-------VPEVSNTEVSDFKIM  1895
               + Q     +   + S+ +  L  N   +D  +           +P +      D K +
Sbjct  580   PAAEQ-----KGTSKPSVKNQELSSNNSSKDIAINGVGKHSTGVELPSMELMGAGDIKSI  634

Query  1896  AADASVFTFGDEEDYESE  1949
             AADASVF+FGD+EDY+S+
Sbjct  635   AADASVFSFGDDEDYDSD  652



>gb|KHG03643.1| pten [Gossypium arboreum]
Length=647

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/618 (58%), Positives = 441/618 (71%), Gaps = 29/618 (5%)
 Frame = +3

Query  126   PSLSTMDTQLSNASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEE  305
             P L T D +    ++   +VT    +S  NS  +    + +S+WA++LK+PQP    QE 
Sbjct  49    PPLKTYDIEPPKPADNASTVTVKTISSQ-NSTASALPSTGISSWARNLKLPQPIAPRQES  107

Query  306   ENSGNAAKSPFARFTSGFGM-LSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAV  482
             + +GN   S  ARFTSG G+ L S     DD +   ST PQ+ F  +F KG+VDSS NAV
Sbjct  108   Q-AGNDGTSALARFTSGLGLRLQSMTLSPDDRAAHASTAPQAVF-ESFKKGIVDSSLNAV  165

Query  483   KAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHM  662
             KAV VKARH+VSQN RRYQEG FDLD+TYITEN+IAMGFPAGD+SSG FG+ EGFYRN M
Sbjct  166   KAVQVKARHMVSQNNRRYQEGEFDLDMTYITENIIAMGFPAGDLSSGLFGFFEGFYRNKM  225

Query  663   EEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYS  842
             EEVIKFFETHHK +YKVYNLCSERLYD SLF+GKVASFPF+DHNCPP  LI SFCQSAYS
Sbjct  226   EEVIKFFETHHKGRYKVYNLCSERLYDASLFQGKVASFPFNDHNCPPFHLIKSFCQSAYS  285

Query  843   WLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPS  1022
             WLKEDIENVVVVHCKAGM RTGLMI SLLL+LKFFPTAEE+I+Y+NQKRC+D K LVLPS
Sbjct  286   WLKEDIENVVVVHCKAGMGRTGLMICSLLLFLKFFPTAEEAIDYFNQKRCIDGKALVLPS  345

Query  1023  QIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPR  1202
             QIRYVKYFERIL  FNGE+QP RRCM+RGFRLHKCPYWIRPSITISDH+G LFST KHP+
Sbjct  346   QIRYVKYFERILTRFNGEDQPGRRCMIRGFRLHKCPYWIRPSITISDHSGTLFSTSKHPK  405

Query  1203  TKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRK  1382
             TK+L+PED+W  APKKG+V+FALP EPG+AE+ GDFK+HF+DRQGDFYCWLNTTMIENR 
Sbjct  406   TKNLMPEDFWIKAPKKGIVIFALPREPGLAEVVGDFKIHFHDRQGDFYCWLNTTMIENRM  465

Query  1383  ILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgss  1562
             ILN SDLDGFDKR +P  GF++E+V++DYD       + +          S+ N   G+S
Sbjct  466   ILNASDLDGFDKRNVPYHGFKIELVMIDYDGPLKMNSKSD----------SANNGTEGNS  515

Query  1563  phsaDEAADANSNQKSGS--SEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNN  1736
              +  D    ANS Q + S   + DD+FSD++ EE+G     + T    G    +S++  N
Sbjct  516   GYVKDRVVGANSKQSNASETEDNDDIFSDSDGEESGASP-NRPTQPAAGAGPTISSNLLN  574

Query  1737  TGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAAS-------VPEVSNTEVSDFKIM  1895
               + Q     +   + S+ +  L  N   +D  +           +P +      D K +
Sbjct  575   PAAEQ-----KGTSKPSVKNQELSSNNSSKDIAINGVGKHSTGVELPSMELMGAGDIKSI  629

Query  1896  AADASVFTFGDEEDYESE  1949
             AADASVF+FGD+EDY+S+
Sbjct  630   AADASVFSFGDDEDYDSD  647



>ref|XP_010679536.1| PREDICTED: uncharacterized protein LOC104894880 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010679537.1| PREDICTED: uncharacterized protein LOC104894880 [Beta vulgaris 
subsp. vulgaris]
Length=603

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/573 (61%), Positives = 427/573 (75%), Gaps = 32/573 (6%)
 Frame = +3

Query  258   AKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTP-QSSF  434
             AK+LK PQ       E ++G+ A+S FARFTSG G+  S  +P  D    T T+  ++  
Sbjct  54    AKNLKTPQ--ASESGESHTGSGARSTFARFTSGLGLRLSASTPVADRDSATDTSAGRTGV  111

Query  435   IGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDM  614
               + TKGLVDSS++AVKAV VKARH+VSQNKRRYQEGGFDLDLTYITEN++AMGFPAGD+
Sbjct  112   FDSLTKGLVDSSRSAVKAVQVKARHMVSQNKRRYQEGGFDLDLTYITENILAMGFPAGDI  171

Query  615   SSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHN  794
             SSG FGYVEGFYRNHMEEVI+FFET H+ KYKVYNLCSERLYD SLF+GK ASFPFDDHN
Sbjct  172   SSGIFGYVEGFYRNHMEEVIRFFETRHQGKYKVYNLCSERLYDASLFQGKAASFPFDDHN  231

Query  795   CPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINY  974
             CPPI L++SFCQSAY+WLK D++N+VVVHCKAG+ RTGLMISSLLLYLKF PTAEESIN 
Sbjct  232   CPPIHLLLSFCQSAYAWLKADVDNIVVVHCKAGLGRTGLMISSLLLYLKFCPTAEESINL  291

Query  975   YNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSIT  1154
             +NQKRC+D KGLVLPSQIRYVKYFER+L  ++G+N PARRCMLRGFRLHKCPYWIRPSIT
Sbjct  292   FNQKRCVDGKGLVLPSQIRYVKYFERVLKDYHGDNPPARRCMLRGFRLHKCPYWIRPSIT  351

Query  1155  ISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQ  1334
             ISD NG+LF+T+KHP+TK+LLPED+W +  +KG+VVFALPGE G+ ELAGDFK+HF DR 
Sbjct  352   ISDQNGILFTTEKHPKTKNLLPEDFWMNTSRKGIVVFALPGERGLTELAGDFKIHFQDRH  411

Query  1335  GDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavs  1514
             GDFYCW NTTM ENR I+N+ DLDGFDKRKLPSP FQVEIV++DYD   P     +   +
Sbjct  412   GDFYCWFNTTMTENRIIMNSDDLDGFDKRKLPSPTFQVEIVMIDYDGTLPKMSNTKQLNT  471

Query  1515  skssdnssanpasgssphsaDEAADANSNQKSGSSE--KDDVFSDNEAEETGKPKVGKVT  1688
                + +   +  +           DA + +   SSE  KDDVFSD++ E   +    +  
Sbjct  472   RPIASSEHTSSGNN---------GDAVTPKTKESSEKDKDDVFSDSDGEGGSRSNQAQAP  522

Query  1689  VATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKH----NEQKRDTTVGAASV-  1853
             V        V +S NN    +IS +TQK +Q+S+  +   H    N       +  +SV 
Sbjct  523   V--------VGSSSNN----KISLMTQKTQQMSVNSTKSTHKRIDNPVNDGVGISGSSVE  570

Query  1854  -PEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
              P++ ++  +DFK +AADASVF+FGDEED++SE
Sbjct  571   TPKLGSSTATDFKAIAADASVFSFGDEEDFDSE  603



>ref|XP_010028180.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Eucalyptus 
grandis]
 ref|XP_010028181.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Eucalyptus 
grandis]
 ref|XP_010028182.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Eucalyptus 
grandis]
 ref|XP_010028183.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Eucalyptus 
grandis]
 gb|KCW54860.1| hypothetical protein EUGRSUZ_I00804 [Eucalyptus grandis]
Length=610

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/578 (61%), Positives = 427/578 (74%), Gaps = 18/578 (3%)
 Frame = +3

Query  240   SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTT  419
             S +S+W ++LK+PQP   S++   S N+     +RF +G G      +PT +  +GTS  
Sbjct  43    SGISSWTRNLKLPQPLATSKDSSQSPNSGIGTLSRFANGMGFRLPAGTPTKEADQGTSEN  102

Query  420   PQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGF  599
              QS  +G+  KGL+DSS+NAVKAV VKARHVVSQNKRRYQEGGFDLD+TYITENVIAMGF
Sbjct  103   AQSGGLGSVAKGLLDSSRNAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENVIAMGF  162

Query  600   PAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFP  779
             PAGD+SSG FGY EGFYRNHMEEVI FFETHH+ KYKVYNLCSERLYD SLF GKVA+FP
Sbjct  163   PAGDISSGLFGYFEGFYRNHMEEVINFFETHHQGKYKVYNLCSERLYDASLFGGKVATFP  222

Query  780   FDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAE  959
             F DHNCPP+ LI+SFCQSA SWLKEDIENVV VHCKAGM RTGLMI SLLL++K FPTA+
Sbjct  223   FVDHNCPPMPLILSFCQSASSWLKEDIENVVAVHCKAGMGRTGLMICSLLLFMKIFPTAD  282

Query  960   ESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWI  1139
             E++ YYNQKRC+D K LVLPSQIRYV+YFER+L  F+ E    RRCMLRGFRLH+CP WI
Sbjct  283   EAVAYYNQKRCIDGKALVLPSQIRYVQYFERVLTGFSREIPAGRRCMLRGFRLHRCPSWI  342

Query  1140  RPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVH  1319
             RP+ITISDHNGVLFS+KKHP+TKDL+P+D+W   PKKGVVVFA+PGEPG+ EL GDFK+H
Sbjct  343   RPAITISDHNGVLFSSKKHPKTKDLMPQDFWIKPPKKGVVVFAIPGEPGLTELKGDFKIH  402

Query  1320  FNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQP  1499
             F++ QGDFYCWLNTTM+ENR +L +SDLDGFDKR +PSPGF VE+V++DYD   P +   
Sbjct  403   FHEYQGDFYCWLNTTMMENRTLLTSSDLDGFDKRNVPSPGFHVEVVMIDYDGTMPAKANT  462

Query  1500  EaavsskssdnssanpasgssphsaD-EAADANSNQKSGSSEKDDVFSDNEAEETGKPKV  1676
             ++      S + S++P   ++  S D +A+  N N        DDVFSD+E EET +P  
Sbjct  463   DSTGKEPDSMSRSSDPNGRATSKSTDTKASQKNDND-------DDVFSDSEGEET-RPSN  514

Query  1677  GKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLG----DSGLKHNEQKRD---TT  1835
              K     D  +  +     ++   Q+ +LTQ  +++SLG      G  + E   D    T
Sbjct  515   NKQVRRGD--EPTLVPDTGSSSVKQMETLTQSADKLSLGSEQHSQGYANKEVHSDGAEKT  572

Query  1836  VGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                  +P+  +  VSDFK +AADASVFTFGDEEDYESE
Sbjct  573   ASGLEMPKPDSGGVSDFKAIAADASVFTFGDEEDYESE  610



>gb|EEC69136.1| hypothetical protein OsI_38062 [Oryza sativa Indica Group]
Length=629

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/660 (58%), Positives = 460/660 (70%), Gaps = 87/660 (13%)
 Frame = +3

Query  99    PPATF----RTLVPSLSTMD---TQLSNASNPQPSVTANMETSNV---NSVPAQDGP---  239
             PPAT      + VP + T D      SN S  Q + T ++  S     N+VP QD     
Sbjct  14    PPATLVDSQDSTVPPVRTPDPVSQATSNDSATQFASTVHVAPSPAPVPNAVPIQDAAGRE  73

Query  240   --------SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDD  395
                     S LS+WAK+LKIPQP +G  +E  +G   K+ F+R TSG G+  SPK P  D
Sbjct  74    AQSSIFSTSGLSSWAKNLKIPQPSSG--QESPTG---KNTFSRLTSGLGLRLSPKGPQQD  128

Query  396   NSEGTSTTP---QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLT  566
              S   STTP   QS   G+FTKG+VDSSKNAVKAV VKARH+VSQNKRRYQEGGFDLD+T
Sbjct  129   ESAEGSTTPTTAQSGVFGSFTKGIVDSSKNAVKAVQVKARHMVSQNKRRYQEGGFDLDMT  188

Query  567   YITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDV  746
             YITEN+IAMGFPAGD+SSG FGY EGFYRNHMEEVI+FFE HHK KYKVYNLCSERLYD 
Sbjct  189   YITENIIAMGFPAGDLSSGLFGYFEGFYRNHMEEVIRFFEMHHKGKYKVYNLCSERLYDA  248

Query  747   SLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSL  926
             SLFEGK                             EDIENVVVVHCKAG ARTGLMISSL
Sbjct  249   SLFEGK-----------------------------EDIENVVVVHCKAGKARTGLMISSL  279

Query  927   LLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLR  1106
             LLYLKFFPTAEESI YYNQKRC+D KGL+LPSQIRYVKYFERIL YFNGENQP RRCMLR
Sbjct  280   LLYLKFFPTAEESIEYYNQKRCVDGKGLILPSQIRYVKYFERILTYFNGENQPPRRCMLR  339

Query  1107  GFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPG  1286
             GFRLH+CPYWIRPSIT+S+HNGVLF+TKKHPRTK+L+PED+WFSAPKKG++VFALPGEPG
Sbjct  340   GFRLHRCPYWIRPSITVSNHNGVLFTTKKHPRTKELMPEDFWFSAPKKGIMVFALPGEPG  399

Query  1287  VAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVD  1466
             + E+A DFK+ F+DRQGDFYCWLNTTM+ENR  LN +DLD FDKRKLPSPGFQVE+VLVD
Sbjct  400   LTEVASDFKIQFHDRQGDFYCWLNTTMMENRVTLNPTDLDDFDKRKLPSPGFQVEVVLVD  459

Query  1467  YDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADAN-SNQKSGSSEKDDVFSD  1643
             YD + P +P+P    ++ S+D  S   +S  +    + A+ A  SN++S S++KDDVFSD
Sbjct  460   YDGSQPPKPKP----AAASTDQKSEADSSTGTVAKGNNASSAEVSNKESASNDKDDVFSD  515

Query  1644  NEAEE-TGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQ  1820
             +EAE+ + K +  KV+   +G       S  ++   + S+   +IE+VS+       +EQ
Sbjct  516   SEAEDGSSKGRREKVSRNVEGTTNAAKASETSSVQKEASAAASRIEKVSI------TSEQ  569

Query  1821  KRDTTVGAASV-----------------PEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                 T  AA +                 P  +++ +S+FK +AADASVF+FGDE+DYESE
Sbjct  570   GSARTPDAAPLKSGVSSKSSSTTAPPPPPAAADSSMSEFKAIAADASVFSFGDEDDYESE  629



>ref|XP_003538807.1| PREDICTED: uncharacterized protein LOC100807702 [Glycine max]
Length=607

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/603 (59%), Positives = 432/603 (72%), Gaps = 32/603 (5%)
 Frame = +3

Query  180   SVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFT--GSQEEENSGNAAKSPFARFTS  353
             S  A+ +T N +        S +S+WA++LK PQ     G+Q+   + NA  S FAR T 
Sbjct  24    STKASGQTGNAHDSQLSSPTSGISSWARNLKFPQALGLGGAQQNSQAQNAGMSAFARLTG  83

Query  354   GFGM--LSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNK  527
             G G+  LS+  +P        S T QS+ + + TKGLVDSSK+AVKAV VKARH+VSQNK
Sbjct  84    GLGLQTLSNETAPV------KSGTEQSNLLESVTKGLVDSSKSAVKAVQVKARHIVSQNK  137

Query  528   RRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKY  707
             RRYQE GFDLD+TYITEN+IAMGFP GD SSG FGY+EGFYRNHM+EVIKFFETHHK KY
Sbjct  138   RRYQEDGFDLDMTYITENIIAMGFPGGDFSSGIFGYIEGFYRNHMDEVIKFFETHHKGKY  197

Query  708   KVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCK  887
             KVYNLCSERLYD SLF+GKVA+FPF DHNCPPIQLI SFCQSAYSWLKEDI+NVVVVHCK
Sbjct  198   KVYNLCSERLYDGSLFQGKVATFPFSDHNCPPIQLIASFCQSAYSWLKEDIQNVVVVHCK  257

Query  888   AGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYF  1067
             AGM RTGLMI SLLL+LKFFPTAEE+I+Y+N KRC+D K L+LPSQIRYVKYFER L +F
Sbjct  258   AGMGRTGLMICSLLLFLKFFPTAEEAIDYFNHKRCVDGKALILPSQIRYVKYFERTLTHF  317

Query  1068  NGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPK  1247
             NGE QP RRCMLRGFRLH+CPYW+RPSITISDH G+LF+T+KHP+TKDL+PED+W SAPK
Sbjct  318   NGEVQPGRRCMLRGFRLHECPYWVRPSITISDHKGILFTTRKHPKTKDLMPEDFWISAPK  377

Query  1248  KGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKL  1427
             KG+VVFALPGEPG+ EL GDFK+ F DRQGDFYCW+NTT+ ENRKIL+ SD DGFDKRK+
Sbjct  378   KGIVVFALPGEPGLTELVGDFKIQFQDRQGDFYCWMNTTLTENRKILDGSDFDGFDKRKI  437

Query  1428  PSPGFQVEIVLVDYDTAFP--TRPQPEaavsskssdnssanpasgssphsaDEAADANSN  1601
             P+PGF+VEIV++ Y+   P  T+  P +  S  ++ N+       +S  S  E       
Sbjct  438   PAPGFKVEIVMIGYNAILPANTKSNPASKGSDGNTSNALPGLKHTTSNSSESEVP-----  492

Query  1602  QKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQ  1781
              ++G    DDVFSD++ EET   +  + T A    +       + T +  +  LT K +Q
Sbjct  493   -RNGD---DDVFSDSDEEET---RDTQSTKAATEYKFMAPHQVSETTTDHVGMLTHKTDQ  545

Query  1782  VSLGDSGLKHNEQKRDTTVGAASVPEVSNTEV-------SDFKIMAADASVFTFGDEEDY  1940
             +SL     K N    ++           N  +       SD K +AADASVF+FGD ED+
Sbjct  546   LSLQQEERKQNVASEESDTDKLHKNHTGNNSINMGSVGASDIKAIAADASVFSFGD-EDF  604

Query  1941  ESE  1949
             ES+
Sbjct  605   ESD  607



>ref|XP_004511888.1| PREDICTED: putative tyrosine-protein phosphatase TPTE-like isoform 
X1 [Cicer arietinum]
Length=598

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/598 (60%), Positives = 442/598 (74%), Gaps = 40/598 (7%)
 Frame = +3

Query  207   NVNSVPA-QDGPSKL-----STWAKSLKIPQ-PFTGSQEEEN-SGNAAKSPFARFTSGFG  362
             N N+ P+  D PS L     S+WA++LK+ Q P  G+ ++ + + N+  S FAR TSG G
Sbjct  24    NGNAHPSDSDSPSLLPEAGISSWARNLKLNQSPGIGAADQNSQTENSGMSAFARLTSGIG  83

Query  363   MLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQE  542
             +    + P+++ +   S   Q + I +FTKGL+DSSK+AVKAV  KARH+VSQNKRRYQE
Sbjct  84    L----RVPSNETATTNSGAEQPNLIESFTKGLMDSSKSAVKAVQTKARHIVSQNKRRYQE  139

Query  543   GGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNL  722
             GGFDLD+TYITEN+I+MGFP GD+SSG  GY+EGFYRNHMEEVIKFFETHHK KYKVYNL
Sbjct  140   GGFDLDMTYITENIISMGFPGGDLSSGILGYIEGFYRNHMEEVIKFFETHHKGKYKVYNL  199

Query  723   CSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMAR  902
             CSERLYD SLF+GKVASFPF DHNCPPIQLI SFCQSAYSWLK DI+NVVVVHCKAGM R
Sbjct  200   CSERLYDGSLFQGKVASFPFSDHNCPPIQLIASFCQSAYSWLKGDIQNVVVVHCKAGMGR  259

Query  903   TGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQ  1082
             TGLMI SLLL+L FFPTAEE+I+Y+NQKRC+D K LVLPSQIRYVKYFE  L +F GE Q
Sbjct  260   TGLMICSLLLFLNFFPTAEEAIDYFNQKRCVDGKALVLPSQIRYVKYFEHTLTHFKGEVQ  319

Query  1083  PARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVV  1262
             P RRCMLRGFRLHKCPYW+RPSITISDHNG+LF+T+KHP+TKDL+PED+W +APKKG+VV
Sbjct  320   PGRRCMLRGFRLHKCPYWVRPSITISDHNGILFTTRKHPKTKDLMPEDFWMNAPKKGIVV  379

Query  1263  FALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGF  1442
             FALPGEPG+ EL GDFK+HF+DRQGDF+CW+NTTMIENRKIL+ SDLD FDKRK+P+PGF
Sbjct  380   FALPGEPGLTELVGDFKIHFHDRQGDFFCWMNTTMIENRKILDGSDLDDFDKRKIPTPGF  439

Query  1443  QVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSE  1622
             QVE+V+VDY+   P +  P +  S  ++ N  ++           +    +S  K  ++ 
Sbjct  440   QVEVVMVDYNGTLPGKANPASKGSDGNTSNVLSSA----------KPTSNSSESKVPTNG  489

Query  1623  KDDVFSDNEAEETGKPKVGKVTVATD-----GVQAKVSTSGNNTGSPQISSLTQKIEQVS  1787
              DDVFSD++ EET   +  +   ATD       Q   +T+ N      +  L    +++S
Sbjct  490   DDDVFSDSDEEETRGTQ--RREAATDYKFMAPHQVSEATTDN------VGMLAHTTDRLS  541

Query  1788  L-GDSGLKHNEQKRDTTVGAASVPEVSNTE---VSDFKIMAADASVFTFGDEEDYESE  1949
             L  +   ++N  K  TT    + P  SN E    S+ K +AADASVF+FGD ED+ES+
Sbjct  542   LQHEERTENNASKESTTDKLHAGPNTSNMESVGASEIKAIAADASVFSFGD-EDFESD  598



>ref|XP_003611670.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Medicago truncatula]
 gb|AES94628.1| phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase [Medicago 
truncatula]
Length=592

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/579 (61%), Positives = 428/579 (74%), Gaps = 44/579 (8%)
 Frame = +3

Query  255   WAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSF  434
             WA++L+       SQ E N      S FAR TSG G+    +SP ++ +  +S   Q + 
Sbjct  39    WARNLRFGAADQNSQTENN----GMSAFARLTSGIGL----RSPPNELATSSSGAEQPNI  90

Query  435   IGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDM  614
             I +FTKGLVDSSK AVKAV  KARH+VSQNKRRYQEGGFDLD+TYITEN+IAMGFP GD 
Sbjct  91    IESFTKGLVDSSKEAVKAVQTKARHIVSQNKRRYQEGGFDLDMTYITENIIAMGFPGGDF  150

Query  615   SSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHN  794
             SSG FGY+EGFYRNHMEEVIKFFETHHK KYKVYNLCSERLYD SLF+GKVASFPF DHN
Sbjct  151   SSGIFGYIEGFYRNHMEEVIKFFETHHKGKYKVYNLCSERLYDGSLFQGKVASFPFSDHN  210

Query  795   CPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINY  974
             CPPIQLI SFC+SAYSWLKEDI+NVVVVHCKAGM RTGLMI SLLLYLKFFPTAEE+I+ 
Sbjct  211   CPPIQLIASFCRSAYSWLKEDIQNVVVVHCKAGMGRTGLMICSLLLYLKFFPTAEEAIDS  270

Query  975   YNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSIT  1154
             +NQKRC+D K L LPSQIRYVKYFER L +FNGE QP RRCMLRGFRLHKCPYW+RPSIT
Sbjct  271   FNQKRCVDGKALTLPSQIRYVKYFERTLTHFNGEVQPGRRCMLRGFRLHKCPYWVRPSIT  330

Query  1155  ISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQ  1334
             ISDHNG+LF+T+KHP+TKDL+PED+W +A KKG++VFALPGEPG+ EL GDFK+HF+DRQ
Sbjct  331   ISDHNGILFTTRKHPKTKDLMPEDFWINASKKGILVFALPGEPGLTELVGDFKIHFHDRQ  390

Query  1335  GDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavs  1514
             GDFYCW+NTTMIENRKIL+ SDLD FDKRK+P+PGFQVE+V+VDYD   P +  P +  S
Sbjct  391   GDFYCWMNTTMIENRKILDGSDLDDFDKRKIPAPGFQVEVVMVDYDGTLPGKVNPASKGS  450

Query  1515  skssdnssanpasgssphsaDEAADANSNQKSG--SSEKDDVFSDNEAEETGKPKVGKVT  1688
                + +S               A   +S++KS    +  DDVFSD++ EET   +  +  
Sbjct  451   DIRNVSSG--------------AKPTSSSRKSKIPKNGDDDVFSDSDEEETKGTQ--RRE  494

Query  1689  VATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASV-----  1853
              ATD    +   +   T +  +  L++  +Q+SL     +H+E+  +    A++      
Sbjct  495   AATDYKYMEPHQASEAT-TDHVGMLSRATDQLSL----QQHDERTENNVSEASTTNKHHN  549

Query  1854  ----PEVSNTE---VSDFKIMAADASVFTFGDEEDYESE  1949
                 P  +N E    S+FK +AADASVF+FGD ED+ES+
Sbjct  550   IHAGPNTTNMESIGTSEFKAIAADASVFSFGD-EDFESD  587



>ref|XP_010095308.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Morus notabilis]
 gb|EXB59519.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Morus notabilis]
Length=588

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/620 (57%), Positives = 451/620 (73%), Gaps = 49/620 (8%)
 Frame = +3

Query  141   MDTQLSNA-SNPQPSVTANMETS---------NVNSVPAQDGPSKLSTWAKSLKIPQPFT  290
             MD++ +N  S P    + N+E S         N++ + ++  P   S+WA  LK+ Q   
Sbjct  1     MDSESTNPPSQPSAKASDNVEHSAPDVSGRDNNMHELASKPTPPTTSSWA--LKLQQSL-  57

Query  291   GSQEEENSGNAAKSPFARFTSGFG-MLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDS  467
             G+ ++  SGNAA S F+RFT GFG  +SS  SP + + +  +   Q + + +FTKGLVDS
Sbjct  58    GTIQDSQSGNAAMSAFSRFTRGFGSQMSSVDSPQNKDVKDNTGNQQFAVLESFTKGLVDS  117

Query  468   SKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGF  647
             S++AVKA+ VKARH+VSQNKRRYQ+GGFDLD+TYITEN+IAMGFPAG ++SGFFGY+EG 
Sbjct  118   SRSAVKAMQVKARHIVSQNKRRYQDGGFDLDMTYITENIIAMGFPAGSLTSGFFGYLEG-  176

Query  648   YRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFC  827
                               KYKVYNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI SFC
Sbjct  177   ------------------KYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLIRSFC  218

Query  828   QSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKG  1007
             QSA++WLKEDI+NVVVVHCKAGMARTGLMI +LLL+LKFFPTA+E+I+YYNQKRC+D K 
Sbjct  219   QSAFAWLKEDIQNVVVVHCKAGMARTGLMICNLLLFLKFFPTADEAIDYYNQKRCVDGKA  278

Query  1008  LVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFST  1187
             L+LPSQIRYVKYFER+L  F GENQP RRCMLRGFRLHKCPYWIRPSITIS+HNG+LF+T
Sbjct  279   LILPSQIRYVKYFERVLTDFKGENQPGRRCMLRGFRLHKCPYWIRPSITISNHNGILFTT  338

Query  1188  KKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTM  1367
             +KHP+TKDL+PED+W    +KG+VVFALPGEPG+ EL GDFKVHF+DRQGD YCWLNTTM
Sbjct  339   RKHPKTKDLMPEDFWIKTSRKGIVVFALPGEPGLTELVGDFKVHFHDRQGDSYCWLNTTM  398

Query  1368  IENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanp  1547
             IENR IL+ S+LDGFDKRKLPSPGFQVEIV++DYD   PTR + ++  +     +SSA  
Sbjct  399   IENRTILDNSELDGFDKRKLPSPGFQVEIVMIDYDGTLPTRSKADSMANKSDGTSSSAPG  458

Query  1548  asgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTS  1727
             ++  +       A++N  Q S S + DDVFSD++ EE G P   +++     +   V  S
Sbjct  459   STVGTE------ANSNRKQASQSEDNDDVFSDSDGEEKGAPN--RMSARATSIAEPVHPS  510

Query  1728  GNNTGSPQISSLTQKIEQVSLGDSGLKHNEQK------RDTTVGAASVPEVSNTEVSDFK  1889
               N+ + QI ++ ++I+ +SLG     +  Q+      R T   + ++P++ +   SD K
Sbjct  511   --NSTAEQIGNVVREIKPLSLGSHSQANVSQEATVDRIRKTDSSSGTLPKLDSVGGSDIK  568

Query  1890  IMAADASVFTFGDEEDYESE  1949
              MAADASVFTF D+ED+ES+
Sbjct  569   AMAADASVFTFCDDEDFESD  588



>ref|XP_007156765.1| hypothetical protein PHAVU_002G015700g [Phaseolus vulgaris]
 gb|ESW28759.1| hypothetical protein PHAVU_002G015700g [Phaseolus vulgaris]
Length=607

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/607 (58%), Positives = 431/607 (71%), Gaps = 23/607 (4%)
 Frame = +3

Query  153   LSNASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTG-SQEEENSGNAAK  329
             +SNA   Q S     + +N +  P+    S +S+WA++LK P    G +Q++  + N   
Sbjct  16    VSNAEE-QHSTKVTGQINNAHDSPSSLPASGMSSWARNLKFPGLGLGPAQQDSQTENTGI  74

Query  330   SPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARH  509
             S FAR  SG G+ +  K      + G     QS+ I +FTKGL+DSSK+AVKAV VKARH
Sbjct  75    SAFARLASGLGLRTQSKETAPPLNSGPE---QSNLIESFTKGLMDSSKSAVKAVQVKARH  131

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VSQNKRRYQE GFDLD+TYITEN+IAMGFPAGD SSG FGY+EGFYRNHMEEVI FFET
Sbjct  132   IVSQNKRRYQEDGFDLDMTYITENIIAMGFPAGDFSSGIFGYIEGFYRNHMEEVINFFET  191

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
             HHK KYKVYNLCSERLYD SLF+GKVA+FPF DHNCPPIQLI SFCQSAYSWLKEDI+NV
Sbjct  192   HHKGKYKVYNLCSERLYDGSLFQGKVATFPFSDHNCPPIQLIASFCQSAYSWLKEDIQNV  251

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
             VVVHCKAGM RTGLMI  LLL+LKFFPTAEE+I+Y+N KRC+D K LVLPSQIRYVKYFE
Sbjct  252   VVVHCKAGMGRTGLMICCLLLFLKFFPTAEEAIDYFNHKRCVDGKALVLPSQIRYVKYFE  311

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDY  1229
             R L  FNGE QP RRC+LRGFRLHKCPYW+RPSITISDH GVLF+TK HP+TKDLLPED+
Sbjct  312   RTLTQFNGEVQPGRRCILRGFRLHKCPYWVRPSITISDHKGVLFATKNHPKTKDLLPEDF  371

Query  1230  WFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDG  1409
             W SAPKKG+VVFALPGEPG+ EL GDFK+HFNDR GDFYCW+NTTM ENRKIL+ SD DG
Sbjct  372   WISAPKKGIVVFALPGEPGLTELVGDFKIHFNDRHGDFYCWMNTTMTENRKILDGSDFDG  431

Query  1410  FDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAAD  1589
             FDKRK+P+PGF+VE+V++DY+   P R +   A      + +SA P    +  ++ E+  
Sbjct  432   FDKRKIPAPGFRVEVVMIDYNGTLPARTKANPASKGSDGNTTSALPGPKPTTSNSTES--  489

Query  1590  ANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQ  1769
                  K   +  DDVFSD++ EE+   +  K       +     + G    +  +  LT 
Sbjct  490   -----KLPRTGDDDVFSDSDEEESRDTQSKKAATEYKFMAPHQVSEGT---TDHVGMLTH  541

Query  1770  KIEQVSLGDSGLKHNEQKRDTTVG-------AASVPEVSNTEVSDFKIMAADASVFTFGD  1928
               +++SL     + +    ++T           S   V +   SD K +AADASVF+FGD
Sbjct  542   TTDRLSLQHEARRQDNYSEESTADKHHKIHTGNSSTNVGSVGASDIKAIAADASVFSFGD  601

Query  1929  EEDYESE  1949
              ED+ES+
Sbjct  602   -EDFESD  607



>gb|EYU44435.1| hypothetical protein MIMGU_mgv1a003321mg [Erythranthe guttata]
Length=592

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/601 (59%), Positives = 434/601 (72%), Gaps = 41/601 (7%)
 Frame = +3

Query  177   PSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSG  356
             PSV +  E+S V    +    S +S+WAKSLK+PQ     Q++  S NA  S F+R  SG
Sbjct  23    PSVVSEKESS-VQDSSSMLSTSAISSWAKSLKLPQ----MQQDSQSANAGTSTFSRLASG  77

Query  357   FGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRY  536
               M    K+     S   ++    S IG+FTKG+VDSS  AVKAV VKARH+VSQNKRRY
Sbjct  78    LRMQIPSKTSVPTESSNNNSVTAQSVIGSFTKGIVDSSLTAVKAVQVKARHMVSQNKRRY  137

Query  537   QEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVY  716
             Q+GGFDLD+TYITEN+IAMGFPAGD+SSG FGY EGFYRNHMEEVIKFFETHHK KYKVY
Sbjct  138   QKGGFDLDMTYITENIIAMGFPAGDLSSGLFGYFEGFYRNHMEEVIKFFETHHKGKYKVY  197

Query  717   NLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGM  896
             NLCSERLYD SLFEGKVASFPFDDHNCPPI LI  FCQSA+SWL+ DI NVVVVHCKAG 
Sbjct  198   NLCSERLYDASLFEGKVASFPFDDHNCPPIHLIKLFCQSAFSWLEPDILNVVVVHCKAGK  257

Query  897   ARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGE  1076
             ARTGLM+ SLLL+LK +PTA E I+YYN++RC D KGL+LPSQIRYVKYFERIL  FNGE
Sbjct  258   ARTGLMVCSLLLFLKLYPTANECIDYYNEQRCTDGKGLILPSQIRYVKYFERILTEFNGE  317

Query  1077  NQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGV  1256
               P RRCMLRGF+LH CPYW+RPSITIS+HNG+LFSTKKHP+TKDL+PED+W   P+KGV
Sbjct  318   TPPGRRCMLRGFKLHNCPYWVRPSITISNHNGILFSTKKHPKTKDLMPEDFWIRVPRKGV  377

Query  1257  VVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSP  1436
             VVFALPGEPG+ EL GDFK+ F+DRQGDFYCW+NTTM+ENR IL+ SDLD FD RKLPSP
Sbjct  378   VVFALPGEPGLTELVGDFKIQFHDRQGDFYCWMNTTMMENRVILDASDLDDFDNRKLPSP  437

Query  1437  GFQVEIVLVDYD-TAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSG  1613
             GFQVEIV++DYD T  P                +  +  +      +   + ANS Q + 
Sbjct  438   GFQVEIVMIDYDGTTIP---------------KTKTDHNTKGEEGKSSNESKANSEQSNA  482

Query  1614  SSEK---DDVFSDNEAEE---TGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKI  1775
             S ++   DDVFSD+E EE   T + K G  T++T+        S ++ G   IS+++ + 
Sbjct  483   SRKQNKDDDVFSDSEGEEESTTSRSKQGN-TISTE--------SRSDAGG--ISTISHQT  531

Query  1776  EQVSLG-DSGLKHNEQKRDTTVGAA--SVPEVSNTEVSDFKIMAADASVFTFGDEEDYES  1946
             E++SLG +S    +    +  +  A  +   + N + +D K +AADASVF+FGD+EDYES
Sbjct  532   EKLSLGRESTSSEHRTSHEVNIDGAERATAIIPNLDSADIKAIAADASVFSFGDDEDYES  591

Query  1947  E  1949
             +
Sbjct  592   D  592



>gb|KHN36257.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Glycine soja]
Length=637

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/647 (56%), Positives = 441/647 (68%), Gaps = 67/647 (10%)
 Frame = +3

Query  159   NASNPQPSVTANMETSNVNSVPAQDG----------PSKLSTWAKSLKIPQPF-TGSQEE  305
             ++S P P  + N E  +   V  Q G           S +S+WA++LK PQ    G+Q+ 
Sbjct  8     SSSQPTPPAS-NTEEQHSTKVSGQPGNAHDSQLSSPTSGISSWARNLKFPQALGLGAQQN  66

Query  306   ENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVK  485
               + NA  S FAR T G G+    ++P+++ +   S   QS+ I + TKGLVDSSK+AVK
Sbjct  67    SQTENAGMSAFARLTGGLGL----RTPSNETAPVKSGAEQSNLIESVTKGLVDSSKSAVK  122

Query  486   AVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHME  665
             AV VKARH+VSQNKRRYQEGGFDLD+TYITEN+IAMGFP GD SSG FGY+EGFYRNHM+
Sbjct  123   AVQVKARHIVSQNKRRYQEGGFDLDMTYITENIIAMGFPGGDFSSGIFGYIEGFYRNHMD  182

Query  666   EVIKFFETHHK-------------------DKYKVYNLCSERLYDVSLFEGKVASFPFDD  788
             EVIKFFETHHK                    KYKVYNLCSERLYD SLF+GKVA+FPF D
Sbjct  183   EVIKFFETHHKYETLGSLTAVANLLCRSPEGKYKVYNLCSERLYDGSLFQGKVATFPFSD  242

Query  789   HNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLK---------  941
             HNCPPIQLI SFCQSAYSWLKEDI+NVVVVHCKAGM RTGLMI SLLL+LK         
Sbjct  243   HNCPPIQLIASFCQSAYSWLKEDIQNVVVVHCKAGMGRTGLMICSLLLFLKASYDNQLQR  302

Query  942   ---FFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGF  1112
                FFPTAEE+I+Y+N KRC+D K LVLPSQIRYVKYFER L +FNGE QP RRCMLRGF
Sbjct  303   LWNFFPTAEEAIDYFNHKRCVDGKALVLPSQIRYVKYFERTLTHFNGEVQPGRRCMLRGF  362

Query  1113  RLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVA  1292
             RLHKCPYW+RPSITISDH G+LF+T+KHP+TKDL+PED+W S PKKG+VVFALPGEPG+A
Sbjct  363   RLHKCPYWVRPSITISDHTGILFTTRKHPKTKDLMPEDFWISVPKKGIVVFALPGEPGLA  422

Query  1293  ELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYD  1472
             EL GDFK+ F DRQGDFYCW+NTTM ENRK L+ SD DGFDKRK+P+PGF+VE+V++DY+
Sbjct  423   ELVGDFKIQFQDRQGDFYCWMNTTMTENRKFLDGSDFDGFDKRKIPAPGFKVEVVMIDYN  482

Query  1473  TAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEA  1652
                P   +   A      + S+A P   S+  ++ E+       K   +  DDVFSD++ 
Sbjct  483   GTLPANTKSNPASKGSDGNTSNALPGPKSTTSNSSES-------KVPRNGDDDVFSDSDE  535

Query  1653  EETGKPKVGKVTVATDGVQ-AKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRD  1829
             EET   +  K       +   +VS + N+     +  LTQK +Q+SL   G K N+   +
Sbjct  536   EETRDTQSNKAAAEYKFMAPHQVSEATND----HVGMLTQKTDQLSLQHEGCKQNDASEE  591

Query  1830  TTVGAASVPEVSNTE-------VSDFKIMAADASVFTFGDEEDYESE  1949
             +           N          SD K +AADASVF+FGD ED++S+
Sbjct  592   SPTDKLHKNHTGNKSTNMGSVGASDIKAIAADASVFSFGD-EDFDSD  637



>gb|ADV04056.1| tyrosine phosphatase [Hevea brasiliensis]
Length=469

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/474 (73%), Positives = 386/474 (81%), Gaps = 11/474 (2%)
 Frame = +3

Query  546   GFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLC  725
             GFDLD+TYITEN+IAMGFPAGDMSSGFFGY EGFYRNHMEEVIKFFETHHK KYKVYNLC
Sbjct  1     GFDLDMTYITENIIAMGFPAGDMSSGFFGYFEGFYRNHMEEVIKFFETHHKGKYKVYNLC  60

Query  726   SERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMART  905
             SERLYD SL EGKVASFPFDDHNCPPIQLI+SFCQSAYSWLKEDIENVVVVHCKAGMART
Sbjct  61    SERLYDASLLEGKVASFPFDDHNCPPIQLIISFCQSAYSWLKEDIENVVVVHCKAGMART  120

Query  906   GLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQP  1085
             GLMISSLLLYLKFFPTAEESI+YYNQKRC D KGLVLPSQIRYVKYFERIL YFNGENQ 
Sbjct  121   GLMISSLLLYLKFFPTAEESIDYYNQKRCXDGKGLVLPSQIRYVKYFERILTYFNGENQR  180

Query  1086  ARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVF  1265
              RRC+LRGFRLH+CPYWIRPSIT+SDHNGVLFSTKKHPRT DL PEDYWFSAPKKGV+VF
Sbjct  181   GRRCILRGFRLHRCPYWIRPSITVSDHNGVLFSTKKHPRTVDLSPEDYWFSAPKKGVMVF  240

Query  1266  ALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQ  1445
             ALPGEPG+AE+AGDFKVHF+DRQGDFY WLNTTM+ENRK+LNT+D+DGFDKRKLPSPGFQ
Sbjct  241   ALPGEPGLAEVAGDFKVHFHDRQGDFYFWLNTTMMENRKVLNTNDIDGFDKRKLPSPGFQ  300

Query  1446  VEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEK  1625
             VE+VLVDY+ A PT P  E A    +  +S+A     ++      AA A    K   ++K
Sbjct  301   VEVVLVDYNGAAPTGPNSETAAEKSNEGSSAAPAPVDAN-----AAAAAPKQNKDQGNDK  355

Query  1626  DDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSG---NNTGSPQISSLTQKIEQVSLGD  1796
             DDVFSD+EAEE+   K+ K   A+ G     +T+     NT + Q++SLT   EQ SLG+
Sbjct  356   DDVFSDSEAEESVSSKLRKAQAASAGGGTATTTTSSSETNTKTDQVASLTHATEQFSLGN  415

Query  1797  SG---LKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             +G   +    Q +   VG A     +N   S+FK MAADASVF+FGDE+DYESE
Sbjct  416   TGSQQVHAASQPKSDAVGEAVSSLGANNSESEFKAMAADASVFSFGDEDDYESE  469



>ref|XP_002461327.1| hypothetical protein SORBIDRAFT_02g000980 [Sorghum bicolor]
 gb|EER97848.1| hypothetical protein SORBIDRAFT_02g000980 [Sorghum bicolor]
Length=625

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/584 (61%), Positives = 438/584 (75%), Gaps = 47/584 (8%)
 Frame = +3

Query  240   SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPT-DDNSEGTS-  413
             S LS+WAK+LKIPQP +G  +E  +G   K+ FAR TSG G+  SPK+P  D+ +EG++ 
Sbjct  75    SGLSSWAKNLKIPQPSSG--QESPTG---KNTFARLTSGLGLRMSPKAPQQDEGAEGSTS  129

Query  414   -TTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIA  590
              TT Q    G+ TKG+VDSSKNAVKAV VKARH+VSQNKRRYQEGGFDLD+TYITEN+IA
Sbjct  130   PTTGQPGVFGSLTKGIVDSSKNAVKAVQVKARHMVSQNKRRYQEGGFDLDMTYITENIIA  189

Query  591   MGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVA  770
             MGFPAGD+SSG FGY EGFYRNHMEEVI+FFE HHK KY+   +   + Y + LF     
Sbjct  190   MGFPAGDLSSGLFGYFEGFYRNHMEEVIRFFEMHHKGKYRC-TIFVLKGYMMHLF-----  243

Query  771   SFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFP  950
                                +SAYSWLKEDIENVVVVHCKAG ARTGLMISSLLL+LKFFP
Sbjct  244   -----------------LKESAYSWLKEDIENVVVVHCKAGKARTGLMISSLLLFLKFFP  286

Query  951   TAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCP  1130
             TAEESI YYNQKRC+D KGL+LPSQIRYVKYFERIL YFNGENQP RRCMLRGFRLH+CP
Sbjct  287   TAEESIEYYNQKRCVDGKGLILPSQIRYVKYFERILTYFNGENQPPRRCMLRGFRLHRCP  346

Query  1131  YWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDF  1310
             YWIRPSIT+S+HNGVLFSTKKHPRTK+L+PED+WFSAPKKG++VFALPGEPG+AE+AGDF
Sbjct  347   YWIRPSITVSNHNGVLFSTKKHPRTKELMPEDFWFSAPKKGIMVFALPGEPGLAEVAGDF  406

Query  1311  KVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTR  1490
             K+ F+DRQGDFYCWLNTTM+ENR  LN +DLD FDKRKLPSPGFQVE+VLVDYD + P +
Sbjct  407   KIQFHDRQGDFYCWLNTTMMENRVTLNPTDLDDFDKRKLPSPGFQVEVVLVDYDGSQPPK  466

Query  1491  PQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKP  1670
             P+P    ++  +DN S   +S S+    + AA A SN+ +GS++KD+VFSD++ E+ G  
Sbjct  467   PKP----ATGPADNKSDADSSASTVAKENNAAPAESNKGTGSNDKDEVFSDSDGED-GSS  521

Query  1671  KVGKVTVATDGVQAKVSTSGNNTGSPQ--ISSLTQKIEQVSLG---------DSGLKHNE  1817
             K  K  +A+ G  +  +   + T + Q  +S+   ++++V++          D+ LK   
Sbjct  522   KGRKEKIASGGQNSVNAAKPSETSNVQKEVSAAASRLDKVAITSEQGTTKAPDASLKTEV  581

Query  1818  QKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
               + +++  A      N+ +S+FK +AADASVF+FGDEEDYESE
Sbjct  582   SSKTSSLTTAPPTAADNSSMSEFKAIAADASVFSFGDEEDYESE  625



>gb|EPS66726.1| hypothetical protein M569_08048, partial [Genlisea aurea]
Length=539

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/574 (61%), Positives = 408/574 (71%), Gaps = 43/574 (7%)
 Frame = +3

Query  240   SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTT  419
             S +S+WA+++++PQ     Q E  + NA K  F+RF SG G   S  SPTD+ ++GT +T
Sbjct  5     STISSWARNIRLPQ----FQPESVTTNAGKFSFSRFASGIGQKLS--SPTDNANDGTPST  58

Query  420   PQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGF  599
              QSS I +F KG+VDSS NAVKAV  KARH VSQNKRRYQEGGFDLD+TYITEN+IAMGF
Sbjct  59    -QSSAIESFAKGIVDSSLNAVKAVQAKARHAVSQNKRRYQEGGFDLDMTYITENIIAMGF  117

Query  600   PAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFP  779
             PAGD+SSG FGY EGFYRNHMEEVIKFFETHHK KYKVYNLCSERLYD SLFEGKVA FP
Sbjct  118   PAGDLSSGLFGYFEGFYRNHMEEVIKFFETHHKGKYKVYNLCSERLYDASLFEGKVACFP  177

Query  780   FDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAE  959
             FDDHNCPPI L+  FCQSAYSWLKEDI NVVVVHCKAG ARTGLMI SLLL+LKFFP+AE
Sbjct  178   FDDHNCPPIHLMKLFCQSAYSWLKEDIINVVVVHCKAGKARTGLMICSLLLFLKFFPSAE  237

Query  960   ESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWI  1139
             E I+YYNQKRC+D KGL+LPSQIRYVKYFE IL  FNG+  P RRCMLRGFRLHKCPYW+
Sbjct  238   ECIDYYNQKRCVDGKGLILPSQIRYVKYFELILNKFNGDTPPGRRCMLRGFRLHKCPYWV  297

Query  1140  RPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVH  1319
             RPSITIS+HNG+LFSTKKHP+ K+L+PED+W  APKK  VVFALPGEPG+ EL GDFK+H
Sbjct  298   RPSITISNHNGILFSTKKHPKMKNLMPEDFWLRAPKKSAVVFALPGEPGLTELKGDFKIH  357

Query  1320  FNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTR-PQ  1496
             F DRQGDFYCWLNT+M+ENR  L+ S+LDGF  RKLPSPGFQ+EIV++DYD    TR P 
Sbjct  358   FQDRQGDFYCWLNTSMMENRVTLDASELDGFHNRKLPSPGFQLEIVMIDYDGV--TRSPT  415

Query  1497  PEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEA---EETGK  1667
             P    S                        DA +    G  +     S+  A   +  G 
Sbjct  416   PAKIGSEN----------------------DAKNGPPKGEVDSSAFGSETRAIPRKHEGD  453

Query  1668  PKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAA  1847
                       D   +K +T G+      +SS  QK EQ   G S  +   ++    V   
Sbjct  454   DDDVFSDSDGDESASKTATKGDRVVVQTVSSSGQK-EQAGGGTSSGEPKLERAPPAV---  509

Query  1848  SVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                   + E +D K +AADASVF+FGD+EDYESE
Sbjct  510   ----TGDMESTDIKAIAADASVFSFGDDEDYESE  539



>emb|CAN59799.1| hypothetical protein VITISV_038871 [Vitis vinifera]
Length=571

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/615 (60%), Positives = 432/615 (70%), Gaps = 56/615 (9%)
 Frame = +3

Query  141   MDTQLSNASNPQPSVTANMETSNVNSVPAQD----------GPSKLSTWAKSLKIPQPFT  290
             MD   + +S+ QP+  A  E S   +V  QD            S +S+WAK+LKIPQP  
Sbjct  1     MDQDSAKSSSQQPANAAAAE-SPTPAVATQDRSTHDSPPLLSASGISSWAKNLKIPQPLA  59

Query  291   GSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSE-GTSTTPQSSFIGTFTKGLVDS  467
              +Q++  +G+  KS F+RFTSGFG+  SP +P    S   TSTT Q   + +FTKGLVDS
Sbjct  60    ATQDDXQTGDXGKSTFSRFTSGFGLRLSPAAPMPAESVVSTSTTTQPGVLESFTKGLVDS  119

Query  468   SKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGF  647
             SK+AVKAV VKARH+VSQNKRRYQEG FDLD+TYITEN+IAMGFPAGDMSSGF G++EGF
Sbjct  120   SKSAVKAVQVKARHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDMSSGFLGFIEGF  179

Query  648   YRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFC  827
             YRNHMEEVIKFFETHHK KYKVYNLCSERLYD SLFEGKVASFPFDDHNCPPIQLI SFC
Sbjct  180   YRNHMEEVIKFFETHHKGKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLITSFC  239

Query  828   QSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKG  1007
             QSAYSWLK+DIENVVVVHCKAGMARTGLM SSLLL+LK                      
Sbjct  240   QSAYSWLKQDIENVVVVHCKAGMARTGLMJSSLLLFLK----------------------  277

Query  1008  LVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFST  1187
                    RYVKYFERIL +FNG+N P RRCMLRGFRLH+CP W RPSIT+SDHNG+LFST
Sbjct  278   -------RYVKYFERILTHFNGQNPPGRRCMLRGFRLHRCPSWFRPSITVSDHNGILFST  330

Query  1188  KKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTM  1367
             +KHP+TKDL+PED+W SA KKG+VVFALP EPG+AELAGDFK HF+D +GDFYCWLNTTM
Sbjct  331   RKHPKTKDLMPEDFWISAAKKGIVVFALPREPGLAELAGDFKFHFHDSEGDFYCWLNTTM  390

Query  1368  IENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanp  1547
              ENRK L T DLDGF+KRKLPSPGFQVE+V++DYD    TR + +++ +    ++     
Sbjct  391   TENRKFLXTYDLDGFEKRKLPSPGFQVEVVMIDYDGTIQTRFKSDSSRNGSDGNSGYVPA  450

Query  1548  asgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTS  1727
              SG        AA +N ++ S S + DDVFSD+E EET +    K   AT G        
Sbjct  451   PSGGV------AATSNQSKVSESQDNDDVFSDSEGEET-ESSTRKQAQATSGTGHGAPGP  503

Query  1728  GNNTGSPQISSLTQKIEQVSL-GDSGLKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAAD  1904
              + +   QI+ +    E +SL  +   + N  K   + GA         EVSDFK +AAD
Sbjct  504   KSGSTVEQIAGIKHGTEHLSLVSEQPSQINPSKEPKSDGALQ-------EVSDFKAIAAD  556

Query  1905  ASVFTFGDEEDYESE  1949
             ASVF+FGDEEDYESE
Sbjct  557   ASVFSFGDEEDYESE  571



>ref|XP_002962229.1| hypothetical protein SELMODRAFT_165134 [Selaginella moellendorffii]
 gb|EFJ37489.1| hypothetical protein SELMODRAFT_165134 [Selaginella moellendorffii]
Length=610

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/594 (57%), Positives = 414/594 (70%), Gaps = 64/594 (11%)
 Frame = +3

Query  231   DGPSKLS-----TWAKSLKIPQPFTGSQEEENSGNA--AKSPFARFTSGFGMLSSPKSPT  389
             + PSKLS     TWAKSLK+P     ++E  N+ +   +KSPF+  +SGFG     K P 
Sbjct  60    EAPSKLSVAGISTWAKSLKLPISPKDAKENSNASSPKDSKSPFSILSSGFGKRVPAKIPV  119

Query  390   DDNSEGTSTTP---QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLD  560
              D+   T+T P   Q    GTFTKG +DSS+NAVK V  +ARH+VSQNKRRYQEGGFDLD
Sbjct  120   VDDELPTTTAPAQAQDGAFGTFTKGFLDSSRNAVKVVQTRARHLVSQNKRRYQEGGFDLD  179

Query  561   LTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLY  740
             +TYIT+++IAMGFPAGDMSSG  GYVEGFYRNHMEEVI+FFET HK KYKVYNLCSERLY
Sbjct  180   MTYITDSIIAMGFPAGDMSSGILGYVEGFYRNHMEEVIRFFETQHKGKYKVYNLCSERLY  239

Query  741   DVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMIS  920
             DVSL EGKVASFPFDDHNCPP+QL+++FC+SAY WLKE+++NVVVVHCKAG ARTGLMIS
Sbjct  240   DVSLLEGKVASFPFDDHNCPPLQLVLAFCRSAYGWLKENLDNVVVVHCKAGKARTGLMIS  299

Query  921   SLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCM  1100
              LLLYLKFFPTAEE I  YN++RC+D+KGL+LPSQIRYVKYFER+L  FNGE    R+C+
Sbjct  300   CLLLYLKFFPTAEECIANYNERRCIDSKGLILPSQIRYVKYFERVLKEFNGETPAGRKCI  359

Query  1101  LRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGE  1280
             LRG RLH+CPYWIRP+IT+SDHNG+LFSTKKHPRTKD++PED+WFSAP++G++VFALPGE
Sbjct  360   LRGIRLHRCPYWIRPAITVSDHNGILFSTKKHPRTKDMMPEDFWFSAPRRGIMVFALPGE  419

Query  1281  PGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVL  1460
               VA+L GDFK+ F DR GDFYCWLNTTM+E R+ILN SDLDGFDKR+LPSPGFQVE+V+
Sbjct  420   RCVADLDGDFKILFQDRHGDFYCWLNTTMMETRQILNVSDLDGFDKRRLPSPGFQVEVVI  479

Query  1461  VDYDTA-----------FPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQK  1607
             +D + +            P  PQ                                  +  
Sbjct  480   LDPNASVPPVPPRESPPLPQAPQ---------------------------------RSPD  506

Query  1608  SGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVS  1787
             + S E DDVFSD+E  ++ + +           QA  +   ++   P+ S  +   E+  
Sbjct  507   TESRENDDVFSDSEDGDSHRKE----------NQAAAAAVVSSENRPKSSDSSPAAEEAP  556

Query  1788  LGDSGLKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                S    +           S  E +  E +DF+ +AADASVFTFGDE+DY SE
Sbjct  557   KARSDKDESSDYVHVKEDHPSKKEKAEDESNDFRAIAADASVFTFGDEDDYASE  610



>ref|XP_002965143.1| hypothetical protein SELMODRAFT_167184 [Selaginella moellendorffii]
 gb|EFJ33981.1| hypothetical protein SELMODRAFT_167184 [Selaginella moellendorffii]
Length=610

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/594 (57%), Positives = 414/594 (70%), Gaps = 64/594 (11%)
 Frame = +3

Query  231   DGPSKLS-----TWAKSLKIPQPFTGSQEEENSGNA--AKSPFARFTSGFGMLSSPKSPT  389
             + PSKLS     TWAKSLK+P     ++E  N+ +   +KSPF+  +SGFG     K P 
Sbjct  60    EAPSKLSVAGISTWAKSLKLPISPKDAKENSNASSPKDSKSPFSILSSGFGKRVPAKIPV  119

Query  390   DDNSEGTSTTP---QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLD  560
              D+   T+T P   Q    GTFTKG +DSS+NAVK V  +ARH+VSQNKRRYQEGGFDLD
Sbjct  120   VDDELPTTTAPAQAQDGAFGTFTKGFLDSSRNAVKVVQTRARHLVSQNKRRYQEGGFDLD  179

Query  561   LTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLY  740
             +TYIT+++IAMGFPAGDMSSG  GYVEGFYRNHMEEVI+FFET HK KYKVYNLCSERLY
Sbjct  180   MTYITDSIIAMGFPAGDMSSGILGYVEGFYRNHMEEVIRFFETQHKGKYKVYNLCSERLY  239

Query  741   DVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMIS  920
             DVSL EGKVASFPFDDHNCPP+QL+++FC+SAY WLKE+++NVVVVHCKAG ARTGLMIS
Sbjct  240   DVSLLEGKVASFPFDDHNCPPLQLVLAFCRSAYGWLKENLDNVVVVHCKAGKARTGLMIS  299

Query  921   SLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCM  1100
              LLLYLKFFPTAEE I  YN++RC+D+KGL+LPSQIRYVKYFER+L  FNGE    R+C+
Sbjct  300   CLLLYLKFFPTAEECIANYNERRCIDSKGLILPSQIRYVKYFERVLKEFNGETPAGRKCI  359

Query  1101  LRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGE  1280
             LRG RLH+CPYWIRP+IT+SDHNG+LFSTKKHPRTKD++PED+WFSAP++G++VFALPGE
Sbjct  360   LRGIRLHRCPYWIRPAITVSDHNGILFSTKKHPRTKDMMPEDFWFSAPRRGIMVFALPGE  419

Query  1281  PGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVL  1460
               VA+L GDFK+ F DR GDFYCWLNTTM+E R+ILN +DLDGFDKR+LPSPGFQVE+V+
Sbjct  420   RCVADLDGDFKILFQDRHGDFYCWLNTTMMETRQILNVADLDGFDKRRLPSPGFQVEVVI  479

Query  1461  VDYDTA-----------FPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQK  1607
             +D + +            P  PQ                                  +  
Sbjct  480   LDPNASVPPVPPRESPPLPQAPQ---------------------------------RSPD  506

Query  1608  SGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVS  1787
             + S E DDVFSD+E  ++ + +           QA  +   ++   P+ S  +   E+  
Sbjct  507   TESRENDDVFSDSEDGDSHRKE----------NQAAAAAVVSSENRPKSSDSSPAAEEAP  556

Query  1788  LGDSGLKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                S    +           S  E +  E +DF+ +AADASVFTFGDE+DY SE
Sbjct  557   KARSDKDESSDYVHVKEDHPSKKEKAEDESNDFRAIAADASVFTFGDEDDYASE  610



>ref|XP_006297600.1| hypothetical protein CARUB_v10013622mg [Capsella rubella]
 gb|EOA30498.1| hypothetical protein CARUB_v10013622mg [Capsella rubella]
Length=469

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/478 (68%), Positives = 376/478 (79%), Gaps = 21/478 (4%)
 Frame = +3

Query  537   QEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVY  716
             QEGGFDLDLTYITEN+IAMGFPAGDMSSGFFGYVEGFYRN MEEVI F ET HK KYKVY
Sbjct  6     QEGGFDLDLTYITENIIAMGFPAGDMSSGFFGYVEGFYRNQMEEVISFLETQHKGKYKVY  65

Query  717   NLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGM  896
             NLCSERLYDVSLFEGKVASFPFDDHNCPPI LI SFCQSAYSWLKEDIENVVVVHCKAGM
Sbjct  66    NLCSERLYDVSLFEGKVASFPFDDHNCPPIHLITSFCQSAYSWLKEDIENVVVVHCKAGM  125

Query  897   ARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGE  1076
             ARTGLMI SLLLYLKFFPTAEE +++YNQKRC+D KGLVLPSQIRYVKYFERIL YFNGE
Sbjct  126   ARTGLMICSLLLYLKFFPTAEECMDFYNQKRCVDGKGLVLPSQIRYVKYFERILTYFNGE  185

Query  1077  NQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGV  1256
             NQP RRCMLRGFRLH+CPYWIRPSITISDHNGVLF+TKKHPRTKDL  ED+WFSAPKKGV
Sbjct  186   NQPGRRCMLRGFRLHRCPYWIRPSITISDHNGVLFTTKKHPRTKDLSSEDFWFSAPKKGV  245

Query  1257  VVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSP  1436
             +VFALPGEPG+ ELAGDFK+HF+DRQGDFYCWLNTTM+ENR IL TS+LD FDKRKLPSP
Sbjct  246   MVFALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTMMENRMILKTSELDAFDKRKLPSP  305

Query  1437  GFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGS  1616
             GF VE+VL D +   PT P  E+A  +    +++ +     S      A+    N+++  
Sbjct  306   GFMVEVVLADINATIPTNPSSESASKTPEETSAANSSPVDGS------ASVPGPNKETED  359

Query  1617  SEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSL-G  1793
              +KDDVFSDNE + TG P     + ++   +AK S         + S LT+  E+VS+ G
Sbjct  360   PDKDDVFSDNEGDSTG-PTKTTSSASSQSPEAKQSAD-------ETSVLTKATEKVSISG  411

Query  1794  DSGLKHNEQKRDTTVGAAS------VPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             ++G     Q    +   A+      V   +++  S+FK+MAADASVF+FGDE+D+ES+
Sbjct  412   NNGSSQPVQGEPVSKAGATEKPSGAVVNATSSSESEFKVMAADASVFSFGDEDDFESD  469



>ref|XP_009399933.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009399934.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009399935.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Musa 
acuminata subsp. malaccensis]
Length=585

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/576 (59%), Positives = 412/576 (72%), Gaps = 38/576 (7%)
 Frame = +3

Query  246   LSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPK-SPTDDNSEGTSTTP  422
             +S+WA+SL+  Q     QE+   GNA K    R TSGFG L  P  S  D+N E   TT 
Sbjct  40    ISSWAQSLRNLQ--QSHQEDSQPGNAGKLTLQRLTSGFGSLLYPNLSSKDENVEHDPTTL  97

Query  423   QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFP  602
             QS   G+ TKGLVDSSK A+K V  KAR +VSQNK+RYQ+G FDLDLTYITE +IAMGFP
Sbjct  98    QSGVWGSLTKGLVDSSKTAMKTVQGKARQIVSQNKKRYQDGEFDLDLTYITEKIIAMGFP  157

Query  603   AGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPF  782
             +G +SSG  G  EG YRNHMEEVIKF ET HK KYKVYNLCSERLYD SLFEGKVA FP 
Sbjct  158   SGYISSGILGLFEGLYRNHMEEVIKFLETQHKGKYKVYNLCSERLYDASLFEGKVACFPI  217

Query  783   DDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEE  962
             D++NCPPIQLI SFC+S  SWL++D+ENVVVVH KAG+ RTGLMISSLLLYL FF TA+E
Sbjct  218   DEYNCPPIQLIASFCESTKSWLQQDVENVVVVHAKAGIERTGLMISSLLLYLGFFATADE  277

Query  963   SINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIR  1142
             SI+++N++RC+DAKGL++PSQIRYV+YF  IL YFNGE QP RRCMLRGFRL+ CPYWIR
Sbjct  278   SIDHFNKERCIDAKGLIIPSQIRYVRYFGCILTYFNGEVQPGRRCMLRGFRLYNCPYWIR  337

Query  1143  PSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHF  1322
             PSIT+S HNGVLFSTKKHP+TKDL+PED+WF + +KG+++FA+PGEPG+ ELAGDFKVHF
Sbjct  338   PSITVSKHNGVLFSTKKHPKTKDLMPEDFWFKSKQKGIMIFAIPGEPGLTELAGDFKVHF  397

Query  1323  NDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPE  1502
             +DRQGDFYCWLNT+MI+N+  L+ S+LDGFDKRK+PSPGFQVEIV+VDYD +    P   
Sbjct  398   HDRQGDFYCWLNTSMIDNKVTLSASELDGFDKRKIPSPGFQVEIVMVDYDHSRSQNPM--  455

Query  1503  aavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGK  1682
                   S++ +  +    ++     +++  +S        KDDVFSD++AEET  P+   
Sbjct  456   ------STNVNKDSDGRLATGKPKGDSSSISSTPNKNKDNKDDVFSDSDAEETRSPR---  506

Query  1683  VTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAAS----  1850
                            G N  SP  +  T  IEQ SL D        K+  T G +S    
Sbjct  507   ---------------GENANSP--NDKTAGIEQASLEDGAAAAMVPKKAPTEGGSSGLMS  549

Query  1851  --VPEVSNTEVSDFKIMAADASVFTFGDEED-YESE  1949
                   ++  VS+FK +AADASVF+FGD+ED YESE
Sbjct  550   EEAVVANSAAVSEFKAIAADASVFSFGDDEDEYESE  585



>ref|XP_007205033.1| hypothetical protein PRUPE_ppa004114mg [Prunus persica]
 gb|EMJ06232.1| hypothetical protein PRUPE_ppa004114mg [Prunus persica]
Length=529

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/509 (64%), Positives = 387/509 (76%), Gaps = 21/509 (4%)
 Frame = +3

Query  426   SSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPA  605
             S    +FTKGLV++S++AVKAV VKARH+VSQNKRRYQEGGFDLDLTYITEN+IAMGFPA
Sbjct  41    SGVFHSFTKGLVNTSQSAVKAVQVKARHLVSQNKRRYQEGGFDLDLTYITENIIAMGFPA  100

Query  606   GDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFD  785
             GD+SSG FGYVEGFYRNHMEEVI F ET HK KYKVYNLCSERLYD S FEGK ASFPFD
Sbjct  101   GDISSGIFGYVEGFYRNHMEEVINFLETQHKGKYKVYNLCSERLYDASRFEGKAASFPFD  160

Query  786   DHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEES  965
             DHNCPP++LI SFC+SA+SWLKE IENVVVVHCKAGM RTGLMI SLLL+LKFFPTAEE+
Sbjct  161   DHNCPPVELIASFCRSAHSWLKEGIENVVVVHCKAGMGRTGLMICSLLLFLKFFPTAEEA  220

Query  966   INYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRP  1145
             INYYN KRC+D + LVLPSQIRYVKYFE IL  FNGEN   RRCMLRGFRLH CPYWIRP
Sbjct  221   INYYNHKRCIDGRALVLPSQIRYVKYFEHILKNFNGENPSPRRCMLRGFRLHNCPYWIRP  280

Query  1146  SITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFN  1325
             SITISDHNG+LFS++KHP+TKDL+PED+W +A KKG+VVFALPGEPG+AEL GDFK+HF+
Sbjct  281   SITISDHNGILFSSRKHPKTKDLMPEDFWINARKKGIVVFALPGEPGLAELLGDFKIHFH  340

Query  1326  DRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEa  1505
             D QGDFYCWLN TM +NRKIL   DLDGFDKRKLPSPGFQVE+V+VDYD   PT+ + ++
Sbjct  341   DSQGDFYCWLN-TMTDNRKILTADDLDGFDKRKLPSPGFQVEVVMVDYDGTLPTKAKADS  399

Query  1506  avsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKV  1685
             +       +S A+ +S         AA+ N N      + DDVFSD++ EE G  K  +V
Sbjct  400   SSRKPEGSSSDASASSHGV------AANPNQNITPQREDGDDVFSDSDGEEAGDIKSTQV  453

Query  1686  TV-ATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEV  1862
                ++ G+ A    S   +     SS  +K        S L H+ +K            +
Sbjct  454   QGNSSTGLPAPNHVSNTRSEDTPKSSSLKKPTSDGAEKSHLVHHSRK------------L  501

Query  1863  SNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             S++   D + +AADASVF+FGD +D++SE
Sbjct  502   SSSGAEDIRAIAADASVFSFGD-DDFDSE  529



>ref|XP_010558861.1| PREDICTED: uncharacterized protein LOC104827383 [Tarenaya hassleriana]
Length=630

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/609 (56%), Positives = 417/609 (68%), Gaps = 51/609 (8%)
 Frame = +3

Query  96    SPPATFRTLVPSLSTMDTQLSNASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKI  275
             +P       +PS++T    L+   +  P        S   SVP+   PS LSTWAKS K 
Sbjct  56    APSGKVDVQLPSITTAAEPLNGTEDVVPCPP---NASPSESVPSVFSPSGLSTWAKSFKF  112

Query  276   PQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQ-SSFIGTFTK  452
                   +Q++  + N+  S FARFTS  G L  P   +D++ +  S   Q    + + TK
Sbjct  113   ------TQQDSKTINSGMSAFARFTSELG-LHLPTKGSDESGDSKSPGAQVGDALESLTK  165

Query  453   GLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFG  632
              +VDSS++AVKAV VKARH+VSQNKRRYQEG FDLD+TYITENVIAMGFPAGD+SSG FG
Sbjct  166   AVVDSSRSAVKAVQVKARHMVSQNKRRYQEGEFDLDMTYITENVIAMGFPAGDLSSGLFG  225

Query  633   YVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQL  812
             + EG YRNHMEEVIKFFETHHK KYKVYNLCSERLYD S FEGKVASFPFDDHNCPPIQL
Sbjct  226   FFEGLYRNHMEEVIKFFETHHKGKYKVYNLCSERLYDASRFEGKVASFPFDDHNCPPIQL  285

Query  813   IMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRC  992
             I SFCQSAYSWL EDI+NVVVVHCKAGMARTGLMI  LLL+LKFFPTAEE+I+YYNQKRC
Sbjct  286   IPSFCQSAYSWLNEDIQNVVVVHCKAGMARTGLMICCLLLFLKFFPTAEEAIDYYNQKRC  345

Query  993   MDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG  1172
              D K LVLPSQIRYVKY+ER+  YF GE  P RRCMLRGFRL  CPYWIRPSITIS+H+G
Sbjct  346   TDGKALVLPSQIRYVKYYERVQNYFKGEVPPGRRCMLRGFRLINCPYWIRPSITISNHSG  405

Query  1173  VLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCW  1352
             +LFST+KHP+TKDL+PED+W  AP+KGVVVFALPGEPG+ EL GDFK+HF+D  GDFYCW
Sbjct  406   ILFSTRKHPKTKDLMPEDFWMKAPRKGVVVFALPGEPGLTELVGDFKIHFHDGDGDFYCW  465

Query  1353  LNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdn  1532
             LNTTM ENR  L+  DLDGFDKRK+P+PGF VEIV+++ D   PT+P+ + + + +    
Sbjct  466   LNTTMAENRTTLDGGDLDGFDKRKMPAPGFHVEIVMIELDGTQPTKPKSDTSPTEEQPQT  525

Query  1533  ssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKP--KVGKVTVATDGV  1706
              S+            + A  ++  K+     DDVFSD++ E+  +P  K   +   ++ +
Sbjct  526   QSST-----------QHASDSAKSKTSRDRDDDVFSDSDEEKPREPSEKAKGLMHESNEI  574

Query  1707  QAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNTEVSDF  1886
             +AK         +P I S    ++    G S L                  + ++  SD 
Sbjct  575   KAK---------APIIKSEEDSVKGGGEGSSSL------------------MDSSGASDI  607

Query  1887  KIMAADASV  1913
             K +AADASV
Sbjct  608   KSIAADASV  616



>ref|XP_008238882.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Prunus 
mume]
Length=529

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/509 (63%), Positives = 387/509 (76%), Gaps = 21/509 (4%)
 Frame = +3

Query  426   SSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPA  605
             S    +FTKGLV++S++AVKAV V+ARH+VSQNKRRYQEGGFDLDLTYITEN+IAMGFPA
Sbjct  41    SGVFQSFTKGLVNTSQSAVKAVQVRARHLVSQNKRRYQEGGFDLDLTYITENIIAMGFPA  100

Query  606   GDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFD  785
             GD+SSG FGYVEGFYRNHMEEVI F ET HK KYKVYNLCSERLYD S FEGK ASFPFD
Sbjct  101   GDISSGIFGYVEGFYRNHMEEVINFLETQHKGKYKVYNLCSERLYDASRFEGKAASFPFD  160

Query  786   DHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEES  965
             DHNCPP++LI SFC+SA+SWLKE IENVVVVHCKAGM RTGLMI SLLL+LKFFPTAEE+
Sbjct  161   DHNCPPVELIASFCRSAHSWLKEGIENVVVVHCKAGMGRTGLMICSLLLFLKFFPTAEEA  220

Query  966   INYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRP  1145
             INYYN KRC+D K LVLPSQIRYVKYFE IL  FNGE    RRCMLRGFRLH CPYWIRP
Sbjct  221   INYYNHKRCIDGKALVLPSQIRYVKYFEHILKNFNGEIPSPRRCMLRGFRLHNCPYWIRP  280

Query  1146  SITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFN  1325
             SITISDHNG+LFS++KHP+TKDL+PED+W +A KKG+VVFALPG+PG+AEL GDFK+HF+
Sbjct  281   SITISDHNGILFSSRKHPKTKDLMPEDFWINARKKGIVVFALPGQPGLAELVGDFKIHFH  340

Query  1326  DRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEa  1505
             D QGDFYCWLN TM +NRKIL   DLDGFDKRKLPSPGFQVE+V++DYD   PT+ + ++
Sbjct  341   DSQGDFYCWLN-TMTDNRKILTADDLDGFDKRKLPSPGFQVEVVMIDYDGTLPTKAKADS  399

Query  1506  avsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKV  1685
             +       ++ A+ +S         AA+ N N+     + DDVFSD++ EE G  K  + 
Sbjct  400   SSRKPEGSSNDASVSSHGV------AANPNQNKTPQREDGDDVFSDSDGEEAGDTKSTQA  453

Query  1686  TV-ATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEV  1862
                ++ G+ A    S   +     SS  +K     +  S L H+ +K            +
Sbjct  454   QGNSSAGLPAPNHVSNTRSEDTPKSSSLKKPTSDGVEKSHLVHHSRK------------L  501

Query  1863  SNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             S++   D + +AADASVF+FGD +D++SE
Sbjct  502   SSSGAEDIRAIAADASVFSFGD-DDFDSE  529



>ref|XP_010515377.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Camelina 
sativa]
Length=624

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/618 (57%), Positives = 432/618 (70%), Gaps = 57/618 (9%)
 Frame = +3

Query  141   MDTQ-LSNASNPQPSVTANMETSNVNSVPAQDGPSKLST-----WAKSLKIPQPFTGSQE  302
             +DTQ LSN S P  S TA++      S P +   S  S+     WAKSLK PQ      +
Sbjct  49    VDTQMLSNGSEPS-SKTADIVPCPPGSSPRESPSSIFSSSGLSSWAKSLKFPQ------Q  101

Query  303   EENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQ-SSFIGTFTKGLVDSSKNA  479
             + ++ ++  S F RFTS  G L  P   +DD S+  +   Q    + + TK +VDSS+ A
Sbjct  102   DPHATDSGMSAFTRFTSELG-LHLPTKGSDDVSDPRAPNTQVGGALESLTKAVVDSSRGA  160

Query  480   VKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNH  659
             VKA+ VKARH+VSQNKRRYQEG FDLD+TYITEN+IAMGFPAGD+SSG FG+ EG YRNH
Sbjct  161   VKAMQVKARHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDISSGLFGFFEGLYRNH  220

Query  660   MEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAY  839
             MEEVIKFFETHHK+KYKVYNLCSERLYD S FEGKVASFPFDDHNCPPIQLI SFCQSAY
Sbjct  221   MEEVIKFFETHHKEKYKVYNLCSERLYDASRFEGKVASFPFDDHNCPPIQLIPSFCQSAY  280

Query  840   SWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLP  1019
             +WLKEDI+NVVVVHCKAGMARTGLMI  LLLYLKFFPTAEE+I+YYNQKRC+D K LVLP
Sbjct  281   TWLKEDIQNVVVVHCKAGMARTGLMICCLLLYLKFFPTAEEAIDYYNQKRCLDGKALVLP  340

Query  1020  SQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHP  1199
             SQIRYVKY+ER+   F+G+  P +RCMLRGFRL  CPYWIRP+ITIS+H G+LFSTKKH 
Sbjct  341   SQIRYVKYYERVQNQFDGKVPPEQRCMLRGFRLINCPYWIRPAITISNHTGILFSTKKHQ  400

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENR  1379
             +TKDL PED+W  APKKGVVVFA+PGE G+ ELAGDFK+HF+D  GDFYCWLNTT+ +NR
Sbjct  401   KTKDLGPEDFWIKAPKKGVVVFAIPGEAGLTELAGDFKIHFHDSDGDFYCWLNTTLTDNR  460

Query  1380  KILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgs  1559
              +L  SD DGFDKRKLP+PGF VEIV+++ D + PT+                 + +  +
Sbjct  461   TMLKGSDFDGFDKRKLPAPGFHVEIVMIESDNSQPTK-----------------SRSDST  503

Query  1560  sphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNT  1739
                S   ++  +S  KS  ++ DDVFSD++ E+ G  K     + T+    K S S + T
Sbjct  504   QQQSQSSSSADSSQLKSSQNKDDDVFSDSDGEDNGNSK----PIETNSTTEKTSGSMHTT  559

Query  1740  GSP-QISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSN------TEVSDFKIMA  1898
               P QI+ L              K ++   + ++ ++S  ++ N        VSD K +A
Sbjct  560   SKPHQINELP-------------KTDDPSANRSITSSSSSDLHNPLPNHSLAVSDIKAIA  606

Query  1899  ADASVFTFGD-EEDYESE  1949
             ADASVF+FGD EEDYES+
Sbjct  607   ADASVFSFGDEEEDYESD  624



>ref|XP_006404056.1| hypothetical protein EUTSA_v10010193mg [Eutrema salsugineum]
 gb|ESQ45509.1| hypothetical protein EUTSA_v10010193mg [Eutrema salsugineum]
Length=640

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/620 (57%), Positives = 432/620 (70%), Gaps = 49/620 (8%)
 Frame = +3

Query  129   SLSTMDTQL-SNASNPQPS------VTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPF  287
             S+ST+D Q+ + +S  +PS      V    ++S   S P+    S LS+WAKS K PQ  
Sbjct  57    SISTVDIQIPAISSGAEPSSKTDDIVPCPPDSSTRESPPSLFSSSGLSSWAKSFKFPQ--  114

Query  288   TGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDS  467
                 ++ N+ ++  S F RFTS  G L  P   +D+  +  +T    + + + TK +VDS
Sbjct  115   ----QDPNATDSGMSAFTRFTSELG-LHLPTKGSDEVGDPPNTQVGGA-LESLTKVVVDS  168

Query  468   SKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGF  647
             S+ AVKA+ VKARH+VSQNKRRYQEG FDLD+TYITEN+IAMGFPAGD+SSG FG+ EG 
Sbjct  169   SRGAVKAMQVKARHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDISSGLFGFFEGL  228

Query  648   YRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFC  827
             YRNHMEEVIKFFETHHKDKYKVYNLCSERLYD S FEGKVASFPFDDHNCPPIQLI SFC
Sbjct  229   YRNHMEEVIKFFETHHKDKYKVYNLCSERLYDASRFEGKVASFPFDDHNCPPIQLIPSFC  288

Query  828   QSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKG  1007
             QSAY+WLKEDI+NVVVVHCKAGMARTGLMI  LLLYLKFFPTAEE+I+YYNQKRC+D K 
Sbjct  289   QSAYTWLKEDIQNVVVVHCKAGMARTGLMICCLLLYLKFFPTAEEAIDYYNQKRCLDGKA  348

Query  1008  LVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFST  1187
             LVLPSQ+RYVKY+ERI   F G+    RRCMLRGFRL  CPYWIRP+ITIS+HN +LFST
Sbjct  349   LVLPSQLRYVKYYERIQNQFGGKVPLERRCMLRGFRLINCPYWIRPAITISNHNDILFST  408

Query  1188  KKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTM  1367
             KKH +TKDL PED+W  APKKGVVVFA+PGE G+ ELAGDFK+HF D  GDFYCWLNTT+
Sbjct  409   KKHQKTKDLGPEDFWIKAPKKGVVVFAIPGEAGLTELAGDFKIHFQDSDGDFYCWLNTTL  468

Query  1368  IENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanp  1547
              + R +L   D DGF+KRKLP+PGF VEIV+++ D + PT+P+ +++ S++    SS+  
Sbjct  469   TDKRTMLKGIDFDGFEKRKLPAPGFHVEIVMIESDNSQPTKPKSDSSYSAEQQPQSSS--  526

Query  1548  asgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTS  1727
                         AD+    K   ++ DDVFSD++ EE G  K     + ++    K   S
Sbjct  527   -----------GADSGKTGKFKQNKDDDVFSDSDGEEEGNSK----HIESNSTTEKTVGS  571

Query  1728  GNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAAS-----VPEVSNTEVSDFKI  1892
              + T  P   +  QK +           N   R  T  ++S     VP  S   VS+ K 
Sbjct  572   MHTTSKPHQINEPQKTDD----------NSANRSVTSSSSSGLYNPVPNES-LAVSNIKA  620

Query  1893  MAADASVFTFGD-EEDYESE  1949
             +AADASVF+FGD EEDYES+
Sbjct  621   IAADASVFSFGDEEEDYESD  640



>ref|XP_010503678.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Camelina sativa]
Length=633

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/624 (56%), Positives = 432/624 (69%), Gaps = 69/624 (11%)
 Frame = +3

Query  141   MDTQ-LSNASNPQPSVTANMETSNVNSVPAQDGPS------------KLSTWAKSLKIPQ  281
             +DTQ LSN S P         +  V+ VP   G S             LS+WAKSLK PQ
Sbjct  58    VDTQMLSNGSEPS--------SKTVDIVPCPPGSSPRESPSSIFSSSGLSSWAKSLKFPQ  109

Query  282   PFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQ-SSFIGTFTKGL  458
                   ++ ++ ++  S F RFTS  G L  P   +D+ S+  ST  Q    + + TK +
Sbjct  110   ------QDPHAADSGMSAFTRFTSELG-LHLPTKGSDEVSDPRSTNTQVGGALESLTKAV  162

Query  459   VDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYV  638
             VDSS+ AVKA+ VKARH+VSQNKRRYQEG FDLD+TYITEN+IAMGFPAGD+SSG FG+ 
Sbjct  163   VDSSRGAVKAMQVKARHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDISSGLFGFF  222

Query  639   EGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIM  818
             EG YRNHMEEVIKFFETHHKDKYKVYNLCSERLYD S FEGKVASFPFDDHNCPPIQLI 
Sbjct  223   EGLYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDASRFEGKVASFPFDDHNCPPIQLIP  282

Query  819   SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMD  998
             SFCQSAY+WLKEDI+NVVVVHCKAGMARTGLMI  LLLYLKFFPTAEE+I+YYNQKRC+D
Sbjct  283   SFCQSAYTWLKEDIQNVVVVHCKAGMARTGLMICCLLLYLKFFPTAEEAIDYYNQKRCLD  342

Query  999   AKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVL  1178
              K LVLPSQIRYVKY+ER+   F+G+  P +RCMLRGFRL  CPYWIRP+ITIS+H  +L
Sbjct  343   GKALVLPSQIRYVKYYERVQNQFDGKVPPEQRCMLRGFRLINCPYWIRPAITISNHTDIL  402

Query  1179  FSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLN  1358
             FSTKKH +TKDL PED+W  APKKGVVVFA+PGE G+ ELAGDFK+HF+D  GDFYCWLN
Sbjct  403   FSTKKHQKTKDLGPEDFWIKAPKKGVVVFAIPGEAGLTELAGDFKIHFHDSDGDFYCWLN  462

Query  1359  TTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnss  1538
             TT+ +NR +L  SD DGFDKRKLP+PGF VEIV+++ D + PT+                
Sbjct  463   TTLTDNRTMLKGSDFDGFDKRKLPAPGFHVEIVMIESDNSQPTK----------------  506

Query  1539  anpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKV  1718
              + +  +   S   ++  +S  +S  ++ DDVFSD++ E+ G  K     + T+      
Sbjct  507   -SKSDSTQQQSQSSSSADSSKLESNQNKDDDVFSDSDGEDNGNSK----PIETN------  555

Query  1719  STSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSN------TEVS  1880
             ST+ N  GS   +S   +I +        K ++   + ++ ++S  ++ N        VS
Sbjct  556   STTENTAGSMHTTSKPHQINEPP------KTDDPSANRSITSSSSSDLHNPLPNHSLAVS  609

Query  1881  DFKIMAADASVFTFGD-EEDYESE  1949
             D K +AADASVF+FGD EEDYES+
Sbjct  610   DIKAIAADASVFSFGDEEEDYESD  633



>ref|XP_010503679.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Camelina sativa]
Length=600

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/624 (56%), Positives = 432/624 (69%), Gaps = 69/624 (11%)
 Frame = +3

Query  141   MDTQ-LSNASNPQPSVTANMETSNVNSVPAQDGPS------------KLSTWAKSLKIPQ  281
             +DTQ LSN S P         +  V+ VP   G S             LS+WAKSLK PQ
Sbjct  25    VDTQMLSNGSEPS--------SKTVDIVPCPPGSSPRESPSSIFSSSGLSSWAKSLKFPQ  76

Query  282   PFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQ-SSFIGTFTKGL  458
                   ++ ++ ++  S F RFTS  G L  P   +D+ S+  ST  Q    + + TK +
Sbjct  77    ------QDPHAADSGMSAFTRFTSELG-LHLPTKGSDEVSDPRSTNTQVGGALESLTKAV  129

Query  459   VDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYV  638
             VDSS+ AVKA+ VKARH+VSQNKRRYQEG FDLD+TYITEN+IAMGFPAGD+SSG FG+ 
Sbjct  130   VDSSRGAVKAMQVKARHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDISSGLFGFF  189

Query  639   EGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIM  818
             EG YRNHMEEVIKFFETHHKDKYKVYNLCSERLYD S FEGKVASFPFDDHNCPPIQLI 
Sbjct  190   EGLYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDASRFEGKVASFPFDDHNCPPIQLIP  249

Query  819   SFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMD  998
             SFCQSAY+WLKEDI+NVVVVHCKAGMARTGLMI  LLLYLKFFPTAEE+I+YYNQKRC+D
Sbjct  250   SFCQSAYTWLKEDIQNVVVVHCKAGMARTGLMICCLLLYLKFFPTAEEAIDYYNQKRCLD  309

Query  999   AKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVL  1178
              K LVLPSQIRYVKY+ER+   F+G+  P +RCMLRGFRL  CPYWIRP+ITIS+H  +L
Sbjct  310   GKALVLPSQIRYVKYYERVQNQFDGKVPPEQRCMLRGFRLINCPYWIRPAITISNHTDIL  369

Query  1179  FSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLN  1358
             FSTKKH +TKDL PED+W  APKKGVVVFA+PGE G+ ELAGDFK+HF+D  GDFYCWLN
Sbjct  370   FSTKKHQKTKDLGPEDFWIKAPKKGVVVFAIPGEAGLTELAGDFKIHFHDSDGDFYCWLN  429

Query  1359  TTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnss  1538
             TT+ +NR +L  SD DGFDKRKLP+PGF VEIV+++ D + PT+                
Sbjct  430   TTLTDNRTMLKGSDFDGFDKRKLPAPGFHVEIVMIESDNSQPTK----------------  473

Query  1539  anpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKV  1718
              + +  +   S   ++  +S  +S  ++ DDVFSD++ E+ G  K     + T+      
Sbjct  474   -SKSDSTQQQSQSSSSADSSKLESNQNKDDDVFSDSDGEDNGNSK----PIETN------  522

Query  1719  STSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSN------TEVS  1880
             ST+ N  GS   +S   +I +        K ++   + ++ ++S  ++ N        VS
Sbjct  523   STTENTAGSMHTTSKPHQINEPP------KTDDPSANRSITSSSSSDLHNPLPNHSLAVS  576

Query  1881  DFKIMAADASVFTFGD-EEDYESE  1949
             D K +AADASVF+FGD EEDYES+
Sbjct  577   DIKAIAADASVFSFGDEEEDYESD  600



>ref|XP_009367508.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Pyrus 
x bretschneideri]
 ref|XP_009367516.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Pyrus 
x bretschneideri]
 ref|XP_009367525.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Pyrus 
x bretschneideri]
Length=529

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/528 (62%), Positives = 393/528 (74%), Gaps = 23/528 (4%)
 Frame = +3

Query  369   SSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGG  548
             ++  S  D+NS   +      F+ +FTKGLV++S++AVKAV VKARH+VSQNKRRYQEGG
Sbjct  24    AAAASGQDNNSTQYAKAVSGVFL-SFTKGLVNTSQSAVKAVQVKARHLVSQNKRRYQEGG  82

Query  549   FDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCS  728
             FDLDLTYITEN+IAMGFPAGD+SSG FGYVEGFYRNHMEEVI F ET HK KYKVYNLCS
Sbjct  83    FDLDLTYITENIIAMGFPAGDISSGLFGYVEGFYRNHMEEVISFLETTHKGKYKVYNLCS  142

Query  729   ERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTG  908
             ERLYD S FEGK ASFPFDDHNCPPI+LI SFC+SA+SWLKE IENVVVVHCKAGMARTG
Sbjct  143   ERLYDASRFEGKAASFPFDDHNCPPIELIESFCRSAHSWLKEGIENVVVVHCKAGMARTG  202

Query  909   LMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPA  1088
             +MI SLLL+LKFFPTAEE++NYYN KRC+D K LVLPSQIRYVKYFE IL +FNGE  PA
Sbjct  203   VMICSLLLFLKFFPTAEEAMNYYNHKRCIDGKALVLPSQIRYVKYFEHILKHFNGETPPA  262

Query  1089  RRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFA  1268
             RRCMLRGFRLH CPYWIRPSITISDH G+LFS++KHP+TKDL+PED+W +A KKG VVFA
Sbjct  263   RRCMLRGFRLHNCPYWIRPSITISDHKGILFSSRKHPKTKDLMPEDFWINARKKGFVVFA  322

Query  1269  LPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQV  1448
             LPGEPG+AEL GDFK+ F D  GDFYCWLN TM ENRKIL   DLDG++KRKLP PGFQV
Sbjct  323   LPGEPGLAELVGDFKIQFQDSHGDFYCWLN-TMTENRKILTADDLDGYEKRKLPCPGFQV  381

Query  1449  EIVLVDYD-TAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEK  1625
             E+V++DYD T  PT+ + +++        S AN +S         A + N ++ S   + 
Sbjct  382   EVVMIDYDGTTLPTKAKADSSGRKPEGSASDANASSRRV------AGNPNQSKISQHEDG  435

Query  1626  DDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGL  1805
             DDVFSD++ +ETG     K  +A    +A +  S + + +  + S      + +   +G 
Sbjct  436   DDVFSDSDGDETGDT---KSRLAEAISRAGLPASNHPSNTRSVDSPRSNSRKPTNDGAGK  492

Query  1806  KHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
              H    R          ++S++   D + MAADASVF+FGD +D +SE
Sbjct  493   SHPGHSR----------KLSSSGGDDIRAMAADASVFSFGD-DDLDSE  529



>ref|XP_004289204.1| PREDICTED: putative tyrosine-protein phosphatase TPTE-like [Fragaria 
vesca subsp. vesca]
Length=513

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/521 (62%), Positives = 390/521 (75%), Gaps = 29/521 (6%)
 Frame = +3

Query  393   DNSEGTSTTPQ--SSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLT  566
             DN+   +  P+  S  +G+FTKG+++ S++AVKAV VKARH+VSQNKRRYQEGGFDLD+T
Sbjct  20    DNATQNAERPKGVSGALGSFTKGILNRSQSAVKAVQVKARHLVSQNKRRYQEGGFDLDMT  79

Query  567   YITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDV  746
             YITEN+IAMGFPAGD+SSGFFGYVEGFYRNHMEEVI+FFET+HK  YKVYNLCSERLYD 
Sbjct  80    YITENIIAMGFPAGDISSGFFGYVEGFYRNHMEEVIRFFETNHKGHYKVYNLCSERLYDA  139

Query  747   SLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSL  926
             S FEGK ASFPFDDHNCPPIQLI SFCQSA+SWLKEDIENVVVVHCKAGMARTG+MI SL
Sbjct  140   SRFEGKAASFPFDDHNCPPIQLIGSFCQSAHSWLKEDIENVVVVHCKAGMARTGVMICSL  199

Query  927   LLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLR  1106
             LLYLKFFPTAEE++ YYN KRC+D K +VLPSQIRYVKYF+ I   FNGE  P RRCMLR
Sbjct  200   LLYLKFFPTAEEAMYYYNNKRCVDGKAMVLPSQIRYVKYFDIISRKFNGEC-PPRRCMLR  258

Query  1107  GFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPG  1286
             GFR+H CPYW+RP IT+SDHNG+LFS++KH +TKDL+PED+W SA KKG++VFALPGEPG
Sbjct  259   GFRIHNCPYWVRPCITVSDHNGILFSSRKHSKTKDLMPEDFWISARKKGIIVFALPGEPG  318

Query  1287  VAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVD  1466
             +AELAGDFK++F+DR GDFYCWLNTT   NR  L   DLDGFDKRKLPSP FQVE+VLVD
Sbjct  319   LAELAGDFKIYFHDRHGDFYCWLNTTTENNRIFLKADDLDGFDKRKLPSPRFQVEVVLVD  378

Query  1467  YDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDN  1646
             Y     T P+ E+        ++ A+ +SG       +AA+ N  +K G    DDVFSD+
Sbjct  379   Y-RGTSTVPKAESLSRKPDGSSNDASASSGG------DAANLNQGKKDG----DDVFSDS  427

Query  1647  EAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKR  1826
             E EE+G  K G++  A            +NT   Q+ +  Q ++  + G+   +     R
Sbjct  428   EGEESGDRK-GRLAEANIKAGTTAPDHSSNTTGKQMETSAQTVD--NPGNGSFQKQTSDR  484

Query  1827  DTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
                          N+   D + +AADASVF+FGD ED++SE
Sbjct  485   -----------AGNSGAEDIRAIAADASVFSFGD-EDFDSE  513



>ref|XP_006290734.1| hypothetical protein CARUB_v10016830mg [Capsella rubella]
 gb|EOA23632.1| hypothetical protein CARUB_v10016830mg [Capsella rubella]
Length=639

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/626 (56%), Positives = 427/626 (68%), Gaps = 45/626 (7%)
 Frame = +3

Query  102   PATFRTLVPSLSTMDTQLSNASNPQPSVTANMETSNVNSVPAQDGPSKLST-----WAKS  266
             P  F     S + +DT + +  +   S T ++      S P +  PS  S+     WAKS
Sbjct  49    PKDFNRTEASAAKVDTPMPSTGSEPSSKTEDIVPCPPGSSPRESPPSIFSSSGLSSWAKS  108

Query  267   LKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIG--  440
             LK PQ      ++ N+ ++  S F RFTS  G+      PT  + E +   P ++ +G  
Sbjct  109   LKFPQ------QDPNTADSGMSAFTRFTSELGL----HLPTKGSDEASDPKPPNTQVGGA  158

Query  441   --TFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDM  614
               + TK +VDSS+ AVKA+ VKARH+VSQNKRRYQEG FDLD+TYITENVIAMGFPAGD+
Sbjct  159   LESLTKAVVDSSRGAVKAMQVKARHIVSQNKRRYQEGEFDLDMTYITENVIAMGFPAGDI  218

Query  615   SSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHN  794
             SSG FG+ EGFYRNHMEEVIKFFET+HK+KYKVYNLCSERLYD S FEGKVASFPFDDHN
Sbjct  219   SSGLFGFFEGFYRNHMEEVIKFFETNHKEKYKVYNLCSERLYDASRFEGKVASFPFDDHN  278

Query  795   CPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINY  974
             CPPIQLI SFCQSAY+WLKEDI+NVVVVHCKAGMARTGLMI  LLLYLKFFPTAEE+I+Y
Sbjct  279   CPPIQLIPSFCQSAYTWLKEDIQNVVVVHCKAGMARTGLMICCLLLYLKFFPTAEEAIDY  338

Query  975   YNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSIT  1154
             YNQKRC+D K LVLPSQIRYVKY+ER+   F+G+    +RCMLRGFRL  CPYWIRP+IT
Sbjct  339   YNQKRCLDGKALVLPSQIRYVKYYERVQNQFDGKVPAEQRCMLRGFRLINCPYWIRPAIT  398

Query  1155  ISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQ  1334
             IS+H  +LFSTKKH +TKDL PED+W  APKKGVVVFA+PGE G+ ELAGDFKVHF D  
Sbjct  399   ISNHTDILFSTKKHQKTKDLGPEDFWIKAPKKGVVVFAIPGEAGLTELAGDFKVHFQDSD  458

Query  1335  GDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavs  1514
             GDFYCWLNTT+ +NR +L  SD DGF+KRKLP+PGF VEIV+++ D + PT+ +      
Sbjct  459   GDFYCWLNTTLTDNRTMLKGSDFDGFEKRKLPAPGFHVEIVMIESDNSQPTKSK------  512

Query  1515  skssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVA  1694
                        +  +   S   ++  +S  KS  +E DDVFSD++ EE    K     + 
Sbjct  513   -----------SDSTQKQSQSSSSAGSSKLKSNQNEDDDVFSDSDGEEDRHSK----PIE  557

Query  1695  TDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNTE  1874
             T+    K   S + T  P   +   KI+   + DS    +     ++     VP  S   
Sbjct  558   TNSKTEKTVDSMHTTSKPHQINEPPKID---VHDSSANRSLTSSSSSGLHNPVPNHS-LA  613

Query  1875  VSDFKIMAADASVFTFGD-EEDYESE  1949
             VSD K +AADASVF+FGD EEDYES+
Sbjct  614   VSDIKAIAADASVFSFGDEEEDYESD  639



>ref|XP_002877728.1| hypothetical protein ARALYDRAFT_485369 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53987.1| hypothetical protein ARALYDRAFT_485369 [Arabidopsis lyrata subsp. 
lyrata]
Length=633

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/614 (57%), Positives = 417/614 (68%), Gaps = 44/614 (7%)
 Frame = +3

Query  117   TLVPSLSTMDTQLSNASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGS  296
             T +P+ ST    LS A +  P       +S   S P+    S LS+WAKS K        
Sbjct  61    TQMPASSTGSEPLSKADDIVPCPPG---SSPRESPPSIFSSSGLSSWAKSFKF------Q  111

Query  297   QEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKN  476
             Q++ N  ++  S F RFTS  G+    K   +     +S T     + + TK +VDSS+ 
Sbjct  112   QQDPNGTDSGMSAFTRFTSELGLHLPTKGSEEVGDSRSSNTQVGGALESLTKAVVDSSRG  171

Query  477   AVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRN  656
             AVKA+ VKARH+VSQNKRRYQEG FDLD+TYITEN+IAMGFPAGD+SSG FG+ EG YRN
Sbjct  172   AVKAMQVKARHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDISSGLFGFFEGLYRN  231

Query  657   HMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSA  836
             HMEEVIKFFETHHKDKYKVYNLCSERLYD S FEGKVASFPFDDHNCPPIQLI SFCQSA
Sbjct  232   HMEEVIKFFETHHKDKYKVYNLCSERLYDASRFEGKVASFPFDDHNCPPIQLIPSFCQSA  291

Query  837   YSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVL  1016
             Y+WLKEDI+NVVVVHCKAGMARTGLMI  LLLYLKFFPTAEE+I+YYNQKRC+D K LVL
Sbjct  292   YTWLKEDIQNVVVVHCKAGMARTGLMICCLLLYLKFFPTAEEAIDYYNQKRCLDGKALVL  351

Query  1017  PSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKH  1196
             PSQIRYVKY+ER+   F+G+  P RRCMLRGFRL  CPYWIRP+ITIS+H  +LFSTKKH
Sbjct  352   PSQIRYVKYYERVQNQFDGKVPPERRCMLRGFRLINCPYWIRPAITISNHTDILFSTKKH  411

Query  1197  PRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIEN  1376
              +TKDL PED+W  APKKGVVVFA+PGE G+ ELAGDFK+HF D  GDFYCWLNTT+ +N
Sbjct  412   QKTKDLGPEDFWIKAPKKGVVVFAIPGEAGLTELAGDFKIHFQDSDGDFYCWLNTTLTDN  471

Query  1377  RKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasg  1556
             R +L  SD DGF+KRKLP+PGF VEIV+++ D + PT+             + S +    
Sbjct  472   RTMLKGSDFDGFEKRKLPAPGFHVEIVMIEPDNSQPTK-------------SKSDSTQQQ  518

Query  1557  ssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNN  1736
             S   S+  ++   SN+K      DDVFSD++ EE G  K               ST+   
Sbjct  519   SQSSSSAGSSKLKSNEKD-----DDVFSDSDGEEEGNSKPID----------SYSTTEKT  563

Query  1737  TGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNTE--VSDFKIMAADAS  1910
             + S  I+S   +I +    D    +    R  T  +     V N    VSD K +AADAS
Sbjct  564   SDSMHITSKPHQINEPPKTDDPAAN----RSVTSSSGHYNPVPNDSLAVSDIKAIAADAS  619

Query  1911  VFTFGD-EEDYESE  1949
             VF+FGD EEDYES+
Sbjct  620   VFSFGDEEEDYESD  633



>ref|XP_009372439.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
TPTE2-like [Pyrus x bretschneideri]
Length=527

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/527 (62%), Positives = 389/527 (74%), Gaps = 29/527 (6%)
 Frame = +3

Query  381   SPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLD  560
             S  D+NS   +      F+ +FTKGL ++S++AVKAV VKARH+VSQNKRRYQEGGFDLD
Sbjct  26    SGQDNNSTQYAKAVSGVFL-SFTKGLFNTSQSAVKAVQVKARHLVSQNKRRYQEGGFDLD  84

Query  561   LTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLY  740
             LTYITEN+IAMGFPAGD+SSG FGYVEGFYRNHMEEVI+F ET HK KYKVYNLCSERLY
Sbjct  85    LTYITENIIAMGFPAGDISSGLFGYVEGFYRNHMEEVIRFLETTHKGKYKVYNLCSERLY  144

Query  741   DVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMIS  920
             D S FEGK ASFPFDDHNCPPI+LI SFC+SA+SWLKE IENVVVVHCKAGMARTG+MI 
Sbjct  145   DASRFEGKAASFPFDDHNCPPIELIESFCRSAHSWLKEGIENVVVVHCKAGMARTGVMIC  204

Query  921   SLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCM  1100
             SLLL LKFFPTAEE++NYYN KRC+D K LVLPSQIRYVKYFE IL +FNGE  P RRCM
Sbjct  205   SLLLLLKFFPTAEEAMNYYNHKRCIDGKALVLPSQIRYVKYFEHILKHFNGETPPPRRCM  264

Query  1101  LRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGE  1280
             LRGFRLH CPYWIRPSI ISDH G+LFS++KHP+TKDL+PED+W SA KKG+VVFALPGE
Sbjct  265   LRGFRLHNCPYWIRPSIAISDHKGILFSSRKHPKTKDLMPEDFWISARKKGIVVFALPGE  324

Query  1281  PGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVL  1460
             PG+AEL GDFK+HF D  GDFYCWLN TM ENRKIL   DLD FDKRK P PGFQVE+V+
Sbjct  325   PGLAELVGDFKIHFQDSHGDFYCWLN-TMTENRKILTADDLDDFDKRKFPCPGFQVEVVM  383

Query  1461  VDYD-TAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVF  1637
             +DYD T  PT+ + +++       +S AN +S         A + N ++ S   + DDVF
Sbjct  384   IDYDGTTLPTKDKADSSGRKPEGSSSDANASSCGV------AGNPNQSKISQREDGDDVF  437

Query  1638  SDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNT---GSPQISSLTQKIEQVSLGDSGLK  1808
             SD++ +E G  K  +   A        S   +NT    SP+  S ++K        S L 
Sbjct  438   SDSDGDEPGD-KTSRQPEANSRAGIAASNHPSNTRSVDSPR--STSRKPTSDGAEKSHLG  494

Query  1809  HNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             H+ +             +S++   D + MAADASVF+FGD +D++SE
Sbjct  495   HSRK-------------LSSSGEDDIRAMAADASVFSFGD-DDFDSE  527



>emb|CBI21370.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/361 (84%), Positives = 333/361 (92%), Gaps = 0/361 (0%)
 Frame = +3

Query  408   TSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVI  587
             TSTT Q   + +FTKGLVDSSK+AVKAV VKARH+VSQNKRRYQEG FDLD+TYITEN+I
Sbjct  9     TSTTTQPGVLESFTKGLVDSSKSAVKAVQVKARHIVSQNKRRYQEGEFDLDMTYITENII  68

Query  588   AMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKV  767
             AMGFPAGDMSSGF G++EGFYRNHMEEVIKFFETHHK KYKVYNLCSERLYD SLFEGKV
Sbjct  69    AMGFPAGDMSSGFLGFIEGFYRNHMEEVIKFFETHHKGKYKVYNLCSERLYDASLFEGKV  128

Query  768   ASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFF  947
             ASFPFDDHNCPPIQLI SFCQSAYSWLK+DIENVVVVHCKAGMARTGLM+SSLLL+LKFF
Sbjct  129   ASFPFDDHNCPPIQLITSFCQSAYSWLKQDIENVVVVHCKAGMARTGLMLSSLLLFLKFF  188

Query  948   PTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKC  1127
             PTAEESINYYNQKRC+D KGLVLPSQIRYVKYFERIL +FNG+N P RRCMLRGFRLH+C
Sbjct  189   PTAEESINYYNQKRCLDGKGLVLPSQIRYVKYFERILTHFNGQNPPGRRCMLRGFRLHRC  248

Query  1128  PYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGD  1307
             P W RPSIT+SDHNG+LFST+KHP+TKDL+PED+W SA KKG+VVFALP EPG+AELAGD
Sbjct  249   PSWFRPSITVSDHNGILFSTRKHPKTKDLMPEDFWISAAKKGIVVFALPREPGLAELAGD  308

Query  1308  FKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPT  1487
             FK HF+D +GDFYCWLNTTM ENRKIL+T DLDGF+KRKLPSPGFQVE+V++DYD    T
Sbjct  309   FKFHFHDSEGDFYCWLNTTMTENRKILSTYDLDGFEKRKLPSPGFQVEVVMIDYDGTIQT  368

Query  1488  R  1490
             R
Sbjct  369   R  369



>ref|NP_566929.1| protein PHOSPHATASE AND TENSIN HOMOLOG DELETED ON CHROMOSOME 
TEN 3 [Arabidopsis thaliana]
 gb|AAN41331.1| putative tyrosine phosphatase [Arabidopsis thaliana]
 gb|AEE78627.1| protein PHOSPHATASE AND TENSIN HOMOLOG DELETED ON CHROMOSOME 
TEN 3 [Arabidopsis thaliana]
Length=632

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/612 (56%), Positives = 415/612 (68%), Gaps = 41/612 (7%)
 Frame = +3

Query  117   TLVPSLSTMDTQLSNASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGS  296
             T +P+ ST    LS   +  P       +S   S P+    S LS+WAKS K        
Sbjct  61    TQMPASSTGSEPLSKTDDIVPCPPG---SSPRESPPSIFSSSGLSSWAKSFKF------Q  111

Query  297   QEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKN  476
             Q++ N  ++  S F RFTS  G+    K   +     +S T       + TK +VDSS+ 
Sbjct  112   QQDPNRTDSGMSAFTRFTSELGLHLPTKGSEEVGDSRSSNTQVGGAFESLTKAVVDSSRG  171

Query  477   AVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRN  656
             AVKA+ VKARH+VSQNKRRYQEG FDLD+TYITEN+IAMGFPAGD+SSG FG+ EG YRN
Sbjct  172   AVKAMQVKARHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDISSGLFGFFEGLYRN  231

Query  657   HMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSA  836
             HMEEVIKFFETHHKDKYKVYNLCSERLYD S FEGKVASFPFDDHNCPPIQLI SFCQSA
Sbjct  232   HMEEVIKFFETHHKDKYKVYNLCSERLYDASRFEGKVASFPFDDHNCPPIQLIPSFCQSA  291

Query  837   YSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVL  1016
             Y+WLKEDI+NVVVVHCKAGMARTGLMI  LLLYLKFFPTAEE+I+YYNQKRC+D K LVL
Sbjct  292   YTWLKEDIQNVVVVHCKAGMARTGLMICCLLLYLKFFPTAEEAIDYYNQKRCLDGKALVL  351

Query  1017  PSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKH  1196
             PSQIRYVKY+ER+   F+G+  P RRCMLRGFRL  CPYWIRP+ITIS+H  +LFSTKKH
Sbjct  352   PSQIRYVKYYERVQNQFDGKVPPERRCMLRGFRLINCPYWIRPAITISNHTDILFSTKKH  411

Query  1197  PRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIEN  1376
              +TKDL PED+W  APKKGVVVFA+PGE G+ ELAGDFK+HF D  GDFYCWLNTT+ +N
Sbjct  412   QKTKDLGPEDFWIKAPKKGVVVFAIPGEAGLTELAGDFKIHFQDSDGDFYCWLNTTLTDN  471

Query  1377  RKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasg  1556
             R +L  SD DGFDKRKLP+PGF VEIV+++ D + PT+             + S +    
Sbjct  472   RTMLKGSDFDGFDKRKLPAPGFHVEIVMIEPDNSQPTK-------------SKSDSTQQQ  518

Query  1557  ssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNN  1736
             S   S+ +++   SN+K      DDVFSD++ EE G  +               ST+   
Sbjct  519   SQSSSSADSSKLKSNEKD-----DDVFSDSDGEEEGNSQ-------------SYSTNEKT  560

Query  1737  TGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVF  1916
               S   +S   +I +    D    +      ++ G  +    ++  VSD K +AADASVF
Sbjct  561   ASSMHTTSKPHQINEPPKRDDPSANRSVTSSSSSGHYNPIPNNSLAVSDIKAIAADASVF  620

Query  1917  TFGD-EEDYESE  1949
             +FGD EEDYES+
Sbjct  621   SFGDEEEDYESD  632



>ref|XP_008338339.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
TPTE2-like [Malus domestica]
 ref|XP_008338340.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
TPTE2-like [Malus domestica]
 ref|XP_008352511.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
TPTE2-like [Malus domestica]
 ref|XP_008352512.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
TPTE2-like [Malus domestica]
 ref|XP_008367987.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
TPTE2-like [Malus domestica]
 ref|XP_008367988.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
TPTE2-like [Malus domestica]
Length=527

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/527 (62%), Positives = 389/527 (74%), Gaps = 29/527 (6%)
 Frame = +3

Query  381   SPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLD  560
             S  D+NS   +      F+ +FTKGL ++S++AVKAV VKARH+VSQNKRRYQEGGFDLD
Sbjct  26    SGQDNNSTQYAKAVSGVFL-SFTKGLFNTSQSAVKAVQVKARHLVSQNKRRYQEGGFDLD  84

Query  561   LTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLY  740
             LTYITEN+IAMGFPAGD+SSG FGYVEGFYRNHMEEVI+F ET HK KYKVYNLCSERLY
Sbjct  85    LTYITENIIAMGFPAGDISSGLFGYVEGFYRNHMEEVIRFLETTHKGKYKVYNLCSERLY  144

Query  741   DVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMIS  920
             D S FEGK ASFPFDDHNCPPI+LI SFC+SA+SWLKE IENVVVVHCKAGMARTG+MI 
Sbjct  145   DASRFEGKAASFPFDDHNCPPIELIESFCRSAHSWLKEGIENVVVVHCKAGMARTGVMIC  204

Query  921   SLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCM  1100
             SLLL LKFFPTA E++NYYN KRC+D K LVLPSQIRYVKYFE IL +FNGE  P RRCM
Sbjct  205   SLLLLLKFFPTAAEAMNYYNHKRCIDGKALVLPSQIRYVKYFEHILKHFNGETPPPRRCM  264

Query  1101  LRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGE  1280
             LRGFRLH CPYWIRPSITISDH G+LFS++KHP+TKDL+PED+W SA KKG+VVFALPGE
Sbjct  265   LRGFRLHNCPYWIRPSITISDHKGILFSSRKHPKTKDLMPEDFWISARKKGIVVFALPGE  324

Query  1281  PGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVL  1460
             PG+AEL GDFK+HF D  GDFYCWLN TM ENRKIL   DLD FDKRK P PGFQVE+V+
Sbjct  325   PGLAELVGDFKIHFLDSHGDFYCWLN-TMTENRKILTADDLDDFDKRKFPCPGFQVEVVM  383

Query  1461  VDYD-TAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDVF  1637
             +DYD TA PT+ + +++       +S AN +S         A + N ++     + DDVF
Sbjct  384   IDYDGTALPTKDKADSSGRKPEGSSSDANASSRGV------AGNPNQSKIFQREDGDDVF  437

Query  1638  SDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNT---GSPQISSLTQKIEQVSLGDSGLK  1808
             SD++ +E G  K  +   A        S   +NT    SP+ +S  +K        S L 
Sbjct  438   SDSDGDEPGD-KTSRQPEANSRAGIAASNHPSNTRSVDSPRRTS--RKPTSDGAEKSHLG  494

Query  1809  HNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
             H+ +             +S++   D + +AADASVF+FGD +D++SE
Sbjct  495   HSRK-------------LSSSGADDIRAIAADASVFSFGD-DDFDSE  527



>emb|CDY23021.1| BnaC07g31660D [Brassica napus]
Length=581

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/569 (58%), Positives = 391/569 (69%), Gaps = 58/569 (10%)
 Frame = +3

Query  255   WAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSF  434
             WAKS              N+ ++  S F RFTS  G L  P   +D+  E  +       
Sbjct  67    WAKSF-------------NAADSGISAFTRFTSELG-LHLPTKGSDEVGESPNIQVGGGA  112

Query  435   IGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDM  614
             + + TK +VDSS  AVKA+ VKARH+VSQNKRRYQEG FDLD+TYITEN+IAMGFPAGD+
Sbjct  113   LESLTKAVVDSSLGAVKAMQVKARHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDI  172

Query  615   SSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHN  794
             SSG FG+ EG YRNHMEEVIKFFETHHKDKYKVYNLCSERLYD S FEGKVASFPFDDHN
Sbjct  173   SSGLFGFFEGLYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDASKFEGKVASFPFDDHN  232

Query  795   CPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINY  974
             CPPIQLI SFCQSAY+WLK+DI+NVVVVHCKAGMARTGLMI  LLLYLKFFPTAEE+I+Y
Sbjct  233   CPPIQLIPSFCQSAYTWLKDDIQNVVVVHCKAGMARTGLMICCLLLYLKFFPTAEEAIDY  292

Query  975   YNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSIT  1154
             YNQKRC+D + L LPSQIRYVKY+ER+   F G+  P RRCMLRGFRL  CPYWIRP+IT
Sbjct  293   YNQKRCLDGRALTLPSQIRYVKYYERVQNQFGGKVPPERRCMLRGFRLINCPYWIRPAIT  352

Query  1155  ISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQ  1334
             IS+HN +LFSTKKH +TKDL+PED+W  APKKGVVVFA+PGE G+ ELAGDFK+HF D  
Sbjct  353   ISNHNDILFSTKKHEKTKDLVPEDFWIKAPKKGVVVFAIPGEAGLTELAGDFKIHFQDSD  412

Query  1335  GDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavs  1514
             GDFYCWLNTT+ + R +L   D DGF+KRKLP+PGF VEIV+ + D++   RPQ      
Sbjct  413   GDFYCWLNTTLTDTRTMLKGIDFDGFEKRKLPAPGFHVEIVMAESDSSTQQRPQ------  466

Query  1515  skssdnssanpasgssphsaDEAADANSNQ-KSGSSEKDDVFSDNEAEETGKPKVGKVTV  1691
                                   ++ A+S + KS  S  DDVFSD++ EE G  K  +   
Sbjct  467   ---------------------SSSGADSGKIKSKQSRDDDVFSDSDGEEEGNSKHTESN-  504

Query  1692  ATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNT  1871
                      ST     GS   +S   +I +    D    H+  K  ++ G  +   V + 
Sbjct  505   ---------STIEKTAGSVHQTSRDHQINEPPKTDD---HSANKSSSSSGLYNNNPVQDD  552

Query  1872  E--VSDFKIMAADASVFTFGD-EEDYESE  1949
                VS+ K +AADASVF+FGD EEDYES+
Sbjct  553   SLAVSNIKAIAADASVFSFGDEEEDYESD  581



>ref|XP_009136536.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
TPTE2 [Brassica rapa]
Length=575

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/548 (59%), Positives = 380/548 (69%), Gaps = 43/548 (8%)
 Frame = +3

Query  318   NAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSV  497
             NAA S F RFTS  G L  P   +D+  E  +T    + + + TK +VDSS  AVKA+ V
Sbjct  67    NAADSAFTRFTSDLG-LHLPTKGSDEVGESPNTQVGGA-LESLTKAVVDSSLGAVKAMQV  124

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             KARH+VSQNKRRYQEG FDLD+TYITEN+IAMGFPAGD+SSG FG+ EG YRNHMEEVIK
Sbjct  125   KARHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDISSGLFGFFEGLYRNHMEEVIK  184

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
             FFETHHKDKYKVYNLCSERLYD S FEGKVASFPFDDHNCPPIQLI SFCQSAY+WLK+D
Sbjct  185   FFETHHKDKYKVYNLCSERLYDASRFEGKVASFPFDDHNCPPIQLIPSFCQSAYTWLKDD  244

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
             I+NVVVVHCKAGMARTGLMI  LLLYLKFFPTAEE+I+YYNQKRC+D + L LPSQIRYV
Sbjct  245   IQNVVVVHCKAGMARTGLMICCLLLYLKFFPTAEEAIDYYNQKRCLDGRALTLPSQIRYV  304

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLL  1217
             KY+ER+   F G+  P RR +LRGFRL  CPYWIRP+ITIS+HN +LFSTKKH +TKDL+
Sbjct  305   KYYERVQNQFGGKVPPERRYLLRGFRLINCPYWIRPAITISNHNDILFSTKKHEKTKDLV  364

Query  1218  PEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTS  1397
             PED+W  APKKGVVVFA+PGE G+ ELAGDFK+HF D  GDFYCWLNTT+ + R +L   
Sbjct  365   PEDFWIKAPKKGVVVFAIPGEAGLTELAGDFKIHFQDSDGDFYCWLNTTLTDTRTMLKGI  424

Query  1398  DLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaD  1577
             D DGF+KRKLP+PGF VEIV+ + D +                               + 
Sbjct  425   DFDGFEKRKLPAPGFHVEIVMAESDNS-------------------------TQQQPQSS  459

Query  1578  EAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATD---GVQAKVSTSGNNTGSP  1748
               AD+    KS  S  DDVFSD++ EE G  K    +   D   G   + S     T  P
Sbjct  460   SGADS-GKIKSKQSRDDDVFSDSDGEEEGNSKAVDSSSTKDKTAGSMHQTSRDHQITEPP  518

Query  1749  QISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGD  1928
             +    +      S   SGL +N   +D ++            VS+ K +AADASVF+FGD
Sbjct  519   KTDDNSANRSITSSSSSGLYNNNPVQDDSLA-----------VSNIKAIAADASVFSFGD  567

Query  1929  -EEDYESE  1949
              EEDYES+
Sbjct  568   EEEDYESD  575



>emb|CAB62119.1| putative tyrosine phosphatase [Arabidopsis thaliana]
Length=628

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/612 (56%), Positives = 411/612 (67%), Gaps = 45/612 (7%)
 Frame = +3

Query  117   TLVPSLSTMDTQLSNASNPQPSVTANMETSNVNSVPAQDGPSKLSTWAKSLKIPQPFTGS  296
             T +P+ ST    LS   +  P       +S   S P+    S LS+WAKS K        
Sbjct  61    TQMPASSTGSEPLSKTDDIVPCPPG---SSPRESPPSIFSSSGLSSWAKSFKF------Q  111

Query  297   QEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKN  476
             Q++ N  ++  S F RFTS  G+    K   +     +S T       + TK +VDSS+ 
Sbjct  112   QQDPNRTDSGMSAFTRFTSELGLHLPTKGSEEVGDSRSSNTQVGGAFESLTKAVVDSSRG  171

Query  477   AVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRN  656
             AVKA+ VKARH+VSQNKRRYQEG FDLD+TYITEN+IAMGFPAGD+SSG FG+ EG YRN
Sbjct  172   AVKAMQVKARHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDISSGLFGFFEGLYRN  231

Query  657   HMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSA  836
             HMEEVIKFFETHHKDKYKVYNLCSERLYD S FEGKVASFPFDDHNCPPIQLI SFCQSA
Sbjct  232   HMEEVIKFFETHHKDKYKVYNLCSERLYDASRFEGKVASFPFDDHNCPPIQLIPSFCQSA  291

Query  837   YSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVL  1016
             Y+WLKEDI+NVVVVHCKAGMARTGLMI  LLLYLKFFPTAEE+I+YYNQKRC+D K LVL
Sbjct  292   YTWLKEDIQNVVVVHCKAGMARTGLMICCLLLYLKFFPTAEEAIDYYNQKRCLDGKALVL  351

Query  1017  PSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKH  1196
             PSQIRYVKY+ER+   F+G+  P R    RGFRL  CPYWIRP+ITIS+H  +LFSTKKH
Sbjct  352   PSQIRYVKYYERVQNQFDGKVPPER----RGFRLINCPYWIRPAITISNHTDILFSTKKH  407

Query  1197  PRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIEN  1376
              +TKDL PED+W  APKKGVVVFA+PGE G+ ELAGDFK+HF D  GDFYCWLNTT+ +N
Sbjct  408   QKTKDLGPEDFWIKAPKKGVVVFAIPGEAGLTELAGDFKIHFQDSDGDFYCWLNTTLTDN  467

Query  1377  RKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasg  1556
             R +L  SD DGFDKRKLP+PGF VEIV+++ D + PT+             + S +    
Sbjct  468   RTMLKGSDFDGFDKRKLPAPGFHVEIVMIEPDNSQPTK-------------SKSDSTQQQ  514

Query  1557  ssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNN  1736
             S   S+ +++   SN+K      DDVFSD++ EE G  +               ST+   
Sbjct  515   SQSSSSADSSKLKSNEKD-----DDVFSDSDGEEEGNSQ-------------SYSTNEKT  556

Query  1737  TGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVF  1916
               S   +S   +I +    D    +      ++ G  +    ++  VSD K +AADASVF
Sbjct  557   ASSMHTTSKPHQINEPPKRDDPSANRSVTSSSSSGHYNPIPNNSLAVSDIKAIAADASVF  616

Query  1917  TFGD-EEDYESE  1949
             +FGD EEDYES+
Sbjct  617   SFGDEEEDYESD  628



>ref|XP_001770087.1| predicted protein [Physcomitrella patens]
 gb|EDQ65069.1| predicted protein [Physcomitrella patens]
Length=371

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/360 (76%), Positives = 315/360 (88%), Gaps = 0/360 (0%)
 Frame = +3

Query  423   QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFP  602
             +S+    F  G +DSS+NAV++V +KARH+VSQNKRR+QEGGFDLD+ YITEN+IAMGFP
Sbjct  2     ESNAFDRFANGFLDSSRNAVRSVQLKARHLVSQNKRRFQEGGFDLDMAYITENIIAMGFP  61

Query  603   AGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPF  782
             AGD+SSGF GYVEGFYRNHMEEV+KFFETHHK KYKVYNLCSERLYD SLF GKVA FPF
Sbjct  62    AGDISSGFLGYVEGFYRNHMEEVLKFFETHHKGKYKVYNLCSERLYDASLFGGKVACFPF  121

Query  783   DDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEE  962
             DDHNCPP+QL+ +FCQSAYSWLK D+ENVVVVHCKAGMARTGLMI+ LL+YLKFFPTAEE
Sbjct  122   DDHNCPPLQLVAAFCQSAYSWLKGDLENVVVVHCKAGMARTGLMITCLLMYLKFFPTAEE  181

Query  963   SINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIR  1142
             SINYYNQKRC+D KGL+LPSQIRYVKYFER++  F GE    R+C+LRG RLHKCPYW+R
Sbjct  182   SINYYNQKRCVDGKGLILPSQIRYVKYFERVMREFKGETPQGRKCILRGIRLHKCPYWVR  241

Query  1143  PSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHF  1322
             P ITISDHNGVLFS+KKHPRTKDLL ED WF+AP+KGV+VFALPGE  VA++ GDFK+ F
Sbjct  242   PGITISDHNGVLFSSKKHPRTKDLLSEDIWFNAPRKGVLVFALPGERCVADINGDFKIQF  301

Query  1323  NDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPE  1502
             +DR GDFYCWLNT M+E R++L TSDLDGFDKR+LPSPG QVEIV++D+D   P +   E
Sbjct  302   SDRHGDFYCWLNTNMMETRQLLGTSDLDGFDKRRLPSPGLQVEIVILDHDAPIPKKKAAE  361



>gb|EAZ20239.1| hypothetical protein OsJ_35839 [Oryza sativa Japonica Group]
Length=456

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/417 (71%), Positives = 330/417 (79%), Gaps = 48/417 (12%)
 Frame = +3

Query  213   NSVPAQDGPSK-----------LSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGF  359
             N+VP QD   +           LS+WAK+LKIPQP +G  +E  +G   K+ F+R TSG 
Sbjct  62    NAVPIQDAAGREAQSSIFSTSGLSSWAKNLKIPQPSSG--QESPTG---KNTFSRLTSGL  116

Query  360   GMLSSPKSPTDDNSEGTSTTP---QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKR  530
             G+  SPK P  D S   STTP   QS   G+FTKG+VDSSKNAVKAV VKARH+VSQNKR
Sbjct  117   GLRLSPKGPQQDESAEGSTTPTTAQSGVFGSFTKGIVDSSKNAVKAVQVKARHMVSQNKR  176

Query  531   RYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYK  710
             RYQEGGFDLD+TYITEN+IAMGFPAGD+SSG FGY EGFYRNHMEEVI+FFE HHK KYK
Sbjct  177   RYQEGGFDLDMTYITENIIAMGFPAGDLSSGLFGYFEGFYRNHMEEVIRFFEMHHKGKYK  236

Query  711   VYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKA  890
             VYNLCSERLYD SLFEGK                             EDIENVVVVHCKA
Sbjct  237   VYNLCSERLYDASLFEGK-----------------------------EDIENVVVVHCKA  267

Query  891   GMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFN  1070
             G ARTGLMISSLLLYLKFFPTAEESI YYNQKRC+D KGL+LPSQIRYVKYFERIL YFN
Sbjct  268   GKARTGLMISSLLLYLKFFPTAEESIEYYNQKRCVDGKGLILPSQIRYVKYFERILTYFN  327

Query  1071  GENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKK  1250
             GENQP RRCMLRGFRLH+CPYWIRPSIT+S+HNGVLF+TKKHPRTK+L+PED+WFSAPKK
Sbjct  328   GENQPPRRCMLRGFRLHRCPYWIRPSITVSNHNGVLFTTKKHPRTKELMPEDFWFSAPKK  387

Query  1251  GVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKR  1421
             G++VFALPGEPG+ E+AGDFK+ F+DRQGDFYCWLNTTM+ENR  LN +DLD FDKR
Sbjct  388   GIMVFALPGEPGLTEVAGDFKIQFHDRQGDFYCWLNTTMMENRVTLNPTDLDDFDKR  444



>ref|XP_001774162.1| predicted protein [Physcomitrella patens]
 gb|EDQ61076.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/353 (76%), Positives = 305/353 (86%), Gaps = 4/353 (1%)
 Frame = +3

Query  444   FTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSG  623
             FT G +DSS+NAV+ V +KARH+VSQNKRRYQEGGFDLD+ YITEN+IAMGFPAGDMSSG
Sbjct  48    FTNGFLDSSRNAVRTVQLKARHLVSQNKRRYQEGGFDLDMAYITENIIAMGFPAGDMSSG  107

Query  624   FFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPP  803
               GYVEGFYRNHMEEV+KFFETHHK KYKVYNLCSERLYD SLF GKVA FPFDDHNCPP
Sbjct  108   LLGYVEGFYRNHMEEVLKFFETHHKGKYKVYNLCSERLYDASLFGGKVACFPFDDHNCPP  167

Query  804   IQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQ  983
             +QL+ +FCQSAYSWLK D+ENVVVVHCKAGMARTGLMI+ LL+YLKFF +AEESINYYNQ
Sbjct  168   LQLVAAFCQSAYSWLKGDLENVVVVHCKAGMARTGLMITCLLMYLKFFQSAEESINYYNQ  227

Query  984   KRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISD  1163
             KRC+D KGLVLPSQIRYV YFER+L  F GE    R    +G RLHKCPYW+RP +TISD
Sbjct  228   KRCVDGKGLVLPSQIRYVNYFERVLKEFKGETPQGR----KGIRLHKCPYWVRPGVTISD  283

Query  1164  HNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDF  1343
             HNGVLFS+KKHPRTKDLL ED WF+AP+KGV+VFALPGE  VA++ GDFK+ F+DR GDF
Sbjct  284   HNGVLFSSKKHPRTKDLLSEDIWFNAPRKGVLVFALPGERCVADINGDFKIQFSDRHGDF  343

Query  1344  YCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPE  1502
             YCWLNT M+E R+IL TSDLDGF+KR+LPSPG QVE+V++D+D   P +   E
Sbjct  344   YCWLNTNMMETRQILETSDLDGFEKRRLPSPGLQVEVVILDHDAPIPRKKAAE  396



>gb|KDO79081.1| hypothetical protein CISIN_1g012952mg [Citrus sinensis]
Length=452

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/473 (64%), Positives = 353/473 (75%), Gaps = 31/473 (7%)
 Frame = +3

Query  561   LTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLY  740
             +TYITEN+IAMGFPAGD+SSG          NHMEEVIKFFETHHK KYKVYNLCSERLY
Sbjct  1     MTYITENIIAMGFPAGDISSG----------NHMEEVIKFFETHHKGKYKVYNLCSERLY  50

Query  741   DVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMIS  920
             D +LF+GKVA FPFDDHNCPPIQLI SFC+SAYSWLKEDI NVVVVHCKAGMARTGLMI 
Sbjct  51    DAALFQGKVACFPFDDHNCPPIQLIASFCRSAYSWLKEDILNVVVVHCKAGMARTGLMIC  110

Query  921   SLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCM  1100
             SLLL+LKFFPTAEE+I+YYNQKRC+D K LVLPSQIRYVKYFERIL Y NGE QPARRCM
Sbjct  111   SLLLFLKFFPTAEEAIDYYNQKRCVDGKALVLPSQIRYVKYFERILTYSNGEIQPARRCM  170

Query  1101  LRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGE  1280
             LRGFRL +CPYWIRPSITI +H+G+LFST+KHP+TKDL+PED+W  APKKG+VVFALPGE
Sbjct  171   LRGFRLLQCPYWIRPSITIFNHSGILFSTRKHPKTKDLMPEDFWIKAPKKGIVVFALPGE  230

Query  1281  PGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVL  1460
             PG+ EL GDFKV F+DRQGDFYCWLNTTM ENRKIL+ SDLDGFDKRK+PSPGFQVEIV+
Sbjct  231   PGLTELVGDFKVLFHDRQGDFYCWLNTTMTENRKILDGSDLDGFDKRKVPSPGFQVEIVM  290

Query  1461  VDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSE-KDDVF  1637
             +DYD   PT+ + +       S N   + ++  +    D A    +++K   SE  DDVF
Sbjct  291   IDYDGILPTKTKSD-------SANRRQDCSTDYASVPTDGATIGPNHRKVTKSEDNDDVF  343

Query  1638  SDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGS--PQISSLTQKIEQVSLGDSGLK-  1808
             SD++ EE    K  +   A+ G  A      N+     PQ    +Q+   +SL +   K 
Sbjct  344   SDSDGEEADTSKSRQADAASGGESAPHGILSNSMADNVPQ----SQRSGHLSLSNEKPKV  399

Query  1809  HNEQKRDTTVG------AASVPEVSNTEVSDFKIMAADASVFTFGDEEDYESE  1949
              N  K  TT G      +  +P + +   SD K MAADASVF+FGD+EDYESE
Sbjct  400   KNVSKEPTTDGVREPASSLPMPNLDSMGASDIKSMAADASVFSFGDDEDYESE  452



>emb|CDY02094.1| BnaA03g40730D [Brassica napus]
Length=563

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/551 (57%), Positives = 374/551 (68%), Gaps = 61/551 (11%)
 Frame = +3

Query  312   SGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTFTKGLVDSSKNAVKAV  491
             S NAA S F RFTS  G L  P   +D+  E  +T    + + + TK +VDSS  AVKA+
Sbjct  69    SFNAADSAFTRFTSELG-LHLPTKGSDEVGESPNTQVGGA-LESLTKAVVDSSLGAVKAM  126

Query  492   SVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEV  671
              VKARH+VSQNKRRYQEG FDLD+TYITEN+IAMGFPAGD+SSG FG+ EG YRNHMEEV
Sbjct  127   QVKARHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDISSGIFGFFEGLYRNHMEEV  186

Query  672   IKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLK  851
             IKFFETHHKDKYKVYNLCSERLYD S FEGKVASFPFDDHNCPPIQLI SFCQSAY+WLK
Sbjct  187   IKFFETHHKDKYKVYNLCSERLYDASRFEGKVASFPFDDHNCPPIQLIPSFCQSAYTWLK  246

Query  852   EDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIR  1031
             +DI+NVVVVHCKAGMARTGLMI  LLLYLKFFPTAEE+I+YYNQKRC+D + L LPSQIR
Sbjct  247   DDIQNVVVVHCKAGMARTGLMICCLLLYLKFFPTAEEAIDYYNQKRCLDGRALTLPSQIR  306

Query  1032  YVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKD  1211
             YVKY+ER+   F G+  P R                RP+ITIS+HN +LFSTKKH +TKD
Sbjct  307   YVKYYERVQNQFGGKVPPER----------------RPAITISNHNDILFSTKKHEKTKD  350

Query  1212  LLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILN  1391
             L+PED+W  APKKGVVVFA+PGE G+ ELAGDFK+HF D  GDFYCWLNTT+ + R +L 
Sbjct  351   LVPEDFWIKAPKKGVVVFAIPGEAGLTELAGDFKIHFQDSDGDFYCWLNTTLTDTRTMLK  410

Query  1392  TSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphs  1571
               D DGF+KRKLP+PGF VEIV+ + D +   +PQ                         
Sbjct  411   GIDFDGFEKRKLPAPGFHVEIVMAESDNSTQRQPQ-------------------------  445

Query  1572  aDEAADANSNQ-KSGSSEKDDVFSDNEAEETGKPKVGKVTVATD---GVQAKVSTSGNNT  1739
                ++ A+S + KS  S  DDVFSD++ EE G  K  + +   D   G   + S     T
Sbjct  446   --SSSGADSGKIKSKQSRDDDVFSDSDGEEEGNSKAVESSSTKDKTAGSMHQTSRDHQIT  503

Query  1740  GSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFT  1919
               P+    +      S   SGL +N   +D ++            VS+ K +AADASVF+
Sbjct  504   EPPKTDDNSANRSVTSSSSSGLYNNNPVQDDSLA-----------VSNIKAIAADASVFS  552

Query  1920  FGD-EEDYESE  1949
             FGD EEDYES+
Sbjct  553   FGDEEEDYESD  563



>ref|XP_006425973.1| hypothetical protein CICLE_v10025539mg [Citrus clementina]
 gb|ESR39213.1| hypothetical protein CICLE_v10025539mg [Citrus clementina]
Length=469

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/376 (71%), Positives = 302/376 (80%), Gaps = 24/376 (6%)
 Frame = +3

Query  237   PSKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNS-EGTS  413
             PS +S+WAK+LK PQP    Q+   +G+   SPFARFTS  G+     +P  D S EGTS
Sbjct  104   PSNISSWAKTLKFPQPVPPPQDNMQTGSPRMSPFARFTSELGLRLPSMTPVADKSAEGTS  163

Query  414   TTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAM  593
             TT  +  + + TKGLVDSS++AVKAV VKARH+VSQNKRRYQEG FDLD+TYITEN+IAM
Sbjct  164   TTNPTGVLESLTKGLVDSSRSAVKAVQVKARHIVSQNKRRYQEGEFDLDMTYITENIIAM  223

Query  594   GFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVAS  773
             GFPAGD+SSGFFGY EG YRNHMEEVIKFFETHHK                      VA 
Sbjct  224   GFPAGDISSGFFGYFEGLYRNHMEEVIKFFETHHK----------------------VAC  261

Query  774   FPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPT  953
             FPFDDHNCPPIQLI SFC+SAYSWLKEDI NVVVVHCKAGMARTGLMI SLLL+LKFFPT
Sbjct  262   FPFDDHNCPPIQLIASFCRSAYSWLKEDILNVVVVHCKAGMARTGLMICSLLLFLKFFPT  321

Query  954   AEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPY  1133
             AEE+I+Y+NQKRC+D K LVLPSQIRYVKYFERIL Y NGE QPARRCMLRGFRL +CPY
Sbjct  322   AEEAIDYFNQKRCVDGKALVLPSQIRYVKYFERILTYSNGEIQPARRCMLRGFRLLQCPY  381

Query  1134  WIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFK  1313
             WIRPSITI +H+G+LFST+KHP+TKDL+PED+W  APKKG+VVFALPGEPG+ EL GDFK
Sbjct  382   WIRPSITIFNHSGILFSTRKHPKTKDLMPEDFWIKAPKKGIVVFALPGEPGLTELVGDFK  441

Query  1314  VHFNDRQGDFYCWLNT  1361
             V F+DRQGDFY W  T
Sbjct  442   VLFHDRQGDFY-WFVT  456



>ref|XP_010431198.1| PREDICTED: uncharacterized protein LOC104715496 [Camelina sativa]
Length=663

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/356 (74%), Positives = 299/356 (84%), Gaps = 6/356 (2%)
 Frame = +3

Query  330   SPFARFTSGFGMLSSPKSPTDDNSEGTSTTPQSSFIGTF---TKGLVDSSKNAVKAVSVK  500
             S F RFTS  G L  P   +DD S+  +  P +   G F   TK +VDSS+ AVKA+ VK
Sbjct  3     SAFTRFTSELG-LHLPTKGSDDVSDPRA--PNTQVGGAFESLTKAVVDSSRGAVKAMQVK  59

Query  501   ARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKF  680
             ARH+VSQNKRRYQEG FDLD+TYITEN+IAMGFPAGD+SSG FG+ EG YRNHMEEVIKF
Sbjct  60    ARHIVSQNKRRYQEGEFDLDMTYITENIIAMGFPAGDISSGLFGFFEGLYRNHMEEVIKF  119

Query  681   FETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDI  860
             FETHHKDKYKVYNLCSERLYD S FEGKVASFPFDDHNCPPIQLI SFCQSAY+WLKEDI
Sbjct  120   FETHHKDKYKVYNLCSERLYDASRFEGKVASFPFDDHNCPPIQLIPSFCQSAYTWLKEDI  179

Query  861   ENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVK  1040
             +NVVVVHCKAGMARTGLMI  LLLYLKFFPTAEE+I+YYNQKRC+D K LVLPSQIRYVK
Sbjct  180   QNVVVVHCKAGMARTGLMICCLLLYLKFFPTAEEAIDYYNQKRCLDGKALVLPSQIRYVK  239

Query  1041  YFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLP  1220
             Y+ER+   F+G+  P +RCMLRGFRL  CPYWIRP+ITIS+H  +LFSTKKH +TKDL P
Sbjct  240   YYERVQNQFDGKVPPEQRCMLRGFRLINCPYWIRPAITISNHTDILFSTKKHQKTKDLGP  299

Query  1221  EDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKIL  1388
             ED+W  APKKGVVVFA+PGE G+ ELAGDFK+HF+D  GDFYCWLNTT+ +NR +L
Sbjct  300   EDFWIKAPKKGVVVFAIPGEAGLTELAGDFKIHFHDSDGDFYCWLNTTLTDNRTML  355


 Score =   268 bits (686),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 206/326 (63%), Gaps = 45/326 (14%)
 Frame = +3

Query  1008  LVLPSQI-----RYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG  1172
             L+L S++     RYVKY+ER+   F+G+  P +RCMLRGFRL  CPYWIRP+ITIS+H  
Sbjct  371   LILLSELSCFLQRYVKYYERVQNQFDGKVPPEQRCMLRGFRLINCPYWIRPAITISNHTD  430

Query  1173  VLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCW  1352
             +LFSTKKH +TKDL PED+W  APKKGVVVFA+PGE G+ ELAGDFK+HF+D  GDFYCW
Sbjct  431   ILFSTKKHQKTKDLGPEDFWIKAPKKGVVVFAIPGEAGLTELAGDFKIHFHDSDGDFYCW  490

Query  1353  LNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdn  1532
             LNTT+ +NR +L  SD DGF+KRKLP+PGF VEIV+++ D + PT+P+            
Sbjct  491   LNTTLTDNRTMLKGSDFDGFEKRKLPAPGFHVEIVMIESDNSQPTKPK------------  538

Query  1533  ssanpasgssphsaDEAADANSNQKSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQA  1712
                  +  S   S   +   +S  +S  ++ DDVFSD++ ++ G  K     + T+    
Sbjct  539   -----SDSSQQPSQSSSEADSSKLQSDQNKDDDVFSDSDGDDNGNSK----PIETN----  585

Query  1713  KVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQKRDTTVGAASVPEVSN------TE  1874
               ST+ N  GS   +S   +I +        K ++   + ++ ++S  ++ N        
Sbjct  586   --STTENTAGSMHTTSKPHQINEPP------KTDDPSANRSITSSSSSDLHNPLPNHSLA  637

Query  1875  VSDFKIMAADASVFTFGD-EEDYESE  1949
             VSD K +AADASVF+FGD EEDYES+
Sbjct  638   VSDIKAIAADASVFSFGDEEEDYESD  663



>gb|EMT22368.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Aegilops tauschii]
Length=674

 Score =   531 bits (1368),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 279/484 (58%), Positives = 331/484 (68%), Gaps = 70/484 (14%)
 Frame = +3

Query  696   KDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVV  875
             K KYKVYNLCSERLYD SLFEGKVA FPFDDHNCPPIQL++SFCQSAYSWLKEDIENVVV
Sbjct  195   KGKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPIQLVISFCQSAYSWLKEDIENVVV  254

Query  876   VHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERI  1055
             VHCKAG ARTGLMISSLL+YLKFFPTAEESI YYNQKRC+D KGL+LPSQIRYVKYFERI
Sbjct  255   VHCKAGKARTGLMISSLLVYLKFFPTAEESIEYYNQKRCVDGKGLILPSQIRYVKYFERI  314

Query  1056  LMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWF  1235
             L YFNGENQP RRCMLRGFRLH+CPYWIRPSIT+S+HNGVLFSTKKHPRTK+L+PED+WF
Sbjct  315   LTYFNGENQPPRRCMLRGFRLHRCPYWIRPSITVSNHNGVLFSTKKHPRTKELMPEDFWF  374

Query  1236  SAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTM----------------  1367
             SAPKKG++VFALPGEPG+AE+AGDFK+ F+DRQGDFYCWLNTTM                
Sbjct  375   SAPKKGIMVFALPGEPGLAEVAGDFKIQFHDRQGDFYCWLNTTMMENRVTLNPTDFDDFD  434

Query  1368  ------------IENRKI----LNTS-----------DLDGFD--------------KRK  1424
                         IEN+ I    L T+           DL+                 +RK
Sbjct  435   KVDVDLVLVVHPIENQIITTEYLKTARNKLGGIKVWKDLEQMRSACEVRLLTNYYGIQRK  494

Query  1425  LPSPGFQVEIVLVDYDTAFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQ  1604
             LPSPGFQVEIVLVDY  + P + +P    +  S+D  S   +S SS      AA   S +
Sbjct  495   LPSPGFQVEIVLVDYSGSQPPKQKP----ADGSADKKSDADSSTSSSAKDSNAAPVESKK  550

Query  1605  KSGSSEKDDVFSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQV  1784
             ++GS +KDDVFSDNEAE+       +V+ +  G       S  +    + S++   IE++
Sbjct  551   ETGSDDKDDVFSDNEAEDGSSKGRKEVSSSGQGGANGAKASETSVAQQEPSAVASGIEKI  610

Query  1785  SL-GDSGLKH--------NEQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEED  1937
             ++ GD G+           E    +    A  P V ++ +S+FK +AADASVF+FGDE+D
Sbjct  611   TISGDQGIARAADAISLKTEASSKSGSTKAHPPAVESSSLSEFKAIAADASVFSFGDEDD  670

Query  1938  YESE  1949
             YESE
Sbjct  671   YESE  674



>gb|EMS56895.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Triticum urartu]
Length=307

 Score =   464 bits (1195),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = +3

Query  702   KYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVH  881
             KYKVYNLCSERLYD SLFEGKVA FPFDDHNCPPIQL++SFCQSAYSWLKEDIENVVV+H
Sbjct  24    KYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPIQLVISFCQSAYSWLKEDIENVVVIH  83

Query  882   CKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILM  1061
             CKAG ARTGLMISSLL+YLKFFPTAEESI YYNQKRC+D KGL+LPSQIRYVKYFERIL+
Sbjct  84    CKAGKARTGLMISSLLVYLKFFPTAEESIEYYNQKRCVDGKGLILPSQIRYVKYFERILI  143

Query  1062  YFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSA  1241
             YFNGENQP RRCMLRGFRLH+CPYWIRPSIT+S+HNGVLFSTKKHPRTK+L+PED+WFSA
Sbjct  144   YFNGENQPPRRCMLRGFRLHRCPYWIRPSITVSNHNGVLFSTKKHPRTKELMPEDFWFSA  203

Query  1242  PKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDK  1418
             P+KG++VFALPGEPG+AE+AGDFK+ F+DRQGDFYCWLNTTM+ENR  LN +D D FDK
Sbjct  204   PRKGIMVFALPGEPGLAEVAGDFKIQFHDRQGDFYCWLNTTMMENRVTLNPTDFDDFDK  262



>ref|XP_001764914.1| predicted protein [Physcomitrella patens]
 gb|EDQ70356.1| predicted protein [Physcomitrella patens]
Length=893

 Score =   431 bits (1109),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 214/416 (51%), Positives = 275/416 (66%), Gaps = 22/416 (5%)
 Frame = +3

Query  231   DGPSKLSTWAKSLKI-PQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPK-SPTDDNSE  404
             D  S  S WA+S +  P    G +  E+S      P++ F+   G  +S K SP     E
Sbjct  255   DSSSGFSKWARSFRFKPTADVGVEISESS------PYSLFSGPSGKRASAKVSPI----E  304

Query  405   GTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENV  584
             G     ++SF G  TKG +DSS+NAVKAV  KARH+VSQNK  YQ+G   LD+ YITEN+
Sbjct  305   GF----ENSF-GVLTKGFIDSSRNAVKAVQDKARHLVSQNKHWYQDGQVQLDIAYITENI  359

Query  585   IAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGK  764
             IA+GFP  + SS   G+ EG Y+ H+EE++ F E  H  KYK++NLCSE+LYD S    K
Sbjct  360   IAVGFPGAESSSNILGFAEGNYQGHLEELVTFCENQHPGKYKIFNLCSEKLYDASFLHDK  419

Query  765   VASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKF  944
             VA FP   +NCP ++L+ +FC++AY+WLKE +ENV VVHCK GM RTGLM S LLL+L+F
Sbjct  420   VAYFPIRGNNCP-LKLLSAFCEAAYTWLKEGLENVAVVHCKGGMERTGLMTSCLLLHLRF  478

Query  945   FPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHK  1124
             FP+AEESIN+YN KRC  +  L LPSQ+RYVKY+E++   ++G     R+C LR  RL+ 
Sbjct  479   FPSAEESINHYNLKRCAGSSCLELPSQLRYVKYYEQVSKKYHGCTPTGRKCTLRSIRLNN  538

Query  1125  CPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAG  1304
             CP WIRPS+T+SDHNGVLF++++HP T  +L ED W SA K GV V  LP +   A + G
Sbjct  539   CPAWIRPSVTVSDHNGVLFASRRHPNTSLMLTEDLWLSAMKSGVYVLELPEDGHAAVVDG  598

Query  1305  DFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVDYD  1472
             DFKVHF +R  DF CWLN+ M E   I    DLDGFDK     P F+VE+ L D D
Sbjct  599   DFKVHFQNRHVDFSCWLNSNM-EGNIIFRVEDLDGFDKEV---PNFEVELELEDMD  650



>ref|XP_001785390.1| predicted protein [Physcomitrella patens]
 gb|EDQ49803.1| predicted protein [Physcomitrella patens]
Length=836

 Score =   380 bits (975),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 229/586 (39%), Positives = 329/586 (56%), Gaps = 83/586 (14%)
 Frame = +3

Query  240   SKLSTWAKSL-------KIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDN  398
             S LS WA+S+       ++ +    S    +SG++AK     +TS  G+L  P +  +++
Sbjct  316   SGLSKWARSIVTKPAADQVIEVDESSPYSLHSGSSAK-----WTSSVGVL--PIAEVENS  368

Query  399   SEGTSTTPQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITE  578
                            FTKGL+DSS++AVKAV  KARH+VSQ  + YQ     LD+ YI +
Sbjct  369   ------------FDVFTKGLLDSSRSAVKAVQNKARHLVSQ--KWYQHRTSHLDMVYIAK  414

Query  579   NVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFE  758
             N+IA+ FP   + S   G++E  YR+++EE++ F E  H  KYK++NLCSE LYD SL  
Sbjct  415   NIIAVEFPV--IESNILGFMEADYRDYIEELVTFCEMQHLGKYKIFNLCSEELYDTSLLY  472

Query  759   GKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYL  938
              KVA FPF  +NCPP+QL+ +FC++ ++WLK  +ENVVVVHCK GMARTGLMIS LLL+L
Sbjct  473   DKVACFPFQTNNCPPLQLVSAFCEAVHTWLKAGLENVVVVHCKGGMARTGLMISCLLLHL  532

Query  939   KFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFERILMYFNGENQPARRCMLRGFRL  1118
              FF TAEES+++YN+KRC+++  L+LPS +RYVKY+E +L   +G     RRC LR  RL
Sbjct  533   NFFSTAEESVHHYNEKRCVNSNALILPSHLRYVKYYEEVLRKHHGFTPGGRRCTLRSIRL  592

Query  1119  HKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAEL  1298
               CP WIRPS+TISDH+GVLF++ KH  +  +L ED W SA    V++F LP     A +
Sbjct  593   INCPSWIRPSVTISDHDGVLFTSIKH--SNFMLAEDLWISALNSKVLLFELPNGGHAAAV  650

Query  1299  AGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIVLVD-YDT  1475
              GDF++HF + +  F CWLNT M+    +L  +DLDG ++    + GFQVE+   D + +
Sbjct  651   DGDFRIHFQNGEVQFSCWLNTNMMRRSIVLRINDLDG-NEGLSEATGFQVELEFQDSFIS  709

Query  1476  AFPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQK----SGSSEKDDVFSD  1643
                T    E A +S                      +D    +K    + ++  + +F+D
Sbjct  710   VMKTTSTAETAPASIRPPL----------------PSDMTFGRKFPCTNTATNGEAIFTD  753

Query  1644  NEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHNEQK  1823
             +E E+   P          GV  + S    +    + +SL  +  + S    G+      
Sbjct  754   SEGEDEESP----------GVLPRSSAEKRDIRESEGTSLMSEDPESSFQSKGIAR----  799

Query  1824  RDTTVGAASVPEVSNTEVSDFK----IMAADASVFTFGDEEDYESE  1949
                          S+   SDF       +ADAS+FTFGDEEDY+S+
Sbjct  800   -----------LTSSDPPSDFHAMAAANSADASLFTFGDEEDYQSD  834



>emb|CDY65163.1| BnaC03g73950D [Brassica napus]
Length=400

 Score =   318 bits (816),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 168/264 (64%), Positives = 185/264 (70%), Gaps = 44/264 (17%)
 Frame = +3

Query  240   SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTT  419
             S +STWAKS K+ QPF+   + E      KS FA+                    GTS++
Sbjct  90    SGISTWAKSFKLSQPFSDVNDTE------KSAFAK--------------------GTSSS  123

Query  420   PQSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGF  599
              Q  FIGT TKGLVD+SKNAVKAV               QEGGFDLDLTYITEN+IAMGF
Sbjct  124   -QPGFIGTITKGLVDTSKNAVKAV---------------QEGGFDLDLTYITENIIAMGF  167

Query  600   PAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFP  779
             PAG +++     +   YRN MEEVI F ET HK KYK YNLCSERLYDVSLFEGKV S  
Sbjct  168   PAG-LANECVSNLNQCYRNQMEEVIDFLETRHKGKYKAYNLCSERLYDVSLFEGKVFSH-  225

Query  780   FDDHNCPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAE  959
             FDDHNCPPI LI SFCQSAYSWLKEDIENVV VHCKAGMARTGLMI SL LYLKFFPTAE
Sbjct  226   FDDHNCPPIHLITSFCQSAYSWLKEDIENVVAVHCKAGMARTGLMICSLFLYLKFFPTAE  285

Query  960   ESINYYNQKRCMDAKGLVLPSQIR  1031
             E +++YNQKRC+D  GLVLPSQIR
Sbjct  286   EYMDFYNQKRCVDGNGLVLPSQIR  309



>ref|XP_008391503.1| PREDICTED: uncharacterized protein LOC103453718 [Malus domestica]
Length=263

 Score =   243 bits (620),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 132/283 (47%), Positives = 182/283 (64%), Gaps = 21/283 (7%)
 Frame = +3

Query  1098  MLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPG  1277
             MLRGFRLH CPYWIRPSIT+SDH G+LFS++KHP+TKDL+PED+W +A KKG VVFALPG
Sbjct  1     MLRGFRLHNCPYWIRPSITVSDHKGILFSSRKHPKTKDLMPEDFWINARKKGFVVFALPG  60

Query  1278  EPGVAELAGDFKVHFNDRQGDFYCWLNTTMIENRKILNTSDLDGFDKRKLPSPGFQVEIV  1457
             EPG+AEL GDFK+ F D  GDFYCWLN TM ENRK+L   DLDG++KRKLP PGFQVE+V
Sbjct  61    EPGLAELVGDFKIQFQDSHGDFYCWLN-TMTENRKVLTADDLDGYEKRKLPCPGFQVEVV  119

Query  1458  LVDYDTA-FPTRPQPEaavsskssdnssanpasgssphsaDEAADANSNQKSGSSEKDDV  1634
             ++DYD A  PT+ + +++  +     S AN +S         A + N ++ S   + DDV
Sbjct  120   MIDYDGATLPTKAKADSSGRTPEGSASDANASSHGV------AGNPNQSKISQREDGDDV  173

Query  1635  FSDNEAEETGKPKVGKVTVATDGVQAKVSTSGNNTGSPQISSLTQKIEQVSLGDSGLKHN  1814
             FSD++ +ET + K+ +   A    +A +    + + + ++ S      + +   +   H 
Sbjct  174   FSDSDGDET-EDKMSRQAEAN--SRAGLPAXNHPSNTRRVDSPRSNSRKPTNDGAEKSHP  230

Query  1815  EQKRDTTVGAASVPEVSNTEVSDFKIMAADASVFTFGDEEDYE  1943
                R          ++S++   D + MAADASVF+FGD+ D E
Sbjct  231   GHSR----------KLSSSGGDDIRAMAADASVFSFGDDFDSE  263



>ref|XP_004988095.1| hypothetical protein PTSG_10560 [Salpingoeca rosetta]
 gb|EGD80305.1| hypothetical protein PTSG_10560 [Salpingoeca rosetta]
Length=415

 Score =   227 bits (578),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/306 (40%), Positives = 172/306 (56%), Gaps = 38/306 (12%)
 Frame = +3

Query  501   ARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKF  680
             A+H+VS+ KRR+ E GFDLD+T+IT N++AMGFPA           EG YRN+M +V +F
Sbjct  5     AKHLVSKKKRRFIEDGFDLDMTFITRNIVAMGFPAEGR--------EGIYRNNMRDVKRF  56

Query  681   FETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDI  860
             F+T H+D YK+YNLCSER YD + F G+V  FPFDDHN PP QLI  FC+    +L+ D 
Sbjct  57    FDTRHRDHYKIYNLCSERDYDPNKFYGRVVKFPFDDHNAPPFQLIEKFCEDVAEYLERDS  116

Query  861   ENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVK  1040
              NV V+HCKAG  RTG+MI++ LL+L+ F    E++ +Y   R M+ KG+ +PSQ+RYV 
Sbjct  117   RNVAVIHCKAGKGRTGVMITAFLLHLRLFTDTNEALEFYGHARTMNGKGVTIPSQVRYVH  176

Query  1041  YFERILMY---FNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPR--T  1205
             Y+ R+L     +       RR +LRG           P ++    NG        P+   
Sbjct  177   YYGRLLRSSAPYEPRMLIMRRIVLRGI----------PDMS----NGTCV-----PQFVI  217

Query  1206  KDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-----FYCWLNTTMI  1370
             K L  +  W+    +    FA    P    + GD K+ F  R+       F+ W NT  I
Sbjct  218   KQLNYKSSWYEGITRE-QSFAELDLPAPLPVCGDIKLEFIHRKSTGKEKMFHLWFNTFFI  276

Query  1371  ENRKIL  1388
             ++ K +
Sbjct  277   DDLKFV  282



>ref|XP_003698646.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Apis 
florea]
Length=465

 Score =   226 bits (576),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/305 (40%), Positives = 175/305 (57%), Gaps = 39/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K
Sbjct  13    RIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVK  64

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
               E+ HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL   
Sbjct  65    LLESRHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRH  124

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              ENV VVHCKAG  RTG+M+   LL++K FPTA E++NYY  KR  D KG+ +PSQ RYV
Sbjct  125   QENVAVVHCKAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYV  184

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHP  1199
              Y+  ++    G N      +LR  +L   P +         H G      V+  +KK  
Sbjct  185   DYYATLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKI  233

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              + D++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT
Sbjct  234   FSSDIV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNT  285

Query  1362  TMIEN  1376
               + +
Sbjct  286   FFVRD  290



>ref|XP_006557297.1| PREDICTED: phosphatase and tensin-like isoform X6 [Apis mellifera]
 ref|XP_006557298.1| PREDICTED: phosphatase and tensin-like isoform X7 [Apis mellifera]
Length=501

 Score =   227 bits (578),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/301 (41%), Positives = 173/301 (57%), Gaps = 39/301 (13%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K  E+
Sbjct  17    MVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVKLLES  68

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL    ENV
Sbjct  69    RHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENV  128

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
              VVHCKAG  RTG+M+   LL++K FPTA E++NYY  KR  D KG+ +PSQ RYV Y+ 
Sbjct  129   AVVHCKAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYA  188

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHPRTKD  1211
              ++    G N      +LR  +L   P +         H G      V+  +KK   + +
Sbjct  189   TLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKIFSSE  237

Query  1212  LLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNTTMIE  1373
             ++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT  + 
Sbjct  238   IV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNTFFVR  289

Query  1374  N  1376
             +
Sbjct  290   D  290



>ref|XP_001749050.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ86125.1| predicted protein [Monosiga brevicollis MX1]
Length=422

 Score =   224 bits (571),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 124/304 (41%), Positives = 168/304 (55%), Gaps = 30/304 (10%)
 Frame = +3

Query  501   ARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKF  680
             A+H+VS+ KRR+ + GFDLDLT+IT N++AMGFPA           EG YRNHM +V +F
Sbjct  5     AKHLVSKKKRRFMDEGFDLDLTFITRNIVAMGFPAEGR--------EGIYRNHMRDVKRF  56

Query  681   FETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDI  860
             F+   KD Y+VYNLCSER YD   F G+VA +PFDDHN PP  L+  FC+  + +L ED 
Sbjct  57    FDYRCKDHYRVYNLCSERDYDPQKFYGRVAKYPFDDHNAPPFLLMQPFCEDVHQYLSEDS  116

Query  861   ENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVK  1040
              NV V+HCKAG  RTG+MIS+ L++   F   EE++ +Y   R M+ KG+ +PSQ+RYV 
Sbjct  117   RNVAVIHCKAGKGRTGVMISAYLMHCGLFEKTEEALEFYGHARTMNGKGVTIPSQVRYVH  176

Query  1041  YFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLP  1220
             Y+ R +     E +P    M R   LH  P          D   V   T +H     L  
Sbjct  177   YYGRYVRE-QREFEPIPLIMKR-IILHGIP-------DFKDGTCVPQFTLRHGPQHVLTF  227

Query  1221  EDYWFS--APKKGVVVFAL-PGEPGVAELAGDFKVHFNDRQGD------FYCWLNTTMIE  1373
             +  W+   + ++G     L P  P    + GD K+ F  R+G       F+ W NT  I 
Sbjct  228   KSGWYEGISREQGTATLELKPHTP----VCGDVKLEFIHRKGSSGKEKMFHLWFNTFFIV  283

Query  1374  NRKI  1385
             N + 
Sbjct  284   NNRF  287



>gb|KFD50012.1| hypothetical protein M513_09105 [Trichuris suis]
Length=497

 Score =   226 bits (575),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 122/314 (39%), Positives = 177/314 (56%), Gaps = 25/314 (8%)
 Frame = +3

Query  489   VSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEE  668
             ++ K R +VS+NKRRYQEGGFDLDL+YI  N+IAMGFPA  +        EG +RNH+++
Sbjct  1     MAAKIRCLVSKNKRRYQEGGFDLDLSYIRPNIIAMGFPAEKL--------EGVFRNHIDD  52

Query  669   VIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWL  848
             V++F ET HKD YK+YNLC+ER Y+ S F  +VA +PF DH  P ++ ++ FC+  + WL
Sbjct  53    VVRFMETKHKDHYKIYNLCNERCYNASRFNNRVAYYPFVDHQPPCLENMLPFCEDVHQWL  112

Query  849   KEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQI  1028
              +D  NVV +HCKAG  RTG+MI + LLY+  F  A+E++ YY Q+R +D  G+ +PSQ 
Sbjct  113   SQDSRNVVAIHCKAGKGRTGVMICAYLLYVGEFTCADEALEYYGQQRTVDMNGVTIPSQR  172

Query  1029  RYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIR----PSITISDHNGVLFSTKKH  1196
             RYV YF  +L   N  +      +LR   L   P   +    P + IS     L+ +   
Sbjct  173   RYVGYFSHLLR--NNIHYSVVPMVLRSIELENAPVLDKAVFSPYVVISSDGRPLYKSCPC  230

Query  1197  PRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIEN  1376
                +DL       S P        + G+  V      +++H  +R   F+ W NT  +  
Sbjct  231   DAIQDLNRLRILLSNP------IHVEGDVRVDLYHKSYRLHKKERL--FHFWFNTFFLSP  282

Query  1377  RKILNT---SDLDG  1409
             +   +T   +D DG
Sbjct  283   KDASSTPSSNDTDG  296



>ref|NP_001155985.1| phosphatase and tensin-like [Apis mellifera]
 gb|ACR55735.1| phosphatase and tensin-like A [Apis mellifera]
Length=501

 Score =   225 bits (574),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 173/301 (57%), Gaps = 39/301 (13%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K  E+
Sbjct  17    MVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVKLLES  68

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL    ENV
Sbjct  69    RHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENV  128

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
              VVHCKAG  RTG+M+   LL+++ FPTA E++NYY  KR  D KG+ +PSQ RYV Y+ 
Sbjct  129   AVVHCKAGKGRTGVMVCCYLLHIEQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYA  188

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHPRTKD  1211
              ++    G N      +LR  +L   P +         H G      V+  +KK   + +
Sbjct  189   TLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKIFSSE  237

Query  1212  LLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNTTMIE  1373
             ++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT  + 
Sbjct  238   IV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNTFFVR  289

Query  1374  N  1376
             +
Sbjct  290   D  290



>ref|XP_006622015.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Apis dorsata]
Length=594

 Score =   228 bits (580),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 122/301 (41%), Positives = 173/301 (57%), Gaps = 39/301 (13%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K  E+
Sbjct  110   MVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVKLLES  161

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL    ENV
Sbjct  162   RHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENV  221

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
              VVHCKAG  RTG+M+   LL++K FPTA E++NYY  KR  D KG+ +PSQ RYV Y+ 
Sbjct  222   AVVHCKAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYA  281

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHPRTKD  1211
              ++    G N      +LR  +L   P +         H G      V+  +KK   + +
Sbjct  282   TLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKIFSSE  330

Query  1212  LLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNTTMIE  1373
             ++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT  + 
Sbjct  331   IV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNTFFVR  382

Query  1374  N  1376
             +
Sbjct  383   D  383



>ref|XP_006557293.1| PREDICTED: phosphatase and tensin-like isoform X2 [Apis mellifera]
Length=594

 Score =   228 bits (580),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/301 (41%), Positives = 173/301 (57%), Gaps = 39/301 (13%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K  E+
Sbjct  110   MVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVKLLES  161

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL    ENV
Sbjct  162   RHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENV  221

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
              VVHCKAG  RTG+M+   LL++K FPTA E++NYY  KR  D KG+ +PSQ RYV Y+ 
Sbjct  222   AVVHCKAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYA  281

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHPRTKD  1211
              ++    G N      +LR  +L   P +         H G      V+  +KK   + +
Sbjct  282   TLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKIFSSE  330

Query  1212  LLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNTTMIE  1373
             ++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT  + 
Sbjct  331   IV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNTFFVR  382

Query  1374  N  1376
             +
Sbjct  383   D  383



>ref|XP_006622014.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Apis dorsata]
Length=596

 Score =   227 bits (579),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 175/305 (57%), Gaps = 39/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K
Sbjct  108   RIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVK  159

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
               E+ HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL   
Sbjct  160   LLESRHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRH  219

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              ENV VVHCKAG  RTG+M+   LL++K FPTA E++NYY  KR  D KG+ +PSQ RYV
Sbjct  220   QENVAVVHCKAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYV  279

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHP  1199
              Y+  ++    G N      +LR  +L   P +         H G      V+  +KK  
Sbjct  280   DYYATLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKI  328

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              + +++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT
Sbjct  329   FSSEIV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNT  380

Query  1362  TMIEN  1376
               + +
Sbjct  381   FFVRD  385



>ref|XP_003486173.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
1 [Bombus impatiens]
Length=501

 Score =   224 bits (572),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 172/301 (57%), Gaps = 39/301 (13%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K  E+
Sbjct  17    MVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVKLLES  68

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL    ENV
Sbjct  69    RHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENV  128

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
              VVHCKAG  RTG+M+   LL+ K FPTA E++NYY  KR  D KG+ +PSQ RYV Y+ 
Sbjct  129   AVVHCKAGKGRTGVMVCCYLLHTKQFPTATEALNYYGNKRTHDRKGVTIPSQRRYVDYYA  188

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHPRTKD  1211
              ++    G +      +LR  +L   P +         H G      V+  +KK   + D
Sbjct  189   TLVQ--EGLDYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKIFSSD  237

Query  1212  LLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNTTMIE  1373
             ++         +KG+   ++P +  +A L GD +V F +R      +  F+ W NT  + 
Sbjct  238   IV-------EVRKGMHTVSIPLKHSIA-LTGDIRVDFFNRPKMKRKEKLFHFWFNTFFVR  289

Query  1374  N  1376
             +
Sbjct  290   D  290



>gb|KHJ40971.1| dual-specificity protein phosphatase PTEN family protein [Trichuris 
suis]
Length=369

 Score =   221 bits (562),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/314 (39%), Positives = 176/314 (56%), Gaps = 25/314 (8%)
 Frame = +3

Query  489   VSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEE  668
             ++ K R +VS+NKRRYQEGGFDLDL+YI  N+IAMGFPA  +        EG +RNH+++
Sbjct  1     MAAKIRCLVSKNKRRYQEGGFDLDLSYIRPNIIAMGFPAEKL--------EGVFRNHIDD  52

Query  669   VIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWL  848
             V++F ET HKD YK+YNLC+ER Y+ S F  +VA +PF DH  P ++ ++ FC+  + WL
Sbjct  53    VVRFMETKHKDHYKIYNLCNERCYNASRFNNRVAYYPFVDHQPPCLENMLPFCEDVHQWL  112

Query  849   KEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQI  1028
              +D  NVV +HCKAG  RTG+MI + LLY+  F  A+E++ YY Q+R +D  G+ +PSQ 
Sbjct  113   SQDSRNVVAIHCKAGKGRTGVMICAYLLYVGEFTCADEALEYYGQQRTVDMNGVTIPSQR  172

Query  1029  RYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYW----IRPSITISDHNGVLFSTKKH  1196
             RYV YF  +L   N  +      +LR   L   P        P + IS     L+ +   
Sbjct  173   RYVGYFSHLLR--NNIHYSVVPMVLRSIELENAPVLDKAVFSPYVVISSDGRPLYKSCPC  230

Query  1197  PRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGDFYCWLNTTMIEN  1376
                +DL       S P        + G+  V      +++H  +R   F+ W NT  +  
Sbjct  231   DAIQDLNRLRILLSNP------IHVEGDVRVDLYHKSYRLHKKERL--FHFWFNTFFLSP  282

Query  1377  RKILNT---SDLDG  1409
             +   +T   +D DG
Sbjct  283   KDASSTPSSNDTDG  296



>ref|XP_003402814.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
1 [Bombus terrestris]
Length=501

 Score =   224 bits (572),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 172/301 (57%), Gaps = 39/301 (13%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K  E+
Sbjct  17    MVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVKLLES  68

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL    ENV
Sbjct  69    RHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRHQENV  128

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
              VVHCKAG  RTG+M+   LL+ K FPTA E++NYY  KR  D KG+ +PSQ RYV Y+ 
Sbjct  129   AVVHCKAGKGRTGVMVCCYLLHTKQFPTATEALNYYGNKRTHDRKGVTIPSQRRYVDYYA  188

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHPRTKD  1211
              ++    G +      +LR  +L   P +         H G      V+  +KK   + D
Sbjct  189   TLVQ--EGLDYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKIFSSD  237

Query  1212  LLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNTTMIE  1373
             ++         +KG+   ++P +  +A L GD +V F +R      +  F+ W NT  + 
Sbjct  238   IV-------EVRKGMHTVSIPLKHSIA-LTGDIRVDFFNRPKMKRKEKLFHFWFNTFFVR  289

Query  1374  N  1376
             +
Sbjct  290   D  290



>ref|XP_006557292.1| PREDICTED: phosphatase and tensin-like isoform X1 [Apis mellifera]
Length=596

 Score =   227 bits (578),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 175/305 (57%), Gaps = 39/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K
Sbjct  108   RIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVK  159

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
               E+ HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL   
Sbjct  160   LLESRHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRH  219

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              ENV VVHCKAG  RTG+M+   LL++K FPTA E++NYY  KR  D KG+ +PSQ RYV
Sbjct  220   QENVAVVHCKAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYV  279

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHP  1199
              Y+  ++    G N      +LR  +L   P +         H G      V+  +KK  
Sbjct  280   DYYATLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKI  328

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              + +++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT
Sbjct  329   FSSEIV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNT  380

Query  1362  TMIEN  1376
               + +
Sbjct  381   FFVRD  385



>ref|XP_006622018.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X5 [Apis dorsata]
Length=527

 Score =   225 bits (574),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 175/305 (57%), Gaps = 39/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K
Sbjct  108   RIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVK  159

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
               E+ HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL   
Sbjct  160   LLESRHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRH  219

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              ENV VVHCKAG  RTG+M+   LL++K FPTA E++NYY  KR  D KG+ +PSQ RYV
Sbjct  220   QENVAVVHCKAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYV  279

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHP  1199
              Y+  ++    G N      +LR  +L   P +         H G      V+  +KK  
Sbjct  280   DYYATLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKI  328

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              + +++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT
Sbjct  329   FSSEIV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNT  380

Query  1362  TMIEN  1376
               + +
Sbjct  381   FFVRD  385



>ref|XP_006557296.1| PREDICTED: phosphatase and tensin-like isoform X5 [Apis mellifera]
Length=527

 Score =   225 bits (573),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 175/305 (57%), Gaps = 39/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K
Sbjct  108   RIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVK  159

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
               E+ HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL   
Sbjct  160   LLESRHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRH  219

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              ENV VVHCKAG  RTG+M+   LL++K FPTA E++NYY  KR  D KG+ +PSQ RYV
Sbjct  220   QENVAVVHCKAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYV  279

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHP  1199
              Y+  ++    G N      +LR  +L   P +         H G      V+  +KK  
Sbjct  280   DYYATLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKI  328

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              + +++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT
Sbjct  329   FSSEIV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNT  380

Query  1362  TMIEN  1376
               + +
Sbjct  381   FFVRD  385



>ref|XP_001382218.2| GA19047 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL29329.2| GA19047 [Drosophila pseudoobscura pseudoobscura]
Length=480

 Score =   223 bits (569),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 131/357 (37%), Positives = 190/357 (53%), Gaps = 53/357 (15%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R+VVS+N+ RY+   FDLDLTYI +N+IAMG+P+ D        +E  YR
Sbjct  3     NTISLMSNVIRNVVSKNRIRYKGERFDLDLTYIYDNIIAMGYPSPDK-------LERMYR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N  E+V+KF +  H D YK+YNLC ER+YD + F G+VA FPF+DHN P I+LI  FC+ 
Sbjct  56    NCQEDVLKFLDEKHGDHYKIYNLCLERIYDSNKFHGRVAIFPFEDHNPPTIELIQKFCKD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
               SWLKED+ NVV VHCKAG  RTG MI + LLY     +A+E++ +Y++KR  D KG+ 
Sbjct  116   VDSWLKEDVLNVVAVHCKAGKGRTGTMICAYLLYSGLQKSADEALAWYDEKRTKDGKGVT  175

Query  1014  LPSQIRYVKYFERIL---------MYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDH  1166
             +PSQ RYV+YF  ++         M+   E + +   +L+     KC  ++    T  + 
Sbjct  176   IPSQRRYVQYFSNLVCSSVPYSKKMFKVCEIRFSESSLLKNLGTVKCKVFVLQDSTTEN-  234

Query  1167  NGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD--  1340
                    K+H   K       W    ++  V+   P       +AGD K  F  +  +  
Sbjct  235   ------VKEHSSKK-------WTVDFQESCVLNINPS----LSVAGDIKFEFEQKSSEKV  277

Query  1341  -FYCWLNTTMIENRKI-------------LNTSDLDGFD---KRKLPSPGFQVEIVL  1460
              F+ WLNT  ++N  +             L  S++DG     K K  S  F++ I+ 
Sbjct  278   IFHFWLNTFFVQNSSVCESDGTLLKCTYTLKKSEIDGVHKDRKHKSFSEDFKISILF  334



>gb|ACR55737.1| phosphatase and tensin-like C [Apis mellifera]
Length=457

 Score =   223 bits (567),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/305 (40%), Positives = 175/305 (57%), Gaps = 39/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K
Sbjct  13    RIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVK  64

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
               E+ HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL   
Sbjct  65    LLESRHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRH  124

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              ENV VVHCKAG  RTG+M+   LL+++ FPTA E++NYY  KR  D KG+ +PSQ RYV
Sbjct  125   QENVAVVHCKAGKGRTGVMVCCYLLHIEQFPTATEALNYYGTKRTHDRKGVTIPSQRRYV  184

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHP  1199
              Y+  ++    G N      +LR  +L   P +         H G      V+  +KK  
Sbjct  185   DYYATLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKI  233

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              + +++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT
Sbjct  234   FSSEIV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNT  285

Query  1362  TMIEN  1376
               + +
Sbjct  286   FFVRD  290



>ref|XP_006622017.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X4 [Apis dorsata]
Length=560

 Score =   225 bits (574),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 175/305 (57%), Gaps = 39/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K
Sbjct  108   RIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVK  159

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
               E+ HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL   
Sbjct  160   LLESRHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRH  219

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              ENV VVHCKAG  RTG+M+   LL++K FPTA E++NYY  KR  D KG+ +PSQ RYV
Sbjct  220   QENVAVVHCKAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYV  279

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHP  1199
              Y+  ++    G N      +LR  +L   P +         H G      V+  +KK  
Sbjct  280   DYYATLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKI  328

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              + +++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT
Sbjct  329   FSSEIV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNT  380

Query  1362  TMIEN  1376
               + +
Sbjct  381   FFVRD  385



>gb|ACR55736.1| phosphatase and tensin-like B [Apis mellifera]
Length=465

 Score =   223 bits (567),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/305 (40%), Positives = 175/305 (57%), Gaps = 39/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K
Sbjct  13    RIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVK  64

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
               E+ HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL   
Sbjct  65    LLESRHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRH  124

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              ENV VVHCKAG  RTG+M+   LL+++ FPTA E++NYY  KR  D KG+ +PSQ RYV
Sbjct  125   QENVAVVHCKAGKGRTGVMVCCYLLHIEQFPTATEALNYYGTKRTHDRKGVTIPSQRRYV  184

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHP  1199
              Y+  ++    G N      +LR  +L   P +         H G      V+  +KK  
Sbjct  185   DYYATLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKI  233

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              + +++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT
Sbjct  234   FSSEIV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNT  285

Query  1362  TMIEN  1376
               + +
Sbjct  286   FFVRD  290



>ref|XP_006557295.1| PREDICTED: phosphatase and tensin-like isoform X4 [Apis mellifera]
Length=560

 Score =   225 bits (573),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 175/305 (57%), Gaps = 39/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K
Sbjct  108   RIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVK  159

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
               E+ HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL   
Sbjct  160   LLESRHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRH  219

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              ENV VVHCKAG  RTG+M+   LL++K FPTA E++NYY  KR  D KG+ +PSQ RYV
Sbjct  220   QENVAVVHCKAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYV  279

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHP  1199
              Y+  ++    G N      +LR  +L   P +         H G      V+  +KK  
Sbjct  280   DYYATLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKI  328

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              + +++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT
Sbjct  329   FSSEIV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNT  380

Query  1362  TMIEN  1376
               + +
Sbjct  381   FFVRD  385



>ref|XP_003402815.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
2 [Bombus terrestris]
Length=465

 Score =   222 bits (566),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 121/305 (40%), Positives = 174/305 (57%), Gaps = 39/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K
Sbjct  13    RIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVK  64

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
               E+ HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL   
Sbjct  65    LLESRHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRH  124

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              ENV VVHCKAG  RTG+M+   LL+ K FPTA E++NYY  KR  D KG+ +PSQ RYV
Sbjct  125   QENVAVVHCKAGKGRTGVMVCCYLLHTKQFPTATEALNYYGNKRTHDRKGVTIPSQRRYV  184

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHP  1199
              Y+  ++    G +      +LR  +L   P +         H G      V+  +KK  
Sbjct  185   DYYATLVQ--EGLDYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKI  233

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              + D++         +KG+   ++P +  +A L GD +V F +R      +  F+ W NT
Sbjct  234   FSSDIV-------EVRKGMHTVSIPLKHSIA-LTGDIRVDFFNRPKMKRKEKLFHFWFNT  285

Query  1362  TMIEN  1376
               + +
Sbjct  286   FFVRD  290



>ref|XP_003486174.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
2 [Bombus impatiens]
Length=465

 Score =   222 bits (565),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 121/305 (40%), Positives = 174/305 (57%), Gaps = 39/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K
Sbjct  13    RIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVK  64

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
               E+ HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL   
Sbjct  65    LLESRHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRH  124

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              ENV VVHCKAG  RTG+M+   LL+ K FPTA E++NYY  KR  D KG+ +PSQ RYV
Sbjct  125   QENVAVVHCKAGKGRTGVMVCCYLLHTKQFPTATEALNYYGNKRTHDRKGVTIPSQRRYV  184

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHP  1199
              Y+  ++    G +      +LR  +L   P +         H G      V+  +KK  
Sbjct  185   DYYATLVQ--EGLDYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKI  233

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              + D++         +KG+   ++P +  +A L GD +V F +R      +  F+ W NT
Sbjct  234   FSSDIV-------EVRKGMHTVSIPLKHSIA-LTGDIRVDFFNRPKMKRKEKLFHFWFNT  285

Query  1362  TMIEN  1376
               + +
Sbjct  286   FFVRD  290



>gb|EMT22367.1| hypothetical protein F775_30443 [Aegilops tauschii]
Length=241

 Score =   214 bits (546),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 122/156 (78%), Gaps = 8/156 (5%)
 Frame = +3

Query  240  SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTT  419
            S LS+WAK+LKIPQP +G  +E  +G   K+  +R  SG G+  SPK P  D S   STT
Sbjct  81   SGLSSWAKNLKIPQPSSG--QESPTG---KNTVSRLASGLGLRLSPKDPQQDESAEGSTT  135

Query  420  P---QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIA  590
            P   Q+   G+ T+G+VDSSKNAVKAV VKARH+VSQNKRRYQEGGFDLD+TYITEN+IA
Sbjct  136  PTTAQAGVFGSLTRGIVDSSKNAVKAVQVKARHMVSQNKRRYQEGGFDLDMTYITENIIA  195

Query  591  MGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHK  698
            MGFPAGD+SSG FGY EGFYRNHMEEVI+FFE HHK
Sbjct  196  MGFPAGDLSSGIFGYFEGFYRNHMEEVIRFFEMHHK  231



>ref|XP_009022389.1| hypothetical protein HELRODRAFT_120014, partial [Helobdella robusta]
 gb|ESN99638.1| hypothetical protein HELRODRAFT_120014, partial [Helobdella robusta]
Length=284

 Score =   216 bits (550),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 123/305 (40%), Positives = 177/305 (58%), Gaps = 30/305 (10%)
 Frame = +3

Query  486   AVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHME  665
             AV+ K + +VS+NKRR QE GFDLDLTYI  N+IAMGFPA +         EG YRN++ 
Sbjct  2     AVANKIKGIVSKNKRRLQEDGFDLDLTYIYPNIIAMGFPAENF--------EGVYRNNIH  53

Query  666   EVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSW  845
             +V++F ++ HKD YKVYNLCSER Y+ S F  +V  +PF+DH+ PP++L+  FC+    W
Sbjct  54    DVVRFLDSKHKDHYKVYNLCSERSYNKSRFHHRVEYYPFNDHHPPPLELLKPFCEDVDKW  113

Query  846   LKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQ  1025
             L +  +NV V+HCKAG  RTG+M+ S LL+ +   TAEE+++YY + R  + KG+ +PSQ
Sbjct  114   LCQHCQNVAVIHCKAGKGRTGVMVCSYLLHREKHKTAEEALSYYGETRTRNKKGVTIPSQ  173

Query  1026  IRYVKYFERILM-YFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPR  1202
             IRYVKY+  ++      +  P     +R          I+P   ++  +   +    HP 
Sbjct  174   IRYVKYYGHLVANQLTYQQTPLVLMTIR----------IQPIPILNGASCSPYFVICHPH  223

Query  1203  TKDLLPEDYWFSAPKKGVVVFALP-GEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              K    E   F   K+  V+F LP   P +  L GDF V F ++      +  F+ WLNT
Sbjct  224   VKHYQSE--VFEHLKREYVLFDLPLTRPSI--LCGDFMVEFFNKIKMMKPEKLFHFWLNT  279

Query  1362  TMIEN  1376
               I +
Sbjct  280   FFIRD  284



>gb|EFW43384.2| pten protein [Capsaspora owczarzaki ATCC 30864]
Length=384

 Score =   219 bits (558),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 119/317 (38%), Positives = 176/317 (56%), Gaps = 34/317 (11%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+ KRR+++ GFDLDLTYIT+ ++AMGFP+  +        EG YRN ME+V++FF
Sbjct  6     KQLVSKQKRRFKQDGFDLDLTYITDKIVAMGFPSEKL--------EGVYRNGMEDVVRFF  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             +  H+D YKVYNLCSER YD + F  +VA++PFDDHN PP +LI  FC   + WL ED  
Sbjct  58    DQKHQDHYKVYNLCSEREYDPAKFHNRVATYPFDDHNAPPFELIKPFCDDVHEWLTEDAR  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             NV V+HCKAG  RTG+MI + L++   +  AE+++ +Y   R  +AKG+ +PSQ RYVK 
Sbjct  118   NVAVIHCKAGKGRTGVMICAYLVHCNHWEKAEDALAFYGAARTQNAKGVTIPSQQRYVKM  177

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYW----IRPSITISDHNGVLFSTKKHPRTKD  1211
             +  ++   N         M +G ++   P +      P  T+S     ++S+K       
Sbjct  178   YASLIQ--NKLTYAPTTLMFKGVKMMTVPNFNGGTCSPMFTLSVQRQKIYSSKP------  229

Query  1212  LLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR---QGDFYC--WLNTTMIEN  1376
                        KK   V  L  +  +  L GD K+ F  +   + +  C  W NT  ++N
Sbjct  230   -------VENVKKDQAVVELKADRPIL-LCGDVKIEFYHKTAFKKEKMCHFWFNTFFVQN  281

Query  1377  RK-ILNTSDLDGFDKRK  1424
                +L   D+D  +K K
Sbjct  282   HTLLLRKVDIDKANKDK  298



>ref|XP_006622016.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X3 [Apis dorsata]
Length=586

 Score =   224 bits (572),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 175/305 (57%), Gaps = 39/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K
Sbjct  108   RIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVK  159

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
               E+ HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL   
Sbjct  160   LLESRHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRH  219

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              ENV VVHCKAG  RTG+M+   LL++K FPTA E++NYY  KR  D KG+ +PSQ RYV
Sbjct  220   QENVAVVHCKAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYV  279

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHP  1199
              Y+  ++    G N      +LR  +L   P +         H G      V+  +KK  
Sbjct  280   DYYATLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKI  328

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              + +++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT
Sbjct  329   FSSEIV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNT  380

Query  1362  TMIEN  1376
               + +
Sbjct  381   FFVRD  385



>gb|EMS62185.1| hypothetical protein TRIUR3_20655 [Triticum urartu]
Length=241

 Score =   214 bits (544),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 122/156 (78%), Gaps = 8/156 (5%)
 Frame = +3

Query  240  SKLSTWAKSLKIPQPFTGSQEEENSGNAAKSPFARFTSGFGMLSSPKSPTDDNSEGTSTT  419
            S LS+WAK+LKIPQP +G  +E  +G   K+  +R  SG G+  SPK P  D S   STT
Sbjct  81   SGLSSWAKNLKIPQPSSG--QESPTG---KNTVSRLASGLGLRLSPKDPHQDESAEGSTT  135

Query  420  P---QSSFIGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIA  590
            P   Q+   G+ T+G+VDSSKNAVKAV VKARH+VSQNKRRYQEGGFDLD+TYITEN+IA
Sbjct  136  PTTAQAGVFGSLTRGIVDSSKNAVKAVQVKARHMVSQNKRRYQEGGFDLDMTYITENIIA  195

Query  591  MGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHK  698
            MGFPAGD+SSG FGY EGFYRNHMEEVI+FFE HHK
Sbjct  196  MGFPAGDLSSGIFGYFEGFYRNHMEEVIRFFEMHHK  231



>ref|XP_006557294.1| PREDICTED: phosphatase and tensin-like isoform X3 [Apis mellifera]
Length=584

 Score =   224 bits (571),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 175/305 (57%), Gaps = 39/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+ +RR+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K
Sbjct  108   RIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVK  159

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
               E+ HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL   
Sbjct  160   LLESRHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLDQIRPFCEDVHEWLSRH  219

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              ENV VVHCKAG  RTG+M+   LL++K FPTA E++NYY  KR  D KG+ +PSQ RYV
Sbjct  220   QENVAVVHCKAGKGRTGVMVCCYLLHIKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYV  279

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHP  1199
              Y+  ++    G N      +LR  +L   P +         H G      V+  +KK  
Sbjct  280   DYYATLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLHCVISESKKKI  328

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              + +++         +KG+   ++P +  VA L GD +V F +R      +  F+ W NT
Sbjct  329   FSSEIV-------EVRKGMHTISIPLKHSVA-LTGDIRVDFFNRPKMKRKEKLFHFWFNT  380

Query  1362  TMIEN  1376
               + +
Sbjct  381   FFVRD  385



>gb|EZA50068.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Cerapachys biroi]
Length=448

 Score =   221 bits (562),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/300 (41%), Positives = 171/300 (57%), Gaps = 37/300 (12%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ ++R+ E GFDLDLTYIT+N+IAMGFPA  +        EG YRNH+++V+K  E+
Sbjct  17    LVSKRRKRFTEDGFDLDLTYITDNLIAMGFPAEKL--------EGVYRNHIDDVVKLLES  68

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              HKD YK+YNLCSER YD   F+ +VA++ FDDHN P ++ I  FC+  +SWL +  +NV
Sbjct  69    KHKDHYKIYNLCSERSYDCKKFKQRVATYAFDDHNPPKLEQIKPFCEDVHSWLSQHKDNV  128

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
              VVHCKAG  RTG+M+   LL+ K FPTA E++NYY  KR  D KG+ +PSQ RYV Y+ 
Sbjct  129   AVVHCKAGKGRTGVMVCCYLLHSKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYA  188

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWI----RPSITISDHNGVLFSTKKHPRTKDLL  1217
              ++   +G N      +LR  +L   P +          IS+ N  +FS     R     
Sbjct  189   TLVQ--DGLNYQPVTLILREIQLDPVPIFNGGQGSLHFVISESNKQVFSDVYEVR-----  241

Query  1218  PEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNTTMIENR  1379
                       KG    ++P    VA L GD +V F +R      +  F+ W NT  +  +
Sbjct  242   ----------KGTSSISIPLH-NVA-LKGDIRVDFFNRPKMKLKEKMFHFWFNTFFVREK  289



>ref|XP_002065075.1| GK15265 [Drosophila willistoni]
 gb|EDW76061.1| GK15265 [Drosophila willistoni]
Length=547

 Score =   222 bits (565),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 128/310 (41%), Positives = 170/310 (55%), Gaps = 28/310 (9%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R+VVS+ + RY+E GF+LDLTYI EN+IAMG+PA D         EG YR
Sbjct  3     NTISLMSNVIRNVVSKKRIRYKENGFNLDLTYICENIIAMGYPAPDK-------FEGLYR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N  E+V KF E +H   YK+YNLC ER YD++ F G+VA +PF+DHN P I+LI  FCQ 
Sbjct  56    NRFEDVFKFLEENHGQHYKIYNLCLEREYDINKFHGRVAIYPFEDHNPPTIELIQRFCQD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
               SWLKED  NVV VHCKAG  RTG MI + LLY     TA+E++ +Y++KR  D KG+ 
Sbjct  116   VDSWLKEDSLNVVAVHCKAGKGRTGTMICAYLLYSGMQKTADEALAWYDEKRTKDRKGVT  175

Query  1014  LPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKK  1193
             +PSQ RYV+YF  ++           R   +   L  C      S  + +    +F  + 
Sbjct  176   IPSQRRYVQYFSNLI---------CSRVQYKKISLKVCEIRFAGSSFLRNVQCSVFVLED  226

Query  1194  HPRTK---DLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFND-RQGDFYC--WL  1355
                 K    LL  D W    KK    F   G   +  +AGD KV  +   +   YC  W 
Sbjct  227   STNEKVKASLL--DTWPIDFKKS---FVYKGNSSLT-VAGDIKVELSQSSKSSPYCHFWF  280

Query  1356  NTTMIENRKI  1385
             NT  ++N  +
Sbjct  281   NTFFVQNSAV  290



>ref|XP_002014403.1| GL19174 [Drosophila persimilis]
 gb|EDW28399.1| GL19174 [Drosophila persimilis]
Length=546

 Score =   219 bits (559),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 131/357 (37%), Positives = 191/357 (54%), Gaps = 58/357 (16%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R+VVS+N+ RY+   FDLDLTYI +N+IAMG+P+ D        +E  YR
Sbjct  3     NTISLMSNVIRNVVSKNRIRYKGERFDLDLTYIYDNIIAMGYPSPDK-------LERMYR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N  E+V+KF +  H D YK+YNLC ER+YD + F G+VA FPF+DHN P I+LI  FC+ 
Sbjct  56    NCQEDVLKFLDEKHGDHYKIYNLCLERIYDSNKFHGRVAIFPFEDHNPPTIELIQKFCKD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
               SWLKED+ NVV VHCKAG  RTG MI + LLY     +A+E++ +Y++KR  D KG+ 
Sbjct  116   VDSWLKEDVLNVVAVHCKAGKGRTGTMICAYLLYSGLQKSADEALAWYDEKRTKDGKGVT  175

Query  1014  LPSQIRYVKYFERIL---------MYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDH  1166
             +PSQ RYV+YF  ++         M+   E + +   +L+     +C  ++    T  + 
Sbjct  176   IPSQRRYVQYFSNLVCSSVPYSKKMFKVCEIRFSESSLLKNLGTVQCKVFVLQDSTTEN-  234

Query  1167  NGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD--  1340
                    K+H            F   +  V    L   P ++ +AGD K  F  +  +  
Sbjct  235   ------VKQHR-----------FDFQESCV----LNINPSLS-VAGDIKFEFEQKSSEKA  272

Query  1341  -FYCWLNTTMIENRKI-------------LNTSDLDGFD---KRKLPSPGFQVEIVL  1460
              F+ WLNT  ++N  +             L  S++DG     K KL S  F++ I+ 
Sbjct  273   IFHFWLNTFFVQNSSVCESDGTLLKCTYTLKKSEIDGVHKDRKHKLFSEDFKISILF  329



>ref|XP_001625001.1| predicted protein [Nematostella vectensis]
 gb|EDO32901.1| predicted protein [Nematostella vectensis]
Length=338

 Score =   213 bits (541),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 123/304 (40%), Positives = 161/304 (53%), Gaps = 44/304 (14%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+ KRR+QE GFDLDLTYI  N++AMGFP+  +        EG YRNHM+EV +F 
Sbjct  5     KQLVSKKKRRFQEDGFDLDLTYIKPNIVAMGFPSEKL--------EGVYRNHMDEVYRFL  56

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             E  HKD YKVYNLCSER YD   F  +VA++PFDDHN PP +LI  FC     WLK    
Sbjct  57    EQKHKDSYKVYNLCSERQYDPMRFHNRVATYPFDDHNAPPFELIKPFCDDVDEWLKASNL  116

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             NV ++HCKAG  RTG+MI + LL+   F   +E++ YY   R  +AKG+ +PSQ RYV+Y
Sbjct  117   NVAIIHCKAGKGRTGVMICAYLLHNGHFKDTKEAMEYYGNARTRNAKGVTIPSQRRYVEY  176

Query  1044  FERILMYFNGENQPARRCMLRGFRL---------HKCPYWIRPSITISDHNGVLFSTKKH  1196
             +  +L   N         +LRGF +         + CP++I     +  H   L  + K 
Sbjct  177   YGYLLR--NCLTYVPTMVLLRGFEIITIPNMQGGNCCPFYIIWQYKVKIHTSKLIESSKK  234

Query  1197  PRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVH------FNDRQGDFYCWLN  1358
               T   L      S P        LP       + GD KV       F  ++  F  W N
Sbjct  235   GDTSIKLE----LSQP--------LP-------ICGDIKVEFFHKDTFGRKERMFQFWFN  275

Query  1359  TTMI  1370
             T  I
Sbjct  276   TFFI  279



>gb|ELU06519.1| hypothetical protein CAPTEDRAFT_90711 [Capitella teleta]
Length=378

 Score =   214 bits (544),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 132/187 (71%), Gaps = 8/187 (4%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             K + +VS+NKRRYQE GFDLDL+YI  N+IAMGFPA  +        EG YRN++++V++
Sbjct  4     KIKGLVSKNKRRYQEDGFDLDLSYIYPNIIAMGFPAEKL--------EGVYRNNIDDVVR  55

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
             F E  H+D+YKVYNLCSER+YD S F  +VA FPFDDH+ P ++LI  FC+    WL  +
Sbjct  56    FLEARHRDQYKVYNLCSERMYDTSKFHKRVAHFPFDDHHPPRLELIRPFCEDMDDWLSRN  115

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              +NV V+HCKAG  RTG+MI + LL+   F  AEE++ +Y   R MD KG+ +PSQ RYV
Sbjct  116   SQNVAVIHCKAGKGRTGVMICAYLLHCGRFKDAEEALRFYGDARTMDQKGVTIPSQRRYV  175

Query  1038  KYFERIL  1058
              Y+ +++
Sbjct  176   NYYGQLI  182



>ref|NP_599147.1| pten, isoform A [Drosophila melanogaster]
 ref|NP_599148.1| pten, isoform E [Drosophila melanogaster]
 gb|AAD45364.1|AF161259_1 PTEN3 [Drosophila melanogaster]
 gb|AAF23235.1|AF201904_1 phosphatase and tensin homolog [Drosophila melanogaster]
 gb|AAF52889.1| pten, isoform E [Drosophila melanogaster]
 gb|AAF52887.2| pten, isoform A [Drosophila melanogaster]
Length=509

 Score =   217 bits (553),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 176/312 (56%), Gaps = 35/312 (11%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R+VVS+ + RY+E G+DLDLTYI +N+IAMG+PA D        +EG +R
Sbjct  3     NTISLMSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDK-------LEGLFR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N +E+V K  E +H   YK+YNLCSER YDV+ F G+VA +PFDDHN P I+LI  FC  
Sbjct  56    NRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
                WLKED  NVV VHCKAG  RTG MI + L++     +A+E++ +Y++KR  D KG+ 
Sbjct  116   VDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVT  175

Query  1014  LPSQIRYVKYFERILMYFNGENQPARR-----CMLRGFRLHKCPY---WIRPSITISDHN  1169
             +PSQ RYV+YF +++      + P  +     C +R F    C      +  SI++  H+
Sbjct  176   IPSQRRYVQYFSKLVC----SSVPYSKVSLNVCEIR-FSESSCVQNLGMVECSISVL-HD  229

Query  1170  GVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-FY  1346
                 + K  P     LP D+     +K  V+   P  P    ++GD K     +  D   
Sbjct  230   SATENAK--PDRLKTLPIDF-----QKSFVLTIKPSIP----VSGDVKFELTKKSPDKII  278

Query  1347  C--WLNTTMIEN  1376
             C  WLNT  + N
Sbjct  279   CHFWLNTFFVRN  290



>gb|AAF23236.1|AF201905_1 phosphatase and tensin homolog [Drosophila melanogaster]
Length=506

 Score =   217 bits (552),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 176/312 (56%), Gaps = 35/312 (11%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R+VVS+ + RY+E G+DLDLTYI +N+IAMG+PA D        +EG +R
Sbjct  3     NTISLMSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDK-------LEGLFR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N +E+V K  E +H   YK+YNLCSER YDV+ F G+VA +PFDDHN P I+LI  FC  
Sbjct  56    NRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
                WLKED  NVV VHCKAG  RTG MI + L++     +A+E++ +Y++KR  D KG+ 
Sbjct  116   VDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVT  175

Query  1014  LPSQIRYVKYFERILMYFNGENQPARR-----CMLRGFRLHKCPY---WIRPSITISDHN  1169
             +PSQ RYV+YF +++      + P  +     C +R F    C      +  SI++  H+
Sbjct  176   IPSQRRYVQYFSKLVC----SSVPYSKVSLNVCEIR-FSESSCVQNLGMVECSISVL-HD  229

Query  1170  GVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-FY  1346
                 + K  P     LP D+     +K  V+   P  P    ++GD K     +  D   
Sbjct  230   SATENAK--PDRLKTLPIDF-----QKSFVLTIKPSIP----VSGDVKFELTKKSPDKII  278

Query  1347  C--WLNTTMIEN  1376
             C  WLNT  + N
Sbjct  279   CHFWLNTFFVRN  290



>gb|AAD45363.1|AF161258_1 PTEN2 [Drosophila melanogaster]
Length=511

 Score =   217 bits (552),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 176/312 (56%), Gaps = 35/312 (11%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R+VVS+ + RY+E G+DLDLTYI +N+IAMG+PA D        +EG +R
Sbjct  3     NTISLMSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDK-------LEGLFR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N +E+V K  E +H   YK+YNLCSER YDV+ F G+VA +PFDDHN P I+LI  FC  
Sbjct  56    NRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
                WLKED  NVV VHCKAG  RTG MI + L++     +A+E++ +Y++KR  D KG+ 
Sbjct  116   VDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVT  175

Query  1014  LPSQIRYVKYFERILMYFNGENQPARR-----CMLRGFRLHKCPY---WIRPSITISDHN  1169
             +PSQ RYV+YF +++      + P  +     C +R F    C      +  SI++  H+
Sbjct  176   IPSQRRYVQYFSKLVC----SSVPYSKVSLNVCEIR-FSESSCVQNLGMVECSISVL-HD  229

Query  1170  GVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-FY  1346
                 + K  P     LP D+     +K  V+   P  P    ++GD K     +  D   
Sbjct  230   SATENAK--PDRLKTLPIDF-----QKSFVLTIKPSIP----VSGDVKFELTKKSPDKII  278

Query  1347  C--WLNTTMIEN  1376
             C  WLNT  + N
Sbjct  279   CHFWLNTFFVRN  290



>ref|NP_477423.1| pten, isoform B [Drosophila melanogaster]
 ref|NP_599149.1| pten, isoform D [Drosophila melanogaster]
 ref|NP_001162933.1| pten, isoform G [Drosophila melanogaster]
 ref|NP_477422.2| pten, isoform H [Drosophila melanogaster]
 gb|AAF08382.1|AF144232_1 phosphatase PTEN [Drosophila melanogaster]
 gb|AAF52888.1| pten, isoform D [Drosophila melanogaster]
 gb|AAN10731.1| pten, isoform B [Drosophila melanogaster]
 gb|ABE73224.1| IP16020p [Drosophila melanogaster]
 gb|ACZ94222.1| pten, isoform G [Drosophila melanogaster]
 gb|AAN10732.2| pten, isoform H [Drosophila melanogaster]
Length=514

 Score =   217 bits (552),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 176/312 (56%), Gaps = 35/312 (11%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R+VVS+ + RY+E G+DLDLTYI +N+IAMG+PA D        +EG +R
Sbjct  3     NTISLMSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDK-------LEGLFR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N +E+V K  E +H   YK+YNLCSER YDV+ F G+VA +PFDDHN P I+LI  FC  
Sbjct  56    NRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
                WLKED  NVV VHCKAG  RTG MI + L++     +A+E++ +Y++KR  D KG+ 
Sbjct  116   VDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVT  175

Query  1014  LPSQIRYVKYFERILMYFNGENQPARR-----CMLRGFRLHKCPY---WIRPSITISDHN  1169
             +PSQ RYV+YF +++      + P  +     C +R F    C      +  SI++  H+
Sbjct  176   IPSQRRYVQYFSKLVC----SSVPYSKVSLNVCEIR-FSESSCVQNLGMVECSISVL-HD  229

Query  1170  GVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-FY  1346
                 + K  P     LP D+     +K  V+   P  P    ++GD K     +  D   
Sbjct  230   SATENAK--PDRLKTLPIDF-----QKSFVLTIKPSIP----VSGDVKFELTKKSPDKII  278

Query  1347  C--WLNTTMIEN  1376
             C  WLNT  + N
Sbjct  279   CHFWLNTFFVRN  290



>ref|NP_001161638.1| phosphatase and tensin homolog [Saccoglossus kowalevskii]
 gb|ACY92627.1| PTEN [Saccoglossus kowalevskii]
Length=399

 Score =   213 bits (543),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 174/305 (57%), Gaps = 35/305 (11%)
 Frame = +3

Query  489   VSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEE  668
             ++ K +++VS+ KRRYQEGGFDLDL+YI  N+IAMGFPA          +E +YRN +++
Sbjct  1     MASKIKNLVSKKKRRYQEGGFDLDLSYIYPNIIAMGFPAEK--------IESYYRNSIDD  52

Query  669   VIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWL  848
             V++F +  HKD YK+YNLCSER YD+S F  +V  +PFDDH+ P ++LI +FC+    WL
Sbjct  53    VVRFLDLKHKDHYKIYNLCSERCYDISKFRNRVVHYPFDDHHPPKLELIKTFCEDVDEWL  112

Query  849   KEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQI  1028
             +++  NV V+HCKAG  RTG+MI S L+++  F +A++++ YY + R ++ KG+ +PSQ 
Sbjct  113   RKNEANVAVIHCKAGKGRTGVMICSYLIHIGKFLSAQKALEYYGKTRTLNEKGVTIPSQR  172

Query  1029  RYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYW----IRPSITISDHNGVLFSTKKH  1196
             RYV+Y+E + +   G+ +     +L+       P +      P   +S     ++S+  +
Sbjct  173   RYVEYYEFLRLKCVGDYKQT-TLLLKTIHFDTVPMFSGGVCNPYFVVSQQKVKIYSSPSY  231

Query  1197  PRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHF-------NDRQGDFYCWL  1355
                             K+G         P +  + GD K+ F         R+  F+ W 
Sbjct  232   --------------ESKRGDKFIKCDVTPPLP-ICGDIKIEFFHKTNMLTKREKMFHFWF  276

Query  1356  NTTMI  1370
             NT +I
Sbjct  277   NTFVI  281



>ref|NP_477424.1| pten, isoform C [Drosophila melanogaster]
 gb|AAD45362.1|AF161257_1 PTEN1 [Drosophila melanogaster]
 gb|AAN10730.1| pten, isoform C [Drosophila melanogaster]
Length=418

 Score =   214 bits (544),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 176/312 (56%), Gaps = 35/312 (11%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R+VVS+ + RY+E G+DLDLTYI +N+IAMG+PA D        +EG +R
Sbjct  3     NTISLMSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDK-------LEGLFR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N +E+V K  E +H   YK+YNLCSER YDV+ F G+VA +PFDDHN P I+LI  FC  
Sbjct  56    NRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVAVYPFDDHNPPTIELIQRFCSD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
                WLKED  NVV VHCKAG  RTG MI + L++     +A+E++ +Y++KR  D KG+ 
Sbjct  116   VDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVT  175

Query  1014  LPSQIRYVKYFERILMYFNGENQPARR-----CMLRGFRLHKCPY---WIRPSITISDHN  1169
             +PSQ RYV+YF +++      + P  +     C +R F    C      +  SI++  H+
Sbjct  176   IPSQRRYVQYFSKLVC----SSVPYSKVSLNVCEIR-FSESSCVQNLGMVECSISVL-HD  229

Query  1170  GVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-FY  1346
                 + K  P     LP D+     +K  V+   P  P    ++GD K     +  D   
Sbjct  230   SATENAK--PDRLKTLPIDF-----QKSFVLTIKPSIP----VSGDVKFELTKKSPDKII  278

Query  1347  C--WLNTTMIEN  1376
             C  WLNT  + N
Sbjct  279   CHFWLNTFFVRN  290



>ref|XP_003382733.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Amphimedon 
queenslandica]
Length=457

 Score =   215 bits (547),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 145/235 (62%), Gaps = 15/235 (6%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             K RH+VS+ KRR+   GFDLD+T+I  N++AMGFP+  +        EG YRN M +V +
Sbjct  5     KFRHLVSKRKRRFIADGFDLDMTFIKPNIVAMGFPSEKL--------EGVYRNKMSDVQR  56

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
             +F+TH+ D YKVYNLCSER YD   F  KV  +PFDDHN PP +LI  FC+    WLKED
Sbjct  57    YFDTHYTDHYKVYNLCSERFYDPKKFH-KVTVYPFDDHNPPPFELIQPFCEDVDGWLKED  115

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
               NV V+HCKAG  RTG+MI S LL+ + F T ++++ +Y + R  +AKG+ +PSQ RYV
Sbjct  116   NRNVAVIHCKAGKGRTGVMICSYLLHDRLFDTVKDALQFYGEARTQNAKGVTIPSQRRYV  175

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYW----IRPSITISDHNGVLFSTK  1190
             +Y+  ++   N      R  +L   RL   P +      P   +  H  VL+++K
Sbjct  176   QYYGHLIR--NNLQYSPRTILLHAIRLEGIPNFSGGTCAPFFIVRKHKVVLYTSK  228



>gb|EFN90161.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase PTEN [Harpegnathos 
saltator]
Length=591

 Score =   218 bits (556),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 126/311 (41%), Positives = 173/311 (56%), Gaps = 43/311 (14%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ ++R+ E GFDLDLTYI +N+IAMGFPA  +        EG YRNH+++V+K  E+
Sbjct  111   LVSKRRKRFTEDGFDLDLTYIRDNLIAMGFPAEKL--------EGVYRNHIDDVVKLLES  162

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              HKD YK+YNLCSER YD   F+ +VA++ FDDHN P ++ I  FC+  + WL    ENV
Sbjct  163   KHKDHYKIYNLCSERSYDCKKFKQRVATYAFDDHNPPKLEQIKPFCEDVHEWLSLHKENV  222

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
              VVHCKAG  RTG+M+   LL+ K F TA +++NYY  KR  D KG+ +PSQ RYV Y+ 
Sbjct  223   AVVHCKAGKGRTGVMVCCYLLHSKQFVTAMDALNYYGTKRTHDRKGVTIPSQRRYVDYYA  282

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYW------IRPSITISDHNGVLFSTKKHPRTKD  1211
              ++    G N      +LR  +L   P +      +R    IS+ N  +F+         
Sbjct  283   TLVQ--GGLNYQPVTLILRKIQLDPVPIFNGGQGSLR--FVISESNKRIFT---------  329

Query  1212  LLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNTTMIE  1373
                EDY     +KG     +  E  VA L GD +V F +R      +  F+ W NT  + 
Sbjct  330   ---EDY---EVRKGTSSINISLESYVA-LTGDIRVDFFNRPKMKRKEKMFHFWFNTFFVR  382

Query  1374  NRKILNTSDLD  1406
                   TSD D
Sbjct  383   E---YTTSDYD  390



>ref|XP_002677109.1| predicted protein [Naegleria gruberi]
 gb|EFC44365.1| predicted protein [Naegleria gruberi]
Length=459

 Score =   215 bits (547),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 176/313 (56%), Gaps = 47/313 (15%)
 Frame = +3

Query  501   ARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKF  680
              R +VS+NK+R QE  FDLDLTYIT+NVIAMGFP    S G    VE  YRN  +EV+ F
Sbjct  5     VRRLVSKNKKRLQEDNFDLDLTYITDNVIAMGFP----SEG----VESIYRNPRDEVVDF  56

Query  681   FETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDI  860
               T H +KYKVYNLCSER Y+  +FEG+VA FPFDDH  P    ++ FC   + +LK+  
Sbjct  57    LSTKHGNKYKVYNLCSERDYNDEIFEGRVARFPFDDHQSPLFDSVLEFCVDVHEFLKDGK  116

Query  861   ENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVK  1040
              N  VVHCKAG  RTG+MI   LL+ +   TA +S+++Y  KR  DAKG+ +PSQ RY  
Sbjct  117   NNAAVVHCKAGKGRTGVMICCYLLFSQTCKTALDSLHFYGDKRTKDAKGVTIPSQRRYCY  176

Query  1041  YFERILMYFNGENQPARRCMLRG-FRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLL  1217
             YFE+ L      NQ A    LRG  +LH+        +T+ ++      +K +   K+L 
Sbjct  177   YFEQYL-----RNQFA----LRGSVKLHR--------VTLREYT----KSKYYITIKNLK  215

Query  1218  PEDYWFSAPKKGV------VVFALPGEPGVAELAGDFK-------VHFNDRQGDFYCWLN  1358
              E+ + S   + V      VV  L  EP   EL GDFK       V+        +CWLN
Sbjct  216   REEVFSSKQDQNVTSSDDRVVIDLK-EP--IELTGDFKVVCVKNGVNVLKSNNLLHCWLN  272

Query  1359  TTMIENRKILNTS  1397
             T  I N  + NTS
Sbjct  273   TRFITNL-VKNTS  284



>ref|XP_005092511.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Aplysia 
californica]
Length=236

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 128/187 (68%), Gaps = 8/187 (4%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+NKRR +E GFDLDLTYIT N+IAMGFPA  +        EG+YRNHME+VIK
Sbjct  5     RIKGLVSRNKRRLKEDGFDLDLTYITPNIIAMGFPAEKL--------EGYYRNHMEDVIK  56

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
             F E  HKD YKVYNLCSER YD + F  +VA +PFDDHN P I+LI  FC+   +WL + 
Sbjct  57    FLEAKHKDHYKVYNLCSERSYDPNKFLNRVAHYPFDDHNPPRIELIKPFCEDLDAWLGQH  116

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              +N+  +HCKAG  RTG+MI + LL+ K F   + ++ +Y   R  D KG+ +PSQ RYV
Sbjct  117   PDNIAAIHCKAGKGRTGVMICAYLLHRKRFKDPDSALRHYGATRTRDEKGVTIPSQRRYV  176

Query  1038  KYFERIL  1058
              Y+  +L
Sbjct  177   LYYADLL  183



>gb|EFA07760.1| hypothetical protein TcasGA2_TC005314 [Tribolium castaneum]
Length=444

 Score =   214 bits (544),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 132/185 (71%), Gaps = 8/185 (4%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             R +VS+ + RY++ GF+LDLTYIT+++IAMG+PA +        +EG YRNH+++V+K  
Sbjct  15    RGLVSKRRIRYKQDGFNLDLTYITDSIIAMGYPASN--------IEGVYRNHIDDVVKLL  66

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ H + Y +YNLCSER YD S F  +V +FPFDDHN P I+LI  FC S + WL +D E
Sbjct  67    DSKHNNHYFIYNLCSERTYDTSKFHNRVQTFPFDDHNPPKIELIQPFCHSVHDWLSKDPE  126

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             NV VVHCKAG  RTG MI   LL+   F TA+E++++Y Q R  D KG+ +PSQ+RY++Y
Sbjct  127   NVAVVHCKAGKGRTGTMICCYLLHSGAFATADEALDHYGQARTQDHKGVTIPSQVRYIRY  186

Query  1044  FERIL  1058
             +E +L
Sbjct  187   YETLL  191



>ref|XP_007895108.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Callorhinchus 
milii]
Length=406

 Score =   213 bits (541),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/306 (38%), Positives = 174/306 (57%), Gaps = 38/306 (12%)
 Frame = +3

Query  489   VSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEE  668
             ++ + + +VS+NKRR+QE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++
Sbjct  1     MASRIKELVSRNKRRFQEDGFDLDLTYIYPNIIAMGFPADRL--------EGVYRNNIDD  52

Query  669   VIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWL  848
             V+KF +  HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+   +WL
Sbjct  53    VVKFLDAKHKNHYKIYNLCAERHYDATKFNCRVAQYPFEDHNPPQLELIKPFCEDLDNWL  112

Query  849   KEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQI  1028
              ED  NV  +HCKAG  RTG+MI + LL+   F  A+E++++Y Q R +D KG+ +PSQ 
Sbjct  113   SEDDNNVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGQARTIDKKGVTIPSQR  172

Query  1029  RYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYW----IRPSITISDHNGVLFSTKKH  1196
             RYV Y+  +L +   E +P    +    R    P +      P   +S     ++++   
Sbjct  173   RYVHYYSYLLKH-KLEYKPV-ALLFHKMRFETVPMFSGGTCNPMFVVSQLKVKIYTSPLG  230

Query  1197  PRTKDLLPEDY-WFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCW  1352
             P  ++   E Y +F  P+       LP       + GD KV F  +Q         F+ W
Sbjct  231   PTRRE---EKYMYFEFPQ------PLP-------VCGDIKVEFFHKQNKMMKKDKMFHFW  274

Query  1353  LNTTMI  1370
             +NT  I
Sbjct  275   INTFFI  280



>ref|XP_003708160.1| PREDICTED: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Megachile 
rotundata]
Length=504

 Score =   215 bits (548),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/305 (38%), Positives = 175/305 (57%), Gaps = 39/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             + + +VS+ ++R+ E GFDLDLTYI +++IAMGFPA  +        EG YRNH+++V++
Sbjct  13    RIKGLVSKRRKRFTEDGFDLDLTYIRDDLIAMGFPAEKL--------EGVYRNHIDDVVR  64

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
               E+ HKD YK+YNLCSER YD   F+ +VA++ FDDHN P +  I  FC+  + WL + 
Sbjct  65    LLESKHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLNQIKPFCEDVHEWLSQH  124

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              +NV VVHCKAG  RTG+M+   LL++K F TA E++N+Y  KR  D KG+ +PSQ RYV
Sbjct  125   KKNVAVVHCKAGKGRTGVMVCCYLLHIKQFLTATEALNFYGTKRTHDRKGVTIPSQRRYV  184

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG------VLFSTKKHP  1199
              Y+  ++    G N      +LR  +L   P +         H G      ++  +KK  
Sbjct  185   DYYATLVQ--EGLNYQPVTLLLRKIQLDPAPIF---------HGGQGYLECIISESKKKI  233

Query  1200  RTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNT  1361
              + D++         +KG+   ++P +  +A L GD +V F +R      +  F+ W NT
Sbjct  234   FSSDIVE-------VRKGMQNVSIPLKHCIA-LTGDIRVDFFNRPKMKRKEKLFHFWFNT  285

Query  1362  TMIEN  1376
               + +
Sbjct  286   FFVRD  290



>ref|XP_008197501.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Tribolium castaneum]
Length=469

 Score =   214 bits (544),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 132/185 (71%), Gaps = 8/185 (4%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             R +VS+ + RY++ GF+LDLTYIT+++IAMG+PA +        +EG YRNH+++V+K  
Sbjct  78    RGLVSKRRIRYKQDGFNLDLTYITDSIIAMGYPASN--------IEGVYRNHIDDVVKLL  129

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ H + Y +YNLCSER YD S F  +V +FPFDDHN P I+LI  FC S + WL +D E
Sbjct  130   DSKHNNHYFIYNLCSERTYDTSKFHNRVQTFPFDDHNPPKIELIQPFCHSVHDWLSKDPE  189

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             NV VVHCKAG  RTG MI   LL+   F TA+E++++Y Q R  D KG+ +PSQ+RY++Y
Sbjct  190   NVAVVHCKAGKGRTGTMICCYLLHSGAFATADEALDHYGQARTQDHKGVTIPSQVRYIRY  249

Query  1044  FERIL  1058
             +E +L
Sbjct  250   YETLL  254



>ref|XP_002036459.1| GM11890 [Drosophila sechellia]
 gb|EDW52382.1| GM11890 [Drosophila sechellia]
Length=514

 Score =   215 bits (547),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 133/195 (68%), Gaps = 7/195 (4%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R+VVS+ + RY+E G++LDLTYI +N+IAMG+PA D        +EG +R
Sbjct  3     NTISLMSNVIRNVVSKKRIRYKEKGYNLDLTYINDNIIAMGYPAPDK-------LEGLFR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N +E+V K  E +H   YKVYNLCSER YDV  F G+VA +PFDDHN P I+LI  FC  
Sbjct  56    NRLEDVFKLLEENHAQHYKVYNLCSERSYDVDKFHGRVAVYPFDDHNPPTIELIQRFCSD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
                WLKED  NVV VHCKAG  RTG MI + L+Y     +A+E++ +Y++KR  D KG+ 
Sbjct  116   VDLWLKEDSSNVVAVHCKAGKGRTGTMICAYLVYSGLKKSADEALAWYDEKRTKDRKGVT  175

Query  1014  LPSQIRYVKYFERIL  1058
             +PSQ RYV+YF +++
Sbjct  176   IPSQRRYVQYFSKLV  190



>ref|XP_008487688.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Diaphorina 
citri]
Length=429

 Score =   212 bits (539),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 123/338 (36%), Positives = 183/338 (54%), Gaps = 45/338 (13%)
 Frame = +3

Query  435   IGTFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDM  614
             + TF + + ++  N      +K   +VS+ ++RY + GF+LDLTYIT N+IAMGFPA  +
Sbjct  41    LQTFAQRMANTISNMKIHNPIKT--LVSKRRQRYTKDGFNLDLTYITNNLIAMGFPAEKL  98

Query  615   SSGFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHN  794
                     E  YRNH+++V+KF E +HKD YK+YNLCSER YD + F+ +VA +PFDDHN
Sbjct  99    --------EAVYRNHIDDVVKFLEAYHKDHYKIYNLCSERSYDKTRFQ-QVAHYPFDDHN  149

Query  795   CPPIQLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINY  974
              P +++I  FC   + WL +D  NV  VHCKAG  RTG+M+   LL+ + + TA++++N+
Sbjct  150   PPRMEVIQPFCNDVHQWLSQDKNNVAAVHCKAGKGRTGVMVCCYLLHSQQYITAKDALNF  209

Query  975   YNQKRCMDAKGLVLPSQIRYVKYF----ERILMYFNGENQPARRCMLRGFRLHKCPYWI-  1139
             Y  +R  D KG+ +PSQ RYV Y+    +  L+Y      P    ++R  RL   P +  
Sbjct  210   YGSQRTTDKKGVTIPSQRRYVGYYATLVQETLLY-----HPV-TLVIREIRLEPAPLFNG  263

Query  1140  ----RPSITISDHNGVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGD  1307
                     TIS  N  LF++                   KKGV    LP    +  + GD
Sbjct  264   AQGGNIQFTISQQNEKLFTSP--------------LKEVKKGVACIELPVSQYIP-ITGD  308

Query  1308  FKVHF----NDRQGDFYCWLNTTMIENRKILNTSDLDG  1409
              KV F      ++  F  W NT  + +  ++ +S  +G
Sbjct  309   VKVEFFRKTMRKEKIFQFWFNTFFVRDEVVVTSSHDNG  346



>ref|XP_004344005.1| Protein-tyrosine-phosphatase [Acanthamoeba castellanii str. Neff]
 gb|ELR20602.1| Protein-tyrosine-phosphatase [Acanthamoeba castellanii str. Neff]
Length=1044

 Score =   221 bits (564),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 130/323 (40%), Positives = 171/323 (53%), Gaps = 35/323 (11%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             R +VSQNK+RYQ   FDLDLTYIT+ V+AMGFP+  +        E  YRN M EV +FF
Sbjct  4     RTLVSQNKKRYQMHSFDLDLTYITDKVVAMGFPSESL--------ESVYRNPMSEVQRFF  55

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ET H D Y VYNLCSER Y    F G+V  +PFDDHNCP I+LI +FC S   WL     
Sbjct  56    ETFHHDHYMVYNLCSERDYKEEKFHGRVERYPFDDHNCPTIELIENFCDSVEVWLHSHRS  115

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             NV  VHCKAG  RTGLMI+  +LY     TA+E++ +Y   RCMD KG+ +PSQIR+V+Y
Sbjct  116   NVAAVHCKAGKGRTGLMITCWMLYSGLCETAQEALEFYAFIRCMDQKGVTIPSQIRFVEY  175

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPE  1223
              ER+ +Y      P     LR   +H  P  +   I+   H+ + F        +  + E
Sbjct  176   IERLKIY---GPVPHVSLALRSLIIHTVPKAL---ISKIRHHSLGFRVLVLLHGEKEMRE  229

Query  1224  DYWFSAPKKGVV----------VFALPGEPGVAELAGDFKVHF--NDRQGD----FYCWL  1355
              +   A +K VV          +F  P       + G  K+ F   D  G     F  W 
Sbjct  230   IFSADAMQKTVVEVKGETREALIFQFPAH---VLITGSVKMEFFYRDILGRPVTLFRFWF  286

Query  1356  NTTMI--ENRKILNTSDLDGFDK  1418
             + + +   N+ +L  S +DG  K
Sbjct  287   HCSFVGSSNQLLLKKSQIDGAHK  309



>ref|XP_002004101.1| GI18266 [Drosophila mojavensis]
 gb|EDW13543.1| GI18266 [Drosophila mojavensis]
Length=611

 Score =   216 bits (550),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 128/358 (36%), Positives = 188/358 (53%), Gaps = 51/358 (14%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R+VVS+ + RY+E GF+LDL+YI   +IAMG+PA D+       +EG YR
Sbjct  3     NTISIMSNALRNVVSKKRIRYKEKGFNLDLSYICPKIIAMGYPAPDI-------IEGIYR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N +E+V KF E +H   Y++YNLC ER YD++ F G VA++PF+DHN PPI L+  FCQ 
Sbjct  56    NRLEDVYKFMEENHGGHYRIYNLCQERSYDINKFHGNVATYPFEDHNPPPIVLMQRFCQD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
               SWL  D  NVV VHCKAG  RTG MI + L++ KF  TA+E++ +Y++KR +D KG+ 
Sbjct  116   VESWLNRDPLNVVAVHCKAGKGRTGTMICAYLVHSKFLNTADEALAFYDEKRTIDRKGVT  175

Query  1014  LPSQIRYVKYFE--------RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHN  1169
             +PSQ RYV+Y+          ++  +  E + A    L      +C        +ISD  
Sbjct  176   IPSQRRYVQYYSNLIPDIHYEVVSLYISEIRFAEANYLHNLGTVQC--------SISDRQ  227

Query  1170  GVLFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQG-DFY  1346
                 S K         P D+      +   +  L   P +  ++GD KV    +      
Sbjct  228   ESA-SEKLKAHELKTWPIDF------QKTSILDLTSSPLM--VSGDIKVELTQKSSRKMI  278

Query  1347  C--WLNTTMIEN-------------RKILNTSDLDGFDK---RKLPSPGFQVEIVLVD  1466
             C  W+NT  ++N                LN S++DG  K    K  S  F++ +V ++
Sbjct  279   CSFWVNTFFMQNDAARILDGNTVKFMHTLNKSEIDGAHKDKDHKSFSEDFKISLVFIN  336



>ref|XP_009291324.1| PREDICTED: phosphatase and tensin homolog A isoform X1 [Danio 
rerio]
 gb|AAR04344.1| phosphatase and tensin-like protein A short splice variant [Danio 
rerio]
Length=431

 Score =   212 bits (539),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 134/191 (70%), Gaps = 8/191 (4%)
 Frame = +3

Query  486   AVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHME  665
             A++ K + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN+++
Sbjct  2     AMTAKLKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNID  53

Query  666   EVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSW  845
             +V++F ++ HK+ YK+YNLC+ER YD S F  +VA +PF+DHN P ++LI  FC+    W
Sbjct  54    DVVRFLDSKHKNHYKIYNLCAERHYDASKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQW  113

Query  846   LKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQ  1025
             L ED  +V  +HCKAG  RTG+MI + LL+ K F  A+E++++Y + R  D KG+ +PSQ
Sbjct  114   LSEDENHVAAIHCKAGKGRTGVMICAYLLHRKKFAEAQEALDFYGEVRTRDKKGVTIPSQ  173

Query  1026  IRYVKYFERIL  1058
              RYV Y+  +L
Sbjct  174   RRYVYYYSYLL  184



>ref|XP_002089058.1| GE26252 [Drosophila yakuba]
 gb|EDW88770.1| GE26252 [Drosophila yakuba]
Length=515

 Score =   214 bits (544),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 121/308 (39%), Positives = 171/308 (56%), Gaps = 27/308 (9%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R+VVS+ + RY+E G++LDLTYI +N+IAMG+PA D        +EG YR
Sbjct  3     NTISLMSNVIRNVVSKKRIRYKEKGYNLDLTYIYDNIIAMGYPATDK-------LEGLYR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N +E+V KF E +H   YK+YNLCSER YDV+ F G+VA  PF+DHN P I+LI  FC  
Sbjct  56    NRLEDVFKFLEENHAQHYKIYNLCSERSYDVAKFHGRVAVLPFEDHNPPTIELIQRFCMD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
                WLKED  NVV VHCKAG  RTG MI + L++     +A++++ +Y++KR  D KG+ 
Sbjct  116   VDLWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGLQKSADDALAWYDEKRTKDRKGVT  175

Query  1014  LPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTK-  1190
             +PSQ RYV+YF +++      + P  +       L+ C      S  + +   V  S   
Sbjct  176   IPSQRRYVQYFSKLVC----SSVPYSK-----ISLNVCEIRFSESSCLQNLGTVQCSVSV  226

Query  1191  -KHPRTKDLLPEDY--WFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-FYC--W  1352
                  T++  P++   W    KK  V+   P  P    + GD K     +  D   C  W
Sbjct  227   LHDSTTENAEPDNLKTWTIDFKKSFVLTIKPYLP----VCGDVKFELTQKSSDKIICHFW  282

Query  1353  LNTTMIEN  1376
             LNT  + N
Sbjct  283   LNTFFVRN  290



>ref|XP_003723944.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Strongylocentrotus 
purpuratus]
Length=417

 Score =   211 bits (537),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 121/305 (40%), Positives = 163/305 (53%), Gaps = 40/305 (13%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             K + +VS+NK R ++G FDLDLTYI  N+IAMGFPA  +        E  YRN ME V+K
Sbjct  5     KIKSIVSKNKIRLRDGNFDLDLTYICPNIIAMGFPAESL--------ERMYRNDMEHVVK  56

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
             F  +HH+D YKVYNLCSER YD S F+ +VA +PFDDHN P I+LI  FC+    WL ED
Sbjct  57    FLNSHHQDHYKVYNLCSERNYDTSRFDHRVAHYPFDDHNPPRIELIRPFCEDVMQWLAED  116

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              +NV  +HCKAG  RTG+MI +LLL+     TA ES+ YY + R  D KG+ +PSQ RYV
Sbjct  117   KDNVAAIHCKAGKGRTGVMICALLLHQGRCLTAAESMEYYGKIRTTDGKGVTIPSQRRYV  176

Query  1038  KYFERILMYFNGENQPARRCMLRGFRLHKCPYW----IRPSITISDHNGVLFSTKKHPRT  1205
             +Y+  ++          +  +L+  +L+  P        P  T+  H   + + +     
Sbjct  177   QYYGELVK--RNTLYKTQTVLLKRVQLYTIPMMSSGTCCPFFTVHQHKVKIHTQEA----  230

Query  1206  KDLLPEDYWFSAPKKGV--VVFALPGEPGVAELAGDFKVHFNDRQG--------DFYCWL  1355
                          KKG+  V F L   P    +  D K+ F  + G         F+ W 
Sbjct  231   ---------VKGVKKGLSCVEFEL---PHALPIRDDVKIEFYHKSGLLKMDKRLMFHMWF  278

Query  1356  NTTMI  1370
             NT  I
Sbjct  279   NTYFI  283



>ref|XP_008340400.1| PREDICTED: cyclin-G-associated kinase-like [Malus domestica]
 ref|XP_008340402.1| PREDICTED: cyclin-G-associated kinase-like [Malus domestica]
Length=163

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  441  TFTKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSS  620
            +FTKGLV++S++AVKAV VKARH+VSQNKRRYQEGGFDLDLTYITEN+IAMGFPAGD+SS
Sbjct  46   SFTKGLVNTSQSAVKAVQVKARHLVSQNKRRYQEGGFDLDLTYITENIIAMGFPAGDISS  105

Query  621  GFFGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKV  767
            G FGYVEGFYRNHMEEVI F ET HK KYKVYNLCSERLYD S FEGKV
Sbjct  106  GLFGYVEGFYRNHMEEVISFLETTHKGKYKVYNLCSERLYDASRFEGKV  154



>ref|XP_008547428.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Microplitis 
demolitor]
Length=375

 Score =   209 bits (533),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 127/179 (71%), Gaps = 8/179 (4%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ ++R+ E GFDLDLTYI  N+IAMGFPA  +        EG YRNH+++V+KF E+
Sbjct  107   LVSKRRKRFTEDGFDLDLTYIQTNLIAMGFPAEKL--------EGVYRNHIDDVVKFLES  158

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              HKD YK+YNLC ER YD   F+ +VA +PFDDHN P I+ I  FC+  ++WL +D +N+
Sbjct  159   RHKDHYKIYNLCKERSYDPRKFKNRVAEYPFDDHNPPNIEQIKPFCEDVHNWLSQDCKNI  218

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYF  1046
               VHCKAG  RTG+M++  LL+ K FPTA +++ +Y  KR  D+KG+ +PSQ RYV Y+
Sbjct  219   AAVHCKAGKGRTGVMVACYLLHTKQFPTALDALTFYGSKRTTDSKGVTIPSQRRYVGYY  277



>gb|AAR04345.1| phosphatase and tensin-like protein A long splice variant [Danio 
rerio]
Length=454

 Score =   212 bits (539),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 134/191 (70%), Gaps = 8/191 (4%)
 Frame = +3

Query  486   AVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHME  665
             A++ K + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN+++
Sbjct  2     AMTAKLKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNID  53

Query  666   EVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSW  845
             +V++F ++ HK+ YK+YNLC+ER YD S F  +VA +PF+DHN P ++LI  FC+    W
Sbjct  54    DVVRFLDSKHKNHYKIYNLCAERHYDASKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQW  113

Query  846   LKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQ  1025
             L ED  +V  +HCKAG  RTG+MI + LL+ K F  A+E++++Y + R  D KG+ +PSQ
Sbjct  114   LSEDENHVAAIHCKAGKGRTGVMICAYLLHRKKFAEAQEALDFYGEVRTRDKKGVTIPSQ  173

Query  1026  IRYVKYFERIL  1058
              RYV Y+  +L
Sbjct  174   RRYVYYYSYLL  184



>ref|NP_957002.2| phosphatase and tensin homolog A [Danio rerio]
Length=454

 Score =   212 bits (539),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 134/191 (70%), Gaps = 8/191 (4%)
 Frame = +3

Query  486   AVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHME  665
             A++ K + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN+++
Sbjct  2     AMTAKLKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNID  53

Query  666   EVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSW  845
             +V++F ++ HK+ YK+YNLC+ER YD S F  +VA +PF+DHN P ++LI  FC+    W
Sbjct  54    DVVRFLDSKHKNHYKIYNLCAERHYDASKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQW  113

Query  846   LKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQ  1025
             L ED  +V  +HCKAG  RTG+MI + LL+ K F  A+E++++Y + R  D KG+ +PSQ
Sbjct  114   LSEDENHVAAIHCKAGKGRTGVMICAYLLHRKKFAEAQEALDFYGEVRTRDKKGVTIPSQ  173

Query  1026  IRYVKYFERIL  1058
              RYV Y+  +L
Sbjct  174   RRYVYYYSYLL  184



>gb|EFX81708.1| phosphatase and tensin-like protein [Daphnia pulex]
Length=280

 Score =   206 bits (524),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 128/183 (70%), Gaps = 8/183 (4%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ K+RY+E GF+LDLTYI +NVIAMG+PA  +        EG YRNH+++V KF ET
Sbjct  8     LVSRKKKRYKEDGFNLDLTYIFDNVIAMGYPAAKL--------EGVYRNHIDDVYKFLET  59

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              HKD YK+YNLCSER YD S F  +V+SFPFDDHN P + LI  FC+    WL +D  NV
Sbjct  60    KHKDHYKIYNLCSERSYDYSRFNNRVSSFPFDDHNPPKLGLIEPFCKDMDEWLNQDQSNV  119

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
               +HCKAG  RTGLMI   +L+  +   A++++ +Y Q R  D KG+ +PSQ RYV+Y++
Sbjct  120   AAIHCKAGKGRTGLMICCYILHRGWAENADDALKHYGQTRTHDTKGVTIPSQRRYVEYYD  179

Query  1050  RIL  1058
             ++L
Sbjct  180   QLL  182



>ref|XP_001963068.1| GF14124 [Drosophila ananassae]
 gb|EDV32289.1| GF14124 [Drosophila ananassae]
Length=512

 Score =   213 bits (541),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 135/195 (69%), Gaps = 7/195 (4%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R+VVS+ + RY+E G+DLDLTYI EN+IAMG+PA D+       VEG +R
Sbjct  3     NTISLMSNVIRNVVSKKRIRYKEKGYDLDLTYIYENIIAMGYPAPDI-------VEGMFR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N +E+V KF E +H   YK+YNLC E+ YD+S F G+VASF F+DHN P I+L+  FC+ 
Sbjct  56    NRLEDVYKFLEENHGRHYKIYNLCLEKNYDISKFNGRVASFLFEDHNPPTIELMQRFCKD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
                WLK D  NVV VHCKAG  RTG MI + LLY     +A+E++ +Y++KR  D KG+ 
Sbjct  116   VDLWLKADSSNVVAVHCKAGKGRTGTMICAYLLYSGLQKSADEALAWYDEKRTKDLKGVT  175

Query  1014  LPSQIRYVKYFERIL  1058
             +PSQ RYV+YF ++L
Sbjct  176   IPSQRRYVQYFFKLL  190



>ref|XP_974994.2| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Tribolium castaneum]
Length=565

 Score =   213 bits (543),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 132/185 (71%), Gaps = 8/185 (4%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             R +VS+ + RY++ GF+LDLTYIT+++IAMG+PA +        +EG YRNH+++V+K  
Sbjct  78    RGLVSKRRIRYKQDGFNLDLTYITDSIIAMGYPASN--------IEGVYRNHIDDVVKLL  129

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ H + Y +YNLCSER YD S F  +V +FPFDDHN P I+LI  FC S + WL +D E
Sbjct  130   DSKHNNHYFIYNLCSERTYDTSKFHNRVQTFPFDDHNPPKIELIQPFCHSVHDWLSKDPE  189

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             NV VVHCKAG  RTG MI   LL+   F TA+E++++Y Q R  D KG+ +PSQ+RY++Y
Sbjct  190   NVAVVHCKAGKGRTGTMICCYLLHSGAFATADEALDHYGQARTQDHKGVTIPSQVRYIRY  249

Query  1044  FERIL  1058
             +E +L
Sbjct  250   YETLL  254



>ref|XP_001969427.1| GG23962 [Drosophila erecta]
 gb|EDV58486.1| GG23962 [Drosophila erecta]
Length=514

 Score =   212 bits (540),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 133/195 (68%), Gaps = 7/195 (4%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R VVS+ + RY E G++LDLTYI +N+IAMG+PA D        +E  YR
Sbjct  3     NTISLMSNVIRKVVSKQRIRYNEKGYNLDLTYICDNIIAMGYPATDK-------LERLYR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N ME+V+KF E +H   YK+YNLCSER YDV++F G+VA  PF+DHN P I+LI  FC  
Sbjct  56    NRMEDVLKFLEENHGRHYKIYNLCSERSYDVAIFHGRVAVLPFEDHNPPTIELIQRFCMD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
                WLKED  NVV VHCKAG  RTG MI + L++     +A++++ +Y++KR  D KG+ 
Sbjct  116   VDLWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGLQKSADDALAWYDEKRTKDRKGVT  175

Query  1014  LPSQIRYVKYFERIL  1058
             +PSQ RYV+YF +++
Sbjct  176   IPSQRRYVQYFSKLV  190



>gb|EKC26943.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase PTEN [Crassostrea 
gigas]
Length=481

 Score =   211 bits (537),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 120/303 (40%), Positives = 166/303 (55%), Gaps = 41/303 (14%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             +++VS++KRRY E GFDLDLTYI  N+IAMGFPA  +        EG YRN M +V+ F 
Sbjct  6     KNLVSKHKRRYTEDGFDLDLTYIYPNIIAMGFPAEKL--------EGVYRNKMADVVNFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             +  HKD Y+VYNLCSER YDVS F  +V S+PFDDHN P ++LI  FC+    WL++D  
Sbjct  58    DERHKDHYRVYNLCSERSYDVSKFHNRVVSYPFDDHNPPRLELIKPFCEDLDEWLRQDGR  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             N+  +HCKAG  RTG+MI + +L+ K F  A  ++ YY Q R  D KG+ +PSQ+RYV+Y
Sbjct  118   NIAAIHCKAGKGRTGVMICAYMLHRKKFTDAGAALRYYGQTRTRDEKGVTIPSQVRYVEY  177

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG-------VLFSTKKHPR  1202
             +  ++ + N + +P    +L+               TI  HNG        +F  K    
Sbjct  178   YGYMIRH-NLQYKPV-TLLLKAIDF----------FTIPMHNGGTCCPFFEVFQLKVKVY  225

Query  1203  TKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFND-------RQGDFYCWLNT  1361
             T         +   KKG   F +  +  V  L GD KV F +       ++  F  W NT
Sbjct  226   TSKT------YEDIKKGQDKFTMSTDQSVP-LCGDIKVVFYNKPRLTKKKEKMFQFWFNT  278

Query  1362  TMI  1370
               +
Sbjct  279   FFV  281



>ref|NP_001128398.1| phosphatase and tensin homolog [Nasonia vitripennis]
Length=497

 Score =   211 bits (538),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 124/327 (38%), Positives = 182/327 (56%), Gaps = 32/327 (10%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ ++R+   GF+LDLTYI +N+IAMGFPA  +        EG YRN+++EV +F E+
Sbjct  17    LVSKRRKRFTADGFNLDLTYIKDNLIAMGFPAEKL--------EGVYRNNIDEVARFLES  68

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              H++ Y +YNLCSER YD + F+G+VA++ FDDHN PP++LI  FC+   SWL +  ENV
Sbjct  69    RHRNHYTIYNLCSERSYDHTKFKGRVATYAFDDHNPPPLELIKPFCEDVDSWLLQHDENV  128

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
              VVHCKAG  RTG+M+   LL+ K F TA E++N+Y  +R  D KG+ +PSQ RYV Y+ 
Sbjct  129   SVVHCKAGKGRTGVMVCCYLLHSKQFRTATEALNFYGNERTTDKKGVTIPSQRRYVDYYA  188

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDY  1229
               L+  N   QP    +LR  +L        P    +   G  F   +  + K    E Y
Sbjct  189   -TLVQENLSYQPV-TLILREIKL-------EPISATNGGQGYHFVISE-AKNKIFSSETY  238

Query  1230  WFSAPKKGVVVFALPGEPGVAELAGDFKVHFND------RQGDFYCWLNTTMIENRKILN  1391
                  +KG     +P   GV  + GD +V F +      ++  F+ W NT  +    + +
Sbjct  239   EI---RKGTSTLCIPLNHGVP-IKGDIRVDFYNIPKVKRKEKLFHFWFNTFFVREH-VTS  293

Query  1392  TSDLDG---FDKRKLPSPGFQVEIVLV  1463
              +D +G      R L   G  +E+ +V
Sbjct  294   ENDNEGPVERTTRALSCDGSAMELPMV  320



>dbj|GAM17605.1| hypothetical protein SAMD00019534_007800 [Acytostelium subglobosum 
LB1]
Length=434

 Score =   210 bits (534),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 132/209 (63%), Gaps = 11/209 (5%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             R+ VS+ KRRYQ+ G+DLDL+YIT  +IAMGFP+  M        EG +RN M+EV+KF 
Sbjct  6     RNAVSKQKRRYQKDGYDLDLSYITPRIIAMGFPSEKM--------EGVFRNPMKEVVKFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             +  HKD +KVYNLCSER YD S F G+V  FPFDDHN P   LI  FCQ  + WL+ D +
Sbjct  58    DHKHKDHFKVYNLCSERDYDHSKFYGRVGHFPFDDHNAPEFSLIEKFCQDVHEWLR-DKD  116

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             N+ V+HCKAG  RTGLMI   L+Y   +P  E S+ +Y   R  + KG+ +PSQIRYV Y
Sbjct  117   NIAVIHCKAGKGRTGLMICCYLIYCGEWPETENSLKFYAAARTYNQKGVTIPSQIRYVHY  176

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCP  1130
             F R L      N P R  +LR   L   P
Sbjct  177   FSRYLREKLPYNPPER--VLRKIVLKPLP  203



>gb|AAH59457.1| Phosphatase and tensin homolog A [Danio rerio]
Length=452

 Score =   210 bits (534),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 133/190 (70%), Gaps = 8/190 (4%)
 Frame = +3

Query  489   VSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEE  668
             ++ K + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++
Sbjct  1     MTAKLKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDD  52

Query  669   VIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWL  848
             V++F ++ HK+ YK+YNLC+ER YD S F  +VA +PF+DHN P ++LI  FC+    WL
Sbjct  53    VVRFLDSKHKNHYKIYNLCAERHYDASKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWL  112

Query  849   KEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQI  1028
              ED  +V  +HCKAG  RTG+MI + LL+ K F  A+E++++Y + R  D KG+ +PSQ 
Sbjct  113   SEDENHVAAIHCKAGKGRTGVMICAYLLHRKKFAEAQEALDFYGEVRTRDKKGVTIPSQR  172

Query  1029  RYVKYFERIL  1058
             RYV Y+  +L
Sbjct  173   RYVYYYSYLL  182



>ref|XP_637576.1| protein tyrosine phosphatase [Dictyostelium discoideum AX4]
 sp|Q8T9S7.1|PTEN_DICDI RecName: Full=Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN; AltName: 
Full=Pten 3-phosphoinositide phosphatase alpha [Dictyostelium 
discoideum]
 gb|AAL75566.1|AF467431_1 Pten 3-phosphoinositide phosphatase alpha [Dictyostelium discoideum 
AX3]
 gb|EAL64034.1| protein tyrosine phosphatase [Dictyostelium discoideum AX4]
Length=533

 Score =   212 bits (539),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 144/234 (62%), Gaps = 13/234 (6%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             R  VS+ KRRYQ+ G+DLDL YIT+N++AMGFP+          VEG +RN M++V +F 
Sbjct  6     RVAVSKQKRRYQKNGYDLDLAYITDNIVAMGFPSEK--------VEGVFRNPMKDVQRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             + +HKD +KVYNLCSER+YD S F G+V  +PFDDHN P  ++I +FC+   +W+KED +
Sbjct  58    DQYHKDHFKVYNLCSERVYDHSKFYGRVGYYPFDDHNAPQFEMIDAFCRDVDAWMKEDSK  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             N+ V+HCKAG  RTGLMI   L+Y   +   E+S+ +Y   R  + KG+ +PSQIRYV Y
Sbjct  118   NIAVIHCKAGKGRTGLMICCWLMYCGMWKNTEDSLRFYAALRTYNQKGVTIPSQIRYVGY  177

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPS---ITISDHNGVLFSTKKH  1196
             F R +          R   L+   L   P  I  S     IS     +F++K+H
Sbjct  178   FGRSIR--ESIKYVPRNVTLKKIVLRPLPKEINLSEVQFNISVGKNCVFNSKEH  229



>ref|NP_001184205.1| uncharacterized protein LOC100505440 [Xenopus laevis]
 gb|AAI29556.1| Unknown (protein for MGC:160221) [Xenopus laevis]
Length=402

 Score =   208 bits (530),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 122/324 (38%), Positives = 177/324 (55%), Gaps = 50/324 (15%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             +  VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL E+ E
Sbjct  58    DSKHKNHYKIYNLCAERHYDTNKFSCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEN-E  116

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             NV  +HCKAG  RTG+MI + LL+ + FP A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  117   NVAAIHCKAGKGRTGVMICAYLLHRRKFPKAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  176

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYW----IRPSITISDHNGVLFSTKKHPRTKD  1211
             +  +L   N E +P    +         P +      P   +      +F++   P+   
Sbjct  177   YSYLLKN-NLEYRPV-PLLFHKMEFETIPMFSSSTCNPQFIVYQLKVKIFTSTAGPKR--  232

Query  1212  LLPEDY-WFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCWLNTTM  1367
                E Y +F  P+       LP       + GD KV F  +Q         F+ W+NT  
Sbjct  233   --AEKYMYFDFPQ------PLP-------VCGDIKVEFFHKQNKVMKKEKMFHFWVNTFF  277

Query  1368  I----------ENRKILNTSDLDG  1409
             I          EN  ++   +LDG
Sbjct  278   IPGPEEYSEKVENGTLVGEHELDG  301



>gb|AAL99958.1| PteN [Dictyostelium discoideum]
Length=515

 Score =   211 bits (538),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 144/234 (62%), Gaps = 13/234 (6%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             R  VS+ KRRYQ+ G+DLDL YIT+N++AMGFP+          VEG +RN M++V +F 
Sbjct  6     RVAVSKQKRRYQKNGYDLDLAYITDNIVAMGFPSEK--------VEGVFRNPMKDVQRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             + +HKD +KVYNLCSER+YD S F G+V  +PFDDHN P  ++I +FC+   +W+KED +
Sbjct  58    DQYHKDHFKVYNLCSERVYDHSKFYGRVGYYPFDDHNAPQFEMIDAFCRDVDAWMKEDSK  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             N+ V+HCKAG  RTGLMI   L+Y   +   E+S+ +Y   R  + KG+ +PSQIRYV Y
Sbjct  118   NIAVIHCKAGKGRTGLMICCWLMYCGMWKNTEDSLRFYAALRTYNQKGVTIPSQIRYVGY  177

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPS---ITISDHNGVLFSTKKH  1196
             F R +          R   L+   L   P  I  S     IS     +F++K+H
Sbjct  178   FGRSIR--ESIKYVPRNVTLKKIVLRPLPKEINLSEVQFNISVGKNCVFNSKEH  229



>ref|XP_001993525.1| GH13854 [Drosophila grimshawi]
 gb|EDV99450.1| GH13854 [Drosophila grimshawi]
Length=475

 Score =   210 bits (535),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 127/360 (35%), Positives = 186/360 (52%), Gaps = 35/360 (10%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R+VVS+ + RY+E GF+LDL+YI  N+IAMG+PA D        +EG YR
Sbjct  3     NTISIMSNAIRNVVSKKRIRYKEKGFNLDLSYICPNIIAMGYPAPDK-------LEGIYR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N +++V KF E +H+ +YK+YNLC ER YD + F G+VA +PF+DHN P IQL+  FC  
Sbjct  56    NRLDDVYKFLEENHRGRYKIYNLCLERSYDTNKFHGRVAIYPFEDHNPPTIQLMQRFCHD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
               +WL  D  NVV VHCKAG  RTG MI + L++ +   TA+E++ YY++KR +D KG+ 
Sbjct  116   VGTWLNADPLNVVAVHCKAGKGRTGTMICAYLVHSRLMRTADEALAYYDEKRTIDKKGVT  175

Query  1014  LPSQIRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKK  1193
             +PSQ RYV+Y+  ++     +      C +R    +          +ISD         K
Sbjct  176   IPSQRRYVQYYSNLIPDVQYKVISLYVCEIRFTETNILHNLGTVQCSISDMQDSATEKVK  235

Query  1194  HPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQG-DFYC--WLNTT  1364
               R K       W    +K  +   L        +AGD KV    +      C  WLNT+
Sbjct  236   PHRLKT------WTIDFQKSCI---LDISTSPLAVAGDIKVELTQKSSRKMICQFWLNTS  286

Query  1365  MIENRK-------------ILNTSDLDGFDK---RKLPSPGFQVEIVLVDYDTAFPTRPQ  1496
              ++                 LN S++DG  K    K  S  F++ +V  +   +  T+ Q
Sbjct  287   FVQKNSACDTDGPTVKYMYTLNKSEIDGAHKDKDHKSFSEDFKISVVFEEEKRSECTKNQ  346



>ref|XP_002405586.1| TPIP alpha lipid phosphatase, putative [Ixodes scapularis]
 gb|EEC15363.1| TPIP alpha lipid phosphatase, putative [Ixodes scapularis]
Length=363

 Score =   207 bits (526),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 132/190 (69%), Gaps = 8/190 (4%)
 Frame = +3

Query  489   VSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEE  668
             ++ + + VVS+NK+RYQ+  FDLDL+YI +N+IAMGFPA  +        EG +RNH+++
Sbjct  3     MTARLKQVVSKNKKRYQDEDFDLDLSYIRDNIIAMGFPAEKL--------EGVFRNHVDD  54

Query  669   VIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWL  848
             V KF E  H   YK+YNLCSER YD   FE +VA +PF DHN P I LI  FC+    WL
Sbjct  55    VHKFLEKKHGGHYKIYNLCSERQYDAKKFENRVAVYPFKDHNPPKIDLIKPFCEDVERWL  114

Query  849   KEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQI  1028
              E  +NV V+HCKAG  RTG+M+ S L++ K F TA++++++Y++KR  D KG+ +PSQ 
Sbjct  115   SEHPDNVAVIHCKAGKGRTGVMVCSYLVHSKIFSTAKDALSFYSEKRTKDLKGVTIPSQR  174

Query  1029  RYVKYFERIL  1058
             RYV+Y+  ++
Sbjct  175   RYVEYYSELV  184



>ref|XP_002115205.1| hypothetical protein TRIADDRAFT_28654 [Trichoplax adhaerens]
 gb|EDV22661.1| hypothetical protein TRIADDRAFT_28654 [Trichoplax adhaerens]
Length=351

 Score =   206 bits (525),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 107/238 (45%), Positives = 146/238 (61%), Gaps = 16/238 (7%)
 Frame = +3

Query  495   VKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVI  674
             +  +  VS+NKRRY++  FDLDL+YI   +IAMGFP+  +        EG YRNH++EVI
Sbjct  2     LNIKKTVSKNKRRYRDDDFDLDLSYIKPTIIAMGFPSDKL--------EGVYRNHIDEVI  53

Query  675   KFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKE  854
             +FF+T HK  YK+YNLC+ER YD   F  +VA++ F+DHN PP  LI  FC     WLK+
Sbjct  54    RFFDTKHKQHYKIYNLCNERTYDPDRFFNRVATYAFEDHNAPPFALIQPFCDDVDEWLKK  113

Query  855   DIENVVVVHCKAGMA--RTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQI  1028
             D +N+V VHCKAG A  RTG+MIS  LLY  FF    +++N+Y Q R +DAKG+ +PSQ 
Sbjct  114   DEKNIVAVHCKAGKACGRTGVMISCYLLYANFFDDTNDALNFYGQARTLDAKGVTIPSQR  173

Query  1029  RYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYW----IRPSITISDHNGVLFSTK  1190
             RYV+Y+   L +     Q  R  ++ G  +   P        P  T+  HN  L ++K
Sbjct  174   RYVEYYGYSLRHKLIYKQ--RPLLMNGIIIETVPNISNGTCCPFFTVRQHNVKLITSK  229



>ref|XP_003449455.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
1 [Oreochromis niloticus]
Length=411

 Score =   208 bits (530),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 120/312 (38%), Positives = 170/312 (54%), Gaps = 48/312 (15%)
 Frame = +3

Query  486   AVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHME  665
             A  ++ R +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN+++
Sbjct  2     AALIRIRGIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNID  53

Query  666   EVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSW  845
             +V++F ++ HK+ YK+YNLC+ER YD S F  +VA +PF+DHN P ++LI  FC+    W
Sbjct  54    DVVRFLDSKHKNHYKIYNLCAERHYDASKFNCQVAQYPFEDHNPPQLELIKPFCEDLDQW  113

Query  846   LKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQ  1025
             L ED ++V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ
Sbjct  114   LSEDEQHVAAIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTHDKKGVTIPSQ  173

Query  1026  IRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHN----------GV  1175
              RYV Y+  +L     +NQ   + +      HK  +   P  T    N           +
Sbjct  174   RRYVVYYNFLL-----KNQLQYKPV--ALLFHKMLFETIPMFTGGTCNPQFVVYQLKVKI  226

Query  1176  LFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-----  1340
               S   H R +D L             ++F  P    V    GD KV F  +Q       
Sbjct  227   HTSNPTHTRREDKL-------------MLFEFPQPLPV---CGDIKVEFFHKQNKVLKKE  270

Query  1341  --FYCWLNTTMI  1370
               F+ W+NT  I
Sbjct  271   KMFHFWINTFFI  282



>ref|XP_002052397.1| GJ17528 [Drosophila virilis]
 gb|EDW64552.1| GJ17528 [Drosophila virilis]
Length=571

 Score =   213 bits (541),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 134/195 (69%), Gaps = 7/195 (4%)
 Frame = +3

Query  474   NAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYR  653
             N +  +S   R+VVS+ +RRY+E GF+LDL+YI  N+IAMG+PA D+        EG YR
Sbjct  3     NTISIMSNALRNVVSKKRRRYKEKGFNLDLSYICPNIIAMGYPAPDI-------FEGIYR  55

Query  654   NHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQS  833
             N +++V KF E +H D Y++YNLC ER YD++ F  +VA++PF+DHN P I+LI  FC  
Sbjct  56    NRLDDVYKFLEENHGDHYRIYNLCQERSYDINKFHRRVATYPFEDHNPPTIELIQRFCHD  115

Query  834   AYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLV  1013
               SWL  D  NVV VHCKAG  RTG MI + L++ K   TA++++ YY++KR  D KG+ 
Sbjct  116   VDSWLNRDPLNVVAVHCKAGKGRTGTMICAYLVHSKLKKTADDALAYYDEKRTKDRKGVT  175

Query  1014  LPSQIRYVKYFERIL  1058
             +PSQ RYV+Y+  ++
Sbjct  176   IPSQRRYVQYYSNLI  190



>ref|NP_001116943.1| phosphatase and tensin homolog [Xenopus (Silurana) tropicalis]
 gb|AAI61129.1| pten protein [Xenopus (Silurana) tropicalis]
Length=402

 Score =   207 bits (528),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 121/323 (37%), Positives = 176/323 (54%), Gaps = 48/323 (15%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             +  VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL E+ E
Sbjct  58    DSKHKNHYKIYNLCAERHYDTNKFSCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEN-E  116

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             NV  +HCKAG  RTG+MI + LL+   FP A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  117   NVAAIHCKAGKGRTGVMICAYLLHRGKFPRAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  176

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYW----IRPSITISDHNGVLFSTKKHPRTKD  1211
             +  +L   N E +P    +         P +      P   +      +F++   P+  +
Sbjct  177   YSYLLKN-NLEYRPV-PLLFHKIEFETIPMFSGSTCNPQFVVYQLKVKIFTSTAGPKRIE  234

Query  1212  LLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCWLNTTMI  1370
              L    +F  P+       LP       + GD KV F  +Q         F+ W+NT  I
Sbjct  235   KL---MYFDFPQ------PLP-------VCGDIKVEFFHKQNKVMKKEKMFHFWINTFFI  278

Query  1371  ----------ENRKILNTSDLDG  1409
                       EN  ++   +LDG
Sbjct  279   PGPEEYSEKVENGTLVGEQELDG  301



>ref|XP_004565290.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Maylandia zebra]
 ref|XP_005743478.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Pundamilia nyererei]
Length=411

 Score =   207 bits (527),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 120/312 (38%), Positives = 170/312 (54%), Gaps = 48/312 (15%)
 Frame = +3

Query  486   AVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHME  665
             A  ++ R +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN+++
Sbjct  2     AALIRIRGIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNID  53

Query  666   EVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSW  845
             +V++F ++ HK+ YK+YNLC+ER YD S F  +VA +PF+DHN P ++LI  FC+    W
Sbjct  54    DVVRFLDSKHKNHYKIYNLCAERHYDSSKFNCQVAQYPFEDHNPPQLELIKPFCEDLDKW  113

Query  846   LKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQ  1025
             L ED ++V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ
Sbjct  114   LSEDEQHVAAIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTHDKKGVTIPSQ  173

Query  1026  IRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHN----------GV  1175
              RYV Y+  +L     +NQ   + +      HK  +   P  T    N           +
Sbjct  174   RRYVVYYNFLL-----KNQLQYKPV--ALLFHKMLFETIPMFTGGTCNPQFVVYQLKVKI  226

Query  1176  LFSTKKHPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-----  1340
               S   H R +D L             ++F  P    V    GD KV F  +Q       
Sbjct  227   HTSNPGHTRREDKL-------------MLFEFPQPLPV---CGDIKVEFFHKQNKVLKKE  270

Query  1341  --FYCWLNTTMI  1370
               F+ W+NT  I
Sbjct  271   KMFHFWINTFFI  282



>ref|XP_009063523.1| hypothetical protein LOTGIDRAFT_195725, partial [Lottia gigantea]
 gb|ESO85792.1| hypothetical protein LOTGIDRAFT_195725, partial [Lottia gigantea]
Length=337

 Score =   205 bits (521),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 133/187 (71%), Gaps = 8/187 (4%)
 Frame = +3

Query  498   KARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIK  677
             K + +VS+NKRR+Q+ G+DLDLTYI  N+IAMGFPA  +        EG YRN++++V+ 
Sbjct  4     KIKGLVSKNKRRFQDYGYDLDLTYIYPNIIAMGFPAMRL--------EGVYRNNIDDVVG  55

Query  678   FFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKED  857
             F E  H+D YKVYNLCSER YD S F  +VA++PFDDH+ P ++LI  FC+   +WL ED
Sbjct  56    FLEERHRDHYKVYNLCSERKYDASKFWSRVANYPFDDHHPPRLELIKPFCEDLDNWLLED  115

Query  858   IENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYV  1037
              +NV  +HCKAG  RTG+MI + +L+   F T+E+++ YY + R  D KG+ +PSQ RYV
Sbjct  116   EQNVAAIHCKAGKGRTGVMICAYMLHRHKFKTSEQALEYYAKTRTRDHKGVTIPSQRRYV  175

Query  1038  KYFERIL  1058
             KY+E ++
Sbjct  176   KYYEHLV  182



>ref|XP_005743477.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Pundamilia nyererei]
Length=437

 Score =   207 bits (528),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 123/322 (38%), Positives = 176/322 (55%), Gaps = 42/322 (13%)
 Frame = +3

Query  486   AVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHME  665
             A  ++ R +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN+++
Sbjct  2     AALIRIRGIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNID  53

Query  666   EVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSW  845
             +V++F ++ HK+ YK+YNLC+ER YD S F  +VA +PF+DHN P ++LI  FC+    W
Sbjct  54    DVVRFLDSKHKNHYKIYNLCAERHYDSSKFNCQVAQYPFEDHNPPQLELIKPFCEDLDKW  113

Query  846   LKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQ  1025
             L ED ++V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ
Sbjct  114   LSEDEQHVAAIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTHDKKGVTIPSQ  173

Query  1026  IRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSI---TISDHNGV----LFS  1184
              RYV Y+  +L     +NQ   + +      HK  +   P     T S+   V    L +
Sbjct  174   RRYVVYYNFLL-----KNQLQYKPV--ALLFHKMLFETIPMFTGGTCSESRAVSLPSLRA  226

Query  1185  TKKHPRTKDLLPEDYWFSAPKKGVVVF-ALPGE------------PGVAELAGDFKVHFN  1325
             T        +LP D  F   +  V +  + PG             P    + GD KV F 
Sbjct  227   TSVELTGVPVLPADPQFVVYQLKVKIHTSNPGHTRREDKLMLFEFPQPLPVCGDIKVEFF  286

Query  1326  DRQGD-------FYCWLNTTMI  1370
              +Q         F+ W+NT  I
Sbjct  287   HKQNKVLKKEKMFHFWINTFFI  308



>ref|XP_008207909.1| PREDICTED: phosphatase and tensin homolog isoform X2 [Nasonia 
vitripennis]
Length=592

 Score =   211 bits (538),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 124/327 (38%), Positives = 182/327 (56%), Gaps = 32/327 (10%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ ++R+   GF+LDLTYI +N+IAMGFPA  +        EG YRN+++EV +F E+
Sbjct  112   LVSKRRKRFTADGFNLDLTYIKDNLIAMGFPAEKL--------EGVYRNNIDEVARFLES  163

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              H++ Y +YNLCSER YD + F+G+VA++ FDDHN PP++LI  FC+   SWL +  ENV
Sbjct  164   RHRNHYTIYNLCSERSYDHTKFKGRVATYAFDDHNPPPLELIKPFCEDVDSWLLQHDENV  223

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
              VVHCKAG  RTG+M+   LL+ K F TA E++N+Y  +R  D KG+ +PSQ RYV Y+ 
Sbjct  224   SVVHCKAGKGRTGVMVCCYLLHSKQFRTATEALNFYGNERTTDKKGVTIPSQRRYVDYYA  283

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDY  1229
               L+  N   QP    +LR  +L        P    +   G  F   +  + K    E Y
Sbjct  284   -TLVQENLSYQPV-TLILREIKL-------EPISATNGGQGYHFVISE-AKNKIFSSETY  333

Query  1230  WFSAPKKGVVVFALPGEPGVAELAGDFKVHFND------RQGDFYCWLNTTMIENRKILN  1391
                  +KG     +P   GV  + GD +V F +      ++  F+ W NT  +    + +
Sbjct  334   EI---RKGTSTLCIPLNHGVP-IKGDIRVDFYNIPKVKRKEKLFHFWFNTFFVREH-VTS  388

Query  1392  TSDLDG---FDKRKLPSPGFQVEIVLV  1463
              +D +G      R L   G  +E+ +V
Sbjct  389   ENDNEGPVERTTRALSCDGSAMELPMV  415



>ref|XP_004565289.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Maylandia zebra]
Length=437

 Score =   207 bits (528),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 123/322 (38%), Positives = 176/322 (55%), Gaps = 42/322 (13%)
 Frame = +3

Query  486   AVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHME  665
             A  ++ R +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN+++
Sbjct  2     AALIRIRGIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNID  53

Query  666   EVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSW  845
             +V++F ++ HK+ YK+YNLC+ER YD S F  +VA +PF+DHN P ++LI  FC+    W
Sbjct  54    DVVRFLDSKHKNHYKIYNLCAERHYDSSKFNCQVAQYPFEDHNPPQLELIKPFCEDLDKW  113

Query  846   LKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQ  1025
             L ED ++V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ
Sbjct  114   LSEDEQHVAAIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTHDKKGVTIPSQ  173

Query  1026  IRYVKYFERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSI---TISDHNGV----LFS  1184
              RYV Y+  +L     +NQ   + +      HK  +   P     T S+   V    L +
Sbjct  174   RRYVVYYNFLL-----KNQLQYKPV--ALLFHKMLFETIPMFTGGTCSESRAVSLLSLRA  226

Query  1185  TKKHPRTKDLLPEDYWFSAPKKGVVVF-ALPGE------------PGVAELAGDFKVHFN  1325
             T        +LP D  F   +  V +  + PG             P    + GD KV F 
Sbjct  227   TSVELTGVPVLPADPQFVVYQLKVKIHTSNPGHTRREDKLMLFEFPQPLPVCGDIKVEFF  286

Query  1326  DRQGD-------FYCWLNTTMI  1370
              +Q         F+ W+NT  I
Sbjct  287   HKQNKVLKKEKMFHFWINTFFI  308



>gb|EPZ34584.1| Protein-tyrosine phosphatase domain-containing protein [Rozella 
allomycis CSF55]
Length=319

 Score =   204 bits (518),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 130/185 (70%), Gaps = 8/185 (4%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             R +VS+ KRRY   GFDLDLTYITE +IAMGFP+ ++        EG YRN M +V++F 
Sbjct  6     RRLVSKKKRRYNLDGFDLDLTYITERIIAMGFPSDNL--------EGVYRNKMADVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ H DKYKVYNLCSER YD S F  +V+S+PFDDHN P + L+++FC+    WL ++ +
Sbjct  58    DSRHPDKYKVYNLCSERNYDTSNFNNRVSSYPFDDHNAPTMNLVINFCRDVDEWLMKNPK  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             NVVV+HCKAG  RTG+MI S L++     + EES+ +Y   R  ++KG+ +PSQ RYV Y
Sbjct  118   NVVVIHCKAGKGRTGVMICSYLIHSGICKSFEESLEFYGVARTQNSKGVTIPSQKRYVMY  177

Query  1044  FERIL  1058
             ++ ++
Sbjct  178   YDLLI  182



>ref|XP_008207907.1| PREDICTED: phosphatase and tensin homolog isoform X1 [Nasonia 
vitripennis]
 ref|XP_008207908.1| PREDICTED: phosphatase and tensin homolog isoform X1 [Nasonia 
vitripennis]
Length=593

 Score =   211 bits (538),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 124/327 (38%), Positives = 182/327 (56%), Gaps = 32/327 (10%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ ++R+   GF+LDLTYI +N+IAMGFPA  +        EG YRN+++EV +F E+
Sbjct  113   LVSKRRKRFTADGFNLDLTYIKDNLIAMGFPAEKL--------EGVYRNNIDEVARFLES  164

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              H++ Y +YNLCSER YD + F+G+VA++ FDDHN PP++LI  FC+   SWL +  ENV
Sbjct  165   RHRNHYTIYNLCSERSYDHTKFKGRVATYAFDDHNPPPLELIKPFCEDVDSWLLQHDENV  224

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
              VVHCKAG  RTG+M+   LL+ K F TA E++N+Y  +R  D KG+ +PSQ RYV Y+ 
Sbjct  225   SVVHCKAGKGRTGVMVCCYLLHSKQFRTATEALNFYGNERTTDKKGVTIPSQRRYVDYYA  284

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDY  1229
               L+  N   QP    +LR  +L        P    +   G  F   +  + K    E Y
Sbjct  285   -TLVQENLSYQPV-TLILREIKL-------EPISATNGGQGYHFVISE-AKNKIFSSETY  334

Query  1230  WFSAPKKGVVVFALPGEPGVAELAGDFKVHFND------RQGDFYCWLNTTMIENRKILN  1391
                  +KG     +P   GV  + GD +V F +      ++  F+ W NT  +    + +
Sbjct  335   EI---RKGTSTLCIPLNHGVP-IKGDIRVDFYNIPKVKRKEKLFHFWFNTFFVREH-VTS  389

Query  1392  TSDLDG---FDKRKLPSPGFQVEIVLV  1463
              +D +G      R L   G  +E+ +V
Sbjct  390   ENDNEGPVERTTRALSCDGSAMELPMV  416



>ref|XP_008302817.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Stegastes 
partitus]
Length=291

 Score =   202 bits (515),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 130/185 (70%), Gaps = 8/185 (4%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  7     KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  58

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD S F  +VA +PF+DHN P ++LI  FC+    WL ED +
Sbjct  59    DSKHKNHYKIYNLCAERHYDTSKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDEQ  118

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  119   HVAAIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVVY  178

Query  1044  FERIL  1058
             +  +L
Sbjct  179   YSFLL  183



>dbj|GAM16849.1| hypothetical protein SAMD00019534_000240, partial [Acytostelium 
subglobosum LB1]
Length=481

 Score =   208 bits (530),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 137/230 (60%), Gaps = 13/230 (6%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             R  VS+ KRRYQ+ GFDLDL YITE +IAMGFP+  M        EG +RN M+EV +F 
Sbjct  6     RLAVSKQKRRYQKDGFDLDLAYITERIIAMGFPSEKM--------EGVFRNPMKEVQRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ET HKD Y+VYNLCSER YD   F G+VA +PFDDHN P   LI  FC+   +W+    +
Sbjct  58    ETKHKDHYRVYNLCSERDYDHGKFHGRVACYPFDDHNAPEFTLIEEFCKDVDNWMSRSEK  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             N+ V+HCKAG  RTGLMI   LLY + +   E S+ +Y   R  + KG+ +PSQIRYV Y
Sbjct  118   NIAVIHCKAGKGRTGLMICCWLLYCRMWTDTESSLKFYAALRTYNQKGVTIPSQIRYVHY  177

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKK  1193
             F R +   +G +Q  R   L    L   P      I +SD N  +   KK
Sbjct  178   FGRFVQA-SGNHQLHRPLTLGKIVLKPLP----NEINLSDINFNICLLKK  222



>gb|EFN66467.1| Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity 
protein phosphatase PTEN [Camponotus floridanus]
Length=597

 Score =   211 bits (536),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 119/304 (39%), Positives = 167/304 (55%), Gaps = 40/304 (13%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             R  VS+ ++R+   GF+LDLTYI  N+IAMGFPA  +        EG YRNH+++V+K  
Sbjct  107   RGFVSKQRKRFIADGFNLDLTYIKNNLIAMGFPAEKL--------EGVYRNHIDDVVKLL  158

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             E+ HKD YK+YNLCSER YD + F+ +VA++ FDDHN P ++ I  FC+  + WL +  +
Sbjct  159   ESKHKDHYKIYNLCSERSYDCNKFKQRVATYAFDDHNPPKLEQIKPFCEDVHLWLSQHKD  218

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             NV VVHCKAG  RTG+M+S  LL+ K F  A E++N+Y   R  D KG+ +PSQIRYV Y
Sbjct  219   NVAVVHCKAGKGRTGVMVSCYLLHSKQFLNATEALNFYGNIRTHDKKGVTIPSQIRYVDY  278

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYW------IRPSITISDHNGVLFSTKKHPRT  1205
             +  I+    G N      +LR  +L   P +      +R    IS+ N  +FS     R 
Sbjct  279   YATIVR--EGLNYQPVTLILRKIQLDPAPIFNGGQACLR--YIISESNKRIFSGVYEVR-  333

Query  1206  KDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDR------QGDFYCWLNTTM  1367
                           KG     +  +  VA L GD +V F +R      +  F+ W NT  
Sbjct  334   --------------KGTPSICISLQHSVA-LTGDIRVEFFNRPKVKPKEKMFHFWFNTFF  378

Query  1368  IENR  1379
             +  +
Sbjct  379   VREK  382



>ref|XP_006009982.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Latimeria 
chalumnae]
Length=404

 Score =   206 bits (523),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 120/321 (37%), Positives = 175/321 (55%), Gaps = 42/321 (13%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL ED  
Sbjct  58    DSKHKNHYKIYNLCAERHYDATKFNCRVAQYPFEDHNPPQLELIKPFCEDLDKWLSEDDN  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAIHCKAGKGRTGVMICAYLLHRSKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  177

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG--VLFSTKKHPRTKDLL  1217
             +  +L +   + +P           HK  +   P  +    N   V++  K    T  L 
Sbjct  178   YSYLLKH-QLDYKPV------ALLFHKLAFETIPMFSGGTCNPLFVVYQLKVKIYTSPLG  230

Query  1218  PEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCWLNTTMI--  1370
             P     +  ++  + F  P    V    GD KV F  +Q         F+ W+NT  I  
Sbjct  231   P-----TRREEKYMHFEFPQPLPV---CGDIKVEFFHKQNKMMKKEKMFHFWINTFFIPG  282

Query  1371  --------ENRKILNTSDLDG  1409
                     EN  ++   +LDG
Sbjct  283   PEENSDKVENGSVVGEKELDG  303



>ref|XP_008207911.1| PREDICTED: phosphatase and tensin homolog isoform X4 [Nasonia 
vitripennis]
Length=542

 Score =   209 bits (532),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 124/327 (38%), Positives = 182/327 (56%), Gaps = 32/327 (10%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ ++R+   GF+LDLTYI +N+IAMGFPA  +        EG YRN+++EV +F E+
Sbjct  113   LVSKRRKRFTADGFNLDLTYIKDNLIAMGFPAEKL--------EGVYRNNIDEVARFLES  164

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              H++ Y +YNLCSER YD + F+G+VA++ FDDHN PP++LI  FC+   SWL +  ENV
Sbjct  165   RHRNHYTIYNLCSERSYDHTKFKGRVATYAFDDHNPPPLELIKPFCEDVDSWLLQHDENV  224

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
              VVHCKAG  RTG+M+   LL+ K F TA E++N+Y  +R  D KG+ +PSQ RYV Y+ 
Sbjct  225   SVVHCKAGKGRTGVMVCCYLLHSKQFRTATEALNFYGNERTTDKKGVTIPSQRRYVDYYA  284

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDY  1229
               L+  N   QP    +LR  +L        P    +   G  F   +  + K    E Y
Sbjct  285   -TLVQENLSYQPV-TLILREIKL-------EPISATNGGQGYHFVISE-AKNKIFSSETY  334

Query  1230  WFSAPKKGVVVFALPGEPGVAELAGDFKVHFND------RQGDFYCWLNTTMIENRKILN  1391
                  +KG     +P   GV  + GD +V F +      ++  F+ W NT  +    + +
Sbjct  335   EI---RKGTSTLCIPLNHGVP-IKGDIRVDFYNIPKVKRKEKLFHFWFNTFFVREH-VTS  389

Query  1392  TSDLDG---FDKRKLPSPGFQVEIVLV  1463
              +D +G      R L   G  +E+ +V
Sbjct  390   ENDNEGPVERTTRALSCDGSAMELPMV  416



>ref|XP_003964007.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
1 [Takifugu rubripes]
Length=412

 Score =   205 bits (522),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 123/334 (37%), Positives = 182/334 (54%), Gaps = 53/334 (16%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL ED  
Sbjct  58    DSKHKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDN  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAIHCKAGKGRTGVMICAYLLHRGKFLDAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  177

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHN----------GVLFSTKK  1193
             +  +L     +NQ   + +      HK  +   P  +    N           +  S   
Sbjct  178   YNYLL-----KNQLEYKPV--ALLFHKMVFETLPMFSGGTCNPQFVVYQLKVKIHTSNPS  230

Query  1194  HPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCW  1352
             H R +D   +  +F  P+       LP       + GD KV F  +Q         F+ W
Sbjct  231   HTRRED---KHMFFEFPQ------PLP-------VCGDIKVEFFHKQNKMMKKDKMFHFW  274

Query  1353  LNTTMI----ENRKILNTSDLDGFDKRK-LPSPG  1439
             +NT  I    E+R  L    ++  D ++ +P+PG
Sbjct  275   VNTFFIPGPEESRDKLENGAVNNADSQQGVPAPG  308



>ref|XP_005406534.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Chinchilla 
lanigera]
Length=333

 Score =   203 bits (516),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 131/185 (71%), Gaps = 8/185 (4%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NK+RYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++ +V++F 
Sbjct  6     KEMVSKNKKRYQEDGFDLDLTYIYPNIIAMGFPAEKL--------EGIYRNNIVDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK++YK+YNLC+ER YD + F GKVA +PF+DHN P ++LI +FC+    WL ED  
Sbjct  58    DSKHKNQYKIYNLCAERHYDPAKFNGKVARYPFEDHNPPQLELIKAFCEDLDQWLSEDDN  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  VHCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAVHCKAGKGRTGVMICAYLLHRGKFLRAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  177

Query  1044  FERIL  1058
             +  +L
Sbjct  178   YSYLL  182



>gb|AAL08419.1| PTEN [Takifugu rubripes]
Length=412

 Score =   205 bits (522),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 123/334 (37%), Positives = 182/334 (54%), Gaps = 53/334 (16%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL ED  
Sbjct  58    DSKHKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDN  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAIHCKAGKGRTGVMICAYLLHRGKFLDAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  177

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHN----------GVLFSTKK  1193
             +  +L     +NQ   + +      HK  +   P  +    N           +  S   
Sbjct  178   YNYLL-----KNQLEYKPV--ALLFHKMVFETLPMFSGGTCNPQFVVYQLKVKIHTSNPS  230

Query  1194  HPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCW  1352
             H R +D   +  +F  P+       LP       + GD KV F  +Q         F+ W
Sbjct  231   HTRRED---KHMFFEFPQ------PLP-------VCGDIKVEFFHKQNKMMKKDKMFHFW  274

Query  1353  LNTTMI----ENRKILNTSDLDGFDKRK-LPSPG  1439
             +NT  I    E+R  L    ++  D ++ +P+PG
Sbjct  275   VNTFFIPGPEESRDKLENGAVNNADSQQGVPAPG  308



>ref|XP_008207910.1| PREDICTED: phosphatase and tensin homolog isoform X3 [Nasonia 
vitripennis]
Length=543

 Score =   209 bits (531),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 124/327 (38%), Positives = 182/327 (56%), Gaps = 32/327 (10%)
 Frame = +3

Query  510   VVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFET  689
             +VS+ ++R+   GF+LDLTYI +N+IAMGFPA  +        EG YRN+++EV +F E+
Sbjct  113   LVSKRRKRFTADGFNLDLTYIKDNLIAMGFPAEKL--------EGVYRNNIDEVARFLES  164

Query  690   HHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENV  869
              H++ Y +YNLCSER YD + F+G+VA++ FDDHN PP++LI  FC+   SWL +  ENV
Sbjct  165   RHRNHYTIYNLCSERSYDHTKFKGRVATYAFDDHNPPPLELIKPFCEDVDSWLLQHDENV  224

Query  870   VVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFE  1049
              VVHCKAG  RTG+M+   LL+ K F TA E++N+Y  +R  D KG+ +PSQ RYV Y+ 
Sbjct  225   SVVHCKAGKGRTGVMVCCYLLHSKQFRTATEALNFYGNERTTDKKGVTIPSQRRYVDYYA  284

Query  1050  RILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPEDY  1229
               L+  N   QP    +LR  +L        P    +   G  F   +  + K    E Y
Sbjct  285   -TLVQENLSYQPV-TLILREIKL-------EPISATNGGQGYHFVISE-AKNKIFSSETY  334

Query  1230  WFSAPKKGVVVFALPGEPGVAELAGDFKVHFND------RQGDFYCWLNTTMIENRKILN  1391
                  +KG     +P   GV  + GD +V F +      ++  F+ W NT  +    + +
Sbjct  335   EI---RKGTSTLCIPLNHGVP-IKGDIRVDFYNIPKVKRKEKLFHFWFNTFFVREH-VTS  389

Query  1392  TSDLDG---FDKRKLPSPGFQVEIVLV  1463
              +D +G      R L   G  +E+ +V
Sbjct  390   ENDNEGPVERTTRALSCDGSAMELPMV  416



>ref|XP_005810521.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like [Xiphophorus 
maculatus]
Length=412

 Score =   205 bits (521),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/296 (39%), Positives = 165/296 (56%), Gaps = 28/296 (9%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  7     KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  58

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD S F  +VA +PF+DHN P ++LI  FC+    WL ED  
Sbjct  59    DSKHKNHYKIYNLCAERHYDTSKFSCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDEH  118

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  119   HVAAIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVIY  178

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPE  1223
             +  +L      N+   R +      HK  +   P  T    N      +   +     P 
Sbjct  179   YNFLL-----RNRLHYRPV--ALLFHKMLFETIPMFTAGTCNPHFVVYQLKVKIHTYNPA  231

Query  1224  DYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCWLNTTMI  1370
                ++  +  +++F  P    V    GD KV F  +Q         F+ W+NT  I
Sbjct  232   ---YTRREDKLMLFEFPQPLPV---CGDIKVEFFHKQNKMMKKEKMFHFWINTFFI  281



>emb|CDQ60841.1| unnamed protein product [Oncorhynchus mykiss]
Length=465

 Score =   206 bits (524),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 137/204 (67%), Gaps = 11/204 (5%)
 Frame = +3

Query  447   TKGLVDSSKNAVKAVSVKARHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGF  626
             TK L D  K     ++ K + +VS+NKRR+QE GFDLDLTYI  N+IAMGFPA  +    
Sbjct  11    TKELADYKK---PTMASKIKLMVSRNKRRFQEDGFDLDLTYIYPNIIAMGFPAERL----  63

Query  627   FGYVEGFYRNHMEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPI  806
                 EG YRN+++EV++F ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P +
Sbjct  64    ----EGVYRNNIDEVVRFLDSKHKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQL  119

Query  807   QLIMSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQK  986
             +LI  FC+    WL ED  +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + 
Sbjct  120   ELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFQDAQEALDFYGEV  179

Query  987   RCMDAKGLVLPSQIRYVKYFERIL  1058
             R  D KG+ +PSQ RYV Y+  +L
Sbjct  180   RTRDKKGVTIPSQRRYVYYYSHLL  203



>ref|XP_005743479.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X3 [Pundamilia nyererei]
Length=409

 Score =   204 bits (520),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 119/306 (39%), Positives = 167/306 (55%), Gaps = 48/306 (16%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             R +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     RGIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD S F  +VA +PF+DHN P ++LI  FC+    WL ED +
Sbjct  58    DSKHKNHYKIYNLCAERHYDSSKFNCQVAQYPFEDHNPPQLELIKPFCEDLDKWLSEDEQ  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTHDKKGVTIPSQRRYVVY  177

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHN----------GVLFSTKK  1193
             +  +L     +NQ   + +      HK  +   P  T    N           +  S   
Sbjct  178   YNFLL-----KNQLQYKPV--ALLFHKMLFETIPMFTGGTCNPQFVVYQLKVKIHTSNPG  230

Query  1194  HPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCW  1352
             H R +D L             ++F  P    V    GD KV F  +Q         F+ W
Sbjct  231   HTRREDKL-------------MLFEFPQPLPV---CGDIKVEFFHKQNKVLKKEKMFHFW  274

Query  1353  LNTTMI  1370
             +NT  I
Sbjct  275   INTFFI  280



>ref|XP_010750896.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Larimichthys 
crocea]
Length=414

 Score =   204 bits (520),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/306 (38%), Positives = 167/306 (55%), Gaps = 48/306 (16%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  7     KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  58

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL ED +
Sbjct  59    DSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDKWLSEDEQ  118

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  119   HVAAIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVIY  178

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHN----------GVLFSTKK  1193
             +  +L      NQ   + +      HK  +   P  T    N           +  S+  
Sbjct  179   YSFLL-----RNQLLYKPV--ALLFHKMLFETIPMFTGGTCNPQFVVYQLKVKIHTSSSA  231

Query  1194  HPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCW  1352
             H R +D L             ++F  P    V    GD KV F  +Q         F+ W
Sbjct  232   HTRREDKL-------------MLFEFPQPLPV---CGDIKVEFFHKQNKMMKKEKMFHFW  275

Query  1353  LNTTMI  1370
             +NT  I
Sbjct  276   VNTFFI  281



>ref|XP_010868420.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X2 [Esox lucius]
Length=415

 Score =   204 bits (520),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 129/185 (70%), Gaps = 8/185 (4%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HKD YK+YNLC+ER YD + F  +VA FPF+DHN P ++LI  FC+    WL +D  
Sbjct  58    DSKHKDHYKIYNLCAERHYDAAKFNCRVAQFPFEDHNPPQLELIKPFCEDLDQWLSKDDN  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  177

Query  1044  FERIL  1058
             +  +L
Sbjct  178   YSHLL  182



>ref|XP_003224419.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Anolis carolinensis]
Length=404

 Score =   204 bits (519),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/323 (36%), Positives = 173/323 (54%), Gaps = 46/323 (14%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL ED  
Sbjct  58    DSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDRWLSEDGN  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAIHCKAGKGRTGVMICAYLLHRGRFHKAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  177

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYW----IRPSITISDHNGVLFSTKKHPRTKD  1211
             +  +L   N  +      +         P +      P   +      +F++   P  ++
Sbjct  178   YSYLLK--NHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVYQLKVKIFTSTSGPTRRE  235

Query  1212  LLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCWLNTTMI  1370
                +  +F  P+       LP       + GD KV F  +Q         F+ W+NT  I
Sbjct  236   --DKYMYFEFPQ------PLP-------VCGDIKVEFFHKQNKMLKKEKMFHFWVNTFFI  280

Query  1371  ----------ENRKILNTSDLDG  1409
                       EN  +L   +LDG
Sbjct  281   PGLEENSDKVENGSLLGDPELDG  303



>ref|XP_010868419.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
X1 [Esox lucius]
Length=438

 Score =   204 bits (520),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 129/185 (70%), Gaps = 8/185 (4%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HKD YK+YNLC+ER YD + F  +VA FPF+DHN P ++LI  FC+    WL +D  
Sbjct  58    DSKHKDHYKIYNLCAERHYDAAKFNCRVAQFPFEDHNPPQLELIKPFCEDLDQWLSKDDN  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  177

Query  1044  FERIL  1058
             +  +L
Sbjct  178   YSHLL  182



>ref|XP_010564236.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Haliaeetus leucocephalus]
Length=328

 Score =   201 bits (512),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 129/185 (70%), Gaps = 8/185 (4%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL ED  
Sbjct  58    DSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDN  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  177

Query  1044  FERIL  1058
             +  +L
Sbjct  178   YSYLL  182



>ref|XP_008320667.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X2 
[Cynoglossus semilaevis]
Length=422

 Score =   204 bits (519),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 130/185 (70%), Gaps = 8/185 (4%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL ED  
Sbjct  58    DSKHKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDN  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+ + F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAIHCKAGKGRTGVMICAYLLHRRKFMEAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  177

Query  1044  FERIL  1058
             +  +L
Sbjct  178   YSHLL  182



>ref|XP_009492856.1| hypothetical protein H696_00701 [Fonticula alba]
 gb|KCV73155.1| hypothetical protein H696_00701 [Fonticula alba]
Length=656

 Score =   209 bits (533),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 131/193 (68%), Gaps = 11/193 (6%)
 Frame = +3

Query  489   VSVKARHVVSQNKRRY---QEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNH  659
             +S  AR +VS+ KRR+    +GGFDLDLTY+T N+IAMGFP    S  F    EG YRN 
Sbjct  1     MSTFARKLVSKKKRRFVTKDDGGFDLDLTYVTPNIIAMGFP----SESF----EGVYRNP  52

Query  660   MEEVIKFFETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAY  839
             M  V++F ++ H ++Y+VYNLCSER YD S F G+VA FPFDDHN P + LI +FC+ A 
Sbjct  53    MSSVVRFLDSRHPERYRVYNLCSERCYDPSKFYGRVARFPFDDHNAPMLSLIPAFCEDAA  112

Query  840   SWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLP  1019
             SWL +  +NV+ VHCKAG  RTG+MI + LLY + +  A E++ +Y   R  + KG+ +P
Sbjct  113   SWLSQHPDNVIAVHCKAGKGRTGVMICAYLLYSRQWQVAAEALAFYGAARTENGKGVTIP  172

Query  1020  SQIRYVKYFERIL  1058
             SQ RY+ YF  +L
Sbjct  173   SQQRYIDYFAMML  185



>ref|XP_007071643.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Chelonia 
mydas]
Length=402

 Score =   203 bits (517),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 118/323 (37%), Positives = 173/323 (54%), Gaps = 47/323 (15%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPADRL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL ED  
Sbjct  58    DSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDN  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  177

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYW----IRPSITISDHNGVLFSTKKH-PRTK  1208
             +  +L   N  +      +         P +      P   +      +F++    PR +
Sbjct  178   YSYLLK--NHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVYQLKVKIFTSPSGPPRRE  235

Query  1209  DLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCWLNTTM  1367
             D      +F  P+       LP       + GD KV F  +Q         F+ W+NT  
Sbjct  236   DKY---MYFEFPQ------PLP-------VCGDIKVEFFHKQNKMLKKEKMFHFWVNTFF  279

Query  1368  I---------ENRKILNTSDLDG  1409
             I         EN  ++   +LDG
Sbjct  280   IGLDENSDKVENGSLVGDQELDG  302



>ref|XP_005292555.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Chrysemys 
picta bellii]
Length=402

 Score =   203 bits (517),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 118/323 (37%), Positives = 173/323 (54%), Gaps = 47/323 (15%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPADRL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL ED  
Sbjct  58    DSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDN  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  177

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYW----IRPSITISDHNGVLFSTKKH-PRTK  1208
             +  +L   N  +      +         P +      P   +      +F++    PR +
Sbjct  178   YSYLLK--NHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVYQLKVKIFTSPSGPPRRE  235

Query  1209  DLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCWLNTTM  1367
             D      +F  P+       LP       + GD KV F  +Q         F+ W+NT  
Sbjct  236   DKY---MYFEFPQ------PLP-------VCGDIKVEFFHKQNKMLKKDKMFHFWVNTFF  279

Query  1368  I---------ENRKILNTSDLDG  1409
             I         EN  ++   +LDG
Sbjct  280   IGLDENSDKVENGSLVGDQELDG  302



>ref|XP_004086824.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like isoform 
1 [Oryzias latipes]
Length=404

 Score =   203 bits (517),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 115/306 (38%), Positives = 169/306 (55%), Gaps = 48/306 (16%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRR+QE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  7     KEIVSRNKRRFQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  58

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL E+  
Sbjct  59    DSKHKNHYKIYNLCAERHYDTTKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSENEH  118

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  119   HVAAIHCKAGKGRTGVMICAYLLHRGKFREAQEALDFYGEVRTRDKKGVTIPSQRRYVVY  178

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNG--VLFSTK--------K  1193
             +  +L     +N+   + +      HK  +   P  T+   N   V++  K         
Sbjct  179   YNYLL-----KNRLQYKPV--ALLFHKMMFETVPMFTVGTCNPQFVVYQLKVKIHTSNPA  231

Query  1194  HPRTKDLLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCW  1352
             H R +D L             ++F  P    V    GD KV F  +Q         F+ W
Sbjct  232   HTRREDKL-------------LLFEFPQPLPV---CGDIKVEFFHKQNKVMKKEKMFHFW  275

Query  1353  LNTTMI  1370
             +NT  I
Sbjct  276   INTFFI  281



>ref|XP_008320666.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN isoform X1 
[Cynoglossus semilaevis]
Length=445

 Score =   204 bits (520),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 130/185 (70%), Gaps = 8/185 (4%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL ED  
Sbjct  58    DSKHKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDN  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+ + F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAIHCKAGKGRTGVMICAYLLHRRKFMEAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  177

Query  1044  FERIL  1058
             +  +L
Sbjct  178   YSHLL  182



>ref|XP_008436305.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Poecilia 
reticulata]
 ref|XP_008436306.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Poecilia 
reticulata]
Length=412

 Score =   203 bits (517),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 163/296 (55%), Gaps = 28/296 (9%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  7     KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  58

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD S F  +VA +PF+DHN P ++LI  FC+    WL ED  
Sbjct  59    DSKHKNHYKIYNLCAERHYDTSKFSCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDEH  118

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  119   HVAAIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVIY  178

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPE  1223
             +   L+      +P           HK  +   P  T    N      +   +     P 
Sbjct  179   YN-FLLRNRLHYKPV------ALLFHKMLFETIPMFTAGTCNPHFVVYQLKVKIHTYNPA  231

Query  1224  DYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCWLNTTMI  1370
                ++  +  +++F  P    V    GD KV F  +Q         F+ W+NT  I
Sbjct  232   ---YTRREDKLMLFEFPQPLPV---CGDIKVEFFHKQNKMMKKEKMFHFWINTFFI  281



>gb|AAH93110.1| Ptenb protein, partial [Danio rerio]
Length=289

 Score =   199 bits (507),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 129/182 (71%), Gaps = 8/182 (4%)
 Frame = +3

Query  513   VSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETH  692
             VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F ++ 
Sbjct  9     VSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFLDSK  60

Query  693   HKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIENVV  872
             HKD YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+ +  WL E+  +V 
Sbjct  61    HKDHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDSDKWLSENDNHVA  120

Query  873   VVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKYFER  1052
              +HCKAG  RTG+MI + LL+   F  A+E++++Y++ R  D KG+ +PSQ RYV Y+  
Sbjct  121   AIHCKAGKGRTGVMICAYLLHRGKFKKAQEALDFYDEVRTRDKKGVTIPSQRRYVYYYSY  180

Query  1053  IL  1058
             +L
Sbjct  181   LL  182



>ref|XP_006273492.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Alligator 
mississippiensis]
Length=403

 Score =   203 bits (517),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 116/322 (36%), Positives = 173/322 (54%), Gaps = 45/322 (14%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL ED  
Sbjct  58    DSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDN  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  177

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYW----IRPSITISDHNGVLFSTKKHPRTKD  1211
             +  +L   N  +      +         P +      P   +      +F++   P  ++
Sbjct  178   YSYLLK--NHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVYQLKVKIFTSPSGPSRRE  235

Query  1212  LLPEDYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCWLNTTMI  1370
                +  +F  P+       LP       + GD KV F  +Q         F+ W+NT  I
Sbjct  236   --DKYMYFEFPQ------PLP-------VCGDIKVEFFHKQNKMLKKXKMFHFWVNTFFI  280

Query  1371  ---------ENRKILNTSDLDG  1409
                      EN  ++   +LDG
Sbjct  281   GLDENLDKVENGSLVGDQELDG  302



>ref|XP_007541048.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN [Poecilia 
formosa]
Length=412

 Score =   203 bits (517),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 163/296 (55%), Gaps = 28/296 (9%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  7     KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  58

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD S F  +VA +PF+DHN P ++LI  FC+    WL ED  
Sbjct  59    DSKHKNHYKIYNLCAERHYDTSKFSCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDEH  118

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  119   HVAAIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVIY  178

Query  1044  FERILMYFNGENQPARRCMLRGFRLHKCPYWIRPSITISDHNGVLFSTKKHPRTKDLLPE  1223
             +   L+      +P           HK  +   P  T    N      +   +     P 
Sbjct  179   YN-FLLRNRLHYKPV------ALLFHKMLFETIPMFTAGTCNPHFVVYQLKVKIHTYNPA  231

Query  1224  DYWFSAPKKGVVVFALPGEPGVAELAGDFKVHFNDRQGD-------FYCWLNTTMI  1370
                ++  +  +++F  P    V    GD KV F  +Q         F+ W+NT  I
Sbjct  232   ---YTRREDKLMLFEFPQPLPV---CGDIKVEFFHKQNKMMKKEKMFHFWINTFFI  281



>ref|XP_007433696.1| PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase 
and dual-specificity protein phosphatase PTEN-like, partial 
[Python bivittatus]
Length=266

 Score =   199 bits (505),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 129/185 (70%), Gaps = 8/185 (4%)
 Frame = +3

Query  504   RHVVSQNKRRYQEGGFDLDLTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFF  683
             + +VS+NKRRYQE GFDLDLTYI  N+IAMGFPA  +        EG YRN++++V++F 
Sbjct  6     KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFL  57

Query  684   ETHHKDKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIQLIMSFCQSAYSWLKEDIE  863
             ++ HK+ YK+YNLC+ER YD + F  +VA +PF+DHN P ++LI  FC+    WL ED  
Sbjct  58    DSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDRWLSEDGN  117

Query  864   NVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESINYYNQKRCMDAKGLVLPSQIRYVKY  1043
             +V  +HCKAG  RTG+MI + LL+   F  A+E++++Y + R  D KG+ +PSQ RYV Y
Sbjct  118   HVAAIHCKAGKGRTGVMICAYLLHRGRFQKAQEALDFYGEVRTRDKKGVTIPSQRRYVYY  177

Query  1044  FERIL  1058
             +  +L
Sbjct  178   YSYLL  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8460059161422