BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23970_g1_i1 len=1906 path=[1884:0-342 2227:343-356 2241:357-396
2281:397-481 2366:482-608 2493:609-618 2503:619-662 2547:663-724
2609:725-1905]

Length=1906
                                                                      Score     E

ref|XP_009603325.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    783   0.0      
ref|XP_009760346.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    777   0.0      
ref|XP_009401015.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    769   0.0      
ref|XP_009603535.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    768   0.0      
ref|XP_009793131.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    766   0.0      
ref|XP_010912224.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    763   0.0      
gb|KDP45030.1|  hypothetical protein JCGZ_01530                         761   0.0      
ref|XP_002283672.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    759   0.0      Vitis vinifera
ref|XP_008804385.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    758   0.0      
ref|XP_011094427.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    756   0.0      
ref|XP_002315357.1|  4-mannan synthase family protein                   756   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009404378.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    755   0.0      
ref|XP_004239715.2|  PREDICTED: glucomannan 4-beta-mannosyltransf...    754   0.0      
ref|XP_010050059.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    754   0.0      
ref|XP_009771587.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    754   0.0      
ref|XP_009421122.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    754   0.0      
gb|KDP42759.1|  hypothetical protein JCGZ_23699                         753   0.0      
ref|XP_007010197.1|  Nucleotide-diphospho-sugar transferases supe...    753   0.0      
ref|XP_008232025.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    752   0.0      
ref|XP_007220072.1|  hypothetical protein PRUPE_ppa024741mg             751   0.0      
gb|EYU41550.1|  hypothetical protein MIMGU_mgv1a004346mg                752   0.0      
emb|CBI30236.3|  unnamed protein product                                752   0.0      
ref|XP_006341174.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    751   0.0      
gb|KEH24115.1|  cellulose synthase-like protein A1                      751   0.0      
ref|XP_009793130.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    752   0.0      
ref|XP_008456578.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    750   0.0      
ref|XP_008359466.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    751   0.0      
ref|XP_002269110.2|  PREDICTED: glucomannan 4-beta-mannosyltransf...    750   0.0      Vitis vinifera
ref|XP_003554414.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    751   0.0      
emb|CDP15350.1|  unnamed protein product                                750   0.0      
ref|XP_003521436.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    750   0.0      
ref|XP_007219015.1|  hypothetical protein PRUPE_ppa004315mg             749   0.0      
ref|XP_009623019.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    749   0.0      
ref|XP_004494136.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    749   0.0      
ref|XP_009365313.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    749   0.0      
ref|XP_006492171.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    749   0.0      
gb|KDO40534.1|  hypothetical protein CISIN_1g009761mg                   749   0.0      
ref|XP_007027600.1|  Nucleotide-diphospho-sugar transferases supe...    749   0.0      
ref|XP_009774056.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    748   0.0      
gb|KCW89261.1|  hypothetical protein EUGRSUZ_A01558                     748   0.0      
ref|XP_006360487.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    747   0.0      
ref|XP_006851749.1|  hypothetical protein AMTR_s00040p00223350          747   0.0      
ref|XP_003556282.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    747   0.0      
ref|XP_003535494.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    747   0.0      
ref|XP_009601859.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    746   0.0      
gb|ABG34547.1|  cellulose synthase-like A1                              746   0.0      Pinus taeda
ref|XP_007143832.1|  hypothetical protein PHAVU_007G105400g             746   0.0      
ref|XP_004249461.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    746   0.0      
gb|AGE09561.1|  CSLA9-like protein                                      745   0.0      
ref|XP_007162846.1|  hypothetical protein PHAVU_001G185800g             745   0.0      
ref|XP_006436686.1|  hypothetical protein CICLE_v10031284mg             744   0.0      
ref|XP_006339112.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    745   0.0      
gb|KHN00923.1|  Glucomannan 4-beta-mannosyltransferase 9                744   0.0      
ref|XP_010325939.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    744   0.0      
ref|XP_009379774.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    744   0.0      
ref|XP_004250002.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    744   0.0      
gb|KHN37850.1|  Glucomannan 4-beta-mannosyltransferase 9                743   0.0      
ref|XP_009353014.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    743   0.0      
ref|XP_009390016.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    742   0.0      
ref|XP_010940677.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    741   0.0      
ref|XP_008241312.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    740   0.0      
ref|XP_011024272.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    739   0.0      
ref|XP_011018871.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    738   0.0      
ref|XP_007203625.1|  hypothetical protein PRUPE_ppa004037mg             738   0.0      
ref|XP_009403735.1|  PREDICTED: probable mannan synthase 9 isofor...    738   0.0      
ref|XP_002873112.1|  ATCSLA09                                           738   0.0      
ref|XP_010694523.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    738   0.0      
gb|AES60635.2|  cellulose synthase-like protein A1                      737   0.0      
ref|XP_008462529.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    737   0.0      
ref|XP_010243535.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    737   0.0      
gb|KFK24842.1|  hypothetical protein AALP_AA8G031700                    736   0.0      
ref|XP_010543471.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    736   0.0      
ref|XP_010558212.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    735   0.0      
ref|XP_007145259.1|  hypothetical protein PHAVU_007G223800g             734   0.0      
ref|NP_195996.1|  glucomannan 4-beta-mannosyltransferase 9              734   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98718.1|  hypothetical protein                                   734   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006381326.1|  hypothetical protein POPTR_0006s11810g             733   0.0      
ref|XP_009130779.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    733   0.0      
ref|XP_006287469.1|  hypothetical protein CARUB_v10000681mg             733   0.0      
ref|XP_004143300.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    733   0.0      
ref|XP_010490868.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    733   0.0      
ref|XP_002311972.2|  4-mannan synthase family protein                   732   0.0      Populus trichocarpa [western balsam poplar]
emb|CDY11268.1|  BnaA03g01040D                                          732   0.0      
ref|XP_004151323.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    730   0.0      
ref|XP_004164074.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    732   0.0      
gb|AFZ78578.1|  cellulose synthase-like protein                         731   0.0      
ref|XP_010452272.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    731   0.0      
gb|KHG19821.1|  Glucomannan 4-beta-mannosyltransferase 9 -like pr...    730   0.0      
ref|XP_010110184.1|  hypothetical protein L484_016805                   731   0.0      
ref|XP_006398833.1|  hypothetical protein EUTSA_v10013220mg             730   0.0      
ref|XP_009122674.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    729   0.0      
ref|XP_010423663.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    729   0.0      
gb|KEH42109.1|  cellulose synthase-like protein A1                      728   0.0      
emb|CDX70286.1|  BnaA10g26350D                                          729   0.0      
ref|XP_011010407.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    728   0.0      
ref|XP_009335111.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    728   0.0      
ref|XP_004496174.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    728   0.0      
ref|XP_010112526.1|  hypothetical protein L484_012804                   729   0.0      
ref|XP_006345855.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    726   0.0      
gb|ABG34548.1|  cellulose synthase-like A2                              727   0.0      Pinus taeda
gb|KGN63048.1|  hypothetical protein Csa_2G386160                       733   0.0      
ref|XP_004143299.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    725   0.0      
ref|XP_004170553.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    725   0.0      
ref|XP_009361452.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    723   0.0      
ref|XP_004307031.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    722   0.0      
ref|XP_009403734.1|  PREDICTED: probable mannan synthase 9 isofor...    723   0.0      
gb|EMS67675.1|  hypothetical protein TRIUR3_27071                       721   0.0      
ref|XP_008363208.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    718   0.0      
gb|KEH42113.1|  cellulose synthase-like protein A1                      720   0.0      
emb|CDY10358.1|  BnaCnng02590D                                          719   0.0      
ref|XP_006424348.1|  hypothetical protein CICLE_v10028164mg             714   0.0      
ref|XP_008442792.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    714   0.0      
emb|CDP06989.1|  unnamed protein product                                714   0.0      
ref|XP_008232088.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    711   0.0      
ref|XP_010067160.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    711   0.0      
ref|XP_004497598.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    712   0.0      
ref|XP_004137864.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    712   0.0      
ref|XP_006484970.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    712   0.0      
ref|XP_008659807.1|  PREDICTED: probable mannan synthase 9              710   0.0      
ref|XP_006656269.1|  PREDICTED: probable mannan synthase 9-like         710   0.0      
ref|XP_004303037.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    710   0.0      
ref|XP_004965827.1|  PREDICTED: probable mannan synthase 9-like         709   0.0      
gb|ACF33171.1|  mannan synthase                                         709   0.0      Coffea canephora [robusta coffee]
ref|XP_010683891.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    708   0.0      
gb|KEH42110.1|  cellulose synthase-like protein A1                      707   0.0      
ref|XP_006481909.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    708   0.0      
ref|XP_006430317.1|  hypothetical protein CICLE_v10011455mg             706   0.0      
sp|Q67VS7.1|CSLA9_ORYSJ  RecName: Full=Probable mannan synthase 9...    703   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009337395.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    704   0.0      
ref|XP_006606289.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    701   0.0      
ref|XP_002269677.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    703   0.0      Vitis vinifera
gb|KDP34366.1|  hypothetical protein JCGZ_11249                         702   0.0      
ref|XP_009794211.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    701   0.0      
ref|XP_008385455.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    702   0.0      
ref|XP_006384673.1|  glycosyl transferase family 2 family protein       701   0.0      
ref|XP_002527445.1|  transferase, transferring glycosyl groups, p...    700   0.0      Ricinus communis
ref|XP_003560565.2|  PREDICTED: probable mannan synthase 9              698   0.0      
ref|XP_002312893.1|  glycosyl transferase family 2 family protein       700   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010278246.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    699   0.0      
ref|XP_011005673.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    699   0.0      
ref|XP_010038980.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    699   0.0      
ref|XP_011044347.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    697   0.0      
gb|AFZ78579.1|  cellulose synthase-like protein                         697   0.0      
ref|XP_011089999.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    696   0.0      
ref|XP_009590983.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    696   0.0      
ref|NP_850952.1|  putative mannan synthase 3                            696   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ACV71015.1|  UPA15                                                   695   0.0      Capsicum annuum
ref|XP_006400777.1|  hypothetical protein EUTSA_v10013221mg             694   0.0      
ref|XP_003551076.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    694   0.0      
ref|NP_197666.1|  glucomannan 4-beta-mannosyltransferase 2              694   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010535659.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    693   0.0      
ref|XP_002874083.1|  hypothetical protein ARALYDRAFT_489123             693   0.0      
ref|XP_002890585.1|  hypothetical protein ARALYDRAFT_889889             694   0.0      
ref|XP_007015961.1|  Cellulose synthase-like A02 isoform 1              692   0.0      
ref|XP_004241301.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    692   0.0      
gb|KFK39910.1|  hypothetical protein AALP_AA3G305000                    692   0.0      
ref|XP_006287471.1|  hypothetical protein CARUB_v10000683mg             692   0.0      
ref|XP_006347222.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    692   0.0      
ref|XP_010089159.1|  hypothetical protein L484_003290                   692   0.0      
emb|CBI40224.3|  unnamed protein product                                688   0.0      
ref|XP_010031452.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    691   0.0      
ref|XP_006589371.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    690   0.0      
gb|KHN48194.1|  Glucomannan 4-beta-mannosyltransferase 9                689   0.0      
ref|XP_006307154.1|  hypothetical protein CARUB_v10008745mg             691   0.0      
ref|XP_003542549.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    689   0.0      
gb|KEH43412.1|  cellulose synthase-like protein A1                      690   0.0      
ref|XP_003535285.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    689   0.0      
ref|XP_010525608.1|  PREDICTED: probable mannan synthase 3 isofor...    690   0.0      
ref|XP_009126562.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    689   0.0      
ref|XP_009629011.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    689   0.0      
ref|XP_010525610.1|  PREDICTED: probable mannan synthase 3 isofor...    689   0.0      
ref|XP_010493365.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    689   0.0      
ref|XP_010912225.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    687   0.0      
ref|XP_010454539.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    689   0.0      
emb|CAN82595.1|  hypothetical protein VITISV_013708                     688   0.0      Vitis vinifera
ref|XP_004251009.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    687   0.0      
ref|XP_010421063.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    688   0.0      
ref|XP_010477641.1|  PREDICTED: probable mannan synthase 3              688   0.0      
emb|CAN74357.1|  hypothetical protein VITISV_042153                     686   0.0      Vitis vinifera
ref|XP_008458630.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    686   0.0      
ref|XP_004294040.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    686   0.0      
gb|KHF98868.1|  Glucomannan 4-beta-mannosyltransferase 2 -like pr...    686   0.0      
ref|XP_010520406.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    686   0.0      
ref|XP_010498857.1|  PREDICTED: probable mannan synthase 3              686   0.0      
ref|XP_008227108.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    685   0.0      
ref|XP_003538146.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    685   0.0      
gb|KHN45690.1|  Glucomannan 4-beta-mannosyltransferase 9                683   0.0      
ref|XP_007027601.1|  Nucleotide-diphospho-sugar transferases supe...    682   0.0      
gb|KHN38673.1|  Glucomannan 4-beta-mannosyltransferase 2                685   0.0      
ref|XP_009603536.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    682   0.0      
ref|XP_009793132.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    682   0.0      
ref|XP_003539806.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    684   0.0      
gb|EYU36982.1|  hypothetical protein MIMGU_mgv1a004240mg                684   0.0      
gb|AFW87395.1|  hypothetical protein ZEAMMB73_638072                    681   0.0      
ref|XP_004145779.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    683   0.0      
ref|XP_007132379.1|  hypothetical protein PHAVU_011G089900g             683   0.0      
dbj|BAK03076.1|  predicted protein                                      682   0.0      
ref|XP_007208460.1|  hypothetical protein PRUPE_ppa003918mg             682   0.0      
ref|XP_006349077.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    681   0.0      
ref|XP_003571119.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    681   0.0      
emb|CDO99850.1|  unnamed protein product                                677   0.0      
ref|XP_007208459.1|  hypothetical protein PRUPE_ppa003918mg             679   0.0      
ref|XP_002963530.1|  glycosyltransferase family 2 protein               679   0.0      
ref|XP_006416081.1|  hypothetical protein EUTSA_v10007266mg             681   0.0      
ref|XP_011088835.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    679   0.0      
gb|KHG21024.1|  Glucomannan 4-beta-mannosyltransferase 2 -like pr...    679   0.0      
ref|XP_009115523.1|  PREDICTED: probable mannan synthase 3              680   0.0      
ref|XP_002981551.1|  family 2 glycosyltransferase                       679   0.0      
emb|CDY44151.1|  BnaA09g31010D                                          680   0.0      
emb|CDY04707.1|  BnaC05g18820D                                          679   0.0      
ref|XP_010509580.1|  PREDICTED: probable mannan synthase 7              678   0.0      
ref|XP_009769755.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    677   0.0      
ref|XP_004951606.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    676   0.0      
ref|XP_008360269.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    676   0.0      
ref|XP_004506130.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    676   0.0      
ref|XP_010516764.1|  PREDICTED: probable mannan synthase 7 isofor...    676   0.0      
ref|XP_010554514.1|  PREDICTED: probable mannan synthase 7 isofor...    676   0.0      
gb|ADW77641.1|  putative mannan synthase                                674   0.0      
ref|NP_001031084.1|  putative mannan synthase 3                         672   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554517.1|  PREDICTED: probable mannan synthase 11             674   0.0      
ref|XP_010505088.1|  PREDICTED: probable mannan synthase 7              674   0.0      
ref|XP_002453460.1|  hypothetical protein SORBIDRAFT_04g006260          672   0.0      Sorghum bicolor [broomcorn]
gb|KDO45609.1|  hypothetical protein CISIN_1g040333mg                   672   0.0      
ref|NP_001046164.1|  Os02g0192500                                       672   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010521855.1|  PREDICTED: probable mannan synthase 3              674   0.0      
ref|XP_009364844.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    671   0.0      
ref|XP_010540228.1|  PREDICTED: probable mannan synthase 11 isofo...    670   0.0      
ref|XP_004497599.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    670   0.0      
ref|XP_001764061.1|  cellulose synthase-like A1, glycosyltransfer...    670   0.0      
ref|XP_003590384.1|  Glucomannan 4-beta-mannosyltransferase             666   0.0      
ref|XP_009131529.1|  PREDICTED: probable mannan synthase 11             668   0.0      
ref|XP_009120642.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    669   0.0      
gb|ABD79100.1|  cellulose synthase-like A2                              669   0.0      Physcomitrella patens
gb|AAQ62570.1|  glycosyltransferase 1                                   668   0.0      Ipomoea trifida
ref|XP_002528577.1|  conserved hypothetical protein                     666   0.0      Ricinus communis
gb|AAQ62572.1|  glycosyltransferase 10                                  666   0.0      Ipomoea trifida
ref|XP_003606273.1|  Glucomannan 4-beta-mannosyltransferase             666   0.0      
ref|XP_010540227.1|  PREDICTED: probable mannan synthase 11 isofo...    665   0.0      
ref|XP_010420302.1|  PREDICTED: probable mannan synthase 11             664   0.0      
gb|AAQ62571.1|  glycosyltransferase 5                                   664   0.0      Ipomoea trifida
ref|XP_006606290.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    661   0.0      
ref|XP_006646997.1|  PREDICTED: LOW QUALITY PROTEIN: glucomannan ...    664   0.0      
ref|XP_010690012.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    665   0.0      
ref|XP_010492500.1|  PREDICTED: probable mannan synthase 11             663   0.0      
ref|XP_010937167.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    665   0.0      
emb|CDX79614.1|  BnaC03g19500D                                          664   0.0      
ref|XP_011010406.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    663   0.0      
ref|XP_010937165.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    663   0.0      
ref|XP_008783921.1|  PREDICTED: probable mannan synthase 3 isofor...    664   0.0      
ref|XP_001759264.1|  cellulose synthase-like A2, glycosyltransfer...    662   0.0      
ref|XP_001759209.1|  cellulose synthase-like A3, glycosyltransfer...    663   0.0      
ref|XP_008783930.1|  PREDICTED: probable mannan synthase 3 isofor...    664   0.0      
emb|CDX88785.1|  BnaA03g08640D                                          661   0.0      
ref|XP_010453775.1|  PREDICTED: probable mannan synthase 11             660   0.0      
ref|XP_009133031.1|  PREDICTED: probable mannan synthase 7              662   0.0      
ref|XP_009419094.1|  PREDICTED: probable mannan synthase 4              661   0.0      
ref|XP_010325940.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    659   0.0      
gb|EAY84833.1|  hypothetical protein OsI_06199                          660   0.0      Oryza sativa Indica Group [Indian rice]
emb|CDX71011.1|  BnaC03g10950D                                          659   0.0      
ref|XP_010477728.1|  PREDICTED: probable mannan synthase 10             661   0.0      
ref|NP_001131007.1|  uncharacterized protein LOC100192112               659   0.0      Zea mays [maize]
ref|XP_009139628.1|  PREDICTED: probable mannan synthase 15 isofo...    660   0.0      
ref|XP_009353016.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    658   0.0      
ref|XP_009410399.1|  PREDICTED: probable mannan synthase 11 isofo...    659   0.0      
ref|XP_009139627.1|  PREDICTED: probable mannan synthase 15 isofo...    659   0.0      
ref|XP_006287553.1|  hypothetical protein CARUB_v10000762mg             657   0.0      
ref|XP_008783962.1|  PREDICTED: probable mannan synthase 9 isofor...    659   0.0      
emb|CDY01129.1|  BnaA04g06900D                                          657   0.0      
gb|EEE56486.1|  hypothetical protein OsJ_05716                          655   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002879565.1|  hypothetical protein ARALYDRAFT_482526             658   0.0      
ref|XP_009121507.1|  PREDICTED: probable mannan synthase 11             655   0.0      
ref|XP_008363527.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    654   0.0      
ref|XP_008664730.1|  PREDICTED: uncharacterized protein LOC100216...    657   0.0      
ref|XP_002530892.1|  transferase, transferring glycosyl groups, p...    651   0.0      Ricinus communis
ref|XP_010498927.1|  PREDICTED: probable mannan synthase 10             655   0.0      
gb|KFK25839.1|  hypothetical protein AALP_AA8G168900                    653   0.0      
ref|XP_006307167.1|  hypothetical protein CARUB_v10008757mg             655   0.0      
ref|XP_008677729.1|  PREDICTED: uncharacterized protein LOC100501...    654   0.0      
ref|XP_009103139.1|  PREDICTED: probable mannan synthase 10             653   0.0      
ref|NP_193077.2|  putative mannan synthase 15                           653   0.0      
ref|XP_002893324.1|  hypothetical protein ARALYDRAFT_313253             653   0.0      
ref|XP_010460178.1|  PREDICTED: probable mannan synthase 10             653   0.0      
ref|XP_007015962.1|  Cellulose synthase-like A02 isoform 2              650   0.0      
ref|XP_010554516.1|  PREDICTED: probable mannan synthase 7 isofor...    649   0.0      
ref|XP_002277171.1|  PREDICTED: mannan synthase 1-like                  650   0.0      
emb|CDP06773.1|  unnamed protein product                                650   0.0      
gb|KGN46914.1|  hypothetical protein Csa_6G150530                       650   0.0      
gb|KCW89263.1|  hypothetical protein EUGRSUZ_A01558                     646   0.0      
ref|XP_009597672.1|  PREDICTED: mannan synthase 1-like isoform X2       650   0.0      
ref|XP_009765562.1|  PREDICTED: mannan synthase 1-like isoform X2       650   0.0      
emb|CDY26505.1|  BnaC09g41630D                                          649   0.0      
ref|NP_565813.1|  putative mannan synthase 7                            650   0.0      
ref|XP_008363207.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    644   0.0      
emb|CDY35710.1|  BnaC02g09760D                                          648   0.0      
emb|CDY40295.1|  BnaA07g09050D                                          649   0.0      
gb|AAM61171.1|  putative glucosyltransferase                            649   0.0      
ref|XP_004246627.1|  PREDICTED: mannan synthase 1-like                  647   0.0      
ref|XP_009769757.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    647   0.0      
ref|XP_008787138.1|  PREDICTED: probable mannan synthase 11             644   0.0      
ref|XP_010462862.1|  PREDICTED: probable mannan synthase 3              645   0.0      
emb|CDY26949.1|  BnaC09g36340D                                          644   0.0      
ref|XP_006354365.1|  PREDICTED: mannan synthase 1-like                  645   0.0      
ref|NP_173818.1|  cellulose synthase-like A10                           645   0.0      
ref|XP_009410398.1|  PREDICTED: probable mannan synthase 11 isofo...    645   0.0      
ref|XP_004973516.1|  PREDICTED: probable mannan synthase 11-like        645   0.0      
gb|ACE60600.1|  mannan synthase                                         644   0.0      
ref|XP_009385870.1|  PREDICTED: mannan synthase 1-like                  643   0.0      
ref|XP_010516765.1|  PREDICTED: probable mannan synthase 7 isofor...    641   0.0      
gb|KFK44470.1|  hypothetical protein AALP_AA1G260600                    644   0.0      
emb|CDY09164.1|  BnaA02g05900D                                          642   0.0      
ref|XP_006416032.1|  hypothetical protein EUTSA_v10007269mg             643   0.0      
ref|XP_008783951.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    640   0.0      
ref|XP_010440584.1|  PREDICTED: probable mannan synthase 15 isofo...    640   0.0      
gb|ACE60601.1|  mannan synthase                                         639   0.0      
emb|CDY40448.1|  BnaA04g20690D                                          642   0.0      
ref|XP_010440585.1|  PREDICTED: probable mannan synthase 15 isofo...    639   0.0      
ref|XP_008787126.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    638   0.0      
ref|XP_010450208.1|  PREDICTED: probable mannan synthase 15 isofo...    639   0.0      
ref|XP_002870144.1|  hypothetical protein ARALYDRAFT_915064             639   0.0      
ref|XP_010450207.1|  PREDICTED: probable mannan synthase 15 isofo...    638   0.0      
ref|XP_010937166.1|  PREDICTED: probable mannan synthase 11             638   0.0      
ref|XP_010937164.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    640   0.0      
ref|XP_011094610.1|  PREDICTED: mannan synthase 1-like                  637   0.0      
gb|EMT24748.1|  hypothetical protein F775_52670                         637   0.0      
ref|XP_010434799.1|  PREDICTED: probable mannan synthase 1 isofor...    637   0.0      
ref|XP_010434800.1|  PREDICTED: probable mannan synthase 1 isofor...    637   0.0      
ref|XP_003572230.2|  PREDICTED: probable mannan synthase 11 isofo...    637   0.0      
ref|XP_010449754.1|  PREDICTED: probable mannan synthase 1              637   0.0      
ref|XP_009141504.1|  PREDICTED: probable mannan synthase 7              636   0.0      
ref|XP_010435266.1|  PREDICTED: probable mannan synthase 15 isofo...    635   0.0      
gb|KDO49989.1|  hypothetical protein CISIN_1g044519mg                   635   0.0      
gb|KEH24032.1|  cellulose synthase-like protein A1                      635   0.0      
ref|XP_008800552.1|  PREDICTED: mannan synthase 1-like                  635   0.0      
ref|XP_010096071.1|  hypothetical protein L484_000910                   635   0.0      
ref|XP_009765561.1|  PREDICTED: mannan synthase 1-like isoform X1       636   0.0      
ref|XP_009597671.1|  PREDICTED: mannan synthase 1-like isoform X1       635   0.0      
emb|CDX72181.1|  BnaC08g26930D                                          634   0.0      
emb|CDX92340.1|  BnaA10g13790D                                          649   0.0      
gb|KFK34844.1|  hypothetical protein AALP_AA5G200500                    634   0.0      
ref|XP_010440127.1|  PREDICTED: probable mannan synthase 1              635   0.0      
ref|XP_006403035.1|  hypothetical protein EUTSA_v10005891mg             633   0.0      
sp|Q6UDF0.1|CSLA1_CYATE  RecName: Full=Mannan synthase 1; AltName...    633   0.0      
ref|XP_008802588.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    634   0.0      
ref|XP_009410012.1|  PREDICTED: probable mannan synthase 9 isofor...    634   0.0      
ref|XP_002863134.1|  predicted protein                                  632   0.0      
gb|EYU38560.1|  hypothetical protein MIMGU_mgv1a017694mg                632   0.0      
emb|CDY54604.1|  BnaA05g28600D                                          632   0.0      
ref|XP_009410011.1|  PREDICTED: probable mannan synthase 9 isofor...    633   0.0      
emb|CDP15609.1|  unnamed protein product                                630   0.0      
ref|XP_010516194.1|  PREDICTED: probable mannan synthase 14 isofo...    631   0.0      
ref|XP_006414326.1|  hypothetical protein EUTSA_v10024828mg             632   0.0      
ref|XP_010917051.1|  PREDICTED: probable mannan synthase 4 isofor...    633   0.0      
ref|XP_009116294.1|  PREDICTED: probable mannan synthase 14             630   0.0      
ref|XP_004493996.1|  PREDICTED: mannan synthase 1-like                  630   0.0      
ref|XP_006283494.1|  hypothetical protein CARUB_v10004546mg             630   0.0      
ref|XP_008787118.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    628   0.0      
ref|XP_010427404.1|  PREDICTED: probable mannan synthase 14             629   0.0      
ref|XP_010504474.1|  PREDICTED: probable mannan synthase 14             629   0.0      
ref|XP_003520655.1|  PREDICTED: mannan synthase 1-like                  628   0.0      
dbj|BAF36300.1|  hypothetical protein                                   629   0.0      
ref|XP_009136796.1|  PREDICTED: probable mannan synthase 1              628   0.0      
ref|XP_006290419.1|  hypothetical protein CARUB_v10019203mg             627   0.0      
sp|Q84W54.1|CSLA1_ARATH  RecName: Full=Probable mannan synthase 1...    627   0.0      
gb|KFK26523.1|  hypothetical protein AALP_AA8G260200                    627   0.0      
ref|XP_006282581.1|  hypothetical protein CARUB_v10004510mg             627   0.0      
gb|EMT23763.1|  hypothetical protein F775_17087                         637   0.0      
emb|CDX90506.1|  BnaA03g42750D                                          627   0.0      
ref|XP_010917052.1|  PREDICTED: probable mannan synthase 4 isofor...    628   0.0      
gb|AFV79650.1|  mannan synthase                                         625   0.0      
ref|XP_003606274.1|  Glucomannan 4-beta-mannosyltransferase             623   0.0      
emb|CDM86569.1|  unnamed protein product                                625   0.0      
ref|XP_009382953.1|  PREDICTED: probable mannan synthase 11             624   0.0      
ref|XP_008806011.1|  PREDICTED: probable mannan synthase 4              625   0.0      
gb|EMT01783.1|  hypothetical protein F775_21241                         624   0.0      
ref|XP_009380154.1|  PREDICTED: probable mannan synthase 4              624   0.0      
ref|XP_002878056.1|  hypothetical protein ARALYDRAFT_907034             621   0.0      
emb|CBI17089.3|  unnamed protein product                                617   0.0      
sp|Q6YWK8.1|CSLAB_ORYSJ  RecName: Full=Probable mannan synthase 1...    622   0.0      
emb|CAN74410.1|  hypothetical protein VITISV_013215                     620   0.0      
ref|XP_003553558.1|  PREDICTED: mannan synthase 1-like                  620   0.0      
gb|EYU36983.1|  hypothetical protein MIMGU_mgv1a004073mg                620   0.0      
gb|KFK36462.1|  hypothetical protein AALP_AA4G127800                    618   0.0      
ref|XP_006660158.1|  PREDICTED: LOW QUALITY PROTEIN: probable man...    620   0.0      
emb|CDY32098.1|  BnaC04g44680D                                          618   0.0      
gb|EEE68748.1|  hypothetical protein OsJ_27439                          616   0.0      
gb|AAC98005.1|  Similar to gi|2245014 glucosyltransferase homolog...    613   0.0      
ref|XP_008780554.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    617   0.0      
emb|CDX70677.1|  BnaC03g07610D                                          612   0.0      
ref|XP_011088832.1|  PREDICTED: probable mannan synthase 11             616   0.0      
ref|XP_010440586.1|  PREDICTED: probable mannan synthase 15 isofo...    612   0.0      
ref|NP_191159.2|  cellulose synthase like A14                           612   0.0      
sp|Q8S7W0.1|CSLA4_ORYSJ  RecName: Full=Probable mannan synthase 4...    612   0.0      
ref|XP_010935702.1|  PREDICTED: mannan synthase 1-like isoform X1       610   0.0      
ref|XP_002468429.1|  hypothetical protein SORBIDRAFT_01g045850          611   0.0      
ref|XP_008783968.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    610   0.0      
gb|EMT15170.1|  hypothetical protein F775_14200                         609   0.0      
gb|AAO42815.1|  At3g56000                                               610   0.0      
ref|XP_010435267.1|  PREDICTED: probable mannan synthase 15 isofo...    607   0.0      
ref|XP_010554515.1|  PREDICTED: probable mannan synthase 7 isofor...    606   0.0      
ref|XP_008783939.1|  PREDICTED: probable mannan synthase 4 isofor...    608   0.0      
ref|NP_197123.3|  cellulose synthase like A11                           604   0.0      
ref|XP_008658026.1|  PREDICTED: hypothetical protein isoform X1         607   0.0      
gb|KFK25840.1|  hypothetical protein AALP_AA8G168900                    605   0.0      
emb|CDX69464.1|  BnaA10g18130D                                          603   0.0      
gb|KHN09524.1|  Mannan synthase 1                                       605   0.0      
ref|XP_002873761.1|  hypothetical protein ARALYDRAFT_488470             602   0.0      
ref|XP_009403159.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    604   0.0      
gb|AAF87149.1|AC002423_14  T23E23.23                                    602   0.0      
ref|XP_009390887.1|  PREDICTED: probable mannan synthase 11             602   0.0      
emb|CAB87854.1|  putative protein                                       598   0.0      
ref|XP_011089998.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    596   0.0      
ref|XP_010440588.1|  PREDICTED: probable mannan synthase 15 isofo...    595   0.0      
ref|XP_006651080.1|  PREDICTED: probable mannan synthase 4-like         595   0.0      
ref|XP_008649262.1|  PREDICTED: probable mannan synthase 3 isofor...    595   0.0      
ref|XP_004966838.1|  PREDICTED: probable mannan synthase 3-like         595   0.0      
ref|XP_003578707.1|  PREDICTED: mannan synthase 1-like                  594   0.0      
ref|XP_010234713.1|  PREDICTED: probable mannan synthase 4              593   0.0      
gb|EEC73998.1|  hypothetical protein OsI_08915                          593   0.0      
ref|XP_010435268.1|  PREDICTED: probable mannan synthase 15 isofo...    590   0.0      
gb|EYU36103.1|  hypothetical protein MIMGU_mgv1a004186mg                593   0.0      
gb|EEE57800.1|  hypothetical protein OsJ_08359                          592   0.0      
sp|Q6Z2T9.2|CSLA6_ORYSJ  RecName: Full=Probable mannan synthase 6...    593   0.0      
ref|XP_004953872.1|  PREDICTED: probable mannan synthase 6-like         592   0.0      
ref|XP_003560885.1|  PREDICTED: probable mannan synthase 3 isofor...    592   0.0      
gb|ABR16486.1|  unknown                                                 585   0.0      
ref|XP_004959258.1|  PREDICTED: mannan synthase 1-like                  592   0.0      
ref|XP_003606275.1|  Glucomannan 4-beta-mannosyltransferase             587   0.0      
ref|XP_007015963.1|  Cellulose synthase-like A02 isoform 3              587   0.0      
ref|XP_008649263.1|  PREDICTED: probable mannan synthase 3 isofor...    588   0.0      
dbj|BAD15538.1|  putative glycosyltransferase 10                        589   0.0      
dbj|BAK08066.1|  predicted protein                                      587   0.0      
ref|XP_007027602.1|  Nucleotide-diphospho-sugar transferases supe...    579   0.0      
gb|KDO61015.1|  hypothetical protein CISIN_1g0413332mg                  577   0.0      
ref|XP_009139629.1|  PREDICTED: probable mannan synthase 15 isofo...    578   0.0      
ref|XP_002459874.1|  hypothetical protein SORBIDRAFT_02g012870          580   0.0      
ref|XP_010540229.1|  PREDICTED: probable mannan synthase 3 isofor...    578   0.0      
ref|XP_006656810.1|  PREDICTED: probable mannan synthase 3-like         576   0.0      
ref|XP_008681194.1|  PREDICTED: hypothetical protein isoform X1         579   0.0      
ref|NP_001132315.1|  hypothetical protein                               577   0.0      
sp|Q67X45.1|CSLA3_ORYSJ  RecName: Full=Probable mannan synthase 3...    577   0.0      
ref|XP_006662343.1|  PREDICTED: probable mannan synthase 2-like         575   0.0      
ref|XP_008780561.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    575   0.0      
ref|XP_002452557.1|  hypothetical protein SORBIDRAFT_04g028070          575   0.0      
emb|CDX80885.1|  BnaC03g01390D                                          573   0.0      
gb|EEC85104.1|  hypothetical protein OsI_32487                          572   0.0      
tpg|DAA01745.1|  TPA: cellulose synthase-like A4                        574   0.0      
ref|XP_006647880.1|  PREDICTED: probable mannan synthase 6-like         571   0.0      
ref|NP_001183100.1|  hypothetical protein                               571   0.0      
gb|EMS50191.1|  hypothetical protein TRIUR3_23716                       572   0.0      
gb|EYU29872.1|  hypothetical protein MIMGU_mgv1a023425mg                570   0.0      
ref|XP_006657995.1|  PREDICTED: probable mannan synthase 7-like         569   0.0      
tpg|DAA01755.1|  TPA: cellulose synthase-like A2                        568   0.0      
gb|KHN02317.1|  Mannan synthase 1                                       566   0.0      
tpg|DAA50027.1|  TPA: hypothetical protein ZEAMMB73_959739              566   0.0      
sp|Q7PC67.2|CSLA2_ORYSJ  RecName: Full=Probable mannan synthase 2...    569   0.0      
ref|XP_010227823.1|  PREDICTED: probable mannan synthase 3 isofor...    566   0.0      
ref|XP_008664977.1|  PREDICTED: probable mannan synthase 4 isofor...    568   0.0      
gb|EMS62877.1|  hypothetical protein TRIUR3_33379                       561   0.0      
dbj|BAK06422.1|  predicted protein                                      561   0.0      
dbj|BAK05964.1|  predicted protein                                      560   0.0      
ref|XP_008647195.1|  PREDICTED: uncharacterized protein LOC103628848    575   0.0      
ref|XP_006661580.1|  PREDICTED: mannan synthase 1-like                  559   0.0      
ref|XP_010450209.1|  PREDICTED: probable mannan synthase 15 isofo...    556   0.0      
ref|XP_010227824.1|  PREDICTED: probable mannan synthase 3 isofor...    558   0.0      
emb|CBI32777.3|  unnamed protein product                                556   0.0      
gb|EMT23300.1|  hypothetical protein F775_52157                         558   0.0      
ref|XP_010525611.1|  PREDICTED: probable mannan synthase 3 isofor...    553   0.0      
dbj|BAD94168.1|  cellulose synthase like protein                        555   0.0      
ref|XP_004958412.1|  PREDICTED: probable mannan synthase 7-like         559   0.0      
ref|XP_004983152.1|  PREDICTED: probable mannan synthase 2-like         560   0.0      
gb|AFW73395.1|  hypothetical protein ZEAMMB73_786146                    555   0.0      
ref|XP_008653381.1|  PREDICTED: probable mannan synthase 7              558   0.0      
ref|XP_003570663.2|  PREDICTED: probable mannan synthase 6              553   0.0      
gb|AAK98678.1|AC021893_12  Putative glucosyltransferase                 553   0.0      
gb|EYU36101.1|  hypothetical protein MIMGU_mgv1a0044822mg               549   0.0      
sp|Q7XIF5.1|CSLA7_ORYSJ  RecName: Full=Probable mannan synthase 7...    555   0.0      
ref|XP_008673321.1|  PREDICTED: hypothetical protein isoform X1         550   0.0      
ref|XP_003562630.1|  PREDICTED: probable mannan synthase 7              553   0.0      
ref|XP_002461072.1|  hypothetical protein SORBIDRAFT_02g040200          553   0.0      
ref|XP_010935703.1|  PREDICTED: mannan synthase 1-like isoform X2       551   0.0      
ref|XP_010935704.1|  PREDICTED: mannan synthase 1-like isoform X3       549   0.0      
gb|AFW66231.1|  hypothetical protein ZEAMMB73_021965                    545   0.0      
ref|NP_001050229.1|  Os03g0377700                                       551   0.0      
gb|EEE65380.1|  hypothetical protein OsJ_20691                          550   0.0      
gb|EEC80274.1|  hypothetical protein OsI_22257                          549   0.0      
gb|EEC66918.1|  hypothetical protein OsI_33517                          544   0.0      
ref|XP_004984218.1|  PREDICTED: probable mannan synthase 5-like i...    550   0.0      
ref|XP_006428366.1|  hypothetical protein CICLE_v10013685mg             541   0.0      
gb|EEE67643.1|  hypothetical protein OsJ_25231                          547   0.0      
gb|EAY85180.1|  hypothetical protein OsI_06538                          547   0.0      
gb|EMS57245.1|  hypothetical protein TRIUR3_28392                       541   0.0      
gb|EEC75358.1|  hypothetical protein OsI_11796                          546   0.0      
gb|EEE50933.1|  hypothetical protein OsJ_31468                          538   0.0      
gb|EMS51579.1|  hypothetical protein TRIUR3_28386                       542   0.0      
gb|EMS51475.1|  hypothetical protein TRIUR3_09357                       538   0.0      
gb|EPS58942.1|  mannan synthase                                         536   0.0      
ref|XP_010516195.1|  PREDICTED: probable mannan synthase 14 isofo...    534   0.0      
gb|AFW62286.1|  hypothetical protein ZEAMMB73_786937                    532   0.0      
ref|XP_010926632.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    531   2e-180   
ref|XP_008780571.1|  PREDICTED: glucomannan 4-beta-mannosyltransf...    530   5e-180   



>ref|XP_009603325.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=530

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/519 (69%), Positives = 436/519 (84%), Gaps = 5/519 (1%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             D++   +G+LW Q +  ++VP LR+MV LCL M +M+ +E+VY+G V A++KL RR P K
Sbjct  14    DSVTSQIGLLWQQVRVPLLVPFLRIMVVLCLAMSLMLFVERVYMGIVIAFIKLLRRKPEK  73

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +YKWEP+K  DD E+ N  YP VLVQIPM NE+ VYQLSIGAACNLSWP +RI+IQVLDD
Sbjct  74    KYKWEPVK--DDLELANYSYPIVLVQIPMYNEREVYQLSIGAACNLSWPADRILIQVLDD  131

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP +KA+V+QECRRW GKGVNIKYE RDNRKG+KAG+LK+GMKH+YVK C+YVAIFDA
Sbjct  132   STDPTIKAMVEQECRRWTGKGVNIKYEIRDNRKGYKAGALKEGMKHNYVKLCDYVAIFDA  191

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF+PD DFL RTIPFLVHNP++GLVQARWK+VN++EC+LTR+QEMS+D HF+VEQEVGSA
Sbjct  192   DFQPDSDFLMRTIPFLVHNPEVGLVQARWKFVNSDECLLTRMQEMSLDYHFTVEQEVGSA  251

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              HAFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RAGLKGWKFV++GD++VK+ELP
Sbjct  252   THAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYIGDLKVKNELP  311

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKAYRYQQHRWSCGPANLF+KM  EI  NKKV++WKK YLIY+FFFV KIVAH++TF+
Sbjct  312   STFKAYRYQQHRWSCGPANLFRKMALEIAANKKVSMWKKCYLIYSFFFVRKIVAHIVTFV  371

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+V+PAT+LIPE+++P+WGA+Y+P+   LL  +  PRSLH+  FW+LFENVM+LHRT 
Sbjct  372   FYCVVMPATILIPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLVFWILFENVMSLHRTR  431

Query  565   GTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGER--LHLWEIIVGFYMLF  395
              TFIGL E GR++EWVVTEK G+  KT     A K  RFR+GER  LH  EI VG Y+LF
Sbjct  432   ATFIGLFEAGRVNEWVVTEKLGDALKTKMSSKASKKDRFRIGERYKLHFMEIFVGLYLLF  491

Query  394   CGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             CGWY+  FG N +Y+YLFLQ ++F V GFGYIG FV  S
Sbjct  492   CGWYDYSFGKNRFYIYLFLQSMAFFVGGFGYIGVFVPNS  530



>ref|XP_009760346.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=530

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/529 (67%), Positives = 439/529 (83%), Gaps = 6/529 (1%)
 Frame = -1

Query  1855  SSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAY  1676
             SSE ++    D I   +G+LW Q +A ++VP LR+MV+LCL M +M+ +E+VY+G V A+
Sbjct  5     SSETSL-STRDGITSQIGLLWQQVRAPLLVPSLRIMVFLCLAMSLMLFVERVYMGIVIAF  63

Query  1675  LKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPT  1496
             +K+ RR P K+YKWEP+K  DD E+ N  YP VLVQIPM NE+ VYQLSIGAACNLSWP 
Sbjct  64    IKVLRRKPEKKYKWEPVK--DDLELANYSYPMVLVQIPMYNEREVYQLSIGAACNLSWPA  121

Query  1495  NRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVK  1316
             +RI++QVLDDSTD  +KA+V+QECRRWAGKGVNIKYE RDNRKG+KAG+LK+GMKH+YVK
Sbjct  122   DRILVQVLDDSTDLTIKAMVEQECRRWAGKGVNIKYEIRDNRKGYKAGALKEGMKHNYVK  181

Query  1315  SCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRH  1136
              C+YVAIFDADF+PD DFL RTIPFLVHNP++GLVQ RWK+VN++EC+LTR+QEMS+D H
Sbjct  182   LCDYVAIFDADFQPDSDFLMRTIPFLVHNPEVGLVQVRWKFVNSDECLLTRMQEMSLDYH  241

Query  1135  FSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFL  956
             F+VEQEVGSA HAFFGFNGTAG+WRI AL++AGGWKDRTTVEDMDL  RAGLKGWKFV++
Sbjct  242   FTVEQEVGSATHAFFGFNGTAGVWRITALNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYV  301

Query  955   GDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVN  776
             G+++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI  NKKV++WKK YLIY+FFFV 
Sbjct  302   GELKVKNELPSTFKAYRYQQHRWSCGPANLFRKMALEIAANKKVSLWKKCYLIYSFFFVR  361

Query  775   KIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLF  596
             KIVAH++TFI+YC+V+PATVLIPE+++P+WGA+Y+P+   LL  +  PRSLH+  FW+LF
Sbjct  362   KIVAHIVTFIFYCVVMPATVLIPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLVFWILF  421

Query  595   ENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGER--LHLW  425
             ENVM+LHRT  TFIGL EVGR++EW+VTEK G+  KT     A K  RFR+GER  LH  
Sbjct  422   ENVMSLHRTRATFIGLFEVGRVNEWIVTEKLGDALKTKMSSKASKKDRFRIGERYKLHFM  481

Query  424   EIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             EI VG Y+L CGWY+  FG N +Y+YLFLQ ++F V GF YIG FV  S
Sbjct  482   EIFVGLYLLLCGWYDYSFGKNRFYIYLFLQSMAFFVAGFSYIGVFVPNS  530



>ref|XP_009401015.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401017.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/539 (66%), Positives = 438/539 (81%), Gaps = 7/539 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  SS+A +      A +GA D I   LGV+W Q KA VIVP LR+ V LCL M +M+ 
Sbjct  1     MDRLSSTAIL----PEAFQGARDDITEQLGVVWQQIKAPVIVPPLRLSVLLCLAMSVMLF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +EKVY+  V   +KLFRR P  +YKWEP+   DDAE+GN+ YP VLVQIPM NEK VYQL
Sbjct  57    VEKVYMAVVIVLVKLFRRRPETRYKWEPMG--DDAELGNAAYPMVLVQIPMYNEKEVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RIIIQVLDDSTDP +K LVQ ECRRWA KGVNIKYE RDNR G+KAG
Sbjct  115   SIGAACGLSWPSDRIIIQVLDDSTDPAIKELVQIECRRWASKGVNIKYEIRDNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMKH+YVK C+YVA+FDADF+P+PDFL+RTIPFLVHNP IGLVQ RWK+VN+NEC+
Sbjct  175   ALKEGMKHNYVKQCDYVAVFDADFQPEPDFLWRTIPFLVHNPQIGLVQGRWKFVNSNECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKF+FLGD++VKSELPS+ KAYRYQQHRWSCGPANLF+KM  +I RNK VT+W 
Sbjct  295   RASLKGWKFIFLGDLKVKSELPSTLKAYRYQQHRWSCGPANLFRKMAMDIARNKNVTLWT  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY+FFFV KIVAH++TF++YC+V+PATVL+PE+++P WG +Y+P+   LL  +  P
Sbjct  355   KVHVIYSFFFVRKIVAHIVTFVFYCVVIPATVLVPEVEVPNWGLVYIPSTITLLNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPR  455
             RSLH+  FW+LFENVM+LHR   T IGLLE GR++EWVVTEK G+  KT     A + PR
Sbjct  415   RSLHLLVFWILFENVMSLHRAKATLIGLLEAGRVNEWVVTEKLGDVMKTKVAAKAARKPR  474

Query  454   FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              R+G+RLHL E+  G Y+ FCG Y+L FG N+YY+YLFLQ ++F V+GFGY+G FV  +
Sbjct  475   IRIGDRLHLLELFTGAYLFFCGCYDLSFGKNHYYLYLFLQAITFFVVGFGYVGTFVPQT  533



>ref|XP_009603535.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Nicotiana tomentosiformis]
Length=531

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/530 (65%), Positives = 441/530 (83%), Gaps = 2/530 (0%)
 Frame = -1

Query  1864  IMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAV  1685
             ++FSS  A+  A + I   +G+ W Q +A +IVP++R+++++CL +  M+ +E++Y+G V
Sbjct  3     MIFSSSVALLNARNGITSQVGLFWQQTRAPLIVPLIRIVLFVCLALSFMLFVERLYMGIV  62

Query  1684  SAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLS  1505
              A++KL RR P K+YKWEP+KK DD E+GNS YP VLVQIPM NEK VYQLSIGAAC+LS
Sbjct  63    IAFIKLVRRKPEKKYKWEPMKK-DDLELGNSSYPVVLVQIPMYNEKEVYQLSIGAACSLS  121

Query  1504  WPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHS  1325
             WP NRI IQVLDDSTDP +KALV+QECR WA KG+NIKYE RDNRKG+KAG+L++GMKHS
Sbjct  122   WPANRIFIQVLDDSTDPAIKALVEQECRIWASKGINIKYEIRDNRKGYKAGALREGMKHS  181

Query  1324  YVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSM  1145
             YV  C +VAIFDADF+P+PDFL RTIPFLVHNPDIGLVQARW++VNA+EC++TR+QEMS+
Sbjct  182   YVNLCSHVAIFDADFQPEPDFLERTIPFLVHNPDIGLVQARWEFVNADECLMTRMQEMSL  241

Query  1144  DRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKF  965
               HF+VEQEVGSAIHAFFGFNGTAG+WR++AL++AGGWKDRTTVEDMDL  RAGL GWKF
Sbjct  242   GYHFTVEQEVGSAIHAFFGFNGTAGVWRMSALNEAGGWKDRTTVEDMDLAVRAGLNGWKF  301

Query  964   VFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFF  785
             V++GD++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI  NKKV++WKK YLIY+FF
Sbjct  302   VYVGDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAKEIATNKKVSVWKKFYLIYSFF  361

Query  784   FVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFW  605
             FV KI+AHV+TF+ YC+V+PATV +PE+++P WGA+Y+P+   LL +L   RS+++  +W
Sbjct  362   FVRKIIAHVVTFVLYCVVMPATVFVPEVQVPKWGAIYIPSAITLLNVLGSTRSMYLVVYW  421

Query  604   MLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHL  428
             +LFENVM+LHRT  TF+GL E GR++EW+VTEK G+  KT     A +  RFR+GER+H+
Sbjct  422   ILFENVMSLHRTKATFVGLFESGRVNEWIVTEKLGDALKTKMGSKASRKLRFRVGERVHV  481

Query  427   WEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              E+ VG ++LFCGWY+  FG + +YVYLFLQ  +F V+GFGYIG FV  S
Sbjct  482   LELFVGLHLLFCGWYDFSFGKSRFYVYLFLQAAAFFVVGFGYIGVFVPNS  531



>ref|XP_009793131.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Nicotiana sylvestris]
Length=531

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/530 (65%), Positives = 439/530 (83%), Gaps = 2/530 (0%)
 Frame = -1

Query  1864  IMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAV  1685
             ++FSS AA+  A + I   +G+ W Q KA +I P+LR+++++CL +  M+ +E++Y+G V
Sbjct  3     MIFSSSAALLSARNGITSQVGLFWQQTKAPLIAPLLRIVLFVCLALSFMLFVERLYMGIV  62

Query  1684  SAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLS  1505
              A++KL RR P K+YKWE +KK DD E+GNS YP VLVQIPM NEK VYQLSIGAACNLS
Sbjct  63    IAFIKLLRRKPEKKYKWESMKK-DDLELGNSSYPMVLVQIPMYNEKEVYQLSIGAACNLS  121

Query  1504  WPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHS  1325
             WP NRI IQVLDDSTDP +KALV+QECRRWA KGVNIKYE RDNRKG+KAG+L++GMKHS
Sbjct  122   WPANRIFIQVLDDSTDPAIKALVEQECRRWASKGVNIKYEIRDNRKGYKAGALREGMKHS  181

Query  1324  YVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSM  1145
             YVK C +VAIFDADF+P+PDFL R IPFLVHNP+IGLVQARW++VNA+EC++TR+QEMS+
Sbjct  182   YVKLCSHVAIFDADFQPEPDFLERAIPFLVHNPEIGLVQARWEFVNADECLMTRMQEMSL  241

Query  1144  DRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKF  965
               HF+VEQEVGSAIHAFFGFNGTAG+WR++AL++AGGWKDRTTVEDMDL  RAGL GWKF
Sbjct  242   GYHFTVEQEVGSAIHAFFGFNGTAGVWRMSALNEAGGWKDRTTVEDMDLAVRAGLNGWKF  301

Query  964   VFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFF  785
             V++ D++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI  NKKV++WKK YLIY+FF
Sbjct  302   VYVCDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAKEIATNKKVSVWKKFYLIYSFF  361

Query  784   FVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFW  605
             FV KI+AH++TF+ YC+V+PATV +PE+++P WGA+Y+P+   +L +L  PRS+++  +W
Sbjct  362   FVRKIIAHIVTFVLYCVVMPATVFVPEVQVPKWGAIYIPSAITILNVLGSPRSMYLVVYW  421

Query  604   MLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHL  428
             +LFENVM+LHRT  TF+GL E GR++EW+VTEK G+  KT       +  RFR+GER+HL
Sbjct  422   ILFENVMSLHRTKATFVGLFESGRVNEWIVTEKLGDALKTKVSSKTSRKLRFRVGERVHL  481

Query  427   WEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              E+ VG Y+ FCGWY+  FG + ++VYLFLQ  +F V+GFGY+G FV  S
Sbjct  482   LELFVGLYLWFCGWYDFSFGKSRFHVYLFLQAAAFFVVGFGYVGVFVPNS  531



>ref|XP_010912224.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Elaeis guineensis]
Length=533

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/534 (65%), Positives = 443/534 (83%), Gaps = 6/534 (1%)
 Frame = -1

Query  1876  SSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVY  1697
             SS AI+     A +GA D I   +G++W Q KA VIVP+LR+ V+LCL M +M+ +EKVY
Sbjct  5     SSTAIL---PEAFQGARDDITEQMGLVWQQIKAPVIVPLLRLTVFLCLAMSVMLFVEKVY  61

Query  1696  LGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAA  1517
             +  V   +KL  + P K+Y+WEP++  DD E+GNS YP VL+QIPM NEK VYQLSIGAA
Sbjct  62    MAVVIVIVKLLGKRPEKRYRWEPMR--DDLELGNSAYPMVLLQIPMYNEKEVYQLSIGAA  119

Query  1516  CNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQG  1337
             C LSWP++RIIIQVLDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+G
Sbjct  120   CGLSWPSDRIIIQVLDDSTDPVIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEG  179

Query  1336  MKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQ  1157
             MKHSYVK C+YVAIFDADF+P+PDFL+RTIPFLVHNP++ LVQARWK+VN++EC++TR+Q
Sbjct  180   MKHSYVKDCDYVAIFDADFQPEPDFLFRTIPFLVHNPELALVQARWKFVNSDECLMTRMQ  239

Query  1156  EMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLK  977
             EMS+D HF+VEQEVGS  +AFFGFNGTAG+WRI+AL +AGGWKDRTTVEDMDL  RA LK
Sbjct  240   EMSLDYHFTVEQEVGSLTYAFFGFNGTAGVWRISALREAGGWKDRTTVEDMDLAVRASLK  299

Query  976   GWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLI  797
             GWKFVFLGD++VK+ELPS+ KAYRYQQHRWSCGPANLF+KM  EI+RNKKV+++KK+++I
Sbjct  300   GWKFVFLGDLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMLLEIVRNKKVSLFKKVHVI  359

Query  796   YAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHM  617
             Y FFFV KIVAH++TF++YCLV+PATVL+PE++IP WGA+Y+P++  LL  +  PRSLH+
Sbjct  360   YNFFFVRKIVAHIVTFVFYCLVIPATVLVPEVQIPKWGAVYIPSIITLLNAVGTPRSLHL  419

Query  616   TAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGE  440
               FW+LFENVM+LHRT  TFIGLLEVGR++EWVVTEK G+  K      A + PR R+G+
Sbjct  420   LVFWILFENVMSLHRTKATFIGLLEVGRVNEWVVTEKLGDALKMKMAAKAARKPRIRIGD  479

Query  439   RLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             RLHL E+ VG Y+ FCG Y++ FG N++++YLFLQ  +F ++GFGY+G FV+ S
Sbjct  480   RLHLLELGVGAYLFFCGCYDVAFGKNHFFIYLFLQATAFFIVGFGYVGTFVSHS  533



>gb|KDP45030.1| hypothetical protein JCGZ_01530 [Jatropha curcas]
Length=533

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/539 (65%), Positives = 442/539 (82%), Gaps = 7/539 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MDG SS+   +F S    +   D I   L ++W   KA ++VPVL+++V +CL M IM+ 
Sbjct  1     MDGLSSTT--IFPS--TFQSGQDDITSQLNLVWQVLKAPILVPVLKLLVTMCLAMSIMLF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+G V A++KL  R P+K+YKWEP+K  DD E+GNS YP VLVQIPM NEK VYQL
Sbjct  57    IERVYMGVVIAFVKLLGRKPSKRYKWEPMK--DDIELGNSSYPMVLVQIPMYNEKEVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RIIIQVLDDSTDP +K+LV+ EC+R A KG+NIKYE RDNR G+KAG
Sbjct  115   SIGAACGLSWPSDRIIIQVLDDSTDPAIKSLVEMECQRRASKGINIKYEIRDNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMKHSYVK C+YVAIFDADF+P+PDFL+R IPFL+HNP IGLVQARWK+VNA+EC+
Sbjct  175   ALKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRAIPFLLHNPQIGLVQARWKFVNADECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF VEQEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFKVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKFV++ D++VK+ELPS+FKAYRYQQHRWSCGPANLFKKM  EI+RNKKV++WK
Sbjct  295   RASLKGWKFVYIADLKVKNELPSTFKAYRYQQHRWSCGPANLFKKMAMEIVRNKKVSLWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             KLY+IY+FFFV KIVAH++TF++YC+VLPATVL+PE+++P WG++Y+P+   LL  +  P
Sbjct  355   KLYVIYSFFFVRKIVAHIVTFLFYCVVLPATVLVPEVQVPKWGSVYIPSTITLLNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPR  455
             RSLH+  FW+LFENVM+LHRT  TFIGL+E GR++EWVVTEK G+  K+     A K PR
Sbjct  415   RSLHLLIFWVLFENVMSLHRTKATFIGLVEAGRVNEWVVTEKLGDALKSKGSAKAPKKPR  474

Query  454   FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              R+GER+HL E+ VG Y+ FCG Y+  FG N Y++YLFLQ ++F V G GY+G FV  S
Sbjct  475   IRIGERIHLLELGVGAYLFFCGCYDFAFGKNSYFIYLFLQSIAFFVAGIGYVGTFVPNS  533



>ref|XP_002283672.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Vitis vinifera]
Length=533

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/539 (64%), Positives = 445/539 (83%), Gaps = 7/539 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  SS+  +      A++G  D I+  LGV+W Q KA VIVP++ + V +CL M +M+ 
Sbjct  1     MDRLSSTTLL----PDALQGTRDDISEQLGVVWSQIKAPVIVPLMSIAVAVCLAMSLMLF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
              E+VYL  V   +KLF R P K+YKWEP+K  DD E+GNS YP VLVQIPM NEK VYQL
Sbjct  57    FERVYLSIVIVLVKLFGRKPDKRYKWEPMK--DDVELGNSAYPMVLVQIPMYNEKEVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RIIIQVLDDSTDP +K LV+ EC+RWA KG+NIKYE R+NR G+KAG
Sbjct  115   SIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRNNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMKHSYVK C+YVAIFDADF+P+PDFL+RT+PFLVHNP+I LVQARWK+VN++EC+
Sbjct  175   ALKEGMKHSYVKECDYVAIFDADFQPEPDFLWRTVPFLVHNPEIALVQARWKFVNSDECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKFV+LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WK
Sbjct  295   RASLKGWKFVYLGTLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVSLWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY+FF V K+VAH++TF++YC+VLPATVL+P++++P WGA+Y+PT+  +L  +  P
Sbjct  355   KVHVIYSFFIVRKLVAHIVTFVFYCVVLPATVLVPDVEVPRWGAVYIPTIITILNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPR  455
             RSLH+  FW+LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+  K      A K PR
Sbjct  415   RSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVNEWVVTEKLGDALKVKAATKAPKKPR  474

Query  454   FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             F++GERLHL E+ VG ++ FCG Y++ FG N+Y++YL++Q ++F ++GFGY+G FV  S
Sbjct  475   FKIGERLHLLELGVGAFLFFCGCYDVAFGRNHYFIYLYVQAIAFFIVGFGYVGTFVPKS  533



>ref|XP_008804385.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Phoenix 
dactylifera]
Length=533

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/524 (66%), Positives = 437/524 (83%), Gaps = 5/524 (1%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
              ++GA D I   +G++W Q KA VIVP+LR+ V+LCL M +M+ +EKVY+  V   +KL 
Sbjct  13    TLQGARDDITEQMGLVWQQIKAPVIVPLLRLTVFLCLAMSVMLFVEKVYMAVVIVIVKLL  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              + P K+YKWEP++  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RII
Sbjct  73    GKRPEKRYKWEPMR--DDLELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRII  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMKHSYVK C+Y
Sbjct  131   IQVLDDSTDPVIKDLVEVECKRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKDCDY  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+PDFL RTIPFLVHNP+I LVQARWK+VN++EC++TR+QEMS+D HF+VE
Sbjct  191   VAIFDADFQPEPDFLSRTIPFLVHNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFTVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS+ +AFFGFNGTAG+WR++AL +AGGWKDRTTVEDMDL  RA LKGWKFVFLGD++
Sbjct  251   QEVGSSTYAFFGFNGTAGVWRLSALSEAGGWKDRTTVEDMDLAVRASLKGWKFVFLGDIK  310

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+ KAYRYQQHRWSCGPANLF+KM  EI RNKKV+++KK+++IY FFFV KIVA
Sbjct  311   VKNELPSTLKAYRYQQHRWSCGPANLFRKMLLEIARNKKVSLFKKVHVIYNFFFVRKIVA  370

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TF++YCLV+PATVL+PE++IP WGA+Y+P++  LL  +  PRSLH+  FW+LFENVM
Sbjct  371   HIVTFVFYCLVIPATVLVPEVEIPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVM  430

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ--PKSAKKVPRFRLGERLHLWEIIVG  410
             +LHRT  T IGLLE GR++EWVVTEK G+    +   KSA+K PR R+G+RLHL E+ VG
Sbjct  431   SLHRTKATLIGLLEAGRVNEWVVTEKLGDALKMKMATKSARK-PRIRIGDRLHLLELGVG  489

Query  409   FYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              Y+ FCG Y++  G N+Y++YLF+Q  +F ++GFGY+G FV+ S
Sbjct  490   SYLFFCGCYDVALGKNHYFIYLFVQAAAFFIVGFGYVGTFVSHS  533



>ref|XP_011094427.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Sesamum 
indicum]
Length=532

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/519 (66%), Positives = 434/519 (84%), Gaps = 4/519 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G GD    +L V+W Q +A +IVP+LRV V+LCL M  M+ +E+VY+  V   +KLF R 
Sbjct  17    GRGDMTEQFL-VIWSQIRAPLIVPLLRVAVFLCLAMSAMLFVERVYMAVVITLVKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YKWEP+K  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RIIIQV
Sbjct  76    PDKRYKWEPLK--DDLELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+G+KHSYVK C+YVAI
Sbjct  134   LDDSTDPIIKNLVEMECQRWASKGINIKYEIRDNRNGYKAGALKEGLKHSYVKQCDYVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL+RTIPFLVHN  + LVQARWK+VNA+EC++TRLQEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLWRTIPFLVHNSQLALVQARWKFVNADECLMTRLQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ +AFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKF++LG ++VK+
Sbjct  254   GSSTYAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RN KV++WKK+++IY+FFF+ KIVAH++
Sbjct  314   ELPSTFKAYRYQQHRWSCGPANLFRKMLVEIIRNTKVSLWKKVHVIYSFFFIRKIVAHIV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF++YC+VLPATVL+PE++IP WGA+YVP++  LL  +  PRSLH+  FW+LFENVM+LH
Sbjct  374   TFVFYCVVLPATVLVPEVQIPKWGAVYVPSIITLLNAVGTPRSLHLLVFWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYML  398
             RT  TFIGLLE GR++EW+VTEK G+  K      A + PRFRLGER+HL E+  G Y+ 
Sbjct  434   RTKATFIGLLEAGRVNEWIVTEKLGDAHKLKSALKAFRRPRFRLGERIHLLELATGGYLF  493

Query  397   FCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             FCG Y+++FG N+Y++YLFLQ  +F ++GFGYIG FV +
Sbjct  494   FCGCYDIVFGKNHYFIYLFLQATAFFIMGFGYIGTFVPS  532



>ref|XP_002315357.1| 4-mannan synthase family protein [Populus trichocarpa]
 gb|EEF01528.1| 4-mannan synthase family protein [Populus trichocarpa]
Length=530

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/539 (65%), Positives = 440/539 (82%), Gaps = 10/539 (2%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  SS++ I  +         D I    G++W   K  +IVP L+++V +CL M IM+ 
Sbjct  1     MDRVSSASNIFPTGR-------DDITGQFGLIWQVLKEPLIVPALKLLVVVCLGMSIMLF  53

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+G V  ++KLF + P K YKWEP+K  DD E+GNS YP VLVQIPM NEK VYQL
Sbjct  54    IERVYMGIVIVFVKLFGKKPNKMYKWEPMK--DDIEVGNSAYPMVLVQIPMYNEKEVYQL  111

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RIIIQVLDDSTDP +K+LV+ EC+RWA KG+NIKYE RDNRKG+KAG
Sbjct  112   SIGAACGLSWPSDRIIIQVLDDSTDPAIKSLVELECQRWASKGINIKYEIRDNRKGYKAG  171

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMKHSYVK C+YVAIFDADF+P+P++L+RTIPFLVHNP+I LVQARWK+VN++EC+
Sbjct  172   ALKEGMKHSYVKQCDYVAIFDADFQPEPNYLWRTIPFLVHNPEIALVQARWKFVNSDECL  231

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGSA +AFFGFNGTAG+WRI+A+++AGGWKDRTTVEDMDL  
Sbjct  232   MTRMQEMSLDYHFTVEQEVGSATYAFFGFNGTAGVWRISAVNEAGGWKDRTTVEDMDLAV  291

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKFV++GD++VK+ELPS+FKAYRYQQHRWSCGPANLFKKM  EI++NKKV++WK
Sbjct  292   RASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANLFKKMAIEIIKNKKVSLWK  351

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K Y+IY+FFFV KIVAH++TF++YC+VLP+TVL+PE+ +P WGA+Y+P++  LL  +  P
Sbjct  352   KCYVIYSFFFVRKIVAHIVTFVFYCVVLPSTVLVPEVSVPKWGAVYIPSIVTLLNAVGTP  411

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPR  455
             RSLH+  FW+LFENVM+LHRT  TFIGLLE+GR++EWVVTEK G+  K   P  A K PR
Sbjct  412   RSLHLMVFWILFENVMSLHRTKATFIGLLEIGRVNEWVVTEKLGDALKGKLPAKATKKPR  471

Query  454   FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              R+ ERLHL E+  G Y+ FCG Y+  FG N YY++LFLQ ++F + GFGYIG FV  S
Sbjct  472   IRIRERLHLLELCAGAYLFFCGCYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVPNS  530



>ref|XP_009404378.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/537 (65%), Positives = 446/537 (83%), Gaps = 9/537 (2%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  +S+A +      + +GA D I   +G++W Q KA V+VP+LR+ V+LCLVM +M++
Sbjct  1     MDRLTSTALL----PESFQGARDDITEQMGMVWQQIKAPVMVPLLRLAVFLCLVMSVMLV  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +EK Y+  V   +KLF R P K+Y+WEP++  DD E+G+S YP VLVQIPM NEK VYQL
Sbjct  57    VEKAYMAVVIVLVKLFGRRPEKRYRWEPMR--DDLELGSSSYPMVLVQIPMYNEKEVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RIIIQVLDDSTDP +K LV+ ECRRWA KGVNIKYE RDNR G+KAG
Sbjct  115   SIGAACGLSWPSDRIIIQVLDDSTDPVIKDLVEAECRRWASKGVNIKYEIRDNRSGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMKHSYV  C+YVAIFDADF+P+PDFLYRT+PFL+HNP +GLVQARWK+VN++EC+
Sbjct  175   ALKEGMKHSYVNHCDYVAIFDADFQPEPDFLYRTVPFLLHNPAVGLVQARWKFVNSDECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             + R+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  
Sbjct  235   MARMQEMSLDYHFTVEQEVGSSAYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKFVFLGD++VK+ELPS+ +AYRYQQHRWSCGPANLF+KM  EI  NKKV++WK
Sbjct  295   RASLKGWKFVFLGDLKVKNELPSTLRAYRYQQHRWSCGPANLFRKMAMEIANNKKVSLWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY+FFFV K+VAH++TF++YC+V+PA VL+PE++IP WGA+Y+P++ ALL  +  P
Sbjct  355   KVHVIYSFFFVRKVVAHIVTFVFYCVVIPAAVLVPEVEIPRWGAIYIPSIIALLNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ--PKSAKKVP  458
             RSLH+  FW+LFENVM+LHRT  T IGLLE GR++EWVVTEK G+T  A+   K+A+K P
Sbjct  415   RSLHLLVFWILFENVMSLHRTKATLIGLLEAGRVNEWVVTEKLGDTVKAKMAVKAARK-P  473

Query  457   RFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
               R+G+RLHL E+  G Y+ FCG Y++ FG N+Y++YLFLQ ++F V+GFGY+G FV
Sbjct  474   PIRIGDRLHLLELWTGAYLFFCGCYDVAFGKNHYFLYLFLQAIAFFVVGFGYVGTFV  530



>ref|XP_004239715.2| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
lycopersicum]
Length=526

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/519 (66%), Positives = 430/519 (83%), Gaps = 6/519 (1%)
 Frame = -1

Query  1822  AIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQ  1643
              I   +G+ W Q +A ++VP L++MV LCL M +M+ ++KVY+G V  ++K+ R+ P K+
Sbjct  10    GITSQIGLFWQQVRAPLLVPFLKIMVILCLAMSLMLFVDKVYMGIVIIFIKILRKKPEKK  69

Query  1642  YKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDS  1463
             YKWEPIK  DD E+ NS YP VL+QIPM NE+ VYQLSIGAACNLSWP NRI+IQVLDDS
Sbjct  70    YKWEPIK--DDLELANSSYPMVLIQIPMYNEREVYQLSIGAACNLSWPANRILIQVLDDS  127

Query  1462  TDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDAD  1283
             TDP +K +V+QEC+RWA KGVNIKYE RDNRKG+KAG+LK+GMKH+YVK C++VAIFDAD
Sbjct  128   TDPIIKVMVEQECKRWASKGVNIKYEIRDNRKGYKAGALKEGMKHNYVKMCDFVAIFDAD  187

Query  1282  FEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAI  1103
             F+P+ DFL RT+PFLVHNP+IGLVQARWK+VN++EC+LTR+QEMS+D HF VEQEVGS+ 
Sbjct  188   FQPEFDFLLRTVPFLVHNPEIGLVQARWKFVNSDECLLTRMQEMSLDYHFKVEQEVGSSN  247

Query  1102  HAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPS  923
             HAFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RAGLKGWKFV++GD++VK+ELPS
Sbjct  248   HAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYIGDLKVKNELPS  307

Query  922   SFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIY  743
             +FKAYRYQQHRWSCGPANLFKKM  EI  NKKV+IWK+ YLIY+FFFV KI+AH++TFI+
Sbjct  308   TFKAYRYQQHRWSCGPANLFKKMVGEIASNKKVSIWKRFYLIYSFFFVRKIIAHMVTFIF  367

Query  742   YCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIG  563
             YC+++P TVLIPE+++P+WGA+Y+P+   LL  +  PRS ++  FW+LFENVM+LHRT  
Sbjct  368   YCVIIPTTVLIPEVQVPIWGAVYIPSTITLLNAVGTPRSFYLLIFWILFENVMSLHRTRA  427

Query  562   TFIGLLEVGRIHEWVVTEKQGN-TKTAQPKSAKKVPRFRLGE---RLHLWEIIVGFYMLF  395
             TFIGL EVGR++EWVVTEK G+  K        +  RFR+GE   ++H  E+ VG Y++ 
Sbjct  428   TFIGLFEVGRVNEWVVTEKLGDGIKAKTSTKGSRRSRFRIGEWYNKVHFVEVFVGLYLML  487

Query  394   CGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             CGWY+  FG N +Y+YLFLQGV+FLV GFGYIG FV  S
Sbjct  488   CGWYDYSFGKNRFYIYLFLQGVAFLVAGFGYIGVFVPNS  526



>ref|XP_010050059.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Eucalyptus 
grandis]
 gb|KCW89262.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=533

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/520 (65%), Positives = 431/520 (83%), Gaps = 3/520 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             GA D I+  L ++W Q KA ++VP+LRV V+LCL M +M+ +E+VY+  V   +KLF R 
Sbjct  16    GARDDISMQLSLIWAQIKAPLLVPLLRVAVFLCLAMSLMLFLERVYMAVVILLVKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+Y+WEPIK  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RIIIQV
Sbjct  76    PEKRYRWEPIK--DDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K LV+ EC+RWA KG+NI+YE RDNR G+KAG+LK+GMK SYVK C+YVAI
Sbjct  134   LDDSTDPTIKDLVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRSYVKQCDYVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
              DADF+P+PDFL+RTIPFLVHNP++ LVQARWK+VNA+EC++TR+QEMS+D HF+VEQEV
Sbjct  194   LDADFQPEPDFLWRTIPFLVHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKFV+LG ++VK+
Sbjct  254   GSSTHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSLKVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYR+QQHRWSCGPANLF+KM  EI+RNKKVT+WKK+++IY+FF V KIVAH++
Sbjct  314   ELPSTFKAYRFQQHRWSCGPANLFRKMAMEIIRNKKVTLWKKVHVIYSFFLVRKIVAHIV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TFI+YC+VLPATV +PE+ +P WGA+Y+P++  +L  +  PRSLH+  FW+LFENVM+ H
Sbjct  374   TFIFYCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILFENVMSFH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYML  398
             RT  TFIGLLE GR++EW+VTEK G+  K        K P+FR G+RLH+ E+ VG Y+ 
Sbjct  434   RTKATFIGLLEAGRVNEWIVTEKLGDALKVKASNKVPKKPKFRFGDRLHVLELGVGAYLF  493

Query  397   FCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             FCG Y++ FG N+Y++YLF Q ++F ++GFGYIG FV  S
Sbjct  494   FCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPNS  533



>ref|XP_009771587.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=533

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/520 (65%), Positives = 430/520 (83%), Gaps = 3/520 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G  D I     ++W Q KA +IVP+LR+ V LCL M +M+ +E+VY+  V + +KLF R 
Sbjct  16    GTRDDITEQFAIMWEQIKAPLIVPLLRIAVLLCLAMSVMLFIERVYMFIVISLVKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YKWEPIK  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RII+Q+
Sbjct  76    PEKRYKWEPIK--DDVELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIVQI  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP  K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LKQG+KHSYVK C++VAI
Sbjct  134   LDDSTDPITKNLVEMECQRWASKGINIKYEVRDNRSGYKAGALKQGLKHSYVKQCDFVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL+RTIPFLVHNP++ LVQARWKYVNA+EC++TR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLWRTIPFLVHNPELSLVQARWKYVNADECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GSA HAFFGFNGTAG+WRIAA+D+AGGWKDRTTVEDMDL  RA LKGWKF++L  + VK+
Sbjct  254   GSATHAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSSLMVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WKK+++IY+FFFV K+VAH++
Sbjct  314   ELPSTFKAYRYQQHRWSCGPANLFRKMFMEIVRNKKVSLWKKVHVIYSFFFVRKVVAHIV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF++Y +VLPATVL+PE+++P WGA+Y+P +  LL  +  PRSLH+  FW+LFENVM+LH
Sbjct  374   TFVFYVVVLPATVLVPEVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYML  398
             RT  TFIGLLEVGR++EW+VTEK G+  K      A +  R RLG+R+HL E+  G Y+ 
Sbjct  434   RTKATFIGLLEVGRVNEWIVTEKLGDALKLKSAAKAFRKHRMRLGDRIHLLELAAGAYLF  493

Query  397   FCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             FCG Y++ FG+N+Y++YLF+Q  +F ++GFGY+G FV  S
Sbjct  494   FCGCYDIAFGNNHYFLYLFIQAFAFFIVGFGYVGTFVPNS  533



>ref|XP_009421122.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/536 (66%), Positives = 439/536 (82%), Gaps = 7/536 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  SS+A +      A +G  D I   +G++W Q +  V+VP+LR+ V+LCLVM +M+ 
Sbjct  1     MDRLSSTAIL----PEAFQGTRDDITQQMGIVWEQIRTPVVVPLLRLSVFLCLVMSVMLF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +EKVY+  V   +KLFR  P  +YK EP+   DD E+GN+GYP VL+QIPM NEK VYQL
Sbjct  57    VEKVYMAVVIVLVKLFRWRPETRYKCEPMG--DDPELGNAGYPMVLIQIPMYNEKEVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RIIIQVLDDSTDP +K LVQ EC+RWA KGVNIKYE RDNR G+KAG
Sbjct  115   SIGAACGLSWPSDRIIIQVLDDSTDPAIKELVQIECQRWASKGVNIKYEIRDNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMKHSYVK C+YVAIFDADF+P+PDFL+RTIPFL HNP IGLVQ RWK+VN+N+C+
Sbjct  175   ALKEGMKHSYVKHCDYVAIFDADFQPEPDFLWRTIPFLEHNPRIGLVQGRWKFVNSNDCL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRI AL++AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRINALNEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKF+FLGD+RVKSELPS+  AYRYQQHRWSCGPANLF+KM  EI +NKKVT+W 
Sbjct  295   RASLKGWKFIFLGDLRVKSELPSTLTAYRYQQHRWSCGPANLFRKMVLEIAKNKKVTLWT  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY+FFFV KIVAH++TFI+YC+V+PATVL+PE+++P WG +Y+P++  LL  +  P
Sbjct  355   KVHVIYSFFFVRKIVAHIVTFIFYCVVIPATVLVPEVQVPKWGLVYIPSIITLLNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGN-TKTAQPKSAKKVPR  455
             RSLH+  FW+LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+  KT     A K+PR
Sbjct  415   RSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDGMKTKAGAKAAKIPR  474

Query  454   FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              R+GERLHL E++ G Y++FCG Y+L FG NYYY+YLF Q V+F ++GFGY+G FV
Sbjct  475   IRIGERLHLLELLTGAYLVFCGCYDLAFGKNYYYLYLFFQAVAFFIVGFGYVGTFV  530



>gb|KDP42759.1| hypothetical protein JCGZ_23699 [Jatropha curcas]
Length=532

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/538 (64%), Positives = 440/538 (82%), Gaps = 6/538 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  +++A I      A +GA D I+    ++W Q KA +IVP+LR+ V +CL+M +M+ 
Sbjct  1     MDRLTTTAVI----PDAFQGARDDISMQFSIIWDQIKAPLIVPLLRLAVAICLIMSLMLF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+G V   +KLF R P K+YKWEP+K  DD E+GNS YP VLVQIPM NE+ VYQL
Sbjct  57    IERVYMGIVIILVKLFGRKPEKRYKWEPLK--DDVELGNSAYPMVLVQIPMYNEREVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RIIIQVLDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR G+KAG
Sbjct  115   SIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRDNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMK SYVK C+YV IFDADF+P+PDFL+RTIPFLVHNP + LVQARWK+VN++EC+
Sbjct  175   ALKEGMKRSYVKHCDYVVIFDADFQPEPDFLWRTIPFLVHNPQLALVQARWKFVNSDECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKF++LG ++VK+ELPS+ KAYRYQQHRWSCGPANLF+KM  EI+ NKKVT+WK
Sbjct  295   RASLKGWKFLYLGSLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIINKKVTLWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY+FF V KIVAH++TFI+YC+VLPATVL+PE+++P WGA+Y+P++  LL  +  P
Sbjct  355   KVHVIYSFFLVRKIVAHIVTFIFYCVVLPATVLVPEVEVPKWGAVYIPSIITLLNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRF  452
             RSLH+  FW+LFENVM+LHRT  TFIGLLE  R++EW+VTEK G+   ++   A K PRF
Sbjct  415   RSLHLLVFWILFENVMSLHRTKATFIGLLEASRVNEWIVTEKLGDAVKSKAVKAPKKPRF  474

Query  451   RLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             + GERLHL E+  G Y+ FCG Y++ FG N+Y++YLF Q ++F +IGFGY+G FV  S
Sbjct  475   KFGERLHLLELGTGAYLFFCGCYDVAFGKNHYFLYLFAQAIAFFIIGFGYVGTFVPQS  532



>ref|XP_007010197.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
 gb|EOY19007.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
Length=535

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/539 (65%), Positives = 437/539 (81%), Gaps = 5/539 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  S ++  M      V  + D I   +G++W Q KA +IVPVL+ MV LCL M IM+ 
Sbjct  1     MDQISETSRTMIPVTFQV--SQDDITGQVGLIWQQTKAPLIVPVLKGMVVLCLAMSIMLF  58

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+G V  ++KLF R P K YK EP+K  DD E+G S YP VLVQIPM NEK VYQL
Sbjct  59    VERVYMGIVIVFVKLFGRKPEKMYKLEPMK--DDVELGYSAYPMVLVQIPMYNEKEVYQL  116

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP +RIIIQVLDDSTDP +K LV+ EC+RWA KG+N+KYE RDNR G+KAG
Sbjct  117   SIGAACGLSWPADRIIIQVLDDSTDPAIKTLVELECQRWASKGINVKYEIRDNRNGYKAG  176

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMKHSYV  C+YVAIFDADF+P+PDFL+RTIPFLV NP+I LVQARWK+VN++EC+
Sbjct  177   ALKEGMKHSYVNQCDYVAIFDADFQPEPDFLWRTIPFLVSNPEIALVQARWKFVNSDECL  236

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF VEQEVGS+ HAFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  
Sbjct  237   MTRMQEMSLDYHFIVEQEVGSSTHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAV  296

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKFV++GD++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RN+KV++WK
Sbjct  297   RASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAVEIIRNRKVSLWK  356

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K Y+IY+FFFV KIVAH++TFI+YC+VLPATV +PE+++P WGA+Y+P++  LL  +  P
Sbjct  357   KFYVIYSFFFVRKIVAHLVTFIFYCVVLPATVFVPEVEVPKWGAVYIPSIVTLLNAVGTP  416

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPR  455
             RSLH+  FW+LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+  KT     A + PR
Sbjct  417   RSLHLLIFWILFENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALKTKLGGKAPRKPR  476

Query  454   FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              ++GER+HL E+ VG Y+ FCG Y+L FG N Y+++LFLQ ++F + G GY+G FV TS
Sbjct  477   IQIGERIHLLELAVGAYLFFCGCYDLAFGKNRYFIFLFLQSIAFFIAGVGYVGTFVPTS  535



>ref|XP_008232025.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Prunus 
mume]
Length=517

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/511 (67%), Positives = 428/511 (84%), Gaps = 3/511 (1%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
              G++  QAKA +IVP+L+ +V +CL M +M+ +EKVY+G +  ++KLFRR P K +KWE 
Sbjct  9     FGLVLQQAKAPLIVPLLKFLVVVCLGMSVMLFVEKVYMGIIIIFIKLFRRRPLKHWKWEA  68

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             IK  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RIIIQVLDDSTDP +
Sbjct  69    IK--DDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTI  126

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMKHSYVK C+YVAIFDADF+P+P
Sbjct  127   KDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEP  186

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFLYRTIPFLVHN DI LVQARWK+VN++EC++TR+QEMS+D HF+VEQEVGSA +AFFG
Sbjct  187   DFLYRTIPFLVHNSDIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSATYAFFG  246

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA L+GWKFV+L D++VK+ELPS+FKAY
Sbjct  247   FNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLRGWKFVYLSDLKVKNELPSTFKAY  306

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             RYQQHRWSCGPANLF+KM  EI+RNKKV+  KK ++IY+FFFV KIVAH++TF++YC++L
Sbjct  307   RYQQHRWSCGPANLFRKMVMEIVRNKKVSPLKKFHVIYSFFFVRKIVAHIVTFVFYCVIL  366

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             PATVL+PE+++P+WGA+Y+P+   LL  +  PRSLH+  FW+LFENVM+LHRT  TFIGL
Sbjct  367   PATVLVPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKATFIGL  426

Query  547   LEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIF  371
              E GR++EWVVTEK G+  K      A + PR R+GERLH+ E+IVGFY+ FCG Y+L F
Sbjct  427   FEAGRVNEWVVTEKLGDALKKKLGAKAPRKPRLRIGERLHMLELIVGFYLFFCGCYDLAF  486

Query  370   GDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             G N Y++YLF+Q V+F + G GY+G FV  S
Sbjct  487   GKNGYFIYLFIQSVAFFIAGVGYVGTFVPNS  517



>ref|XP_007220072.1| hypothetical protein PRUPE_ppa024741mg [Prunus persica]
 gb|EMJ21271.1| hypothetical protein PRUPE_ppa024741mg [Prunus persica]
Length=517

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/511 (67%), Positives = 428/511 (84%), Gaps = 3/511 (1%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
              G++  QAKA +IVP+L+ +V +CL M +M+ +EKVY+G +  ++KLFRR P K +KWE 
Sbjct  9     FGLVLQQAKAPLIVPLLKFLVVVCLGMSVMLFVEKVYMGIIIIFIKLFRRRPVKHWKWEA  68

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             IK  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RIIIQVLDDSTDP +
Sbjct  69    IK--DDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTI  126

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMKHSYVK C+YVAIFDADF+P+P
Sbjct  127   KDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEP  186

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFLYRTIPFLVHN DI LVQARWK+VN++EC++TR+QEMS+D HF+VEQEVGSA +AFFG
Sbjct  187   DFLYRTIPFLVHNSDIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSATYAFFG  246

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA L+GWKFV+L D++VK+ELPS+FKAY
Sbjct  247   FNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLRGWKFVYLSDLKVKNELPSTFKAY  306

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             RYQQHRWSCGPANLF+KM  EI+RNKKV+  KK ++IY+FFFV K+VAH++TF++YC++L
Sbjct  307   RYQQHRWSCGPANLFRKMVMEIVRNKKVSPLKKFHVIYSFFFVRKVVAHIVTFVFYCVIL  366

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             PATVL+PE+++P+WGA+Y+P+   LL  +  PRSLH+  FW+LFENVM+LHRT  TFIGL
Sbjct  367   PATVLVPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKATFIGL  426

Query  547   LEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIF  371
              E GR++EWVVTEK G+  K      A + PR R+GERLH+ E+IVGFY+ FCG Y+L F
Sbjct  427   FEAGRVNEWVVTEKLGDALKKKLGAKAPRKPRLRIGERLHVLELIVGFYLFFCGCYDLAF  486

Query  370   GDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             G N Y++YLF+Q V+F + G GY+G FV  S
Sbjct  487   GKNGYFIYLFIQSVAFFIAGVGYVGTFVPNS  517



>gb|EYU41550.1| hypothetical protein MIMGU_mgv1a004346mg [Erythranthe guttata]
Length=532

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/538 (63%), Positives = 440/538 (82%), Gaps = 7/538 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  SS+A +         GA D I     ++W Q KA +IVP+L + V+LCL M  M+ 
Sbjct  1     MDQFSSTAVL----PEPFSGARDDITEQFMIIWGQIKAPLIVPLLNIAVFLCLTMSAMLF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+  V + +KLF R P K+YKWEP+K  DD E+GNS YP VLVQIPM NEK VYQL
Sbjct  57    IERVYMAVVISLIKLFGRKPDKRYKWEPLK--DDLELGNSSYPMVLVQIPMYNEKEVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RII+QVLDDSTDP +K +V+ EC+RWA KG+NIKYE RDNR G+KAG
Sbjct  115   SIGAACGLSWPSDRIIVQVLDDSTDPIIKNMVEIECQRWASKGINIKYEIRDNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LKQG+KHSYVK C++VAIFDADF+P+PDFL++TIPFLVHNP++ LVQARWK+VNA+EC+
Sbjct  175   ALKQGLKHSYVKQCDFVAIFDADFQPEPDFLWKTIPFLVHNPELALVQARWKFVNADECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRIAA+D+AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKF++LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKVT+WK
Sbjct  295   RASLKGWKFLYLGSLQVKNELPSTFKAYRYQQHRWSCGPANLFRKMVVEIIRNKKVTLWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY+FFF+ KIVAH++TF++YC+VLPATVL+PE+ IP WGA+Y+P++  +L  +  P
Sbjct  355   KVHVIYSFFFIRKIVAHIVTFVFYCVVLPATVLVPEVYIPKWGAIYIPSIITILNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPR  455
             RSLH+  FW+LFENVM+LHRT  TFIGLLE GR++EW+VTEK G+  K      A K PR
Sbjct  415   RSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDAFKLKSALKAFKKPR  474

Query  454   FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             F++GER+H  E+  G Y+ FCG Y+++FG N+YY+ L++Q ++F ++GF YIG FV +
Sbjct  475   FKIGERVHFLEVATGAYLFFCGCYDVVFGKNHYYICLYVQAIAFFIMGFSYIGTFVPS  532



>emb|CBI30236.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/535 (64%), Positives = 441/535 (82%), Gaps = 7/535 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  SS+  +      A++G  D I+  LGV+W Q KA VIVP++ + V +CL M +M+ 
Sbjct  1     MDRLSSTTLL----PDALQGTRDDISEQLGVVWSQIKAPVIVPLMSIAVAVCLAMSLMLF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
              E+VYL  V   +KLF R P K+YKWEP+K  DD E+GNS YP VLVQIPM NEK VYQL
Sbjct  57    FERVYLSIVIVLVKLFGRKPDKRYKWEPMK--DDVELGNSAYPMVLVQIPMYNEKEVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RIIIQVLDDSTDP +K LV+ EC+RWA KG+NIKYE R+NR G+KAG
Sbjct  115   SIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRNNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMKHSYVK C+YVAIFDADF+P+PDFL+RT+PFLVHNP+I LVQARWK+VN++EC+
Sbjct  175   ALKEGMKHSYVKECDYVAIFDADFQPEPDFLWRTVPFLVHNPEIALVQARWKFVNSDECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKFV+LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WK
Sbjct  295   RASLKGWKFVYLGTLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVSLWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY+FF V K+VAH++TF++YC+VLPATVL+P++++P WGA+Y+PT+  +L  +  P
Sbjct  355   KVHVIYSFFIVRKLVAHIVTFVFYCVVLPATVLVPDVEVPRWGAVYIPTIITILNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPR  455
             RSLH+  FW+LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+  K      A K PR
Sbjct  415   RSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVNEWVVTEKLGDALKVKAATKAPKKPR  474

Query  454   FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAF  290
             F++GERLHL E+ VG ++ FCG Y++ FG N+Y++YL++Q ++F ++GFGY+   
Sbjct  475   FKIGERLHLLELGVGAFLFFCGCYDVAFGRNHYFIYLYVQAIAFFIVGFGYVATL  529



>ref|XP_006341174.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=533

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/520 (65%), Positives = 428/520 (82%), Gaps = 3/520 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G  D I    G++W Q KA +IVP+LR+ V+LCL M +M+ +E+VY+  V   LK+F   
Sbjct  16    GTRDDITEQFGIMWGQIKAPLIVPLLRISVFLCLAMSVMLFIERVYMFVVITLLKVFGTK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YKWEP+K  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RII+QV
Sbjct  76    PEKRYKWEPLK--DDVELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIVQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP  K LV  EC+RWA KG+NIKYE RDNR G+KAG+LK+G+KHSYVK C++VAI
Sbjct  134   LDDSTDPITKNLVDIECQRWASKGINIKYEVRDNRSGYKAGALKEGLKHSYVKQCDFVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL++TIPFLVHNP++ LVQARWKYVNA+EC++TR+QEMS+D HFSVEQEV
Sbjct  194   FDADFQPEPDFLWQTIPFLVHNPELSLVQARWKYVNADECLMTRMQEMSLDYHFSVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAG+WRIAA+D+AGGWKDRTTVEDMDL  RA LKGWKF+FLG V+VK+
Sbjct  254   GSSTHAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLFLGSVKVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+ KAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WKK+++IY+FFFV K+VAH++
Sbjct  314   ELPSTLKAYRYQQHRWSCGPANLFRKMCMEIIRNKKVSLWKKVHVIYSFFFVRKVVAHIV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF++Y +VLPATVL+PE+++P WGA+Y+P +  LL  +  PRSLH+  FW+LFENVM+LH
Sbjct  374   TFVFYVVVLPATVLVPEVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYML  398
             RT  TFIGLLE GR++EW+VTEK G+  K      A K  R RLG+R+HL E   G Y+ 
Sbjct  434   RTKATFIGLLEAGRVNEWIVTEKLGDALKLKSATKAFKKHRMRLGDRIHLLEFAAGAYLF  493

Query  397   FCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             FCG Y++ FG N+Y++YLF+Q  +FL++GFGY+G F+  S
Sbjct  494   FCGCYDIAFGTNHYFLYLFIQSFAFLIVGFGYVGTFIPNS  533



>gb|KEH24115.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=531

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/531 (63%), Positives = 443/531 (83%), Gaps = 7/531 (1%)
 Frame = -1

Query  1876  SSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVY  1697
             SS  I F    A++GA D +   + ++W Q KA +IVP+LR+ V+LCL+M +M+ +E+VY
Sbjct  5     SSTTIPF----ALQGAKDDLTMQISLIWSQIKAPLIVPLLRISVFLCLIMSVMMFIERVY  60

Query  1696  LGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAA  1517
             +G V   +KLF R P K+YKWEPIK  DD E+GNS YP VLVQIPM NE+ VYQLSIGAA
Sbjct  61    MGVVITLVKLFGRKPEKRYKWEPIK--DDIELGNSCYPMVLVQIPMYNEREVYQLSIGAA  118

Query  1516  CNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQG  1337
             C LSWP++RIIIQVLDDSTDP +K LVQ EC+RWA KGVNIKYE RDNR G+KAG+LK+G
Sbjct  119   CGLSWPSDRIIIQVLDDSTDPTIKELVQLECQRWASKGVNIKYEVRDNRNGYKAGALKEG  178

Query  1336  MKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQ  1157
             MKHSYVK C++VAIFDADF+P+PDFL+RT+PF+VHNP+IGL+QARWK+VN++ECM+TR+Q
Sbjct  179   MKHSYVKQCDHVAIFDADFQPEPDFLWRTVPFMVHNPEIGLIQARWKFVNSDECMMTRMQ  238

Query  1156  EMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLK  977
             EMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LK
Sbjct  239   EMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLK  298

Query  976   GWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLI  797
             GWKF++L +++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WKK+++I
Sbjct  299   GWKFLYLSNLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMVLEIIRNKKVSLWKKIHVI  358

Query  796   YAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHM  617
             Y+FFFV K++AH+ TF++YC+VLPATVL+PE+ +P WGA+Y+P++  LL  +  PRSLH+
Sbjct  359   YSFFFVRKVIAHINTFVFYCIVLPATVLVPEVAVPKWGAVYIPSVITLLNAVGTPRSLHL  418

Query  616   TAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKS-AKKVPRFRLGE  440
               FW+LFENVM+LHR   T IGLLE  R++EW+VTEK G+   A+  + A K PRFR+ +
Sbjct  419   LVFWILFENVMSLHRAKATVIGLLEASRVNEWIVTEKLGDALKAKAGTKALKKPRFRIED  478

Query  439   RLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             R+HL E+ VG Y+ F G Y+++FG N+++++LF+Q ++F ++ FGY+G FV
Sbjct  479   RIHLLELGVGMYLFFIGCYDVMFGKNHFFIFLFIQAIAFFIMAFGYVGTFV  529



>ref|XP_009793130.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Nicotiana sylvestris]
Length=553

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/552 (62%), Positives = 439/552 (80%), Gaps = 24/552 (4%)
 Frame = -1

Query  1864  IMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAV  1685
             ++FSS AA+  A + I   +G+ W Q KA +I P+LR+++++CL +  M+ +E++Y+G V
Sbjct  3     MIFSSSAALLSARNGITSQVGLFWQQTKAPLIAPLLRIVLFVCLALSFMLFVERLYMGIV  62

Query  1684  SAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLS  1505
              A++KL RR P K+YKWE +KK DD E+GNS YP VLVQIPM NEK VYQLSIGAACNLS
Sbjct  63    IAFIKLLRRKPEKKYKWESMKK-DDLELGNSSYPMVLVQIPMYNEKEVYQLSIGAACNLS  121

Query  1504  WPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHS  1325
             WP NRI IQVLDDSTDP +KALV+QECRRWA KGVNIKYE RDNRKG+KAG+L++GMKHS
Sbjct  122   WPANRIFIQVLDDSTDPAIKALVEQECRRWASKGVNIKYEIRDNRKGYKAGALREGMKHS  181

Query  1324  YVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSM  1145
             YVK C +VAIFDADF+P+PDFL R IPFLVHNP+IGLVQARW++VNA+EC++TR+QEMS+
Sbjct  182   YVKLCSHVAIFDADFQPEPDFLERAIPFLVHNPEIGLVQARWEFVNADECLMTRMQEMSL  241

Query  1144  DRHFSVEQEVGSAIHAF----------------------FGFNGTAGIWRIAALDDAGGW  1031
               HF+VEQEVGSAIHAF                      FGFNGTAG+WR++AL++AGGW
Sbjct  242   GYHFTVEQEVGSAIHAFFGFNGRLPPPPGRQSDLQSMHLFGFNGTAGVWRMSALNEAGGW  301

Query  1030  KDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMT  851
             KDRTTVEDMDL  RAGL GWKFV++ D++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM 
Sbjct  302   KDRTTVEDMDLAVRAGLNGWKFVYVCDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMA  361

Query  850   FEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYV  671
              EI  NKKV++WKK YLIY+FFFV KI+AH++TF+ YC+V+PATV +PE+++P WGA+Y+
Sbjct  362   KEIATNKKVSVWKKFYLIYSFFFVRKIIAHIVTFVLYCVVMPATVFVPEVQVPKWGAIYI  421

Query  670   PtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-  494
             P+   +L +L  PRS+++  +W+LFENVM+LHRT  TF+GL E GR++EW+VTEK G+  
Sbjct  422   PSAITILNVLGSPRSMYLVVYWILFENVMSLHRTKATFVGLFESGRVNEWIVTEKLGDAL  481

Query  493   KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVI  314
             KT       +  RFR+GER+HL E+ VG Y+ FCGWY+  FG + ++VYLFLQ  +F V+
Sbjct  482   KTKVSSKTSRKLRFRVGERVHLLELFVGLYLWFCGWYDFSFGKSRFHVYLFLQAAAFFVV  541

Query  313   GFGYIGAFVTTS  278
             GFGY+G FV  S
Sbjct  542   GFGYVGVFVPNS  553



>ref|XP_008456578.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=518

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/511 (67%), Positives = 422/511 (83%), Gaps = 3/511 (1%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             +G  W Q  + +I P L++ V +CLVM +M+  E+VY+G V  ++KLFR+ P K YKWEP
Sbjct  10    MGNFWHQTTSPLIAPFLKLFVSICLVMSLMLFFERVYMGIVILFVKLFRKNPHKTYKWEP  69

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             I+  DD E+ +  YP VLVQIPM NEK VYQLSIGAAC LSWPTNRIIIQVLDDSTD  +
Sbjct  70    IR--DDLELAHFAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPTNRIIIQVLDDSTDLSI  127

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMKH+YVK C+YVAIFDADF+P+P
Sbjct  128   KDLVELECKRWANKGINIKYEIRDNRNGYKAGALKEGMKHNYVKLCDYVAIFDADFQPEP  187

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFL+RT+PFL +NP+I LVQARWK+VN++EC++TR+QEMS+D HF VEQEVGSA +AFFG
Sbjct  188   DFLWRTVPFLTNNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFKVEQEVGSATYAFFG  247

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA LKGWKFV++GD++VK+ELPS+FKAY
Sbjct  248   FNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTFKAY  307

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             RYQQHRWSCGPANLFKKM  EIMRNKKV++WKKLYLIY+FFFV KIVAH++TF++YC++L
Sbjct  308   RYQQHRWSCGPANLFKKMVTEIMRNKKVSLWKKLYLIYSFFFVRKIVAHIVTFVFYCVIL  367

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             PATVL+PE+ +P WGA+Y+P+   LL  +  PRS H+  FW+LFENVM+LHRT  TFIGL
Sbjct  368   PATVLVPEVSVPKWGAVYIPSTITLLNAVGTPRSFHLIIFWILFENVMSLHRTKATFIGL  427

Query  547   LEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIF  371
             LE GR++EWVVTEK G+  KT     A + PRFRLGERLH+ E+ VG Y+ FCGWY+L F
Sbjct  428   LEAGRVNEWVVTEKLGDALKTKLGSKAPRKPRFRLGERLHILELCVGAYLFFCGWYDLNF  487

Query  370   GDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             G N Y++YLFLQ  +F + G GY+G  V  S
Sbjct  488   GKNQYFIYLFLQSFAFFIAGVGYVGTMVPNS  518



>ref|XP_008359466.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Malus 
domestica]
Length=534

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/521 (64%), Positives = 430/521 (83%), Gaps = 4/521 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G  D I+  +G++W Q KA +IVP+LR+ V LC +M +M+ +E++Y+  V   +KLF R 
Sbjct  16    GGRDDISMQMGLIWSQIKAPLIVPLLRLAVVLCXIMSVMLFVERLYMAVVIVLIKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YKWEP+K  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RIIIQV
Sbjct  76    PEKRYKWEPMK--DDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K +V+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMK SYVKSC++VAI
Sbjct  134   LDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKSCDFVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL+RTIPFL+HNP++ LVQ RWK+VN+NEC++TR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLWRTIPFLLHNPELALVQTRWKFVNSNECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+GWKFV+LG ++VKS
Sbjct  254   GSSTHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLQGWKFVYLGSIQVKS  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKVT WKK+++IY+FFFV KI+AH+ 
Sbjct  314   ELPSTFKAYRYQQHRWSCGPANLFRKMVMEIIRNKKVTFWKKVHVIYSFFFVRKIIAHIN  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
              F++YC+VLPATVL+PE+ +P WG +Y+P+L  LL  +  PRS+H+  FW+LFEN+M+LH
Sbjct  374   AFVFYCIVLPATVLVPEVVVPKWGGIYIPSLITLLNAVGTPRSIHLLVFWILFENIMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAK--KVPRFRLGERLHLWEIIVGFYM  401
             RT  T IGLLE  R++EW+VTEK G+       + K  + PRFR+GERLHL E+ VG Y+
Sbjct  434   RTKATIIGLLEASRVNEWIVTEKLGDALKTLKVATKLPRKPRFRIGERLHLLELAVGLYL  493

Query  400   LFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              FCG Y+ IFG NY+Y++L++Q  +F +IGFGY+G FV  S
Sbjct  494   FFCGCYDFIFGKNYFYLFLYIQATAFFIIGFGYVGTFVPNS  534



>ref|XP_002269110.2| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Vitis vinifera]
 emb|CAN62185.1| hypothetical protein VITISV_019367 [Vitis vinifera]
Length=529

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/521 (65%), Positives = 429/521 (82%), Gaps = 3/521 (1%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +G    I   +G++W Q +  ++VP+L++MV +CL M +M+ +E+VY+G V A +KLF R
Sbjct  11    QGTSYGIGDRIGLIWEQTREPLMVPLLKLMVVVCLTMSVMLFVERVYMGIVIALVKLFGR  70

Query  1657  TPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQ  1478
              P ++Y WEP+K  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP+ RIIIQ
Sbjct  71    KPEQRYNWEPMK--DDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSERIIIQ  128

Query  1477  VLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVA  1298
             VLDDSTDP +K LV+ EC+RWA KG+NIKYE R NR G+KAG+LK+GMKHSYVK C+YVA
Sbjct  129   VLDDSTDPTIKDLVEMECQRWASKGINIKYEIRGNRHGYKAGALKEGMKHSYVKQCDYVA  188

Query  1297  IFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQE  1118
             IFDADF+P+PDFL+RTIPFLVHNP+IGLVQARWK+VN++EC++TR+QEMS+D HF+VEQE
Sbjct  189   IFDADFQPEPDFLWRTIPFLVHNPEIGLVQARWKFVNSDECLMTRMQEMSLDYHFTVEQE  248

Query  1117  VGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVK  938
             VGS+ HAFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKFV++G ++VK
Sbjct  249   VGSSSHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGALKVK  308

Query  937   SELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHV  758
             +ELPS+FKAYRYQQHRWSCGPANLFKKM  EI RNKKV +WKK+Y+IY+FFFV KIVAH+
Sbjct  309   NELPSTFKAYRYQQHRWSCGPANLFKKMAIEIARNKKVNLWKKVYVIYSFFFVRKIVAHI  368

Query  757   LTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMAL  578
             +TF++YC+V PATV  PE+++P+WGA+Y+P+   LL  +  PRSLH+  FW+LFENVM+L
Sbjct  369   VTFLFYCVVFPATVFFPEVEVPMWGAVYIPSTITLLNAVGTPRSLHLLVFWILFENVMSL  428

Query  577   HRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYM  401
             HRT  TF+GLLEVGR++EWVVTEK G+  K        K PR R+GER+HL E+ VG Y+
Sbjct  429   HRTKATFMGLLEVGRVNEWVVTEKLGDALKMKSSTKTSKKPRIRIGERMHLLELGVGAYL  488

Query  400   LFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              FCG Y++ +G N +++YLF Q ++F + GFGY+G FV  S
Sbjct  489   FFCGCYDVTYGKNGFFIYLFFQSMAFFIAGFGYVGTFVPNS  529



>ref|XP_003554414.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
 gb|KHN02265.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=533

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/539 (63%), Positives = 442/539 (82%), Gaps = 7/539 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  SSS  +      A +GA D     L ++W Q KA +IVP+LR+ V+LCL+M +M+ 
Sbjct  1     MDRFSSSTIL----PEAFQGAKDDFTMQLALVWNQIKAPLIVPLLRLAVFLCLIMSVMMF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+G V   +KLF R P K+YKWEP+K  DD E+GNS YP VLVQ+PM NE+ VYQL
Sbjct  57    IERVYMGIVITLVKLFGRKPEKRYKWEPMK--DDIELGNSCYPMVLVQVPMYNEREVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RIIIQVLDDSTDP +K LVQ EC+RWA KGVNIKYE RDNR G+KAG
Sbjct  115   SIGAACGLSWPSDRIIIQVLDDSTDPTIKELVQLECQRWASKGVNIKYEVRDNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMK SYVK C+ VAIFDADF+P+PDFL+RT+PFLVHNP++ L+QARWK+VNA+EC+
Sbjct  175   ALKEGMKRSYVKQCDCVAIFDADFQPEPDFLWRTVPFLVHNPELALIQARWKFVNADECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKF++L D++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+ NKKV++WK
Sbjct  295   RASLKGWKFLYLSDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMVMEIINNKKVSLWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY+FFFV K+VAH+ TF++YC+VLPATVL+PE+ +P WGA+Y+P++  +L  +  P
Sbjct  355   KIHVIYSFFFVRKVVAHINTFVFYCIVLPATVLVPEVVVPKWGAVYIPSIITILNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPR  455
             RSLH+  FW+LFENVM+LHRT  T IGLLE  R++EWVVTEK G+  KT     A K PR
Sbjct  415   RSLHLMVFWILFENVMSLHRTKATIIGLLEASRVNEWVVTEKLGDALKTKAGGKAPKKPR  474

Query  454   FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             FR+G+R+HL E+ V FY+ FCG Y+++FG N+++++LF+Q ++FL++ FGY+G  V  S
Sbjct  475   FRIGDRIHLLELGVAFYLFFCGCYDIMFGKNHFFIFLFIQSLAFLIMAFGYVGTIVPNS  533



>emb|CDP15350.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/520 (65%), Positives = 429/520 (83%), Gaps = 3/520 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G  D +     ++W Q KA +IVP+L++ V +CL+M +M+ +E+VY+G V   +KLF R 
Sbjct  16    GGRDDMTEQFSMVWAQIKAPLIVPLLKLAVMVCLIMSVMLFIERVYMGVVILLVKLFARK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YKWEPIK  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RIIIQV
Sbjct  76    PEKRYKWEPIK--DDLELGNSAYPVVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +KALV+ EC+RWA KGVNIKYE RDNR G+KAG+LK+G+ H+YVK C+YVAI
Sbjct  134   LDDSTDPIIKALVETECQRWASKGVNIKYEIRDNRNGYKAGALKEGLNHAYVKQCDYVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL+RTIPFLVHNP + LVQARWK+VNA+EC++TR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLWRTIPFLVHNPQLALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ +AFFGFNGTAG+WR+AA+D+AGGWKDRTTVEDMDL  RA L+GWKFV+LG + VK+
Sbjct  254   GSSTYAFFGFNGTAGVWRLAAIDEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGSLVVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKVT+WKK+++IY+FF V KI+AH++
Sbjct  314   ELPSTFKAYRYQQHRWSCGPANLFRKMVMEIIRNKKVTLWKKVHVIYSFFLVRKIIAHLI  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF++YC++LP+TVL+PE+++P WGA+Y+P +  LL  +  PRSLH+  FW+LFENVM+LH
Sbjct  374   TFVFYCVLLPSTVLVPEVQVPKWGAVYIPCVITLLNAVGTPRSLHLMVFWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYML  398
             RT  TF+GLLE  R++EWVVTEK G+  K      A + PRFR GERLHL E+  G Y+ 
Sbjct  434   RTKATFVGLLESSRVNEWVVTEKLGDALKNKSAVKAIRKPRFRFGERLHLLELGTGAYLF  493

Query  397   FCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             FCG Y++ FG N+YY+YLF Q ++F + GFGYIG FV  S
Sbjct  494   FCGCYDVAFGKNHYYLYLFTQAIAFFIAGFGYIGTFVPNS  533



>ref|XP_003521436.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
 gb|KHN18723.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=533

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/539 (63%), Positives = 441/539 (82%), Gaps = 7/539 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  SSS  +      A +GA D     L ++W Q KA +IVP+LR+ V+LCL+M +M+ 
Sbjct  1     MDRFSSSTIL----PEAFQGAKDDFTMQLALVWNQIKAPLIVPLLRITVFLCLIMSVMMF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+G V   +KLF R P K+YKWEP+K  DD E+GNS YP VLVQ+PM NE+ VYQL
Sbjct  57    IERVYMGIVITLVKLFGRKPEKRYKWEPMK--DDIELGNSSYPMVLVQVPMYNEREVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RIIIQVLDDSTDP +K LVQ EC+RWA KGVNIKYE RDNR G+KAG
Sbjct  115   SIGAACGLSWPSDRIIIQVLDDSTDPTIKELVQLECQRWASKGVNIKYEVRDNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMK SYVK C+ VAIFDADF+P+PDFL+RT+PFLVHNP++ L+QARWK+VNA+EC+
Sbjct  175   ALKEGMKRSYVKQCDCVAIFDADFQPEPDFLWRTVPFLVHNPELALIQARWKFVNADECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKF++L D++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+ NKKV++WK
Sbjct  295   RASLKGWKFLYLSDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAMEIINNKKVSLWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY+FFFV K+VAH+ TF++YC+VLPATVL+PE+ +P WGA+Y+P++  +L  +  P
Sbjct  355   KIHVIYSFFFVRKVVAHINTFVFYCIVLPATVLVPEVVVPKWGAVYIPSIITILNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQP-KSAKKVPR  455
             RSLH+  FW+LFENVM+LHRT  T IGLLE  R++EWVVTEK G+   A+    A K PR
Sbjct  415   RSLHLMVFWILFENVMSLHRTKATIIGLLEASRVNEWVVTEKLGDALKAKAGGKAPKKPR  474

Query  454   FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             FR+G+R+HL E+ V FY+ FCG Y+++FG N+++++LF+Q  +FL++ FGY+G  V  S
Sbjct  475   FRIGDRIHLLELGVAFYLFFCGCYDVMFGKNHFFIFLFIQSFAFLIMAFGYVGTIVPNS  533



>ref|XP_007219015.1| hypothetical protein PRUPE_ppa004315mg [Prunus persica]
 gb|EMJ20214.1| hypothetical protein PRUPE_ppa004315mg [Prunus persica]
Length=517

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/511 (67%), Positives = 426/511 (83%), Gaps = 3/511 (1%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
              G++  QAKA +IVP+L+ +V +CL M +M+ +EKVY+G +   +KLFRR P K +KWE 
Sbjct  9     FGLVLQQAKATLIVPLLKFLVVVCLGMSLMLFVEKVYMGIMIILIKLFRRRPVKHWKWEA  68

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             IK  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RIIIQVLDDSTDP +
Sbjct  69    IK--DDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTI  126

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K LV+ EC+RWA KG+NIKYE RD+R GFKAGSLK+GMKHSYVK C+YVAIFDADF+P+P
Sbjct  127   KDLVELECQRWASKGINIKYEIRDDRNGFKAGSLKEGMKHSYVKQCDYVAIFDADFQPEP  186

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFLYRTIPFLVHN DI LVQARWK+VN++EC++TR+QEM++D HF+VEQEVGSA +AFFG
Sbjct  187   DFLYRTIPFLVHNSDIALVQARWKFVNSDECLMTRMQEMTLDYHFTVEQEVGSATYAFFG  246

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRIAAL+DAGGWKD TTVEDMDL  RA LKGWKFV+L D++VK+ELPS+FKAY
Sbjct  247   FNGTAGVWRIAALNDAGGWKDCTTVEDMDLAVRASLKGWKFVYLSDLKVKNELPSTFKAY  306

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             RYQQHRWSCGPANLF+KM  EI+RNKKV+  KK ++IY+FFFV KIVAH++TF++YC++L
Sbjct  307   RYQQHRWSCGPANLFRKMVMEIVRNKKVSPLKKFHVIYSFFFVRKIVAHIVTFVFYCVIL  366

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             PATVL+PE+++P+WGA+Y+P+   LL  +  PRSLH+  FW+LFENVM+LHRT  TFIGL
Sbjct  367   PATVLVPEVQVPIWGAVYIPSTITLLNAVGTPRSLHLLIFWILFENVMSLHRTKATFIGL  426

Query  547   LEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIF  371
              E GR++EWVVTEK G+  K      A + PR R+GERLH+ E+IVGFY+ FCG Y+L F
Sbjct  427   FEAGRVNEWVVTEKLGDALKKKLGAKAPRKPRLRIGERLHVLELIVGFYLFFCGCYDLAF  486

Query  370   GDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             G N Y++YLF+Q V+F + G GY+G FV  S
Sbjct  487   GKNGYFIYLFIQSVAFFIAGVGYVGTFVPNS  517



>ref|XP_009623019.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=526

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/517 (65%), Positives = 432/517 (84%), Gaps = 3/517 (1%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             D +   L +LW Q KA +IVP+LR+ V+LCL+M IM+ +E+VY+G V   +K F + P K
Sbjct  12    DDLTVQLTILWEQIKAPLIVPLLRIAVFLCLLMSIMLFIERVYMGIVIILVKFFGKKPEK  71

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +YKWE +K  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RII+QVLDD
Sbjct  72    RYKWESLK--DDVELGNSSYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIVQVLDD  129

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP +K LV  EC+RWA KG+NIKYE RDNR G+KAG+LK+G+KH YVK C+YVAIFDA
Sbjct  130   STDPIIKNLVSMECQRWASKGINIKYEIRDNRNGYKAGALKEGLKHQYVKQCDYVAIFDA  189

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF+P+PDFL+RTIPFLVHNP++GLVQARWKYVNA+EC++TR+QEMS+D HF+VEQEVGS+
Sbjct  190   DFQPEPDFLWRTIPFLVHNPELGLVQARWKYVNADECLMTRMQEMSLDYHFTVEQEVGSS  249

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              +AFFGFNGTAG+WRIAA+D+AGGWKDRTTVEDMDL  RA LKGWKF++L  ++VK+ELP
Sbjct  250   TYAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSSLKVKNELP  309

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKAYRYQQHRWSCGPANLF+KM  EI+RN+KV++WKK+++IY+FFFV K++AH++TF+
Sbjct  310   STFKAYRYQQHRWSCGPANLFRKMFTEIIRNRKVSLWKKIHVIYSFFFVRKVIAHIVTFV  369

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+VLPATVL+PE+++P WGA+Y+P++  LL  +  PRS H+  FW+LFENVM+LHRT 
Sbjct  370   FYCIVLPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSFHLIIFWILFENVMSLHRTK  429

Query  565   GTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCG  389
              TFIGLLE GR++EW+VTEK G+  K      A K PRFR G+RLHL E+  G Y+ FCG
Sbjct  430   ATFIGLLEAGRVNEWIVTEKLGDAFKIKSAMKAFKKPRFRFGDRLHLLELATGAYLFFCG  489

Query  388   WYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              Y++ FG N+Y++YLF+Q  +FL++GFG++G FV  S
Sbjct  490   CYDIAFGKNHYFLYLFIQAFAFLIMGFGHVGTFVPNS  526



>ref|XP_004494136.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=533

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/539 (63%), Positives = 442/539 (82%), Gaps = 7/539 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  SS   I      A +GA D I     ++W Q KA +IVP+LR+ V+LCL+M +M+ 
Sbjct  1     MDHLSSITTI----PDAFQGAKDDITMQFLLIWSQIKAPLIVPLLRLAVFLCLIMSVMMF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+G V   +KLF + P K+YKWEPIK  DD E+GNS YP VLVQIPM NE+ VYQL
Sbjct  57    IERVYMGIVITLVKLFGKKPEKRYKWEPIK--DDIELGNSCYPMVLVQIPMYNEREVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RII+QVLDDSTDP +K LVQ EC+RWA KGVNIKYE RDNR G+KAG
Sbjct  115   SIGAACGLSWPSDRIIVQVLDDSTDPTIKELVQLECQRWASKGVNIKYEVRDNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMKHSYVK C+ VAIFDADF+P+PDFL+R++PFLVHNP++GL+QARWK+VNA+ECM
Sbjct  175   ALKEGMKHSYVKQCDLVAIFDADFQPEPDFLWRSVPFLVHNPELGLIQARWKFVNADECM  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKF++L +++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WK
Sbjct  295   RASLKGWKFLYLSNLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMVMEIIRNKKVSLWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY+FFFV K++AH+ TF++YC+VLPATVL+PE+ +P WGA+Y+P+L  LL  +  P
Sbjct  355   KIHVIYSFFFVRKVIAHINTFVFYCIVLPATVLVPEVSVPKWGAVYIPSLITLLNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGN-TKTAQPKSAKKVPR  455
             RSLH+  FW++FENVM+LHR   T IGLLE  R++EW+VTEK G+  KT     A K PR
Sbjct  415   RSLHLLVFWIMFENVMSLHRAKATIIGLLEASRVNEWIVTEKLGDAVKTKVRTKALKKPR  474

Query  454   FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             F++ +R+HL E+ VG Y++ CG Y+++FG N++Y++LF+Q ++F ++ FGY+G FV  S
Sbjct  475   FKIQDRIHLLELGVGMYLVICGCYDVMFGKNHFYIFLFIQAMAFFIMAFGYVGTFVPNS  533



>ref|XP_009365313.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=534

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/523 (65%), Positives = 435/523 (83%), Gaps = 8/523 (2%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G  D I+  +G++W Q KA +IVP+LR+ V LCL+M +M+ +E++Y+  V   +KLF R 
Sbjct  16    GGRDDISMQMGLIWSQIKAPLIVPLLRLAVVLCLIMSVMLFVERLYMAIVIVLIKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YKWEP+K  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RIIIQV
Sbjct  76    PEKRYKWEPMK--DDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K +V+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMK SYVKSC++VAI
Sbjct  134   LDDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKSCDFVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL+RTIPFL+H+P++ LVQ RWK+VN+NEC++TR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLWRTIPFLLHSPELALVQTRWKFVNSNECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKFV+LG ++VK+
Sbjct  254   GSSTHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSIQVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKVT WKK+++IY+FFFV KI+AH+ 
Sbjct  314   ELPSTFKAYRYQQHRWSCGPANLFRKMVMEIIRNKKVTCWKKVHVIYSFFFVRKIIAHIN  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
              F++YC+VLPATVL+PE+ +P WG +Y+P+L  LL  +  PRS+H+  FW+LFENVM+LH
Sbjct  374   AFVFYCIVLPATVLVPEVVVPKWGGIYIPSLITLLNAVGTPRSIHLLVFWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVP---RFRLGERLHLWEIIVGF  407
             RT  T IGLLE  R++EW+VTEK G+  KT   K A K+P   RFR+GERLHL E+ VG 
Sbjct  434   RTKATIIGLLEASRVNEWIVTEKLGDALKTL--KVATKLPRKSRFRIGERLHLLELAVGL  491

Query  406   YMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             Y++FCG Y+ IFG NY+Y++L++Q  +F +IGFGY+G FV  S
Sbjct  492   YLIFCGCYDFIFGKNYFYLFLYIQATAFFIIGFGYVGTFVPNS  534



>ref|XP_006492171.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Citrus 
sinensis]
Length=526

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/538 (66%), Positives = 443/538 (82%), Gaps = 12/538 (2%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  +S+A I+F          D I+  +G++W Q KA +IVP+L+++VYLCL + IM+ 
Sbjct  1     MDA-ASAATIIFP---------DRISGQMGLMWQQTKAPLIVPLLKLLVYLCLALSIMLF  50

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+G V   LKLF R P K+YKWE IK  DD E+GNS YP VLVQIPM NEK VYQL
Sbjct  51    VERVYMGIVIVLLKLFGRKPEKRYKWEAIK--DDVELGNSAYPMVLVQIPMYNEKEVYQL  108

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RI IQVLDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR G+KAG
Sbjct  109   SIGAACGLSWPSDRITIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRDNRNGYKAG  168

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMKHSYVK C+YVAIFDADF+P+PDFL+RTIPFLVHNPDI LVQARWK+VNA+EC+
Sbjct  169   ALKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRTIPFLVHNPDIALVQARWKFVNADECL  228

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  
Sbjct  229   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAV  288

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKFV++GD++VK+ELPS+FKAYRYQQHRWSCGPANLFKKM  EIMR KKVT+WK
Sbjct  289   RASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANLFKKMVGEIMRTKKVTLWK  348

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             KLY+IY+FFFV K+VAH++TF++YC++LPATVL PE+++P WGA+Y+P++  LL  +  P
Sbjct  349   KLYVIYSFFFVRKVVAHIVTFVFYCVLLPATVLFPEVEVPKWGAVYIPSIITLLNAVGTP  408

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRF  452
             RSLH+  FW+LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+ K+       K PR 
Sbjct  409   RSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDVKSKLGGKTLKKPRI  468

Query  451   RLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             R+GER+H+ E+ VG Y+  CG Y++ FG N+Y++YLFLQ ++F V G GY+G FV  S
Sbjct  469   RIGERVHVLELGVGAYLFLCGCYDVAFGKNHYFIYLFLQSIAFFVAGVGYVGTFVPNS  526



>gb|KDO40534.1| hypothetical protein CISIN_1g009761mg [Citrus sinensis]
Length=526

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/538 (66%), Positives = 443/538 (82%), Gaps = 12/538 (2%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  +S+A I+F          D I+  +G++W Q KA +IVP+L+++VYLCL + IM+ 
Sbjct  1     MDA-ASAATIIFP---------DRISGQMGLMWQQTKAPLIVPLLKLLVYLCLALSIMLF  50

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+G V   LKLF R P K+YKWE IK  DD E+GNS YP VLVQIPM NEK VYQL
Sbjct  51    VERVYMGIVIVLLKLFGRKPEKRYKWEAIK--DDVELGNSAYPMVLVQIPMYNEKEVYQL  108

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RI IQVLDDSTDP +K LV+ EC+RWA KG+NIKYE RD+R G+KAG
Sbjct  109   SIGAACGLSWPSDRITIQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRDSRNGYKAG  168

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMKHSYVK C+YVAIFDADFEP+PDFL+RTIPFLVHNPDI LVQARWK+VNA+EC+
Sbjct  169   ALKEGMKHSYVKQCDYVAIFDADFEPEPDFLWRTIPFLVHNPDIALVQARWKFVNADECL  228

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  
Sbjct  229   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAV  288

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKFV++GD++VK+ELPS+FKAYRYQQHRWSCGPANLFKKM  EIMR KKVT+WK
Sbjct  289   RASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANLFKKMVGEIMRTKKVTLWK  348

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             KLY+IY+FFFV K+VAH++TF++YC++LPATVL PE+++P WGA+Y+P++  LL  +  P
Sbjct  349   KLYVIYSFFFVRKVVAHIVTFVFYCVLLPATVLFPEVEVPKWGAVYIPSIITLLNAVGTP  408

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRF  452
             RSLH+  FW+LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+ K+       K PR 
Sbjct  409   RSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDVKSKLGGKTLKKPRI  468

Query  451   RLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             R+GER+H+ E+ VG Y+  CG Y++ FG N+Y++YLFLQ ++F V G GY+G FV  S
Sbjct  469   RIGERVHVLELGVGAYLFLCGCYDVAFGKNHYFIYLFLQSIAFFVAGVGYVGTFVPNS  526



>ref|XP_007027600.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY08102.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
Length=533

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/521 (65%), Positives = 434/521 (83%), Gaps = 3/521 (1%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +G  D  +  + V+W Q KA +IVP+LR+ V +CL+M +M+ +E+VY+G V   +KLF R
Sbjct  15    QGTRDDFSMQMAVIWGQIKAPLIVPLLRLTVIVCLIMSLMLFIERVYMGIVIMLVKLFGR  74

Query  1657  TPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQ  1478
              P ++YKWEPIK  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RIIIQ
Sbjct  75    KPERRYKWEPIK--DDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQ  132

Query  1477  VLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVA  1298
             VLDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMK SYVK C+YV 
Sbjct  133   VLDDSTDPTIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVV  192

Query  1297  IFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQE  1118
             IFDADF+P+PDFL+RTIPFLVHNP++ LVQARWK+VNA+EC++TR+QEMS+D HF+VEQE
Sbjct  193   IFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQE  252

Query  1117  VGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVK  938
             VGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA LKGWKF++LG ++VK
Sbjct  253   VGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVK  312

Query  937   SELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHV  758
             +ELPS+ KAYRYQQHRWSCGPANLF+KM  EI+ NKKV+ WKK+++IY+FF V K+VAH+
Sbjct  313   NELPSTLKAYRYQQHRWSCGPANLFRKMVMEIITNKKVSSWKKVHVIYSFFVVRKLVAHI  372

Query  757   LTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMAL  578
             +TFI+YC+VLPATVL+PE+++P WGA+Y+PT+  +L  +  PRSLH+  FW+LFENVM+L
Sbjct  373   VTFIFYCVVLPATVLVPEVEVPKWGAVYIPTIITILNAVGTPRSLHLLVFWILFENVMSL  432

Query  577   HRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKS-AKKVPRFRLGERLHLWEIIVGFYM  401
             HRT  TFIGLLE GR++EW+VTEK G+   A+  + A + PRFR GERLHL E+ VG Y+
Sbjct  433   HRTKATFIGLLEAGRVNEWIVTEKLGDALKAKAGTKAPRKPRFRFGERLHLLELCVGAYL  492

Query  400   LFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              FCG Y+++FG N+Y++YLF Q ++F ++GFGY+G  V  S
Sbjct  493   FFCGCYDVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS  533



>ref|XP_009774056.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
sylvestris]
Length=526

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/517 (65%), Positives = 431/517 (83%), Gaps = 3/517 (1%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             D +   L ++W Q KA +IVP+LR+ V+LCL+M IM+ +E+VY+G V   +K F + P K
Sbjct  12    DDLTVQLTIIWEQIKAPLIVPLLRIAVFLCLLMSIMLFIERVYMGIVIILVKFFGKKPEK  71

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +YKWE +K  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RII+QVLDD
Sbjct  72    RYKWESLK--DDVELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIVQVLDD  129

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP ++ LV  EC+RWA KG+NIKYE RDNR G+KAG+LK+G+KH YVK C+YVAIFDA
Sbjct  130   STDPIIRNLVSMECQRWASKGINIKYEIRDNRNGYKAGALKEGLKHQYVKQCDYVAIFDA  189

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF+P+PDFL+RTIPFLVHNP++GLVQARWKYVNA+EC++TR+QEMS+D HF+VEQEVGS+
Sbjct  190   DFQPEPDFLWRTIPFLVHNPELGLVQARWKYVNADECLMTRMQEMSLDYHFTVEQEVGSS  249

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              +AFFGFNGTAG+WRIAA+D+AGGWKDRTTVEDMDL  RA LKGWKF++L  ++VK+ELP
Sbjct  250   TYAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSSLKVKNELP  309

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKAYRYQQHRWSCGPANLF+KM  EI+RN+KV++WKK+++IY+FFFV K+VAH++TF+
Sbjct  310   STFKAYRYQQHRWSCGPANLFRKMFTEIIRNRKVSLWKKIHVIYSFFFVRKVVAHIVTFV  369

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+VLPATVL+PE+++P WGA+Y+P++  LL  +  PRS H+  FW+LFENVM+LHRT 
Sbjct  370   FYCIVLPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSFHLIIFWILFENVMSLHRTK  429

Query  565   GTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCG  389
              TFIGLLE GR++EW+VTEK G+  K      A K PRFR G+RLHL E+  G Y+ FCG
Sbjct  430   ATFIGLLEAGRVNEWIVTEKLGDAFKIKSAIKAFKKPRFRFGDRLHLLELATGAYLFFCG  489

Query  388   WYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              Y++ FG N+Y++YLF+Q  +F +IGFG++G FV  S
Sbjct  490   CYDIAFGKNHYFLYLFIQAFAFFIIGFGHVGTFVPNS  526



>gb|KCW89261.1| hypothetical protein EUGRSUZ_A01558 [Eucalyptus grandis]
Length=532

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/520 (65%), Positives = 430/520 (83%), Gaps = 4/520 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             GA D I+  L ++W Q KA ++VP+LRV V+LCL M +M+ +E+VY+  V   +KLF R 
Sbjct  16    GARDDISMQLSLIWAQIKAPLLVPLLRVAVFLCLAMSLMLFLERVYMAVVILLVKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+Y+WEPIK  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RIIIQV
Sbjct  76    PEKRYRWEPIK--DDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K LV+ EC+RWA KG+NI+YE RDNR G+KAG+LK+GMK SYVK C+YVAI
Sbjct  134   LDDSTDPTIKDLVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRSYVKQCDYVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
              DADF+P+PDFL+RTIPFLVHNP++ LVQARWK+VNA+EC++TR+QEMS+D HF+VEQEV
Sbjct  194   LDADFQPEPDFLWRTIPFLVHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKFV+LG ++VK+
Sbjct  254   GSSTHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSLKVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYR+QQHRWSCGPANLF+KM  EI+RN KVT+WKK+++IY+FF V KIVAH++
Sbjct  314   ELPSTFKAYRFQQHRWSCGPANLFRKMAMEIIRN-KVTLWKKVHVIYSFFLVRKIVAHIV  372

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TFI+YC+VLPATV +PE+ +P WGA+Y+P++  +L  +  PRSLH+  FW+LFENVM+ H
Sbjct  373   TFIFYCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILFENVMSFH  432

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYML  398
             RT  TFIGLLE GR++EW+VTEK G+  K        K P+FR G+RLH+ E+ VG Y+ 
Sbjct  433   RTKATFIGLLEAGRVNEWIVTEKLGDALKVKASNKVPKKPKFRFGDRLHVLELGVGAYLF  492

Query  397   FCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             FCG Y++ FG N+Y++YLF Q ++F ++GFGYIG FV  S
Sbjct  493   FCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPNS  532



>ref|XP_006360487.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=530

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/530 (64%), Positives = 432/530 (82%), Gaps = 3/530 (1%)
 Frame = -1

Query  1864  IMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAV  1685
             ++FSS  A+  A   I  ++G +  Q +  ++V  LR+++Y+CL +  M+ +E++Y+G V
Sbjct  3     VIFSSSQALLNAHSGITSHVGFIRQQPRTPLVVQFLRIILYVCLALSFMLFVERLYMGIV  62

Query  1684  SAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLS  1505
              A++KLFRR P K+YKWEP+K   D E+GN  YP VLVQ+PMCNEK VYQLSIGAACNLS
Sbjct  63    IAFVKLFRRKPEKKYKWEPLK--GDLELGNYSYPMVLVQLPMCNEKEVYQLSIGAACNLS  120

Query  1504  WPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHS  1325
             WP NRI IQVLDDSTDP +KALV+QECR+WA KGVNIKYE RDNRKG+KAG+L++GMKH+
Sbjct  121   WPANRIFIQVLDDSTDPTIKALVEQECRKWASKGVNIKYEIRDNRKGYKAGALREGMKHN  180

Query  1324  YVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSM  1145
             YVK C +VAIFDADF+P+PDFL R+IPFLVHNP+IGLVQARW++VNA+EC++T++QEMS 
Sbjct  181   YVKLCSHVAIFDADFQPEPDFLERSIPFLVHNPEIGLVQARWEFVNADECLMTKMQEMSF  240

Query  1144  DRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKF  965
               HF+VEQEVGS  HAFFGFNGTAG+WR++AL++AGGWKDRTTVEDMDL  RAGL GWKF
Sbjct  241   GYHFTVEQEVGSTAHAFFGFNGTAGVWRMSALNEAGGWKDRTTVEDMDLAVRAGLNGWKF  300

Query  964   VFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFF  785
             V++ D++VKSELPS+F+AYR QQHRWSCGPANLF+KM  EI  NKKV++WKK YLIY+FF
Sbjct  301   VYVDDLKVKSELPSTFRAYRNQQHRWSCGPANLFRKMAMEIATNKKVSVWKKFYLIYSFF  360

Query  784   FVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFW  605
             FV KI+AHV+TFI YC+V+PAT+ IPE+++P WG +Y+PT   LL +L   RS+ +  +W
Sbjct  361   FVRKIIAHVVTFILYCVVIPATIFIPEVQVPRWGTIYIPTAITLLNILGSARSMQLVVYW  420

Query  604   MLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHL  428
             +LFENVM+LHRT  TFIGL E GR++EW+VTEK G+  KT +   A K  +FR+GER+H+
Sbjct  421   ILFENVMSLHRTKATFIGLFESGRVNEWIVTEKLGDALKTKKGSKALKKLQFRVGERVHV  480

Query  427   WEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              E+ VG Y+LFCGWY+  FG N +YVYL LQ ++F V+GFGY+G FV  S
Sbjct  481   LELFVGLYLLFCGWYDYSFGRNRFYVYLLLQAMAFFVVGFGYVGVFVPNS  530



>ref|XP_006851749.1| hypothetical protein AMTR_s00040p00223350 [Amborella trichopoda]
 gb|ERN13216.1| hypothetical protein AMTR_s00040p00223350 [Amborella trichopoda]
Length=533

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/524 (65%), Positives = 434/524 (83%), Gaps = 5/524 (1%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             A +G GD I   + ++W Q +A +IVP+L++ V+LCL+M +M+ ME+VY+  V   +KLF
Sbjct  13    AFQGTGDDITDQMAIIWQQIRAPLIVPLLKLAVFLCLIMSLMLFMERVYMAVVIVLVKLF  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              + P K+YKWE IK  DD E+GN+ YP VLVQIPM NEK VYQLSIGAAC LSWP++RII
Sbjct  73    GKKPGKRYKWEAIK--DDLELGNANYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRII  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMKH YV+ C+Y
Sbjct  131   IQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHGYVRDCDY  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+PDFL+RTIPFL+HNP+IGLVQARWK+VN++EC++TR+QEMS+D HF+VE
Sbjct  191   VAIFDADFQPEPDFLWRTIPFLIHNPEIGLVQARWKFVNSDECLMTRMQEMSLDYHFTVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA LKGWKFV+LGD++
Sbjct  251   QEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLK  310

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI RNK+V++WKK+++IY FFFV KIVA
Sbjct  311   VKNELPSTFKAYRYQQHRWSCGPANLFRKMAMEIFRNKRVSLWKKIHVIYNFFFVRKIVA  370

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TF++YC+V+PATVL+PE++IP WGA+Y+P+   +L  L  PRSLH+  FW+LFENVM
Sbjct  371   HIVTFVFYCVVIPATVLVPEVEIPKWGAVYIPSTITILNALSSPRSLHLVVFWILFENVM  430

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRF--RLGERLHLWEIIVG  410
             +LHRT  TFIGL E  R++EWVVTEK G+    +    K V +F  R+G +LHL E+ VG
Sbjct  431   SLHRTKATFIGLAEARRVNEWVVTEKLGDALKGKA-GGKSVKKFWIRIGGKLHLLELGVG  489

Query  409   FYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              Y+ FC  Y+L FG N+Y++YL+LQ ++F ++GFGYIG FV  S
Sbjct  490   AYLFFCACYDLAFGKNHYFIYLYLQAMAFFIMGFGYIGTFVPHS  533



>ref|XP_003556282.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoformX1 
[Glycine max]
Length=529

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/528 (64%), Positives = 434/528 (82%), Gaps = 3/528 (1%)
 Frame = -1

Query  1858  FSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSA  1679
              SS A         A  +G++W QA+A ++VP+++++V LCL M +M+ +E+VY+G V  
Sbjct  4     LSSAATFESMHYGSASQMGLIWQQARAPLVVPLMKLLVVLCLAMSLMLFVERVYMGIVII  63

Query  1678  YLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWP  1499
             ++KLFR  P K+YKWEP++  DD E GNS YP VLVQIPM NEK VYQLSIGAAC LSWP
Sbjct  64    FVKLFRYKPEKKYKWEPLR--DDLEFGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWP  121

Query  1498  TNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYV  1319
             ++R+IIQVLDDSTDP +K +V+ EC+RWA KGVNIKYE R+NR G+KAG+LK+GMKHSYV
Sbjct  122   SDRVIIQVLDDSTDPIIKNMVEVECQRWASKGVNIKYEIRENRNGYKAGALKEGMKHSYV  181

Query  1318  KSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDR  1139
               C+YVAIFDADF+P+P+FL+RTIPFL +NP++ LVQARWK+VNA+EC++TR+QEMS+D 
Sbjct  182   NLCDYVAIFDADFQPEPNFLWRTIPFLAYNPEVALVQARWKFVNADECLMTRMQEMSLDY  241

Query  1138  HFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVF  959
             HF VEQEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RAGLKG KFV+
Sbjct  242   HFLVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGGKFVY  301

Query  958   LGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFV  779
             L D++VKSELPS+FKAYRYQQHRWSCGPANLFKKM  EIMRNKKV++WKKLY+IY+FFFV
Sbjct  302   LSDLKVKSELPSTFKAYRYQQHRWSCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFV  361

Query  778   NKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWML  599
              KIVAHV+TF++YC+++PATVL+PE+++P WGA+Y+P++  LL  +  PRS+H+  FW+L
Sbjct  362   RKIVAHVVTFVFYCVIMPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWIL  421

Query  598   FENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWE  422
             FENVM++HRT  T  GLLE GR++EWVVTEK G+  KT     A + PR R+GERLH  E
Sbjct  422   FENVMSMHRTKATLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAARKPRIRIGERLHFLE  481

Query  421   IIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             ++VG Y+ FC  Y+L +G N+Y++YLFLQ ++F V G GY+G FV  S
Sbjct  482   LLVGAYLFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPNS  529



>ref|XP_003535494.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Glycine max]
Length=529

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/528 (64%), Positives = 432/528 (82%), Gaps = 3/528 (1%)
 Frame = -1

Query  1858  FSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSA  1679
              SS A  +      A  +G++W QA+A ++VP+++++V LCL M +M+ +E+VY+G V  
Sbjct  4     LSSAATFKSMHYGSASQMGLIWQQARAPLVVPLMKLLVVLCLAMSLMLFVERVYMGIVII  63

Query  1678  YLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWP  1499
             ++KLFR  P K+YKWEP++  DD E GNS YP VLVQIPM NEK VYQLSIGAAC LSWP
Sbjct  64    FVKLFRYKPEKKYKWEPLR--DDLEFGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWP  121

Query  1498  TNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYV  1319
             ++RIIIQVLDDSTDP +K +V+ EC+RWA KGVNIKYE R NR G+KAG+LK+GMKHSYV
Sbjct  122   SDRIIIQVLDDSTDPIIKNMVEMECQRWASKGVNIKYEIRKNRNGYKAGALKEGMKHSYV  181

Query  1318  KSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDR  1139
               C+YVAIFDADF+P+P+FL+RTIPFL HNP++ LVQARWK+VNA+EC++TR+QEMS+D 
Sbjct  182   NLCDYVAIFDADFQPEPNFLWRTIPFLAHNPEVALVQARWKFVNADECLMTRMQEMSLDY  241

Query  1138  HFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVF  959
             HF VEQEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RAGLKG KFV+
Sbjct  242   HFLVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGGKFVY  301

Query  958   LGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFV  779
             L D++VKSELPS+FKAYRYQQHRWSCGPANLFKKM  EIMRNKKV++WKKLY+IY+FFFV
Sbjct  302   LSDLKVKSELPSTFKAYRYQQHRWSCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFV  361

Query  778   NKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWML  599
              KIVAHV+TF++YC+++PATVL PE+++P WGA+Y+P++  LL  +  PRS+H+  FW+L
Sbjct  362   RKIVAHVVTFVFYCVIMPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWIL  421

Query  598   FENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWE  422
             FENVM++HRT  T  GLLE GR++EWVVTEK G+  KT     A +  R R+GERLH  E
Sbjct  422   FENVMSMHRTKATLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAARKSRIRIGERLHFLE  481

Query  421   IIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             ++VG Y+ FC  Y+L +G N+Y++YLFLQ ++F V G GY+G FV  S
Sbjct  482   LLVGAYLFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPNS  529



>ref|XP_009601859.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/520 (65%), Positives = 429/520 (83%), Gaps = 3/520 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G  D I     ++W Q KA +IVP+LR+ V LCL M +M+ +E+VY+  V + +KLF R 
Sbjct  16    GTRDDITEQFAIMWGQIKAPLIVPLLRIAVLLCLTMSVMLFIERVYMFIVISLVKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YKWEP+K  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RII+QV
Sbjct  76    PEKRYKWEPLK--DDVELGNSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIVQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP  K LV+ EC+RWA KG+NIKYE R+NR G+KAG+LK+G+KHSYVK C++VAI
Sbjct  134   LDDSTDPITKNLVEIECQRWASKGINIKYEVRNNRSGYKAGALKEGLKHSYVKQCDFVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL+RTIPFLVHNP++ LVQARWKYVNA+EC++TR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLWRTIPFLVHNPELSLVQARWKYVNADECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GSA HAFFGFNGTAG+WRIAA+D+AGGWKDRTTVEDMDL  RA LKGWKF++L  + VK+
Sbjct  254   GSATHAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSSLMVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WKK+++IY+FFFV K++AH++
Sbjct  314   ELPSTFKAYRYQQHRWSCGPANLFRKMFMEIVRNKKVSLWKKVHVIYSFFFVRKVIAHIV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF++Y +VLPATVL+PE+++P WGA+Y+P +  LL  +  PRSLH+  FW+LFENVM+LH
Sbjct  374   TFVFYVVVLPATVLVPEVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYML  398
             RT  TFIGLLE GR++EW+VTEK G+  K      A +  R RLG+R+HL E+  G Y+ 
Sbjct  434   RTKATFIGLLEAGRVNEWIVTEKLGDALKLKSAAKAFRKHRMRLGDRIHLLELAAGAYLF  493

Query  397   FCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             FCG Y++ FG+N+Y++YLF+Q  +F ++GFGY+G FV  S
Sbjct  494   FCGCYDIAFGNNHYFLYLFIQAFAFFIVGFGYVGTFVPNS  533



>gb|ABG34547.1| cellulose synthase-like A1 [Pinus taeda]
Length=530

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/510 (66%), Positives = 423/510 (83%), Gaps = 2/510 (0%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             L ++W Q +A +I P+LR  V +CL+M +M+ +E+VY+  V   +KLF + P K+YKWEP
Sbjct  23    LALIWRQIRAPLIAPLLRFAVGICLIMSLMLFIERVYMAVVIVLVKLFGKRPEKRYKWEP  82

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             I+  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RIIIQVLDDSTDP +
Sbjct  83    IR--DDIELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPAI  140

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K LV  EC+RWA KG+NIKYE RDNR G+KAG+LK+GMK SYVK C+YVAIFDADF+P+P
Sbjct  141   KELVTMECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKDCDYVAIFDADFQPEP  200

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             D+L+RT+PFLVHNP++ LVQARWK+VN++EC++TR+QEMS+D HF+VEQEVGS+ HAFFG
Sbjct  201   DYLWRTVPFLVHNPELALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSTHAFFG  260

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRI AL++AGGWKDRTTVEDMDL  RA LKGWKFVF+GD++VK+ELPS+FKAY
Sbjct  261   FNGTAGVWRINALNEAGGWKDRTTVEDMDLAVRASLKGWKFVFVGDLKVKNELPSTFKAY  320

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             RYQQHRWSCGPANLF+KM  EI+RNK+VT WKK ++IYAFFFV KIVAH++TF +YC+V+
Sbjct  321   RYQQHRWSCGPANLFRKMVMEILRNKRVTPWKKFHVIYAFFFVRKIVAHIVTFTFYCVVI  380

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             PATVL+PE+++P WGA+Y+P++  LL  +  P+SLH+  FW+LFENVM+LHRT  TFIGL
Sbjct  381   PATVLVPEVQVPKWGAVYIPSIITLLNAVSTPKSLHLLVFWILFENVMSLHRTKATFIGL  440

Query  547   LEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFG  368
             LE GR++EWVVTEK G+    +     K  R R+GERLH+ E+  G Y+ FC  Y+L FG
Sbjct  441   LEAGRVNEWVVTEKLGDAMKHKSGKQIKKSRSRIGERLHVLELFAGVYLFFCASYDLAFG  500

Query  367   DNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              N++Y+YL+LQ  +F V+GFGYIG FV TS
Sbjct  501   RNHFYIYLYLQAAAFFVMGFGYIGTFVPTS  530



>ref|XP_007143832.1| hypothetical protein PHAVU_007G105400g [Phaseolus vulgaris]
 gb|ESW15826.1| hypothetical protein PHAVU_007G105400g [Phaseolus vulgaris]
Length=530

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/517 (65%), Positives = 428/517 (83%), Gaps = 3/517 (1%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             D     +G++W QA+A ++VP L+++V LCL M IM+ +E+VY+G V  ++KLFR  P K
Sbjct  16    DGSGSQMGLIWQQARAPLVVPALKLLVALCLAMSIMLFVERVYMGIVIIFVKLFRYKPDK  75

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +YKWEP++  DD EIGNS YP VLVQIPM NEK VYQLSIGAAC L WP++RIIIQVLDD
Sbjct  76    KYKWEPLR--DDLEIGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLLWPSDRIIIQVLDD  133

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP +K +V+ EC+RWA KG+NIKYE R NR G+KAG+LK+GMKHSYV  C+YVAIFDA
Sbjct  134   STDPIIKKMVEVECQRWASKGINIKYEIRQNRNGYKAGALKEGMKHSYVNLCDYVAIFDA  193

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF+P+P+FL RTIPFL HNP++ LVQARWK+VNA+EC++TR+QEMS+D HF VEQEVGS+
Sbjct  194   DFQPEPNFLRRTIPFLYHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFLVEQEVGSS  253

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RAGLKG KFV+L D++VKSELP
Sbjct  254   TYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAIRAGLKGGKFVYLSDLKVKSELP  313

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKA+RYQQHRWSCGPANLFKKM  EIMRNKKV+ WKK Y+IY+FFFV KIVAHV+TF+
Sbjct  314   STFKAFRYQQHRWSCGPANLFKKMAMEIMRNKKVSTWKKFYVIYSFFFVRKIVAHVVTFV  373

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+V+PATVL+PE+++P WGA+Y+P++  LL  +  PRS+H+  FW+LFENVM++HRT 
Sbjct  374   FYCVVMPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTK  433

Query  565   GTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCG  389
              T  GLLE GR++EWVVTEK G+  KT     A + PR ++GERLH  E++VG Y+ FCG
Sbjct  434   ATLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAVRKPRIKIGERLHFLELLVGAYLFFCG  493

Query  388   WYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              Y+L +G N+Y++YLFLQ ++F V+G GY+G FV  S
Sbjct  494   CYDLTYGKNHYFIYLFLQSIAFFVVGVGYVGTFVPNS  530



>ref|XP_004249461.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Solanum 
lycopersicum]
Length=533

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/533 (64%), Positives = 436/533 (82%), Gaps = 5/533 (1%)
 Frame = -1

Query  1873  SAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYL  1694
             S+  +F    A  G  D +     ++W Q KA +IVP+LR+ V+LCL+M I++ +E+VY+
Sbjct  5     SSTTLFPDTLA--GTRDDLTEQWTIIWEQIKAPLIVPLLRIAVFLCLLMSILLFIERVYM  62

Query  1693  GAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAAC  1514
             G V   +K+F R P K+YKWE +K  DD EIGNS YP VLVQIPM NEK VYQLSIGAAC
Sbjct  63    GIVITLVKMFGRKPDKRYKWESLK--DDVEIGNSCYPMVLVQIPMYNEKEVYQLSIGAAC  120

Query  1513  NLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGM  1334
              LSWP++RIIIQVLDDSTDP +K LV  EC+RWA KG++IKYE RDNR G+KAG+LK+G+
Sbjct  121   GLSWPSDRIIIQVLDDSTDPIIKNLVSMECQRWASKGIDIKYEIRDNRNGYKAGALKEGL  180

Query  1333  KHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQE  1154
             KH YVK C+YVAIFDADF+P+PDFL+RTIPFLVHNP +GLVQARWK+VNA+EC++TR+QE
Sbjct  181   KHPYVKQCDYVAIFDADFQPEPDFLWRTIPFLVHNPQLGLVQARWKFVNADECLMTRMQE  240

Query  1153  MSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKG  974
             MS+D HF+VEQEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA LKG
Sbjct  241   MSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALEEAGGWKDRTTVEDMDLAVRASLKG  300

Query  973   WKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIY  794
             WKF++L  ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WKK+++IY
Sbjct  301   WKFLYLSALKVKNELPSTFKAYRYQQHRWSCGPANLFRKMFMEIIRNKKVSLWKKIHVIY  360

Query  793   AFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMT  614
             +FFFV K+VAH++TF++YC+VLPATVL+PE+++P WGA+Y+P++  +L  +  PRSLH+ 
Sbjct  361   SFFFVRKVVAHIVTFVFYCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSLHLI  420

Query  613   AFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGER  437
              FW+LFENVM+LHRT  TFIGLLE GR++EW+VTEK G+  K      A K PRFR G+R
Sbjct  421   IFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDVLKMKSAIKAVKKPRFRFGDR  480

Query  436   LHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             L L E+  G Y+ FCG Y++ FG N+Y++YLFLQ  +F +IGFG+IG FV  S
Sbjct  481   LLLLELATGAYLFFCGCYDVAFGKNHYFLYLFLQAFAFFIIGFGHIGTFVPNS  533



>gb|AGE09561.1| CSLA9-like protein [Eucalyptus cladocalyx]
Length=532

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/520 (64%), Positives = 430/520 (83%), Gaps = 4/520 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             GA D ++  L ++W Q KA ++VP+LRV V+LCL M +M+ +E+VY+  V   +KLF R 
Sbjct  16    GARDDVSMQLSLIWAQIKAPLLVPLLRVAVFLCLAMSLMLFVERVYMAVVILLVKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+Y+WEP+K  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RIIIQV
Sbjct  76    PEKRYRWEPMK--DDIELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K LV+ EC+RWA KG+NI+YE RDNR G+KAG+LK+GMK SYVK C+YVAI
Sbjct  134   LDDSTDPTIKDLVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRSYVKQCDYVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
              DADF+P+PDFL+RT+PFLVHNP++ LVQARWK+VNA+EC++TR+QEMS+D HF+VEQEV
Sbjct  194   LDADFQPEPDFLWRTVPFLVHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKF++LG ++VK+
Sbjct  254   GSSTHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYR+QQHRWSCGPANLF+KM  EI+RN KVT+WKKL++IY+FF V KIVAH++
Sbjct  314   ELPSTFKAYRFQQHRWSCGPANLFRKMAMEIIRN-KVTLWKKLHVIYSFFLVRKIVAHIV  372

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TFI+YC+VLPATV +PE+ +P WGA+Y+P++  +L  +  PRSLH+  FW+LFENVM+ H
Sbjct  373   TFIFYCVVLPATVFVPEVTVPKWGAVYIPSIITVLNAVGTPRSLHLVVFWILFENVMSFH  432

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYML  398
             RT  TFIGLLE GR++EW+VTEK G+  K        K P+FR G+RLH+ E+ VG Y+ 
Sbjct  433   RTKATFIGLLEAGRVNEWIVTEKLGDALKVKASSKVPKKPKFRFGDRLHVLELGVGAYLF  492

Query  397   FCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             FCG Y++ FG N+Y++YLF Q ++F ++GFGYIG FV  S
Sbjct  493   FCGCYDIAFGRNHYFMYLFAQAIAFFIMGFGYIGTFVPNS  532



>ref|XP_007162846.1| hypothetical protein PHAVU_001G185800g [Phaseolus vulgaris]
 gb|ESW34840.1| hypothetical protein PHAVU_001G185800g [Phaseolus vulgaris]
Length=533

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/520 (64%), Positives = 433/520 (83%), Gaps = 3/520 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             GA D +   L ++W Q KA +IVP+LR+ V+LCL+M +M+ +E+VY+G V   +KLF R 
Sbjct  16    GAKDDLTTQLALVWNQIKAPLIVPLLRLAVFLCLIMSVMMFIERVYMGVVITLVKLFVRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YKWEP+K  DD E+GNS YP VLVQ+PM NE+ VYQLSIGAAC LSWP++RIIIQV
Sbjct  76    PEKRYKWEPMK--DDIELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K LVQ EC+RWA KGVNIKYE RDNR G+KAG+LK+GMK SYVK C+ VAI
Sbjct  134   LDDSTDPTIKELVQLECQRWASKGVNIKYEVRDNRNGYKAGALKEGMKRSYVKQCDCVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL+RT+PFLVHNP++ L+QARWK+VNA+EC++TR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLWRTVPFLVHNPELALIQARWKFVNADECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKF++L D++VK+
Sbjct  254   GSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSDLKVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+ KAYRYQQHRWSCGPANLF+KM  EI+ NKKV++WKK+++IY+FFFV K+VAH+ 
Sbjct  314   ELPSTLKAYRYQQHRWSCGPANLFRKMVLEIINNKKVSLWKKIHVIYSFFFVRKVVAHIN  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF++YC+VLPATVL+PE+ +P WGA+Y+P++  +L  +  PRSLH+  FW+LFENVM+LH
Sbjct  374   TFVFYCIVLPATVLVPEVVVPKWGAVYIPSVITILNAVGTPRSLHLLVFWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQP-KSAKKVPRFRLGERLHLWEIIVGFYML  398
             RT  T IGLLE  R++EWVVTEK G+   A+    A K PRF++G+R+HL E+ V FY+ 
Sbjct  434   RTKATIIGLLEASRVNEWVVTEKLGDALKAKAGGKAPKKPRFKIGDRIHLLELGVAFYLF  493

Query  397   FCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             FCG Y+++FG N+Y+++LF+Q ++F ++ FGY+G  V  S
Sbjct  494   FCGCYDVMFGKNHYFIFLFIQALAFFIMAFGYVGTIVPQS  533



>ref|XP_006436686.1| hypothetical protein CICLE_v10031284mg [Citrus clementina]
 gb|ESR49926.1| hypothetical protein CICLE_v10031284mg [Citrus clementina]
Length=508

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/510 (68%), Positives = 431/510 (85%), Gaps = 2/510 (0%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             +G++W Q KA +IVP+L+++VYLCL + IM+ +E+VY+G V   LKLF R P K+YKWE 
Sbjct  1     MGLMWQQTKAPLIVPLLKLLVYLCLALSIMLFVERVYMGIVIVLLKLFGRKPEKRYKWEA  60

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             IK  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RI IQVLDDSTDP +
Sbjct  61    IK--DDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRITIQVLDDSTDPTI  118

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMKHSYVK C+YVAIFDADF+P+P
Sbjct  119   KDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEP  178

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFL+RTIPFLVHNPDI LVQARWK+VNA+EC++TR+QEMS+D HF+VEQEVGS+ +AFFG
Sbjct  179   DFLWRTIPFLVHNPDIALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEVGSSTYAFFG  238

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKFV++GD++VK+ELPS+FKAY
Sbjct  239   FNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELPSTFKAY  298

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             RYQQHRWSCGPANLFKKM  EIMR KKVT+WKKLY+IY+FFFV K+VAH++TF++YC++L
Sbjct  299   RYQQHRWSCGPANLFKKMVGEIMRTKKVTLWKKLYVIYSFFFVRKVVAHIVTFVFYCVLL  358

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             PATVL PE+++P WGA+Y+P++  LL  +  PRSLH+  FW+LFENVM+LHRT  TFIGL
Sbjct  359   PATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFIGL  418

Query  547   LEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFG  368
             LE GR++EWVVTEK G+ K+       K PR R+GER+H+ E+ VG Y+  CG Y++ FG
Sbjct  419   LEAGRVNEWVVTEKLGDVKSKLGGKTLKKPRIRIGERVHVLELGVGAYLFLCGCYDVAFG  478

Query  367   DNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              N+Y++YLFLQ ++F V G GY+G FV  S
Sbjct  479   KNHYFIYLFLQSIAFFVAGVGYVGTFVPNS  508



>ref|XP_006339112.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=533

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/533 (64%), Positives = 436/533 (82%), Gaps = 5/533 (1%)
 Frame = -1

Query  1873  SAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYL  1694
             S+  +F    A  G  D +   L ++W Q KA +IVP+LR+ V+LCL+M I++ +E+VY+
Sbjct  5     SSTTLFPDTLA--GTRDDLTEQLTIIWEQIKAPLIVPLLRIAVFLCLLMSILLFIERVYM  62

Query  1693  GAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAAC  1514
             G V   +KLF R   K+YKWE +K  DD EIGNS YP VLVQIPM NEK VYQLSIGAAC
Sbjct  63    GIVITLVKLFGRKSDKRYKWESLK--DDVEIGNSCYPMVLVQIPMYNEKEVYQLSIGAAC  120

Query  1513  NLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGM  1334
              LSWP++RIIIQVLDDSTDP +K LV  EC+RWA KG++I+YE RDNR G+KAG+LK+G+
Sbjct  121   GLSWPSDRIIIQVLDDSTDPIIKNLVSMECQRWASKGIDIRYEIRDNRNGYKAGALKEGL  180

Query  1333  KHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQE  1154
             KH YVK C+YVAIFDADF+P+PDFL+RTIPFLVHNP +GLVQARWK+VNA+EC++TR+QE
Sbjct  181   KHPYVKQCDYVAIFDADFQPEPDFLWRTIPFLVHNPQLGLVQARWKFVNADECLMTRMQE  240

Query  1153  MSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKG  974
             MS+D HF+VEQEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA LKG
Sbjct  241   MSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALEEAGGWKDRTTVEDMDLAVRASLKG  300

Query  973   WKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIY  794
             WKF++L  ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WKK+++IY
Sbjct  301   WKFLYLSALKVKNELPSTFKAYRYQQHRWSCGPANLFRKMFMEIIRNKKVSLWKKIHVIY  360

Query  793   AFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMT  614
             +FFFV K+VAH++TF++YC+VLPATVL+PE+++P WGA+Y+P++  +L  +  PRS H+ 
Sbjct  361   SFFFVRKVVAHIVTFVFYCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLI  420

Query  613   AFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGER  437
              FW+LFENVM+LHRT  TFIGLLE GR++EW+VTEK G+  K      A K PRFR+G+R
Sbjct  421   IFWILFENVMSLHRTKATFIGLLEAGRVNEWIVTEKLGDVLKMKSASKAVKKPRFRVGDR  480

Query  436   LHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             L L E+  G Y+ FCG Y++ FG N+Y++YLF+Q  +F +IGFG+IG FV  S
Sbjct  481   LLLLELATGAYLFFCGCYDVAFGKNHYFLYLFIQAFAFFIIGFGHIGTFVPNS  533



>gb|KHN00923.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=517

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/514 (65%), Positives = 431/514 (84%), Gaps = 3/514 (1%)
 Frame = -1

Query  1816  APYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYK  1637
             A  +G++W QA+A ++VP+++++V LCL M +M+ +E+VY+G V  ++KLFR  P K+YK
Sbjct  6     ASQMGLIWQQARAPLVVPLMKLLVVLCLAMSLMLFVERVYMGIVIIFVKLFRYKPEKKYK  65

Query  1636  WEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTD  1457
             WEP++  DD E GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++R+IIQVLDDSTD
Sbjct  66    WEPLR--DDLEFGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRVIIQVLDDSTD  123

Query  1456  PEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFE  1277
             P +K +V+ EC+RWA KGVNIKYE R+NR G+KAG+LK+GMKHSYV  C+YVAIFDADF+
Sbjct  124   PIIKNMVEVECQRWASKGVNIKYEIRENRNGYKAGALKEGMKHSYVNLCDYVAIFDADFQ  183

Query  1276  PDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHA  1097
             P+P+FL+RTIPFL +NP++ LVQARWK+VNA+EC++TR+QEMS+D HF VEQEVGS+ +A
Sbjct  184   PEPNFLWRTIPFLAYNPEVALVQARWKFVNADECLMTRMQEMSLDYHFLVEQEVGSSTYA  243

Query  1096  FFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSF  917
             FFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RAGLKG KFV+L D++VKSELPS+F
Sbjct  244   FFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGGKFVYLSDLKVKSELPSTF  303

Query  916   KAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYC  737
             KAYRYQQHRWSCGPANLFKKM  EIMRNKKV++WKKLY+IY+FFFV KIVAHV+TF++YC
Sbjct  304   KAYRYQQHRWSCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVFYC  363

Query  736   LVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTF  557
             +++PATVL+PE+++P WGA+Y+P++  LL  +  PRS+H+  FW+LFENVM++HRT  T 
Sbjct  364   VIMPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKATL  423

Query  556   IGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYN  380
              GLLE GR++EWVVTEK G+  KT     A + PR R+GERLH  E++VG Y+ FC  Y+
Sbjct  424   TGLLEAGRVNEWVVTEKLGDALKTKSGGKAARKPRIRIGERLHFLELLVGAYLFFCACYD  483

Query  379   LIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             L +G N+Y++YLFLQ ++F V G GY+G FV  S
Sbjct  484   LKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPNS  517



>ref|XP_010325939.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Solanum lycopersicum]
Length=533

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/517 (65%), Positives = 427/517 (83%), Gaps = 3/517 (1%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             D I    G++W Q KA +IVP+LR+ V+LCLVM +M+ +E+VY+  V   LK+F + P K
Sbjct  19    DDITEQFGIMWGQIKAPLIVPLLRISVFLCLVMSVMLFVERVYMFVVITLLKVFGKKPQK  78

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +YKWEP+K  DD E+ NS YP VLVQIPM NEK VYQLSIGAAC LSWP++RII+QVLDD
Sbjct  79    KYKWEPLK--DDVELANSSYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIVQVLDD  136

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP  K LV+ EC++WA KG+NIKYE RDNR G+KAG+LK+G+KHSYVK C++V IFDA
Sbjct  137   STDPITKNLVEIECQKWAKKGINIKYEVRDNRNGYKAGALKEGLKHSYVKQCDFVGIFDA  196

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF+P+PDFL++TIPFLVHN ++ LVQARWKYVNA+EC++TR+QEMS+D HFSVEQEVGS+
Sbjct  197   DFQPEPDFLWQTIPFLVHNHELSLVQARWKYVNADECLMTRMQEMSLDYHFSVEQEVGSS  256

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              HAFFGFNGTAG+WRIAA+D+AGGWKDRTTVEDMDL  RA LKGWKF+FLG V+VK+ELP
Sbjct  257   THAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFLFLGSVKVKNELP  316

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+ KAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WKK+++IY+FFFV K+VAH++TF+
Sbjct  317   STLKAYRYQQHRWSCGPANLFRKMCMEIIRNKKVSLWKKVHVIYSFFFVRKVVAHIVTFV  376

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +Y +VLPATVL+PE+++P WGA+Y+P +  LL  +  PRSLH+  FW+LFENVM+LHRT 
Sbjct  377   FYVVVLPATVLVPEVEVPKWGAVYIPAIITLLNAVGTPRSLHLLVFWILFENVMSLHRTK  436

Query  565   GTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCG  389
              TFIGLLE GR++EW+VTEK G+  K      A K  R RLG+R+HL E   G Y+ FCG
Sbjct  437   ATFIGLLEAGRVNEWIVTEKLGDALKLKSATKAFKKHRMRLGDRIHLLEFAAGAYLFFCG  496

Query  388   WYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              Y++ FG N+Y++YLF+Q  +FL++GFGY+G FV  S
Sbjct  497   CYDIAFGTNHYFLYLFIQAFAFLIVGFGYVGTFVPNS  533



>ref|XP_009379774.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/539 (63%), Positives = 444/539 (82%), Gaps = 7/539 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  +S+A +      + +G  D I   +G++W Q KA VIVP+LR+ V+LCLVM +M++
Sbjct  1     MDRLTSTARL----PESFQGTRDDIGGQMGMVWQQIKAPVIVPLLRLAVFLCLVMSVMLV  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +EKVY+  V   +KL  R P K+YKWEP++  DD E+G+S YP VLVQIPM NEK VYQL
Sbjct  57    VEKVYMAVVIVLVKLLGRRPEKRYKWEPMR--DDLEVGSSAYPMVLVQIPMYNEKEVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RIIIQVLDDSTDP +K LV+ EC+RWA KGV+IKYE RDNR G+KAG
Sbjct  115   SIGAACGLSWPSDRIIIQVLDDSTDPVIKDLVELECQRWASKGVDIKYEIRDNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMK SYVK C+YV IFDADF+P+PDFL+R IPFL+HNPD+GLVQARWK+VN++EC+
Sbjct  175   ALKEGMKRSYVKHCDYVVIFDADFQPEPDFLWRAIPFLIHNPDVGLVQARWKFVNSDECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKFVFLGD++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI  NKKV +WK
Sbjct  295   RASLKGWKFVFLGDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMVMEIKNNKKVGLWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY+FFFV K+VAH++TF++YC+V+PATVL+PE++IP WGA+Y+P++  LL  +  P
Sbjct  355   KVHVIYSFFFVRKVVAHIVTFVFYCIVIPATVLVPEVEIPKWGAVYIPSIITLLNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVP-R  455
             RSLH+  FW+LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+TK  +  +      R
Sbjct  415   RSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDTKKPKMAAKAARKLR  474

Query  454   FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              R+G+RLHL E+  G Y+  CG Y++ FG++++++YLFLQ ++F ++GFGY+G FV ++
Sbjct  475   IRIGDRLHLLELWTGAYLFVCGCYDVAFGNSHFFIYLFLQAMAFFIVGFGYVGTFVPST  533



>ref|XP_004250002.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
lycopersicum]
Length=529

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/526 (64%), Positives = 426/526 (81%), Gaps = 3/526 (1%)
 Frame = -1

Query  1861  MFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVS  1682
             +FSS  A+  A   I  ++G +W Q +  ++V  LR+++Y+CL +  M+ +E++Y+G V 
Sbjct  4     IFSSSQALLNAHSGITNHVGFIWQQTRTPLVVQFLRLILYVCLALSFMLFVERLYMGIVI  63

Query  1681  AYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSW  1502
             A++KLFRR P K+YKWEP+K   D E+GN  YP VLVQIPMCNEK VYQLSIGAACNLSW
Sbjct  64    AFVKLFRRKPEKKYKWEPLK--GDLELGNYSYPMVLVQIPMCNEKEVYQLSIGAACNLSW  121

Query  1501  PTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSY  1322
             P NRI IQVLDDSTDP +KALV+QECRRWA KGVNIKYE RDNRKG+KAG+L++GMKHSY
Sbjct  122   PANRIFIQVLDDSTDPTIKALVEQECRRWASKGVNIKYEIRDNRKGYKAGALREGMKHSY  181

Query  1321  VKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMD  1142
             VK C +VAIFDADF+P+PDFL R+IPFLVHNP+IGLVQARW++VNA EC++T++QEMS  
Sbjct  182   VKLCSHVAIFDADFQPEPDFLERSIPFLVHNPEIGLVQARWEFVNAEECLMTKMQEMSFG  241

Query  1141  RHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFV  962
              HF+VEQEVGS  HAFFGFNGTAG+WR++AL +AGGWKDRTTVEDMDL  RAGL GWKFV
Sbjct  242   YHFTVEQEVGSTAHAFFGFNGTAGVWRMSALIEAGGWKDRTTVEDMDLAVRAGLNGWKFV  301

Query  961   FLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFF  782
             ++ D++VKSELPS+F+AYR QQHRWSCGPANLF+KM  EI  NKKV++WKK YLIY+FFF
Sbjct  302   YVDDLKVKSELPSTFRAYRNQQHRWSCGPANLFRKMAMEIATNKKVSVWKKFYLIYSFFF  361

Query  781   VNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWM  602
             V KI+AHV+TFI YC+V+PAT+ IPE+++P WG +Y+PT   +L +L   RS+ +  +W+
Sbjct  362   VRKIIAHVVTFILYCVVIPATIFIPEVQVPRWGTIYIPTAITVLNILGSARSMQLVVYWI  421

Query  601   LFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLW  425
             LFENVM+LHRT    IGL E  R++EW+VTEK G+  KT +   A K  +FR+GER+H+ 
Sbjct  422   LFENVMSLHRTKAMLIGLFESERVNEWIVTEKLGDALKTKKGSKALKRLQFRVGERVHVL  481

Query  424   EIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             E+ VG Y+LFCGWY+  FG N +YVYL LQ ++F V+GFGY+G FV
Sbjct  482   ELFVGLYLLFCGWYDYSFGRNKFYVYLLLQAMAFFVVGFGYVGVFV  527



>gb|KHN37850.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=517

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/514 (65%), Positives = 428/514 (83%), Gaps = 3/514 (1%)
 Frame = -1

Query  1816  APYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYK  1637
             A  +G++W QA+A ++VP+++++V LCL M +M+ +E+VY+G V  ++KLFR  P K+YK
Sbjct  6     ASQMGLIWQQARAPLVVPLMKLLVVLCLAMSLMLFVERVYMGIVIIFVKLFRYKPEKKYK  65

Query  1636  WEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTD  1457
             WEP++  DD E GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RIIIQVLDDSTD
Sbjct  66    WEPLR--DDLEFGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTD  123

Query  1456  PEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFE  1277
             P +K +V+ EC+RWA KGVNIKYE R NR G+KAG+LK+GMKHSYV  C+YVAIFDADF+
Sbjct  124   PIIKNMVEMECQRWASKGVNIKYEIRKNRNGYKAGALKEGMKHSYVNLCDYVAIFDADFQ  183

Query  1276  PDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHA  1097
             P+P+FL+RTIPFL HNP++ LVQARWK+VNA+EC++TR+QEMS+D HF VEQEVGS+ +A
Sbjct  184   PEPNFLWRTIPFLAHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFLVEQEVGSSTYA  243

Query  1096  FFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSF  917
             FFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RAGLKG KFV+L D++VKSELPS+F
Sbjct  244   FFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGGKFVYLSDLKVKSELPSTF  303

Query  916   KAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYC  737
             KAYRYQQHRWSCGPANLFKKM  EIMRNKKV++WKKLY+IY+FFFV KIVAHV+TF++YC
Sbjct  304   KAYRYQQHRWSCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVFYC  363

Query  736   LVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTF  557
             +++PATVL PE+++P WGA+Y+P++  LL  +  PRS+H+  FW+LFENVM++HRT  T 
Sbjct  364   VIMPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKATL  423

Query  556   IGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYN  380
              GLLE GR++EWVVTEK G+  KT     A +  R R+GERLH  E++VG Y+ FC  Y+
Sbjct  424   TGLLEAGRVNEWVVTEKLGDALKTKSGGKAARKSRIRIGERLHFLELLVGAYLFFCACYD  483

Query  379   LIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             L +G N+Y++YLFLQ ++F V G GY+G FV  S
Sbjct  484   LKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPNS  517



>ref|XP_009353014.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Pyrus x bretschneideri]
Length=534

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/522 (63%), Positives = 432/522 (83%), Gaps = 6/522 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             GA D I+  +G++W Q KA +IVP+LR+ V LCL+M +M+ +E++Y+  V   +K F R 
Sbjct  16    GARDDISMQMGLIWDQIKAPLIVPMLRLAVVLCLIMSVMLFVERLYMAVVIVLIKFFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YKWEP+K  DD E+GNS YP VLVQIPM NE+ VYQ+SIGAAC LSWP++RII+QV
Sbjct  76    PEKRYKWEPMK--DDVELGNSAYPMVLVQIPMYNEREVYQISIGAACGLSWPSDRIIVQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTD  +K +V+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMK SYVKSC++VAI
Sbjct  134   LDDSTDTTIKEMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKSCDFVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL+RTIPFL+HNP++ LVQ RWK+VN+NEC++TR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLWRTIPFLLHNPELALVQTRWKFVNSNECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAG+WRI A+++AGGWKDRTTVEDMDL  RA LKGWKFV+LG ++VK+
Sbjct  254   GSSTHAFFGFNGTAGVWRITAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSIQVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKVT WKK+++IY+FFFV KI+AH+ 
Sbjct  314   ELPSTFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVTFWKKVHVIYSFFFVRKIIAHIN  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
              F++YC+VLP+TV++PE+++P WG +Y+P++  +L  +  PRS+H+  FW+LFENVM+LH
Sbjct  374   AFVFYCIVLPSTVMVPEVEVPKWGGIYIPSMITILNAVGTPRSIHLLVFWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVP---RFRLGERLHLWEIIVGFY  404
             RT  T IGLLE  R++EW+VTEK G+      K+A K+P   RFR+GERLH+ E+ VG Y
Sbjct  434   RTKATIIGLLEASRVNEWIVTEKLGDALRTL-KAATKLPRKSRFRIGERLHVLELAVGLY  492

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             + FCG Y+ +FG NY++++L++Q  +F +IGFGY+G FV  S
Sbjct  493   LFFCGCYDFVFGKNYFFMFLYIQATAFFIIGFGYVGTFVPNS  534



>ref|XP_009390016.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Musa 
acuminata subsp. malaccensis]
Length=533

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/523 (64%), Positives = 431/523 (82%), Gaps = 4/523 (1%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             + +G  D I   +GV+W Q KA VIVP+LR+ V++CLVM +M+++E+VY+ AV A +K  
Sbjct  13    SFQGTRDDITEQMGVVWQQIKAPVIVPLLRLAVFVCLVMSVMLVVERVYMAAVIALVKFL  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              R P K+YKWEPI+  DD E+G++ YP VLVQIPM NEK VYQLS+GAAC LSWP +RII
Sbjct  73    GRRPEKRYKWEPIR--DDLELGSAAYPMVLVQIPMYNEKEVYQLSVGAACGLSWPADRII  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTDP  K LV+ EC RWA KGV+IKYE RDNR G+KAG+L+ GMK  YV+ C+Y
Sbjct  131   IQVLDDSTDPVTKDLVEMECNRWASKGVHIKYERRDNRSGYKAGALRDGMKRGYVEHCDY  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             V IFDADF+P+PDFL+RT+PFL+HNPD+ LVQARWK+VN++EC++TR+QEMS+D HF+VE
Sbjct  191   VVIFDADFQPEPDFLWRTVPFLIHNPDLALVQARWKFVNSDECLMTRIQEMSLDYHFAVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS  HAFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKFVFLGD++
Sbjct  251   QEVGSFTHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVFLGDLK  310

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+ KAYRYQQHRWSCGPANL +KM  EI  NKKV +WKK+++IY+FFFV K+VA
Sbjct  311   VKNELPSTLKAYRYQQHRWSCGPANLLRKMLMEIASNKKVNLWKKVHVIYSFFFVRKVVA  370

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TF++YC+V+PATVL+PE++IP WGA+Y+P++  LL  +  PRSLH+  FW+LFENVM
Sbjct  371   HIVTFVFYCIVIPATVLVPEVEIPKWGAVYIPSVITLLNAVGTPRSLHLLVFWILFENVM  430

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ--PKSAKKVPRFRLGERLHLWEIIVG  410
             +LHRT  TFIGLLE GR +EW+VTEK G+T   +   K+ KK PR R+G+RLHL E+  G
Sbjct  431   SLHRTKATFIGLLEGGRANEWIVTEKLGDTMKVKMATKAVKKPPRTRIGDRLHLLELGTG  490

Query  409   FYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
              ++ FCG Y++ FG N+Y++YLFLQ ++F V+GFG++G FV +
Sbjct  491   AFLFFCGCYDVAFGKNHYFIYLFLQAIAFFVVGFGHVGTFVPS  533



>ref|XP_010940677.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Elaeis 
guineensis]
Length=533

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/539 (64%), Positives = 446/539 (83%), Gaps = 7/539 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             M+  SS+A +      A +GA D I   +G++W Q KA VIVP+LR+ V LCL M +M+ 
Sbjct  1     METESSTALL----PEAFQGARDDITEQMGLVWQQIKAPVIVPLLRLAVLLCLAMSVMLF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+G V   +KLF + P K+YKWEP++  DD E+GNS YP VLVQIPM NEK VYQL
Sbjct  57    VERVYMGVVILIVKLFGKRPEKRYKWEPMR--DDLELGNSAYPMVLVQIPMYNEKEVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RIIIQVLDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR G+KAG
Sbjct  115   SIGAACGLSWPSDRIIIQVLDDSTDPVIKDLVELECQRWASKGINIKYEIRDNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMKHSYVK C+YVAIFDADF+P+PDFL+RTIPFLV NP++ LVQARWK+VN++EC+
Sbjct  175   ALKEGMKHSYVKDCDYVAIFDADFQPEPDFLWRTIPFLVRNPELALVQARWKFVNSDECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRI+A+++AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRISAINEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKF+FLGD++VK+ELPS+ KAYRYQQHRWSCGPANLF+KM  EI +NKKV+++K
Sbjct  295   RASLKGWKFLFLGDLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMLLEIAKNKKVSLFK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY FF V KIVAH++T ++YC+V+PATVL+PE++IP WGA+Y+P++  LL  +  P
Sbjct  355   KVHVIYNFFLVRKIVAHIVTSVFYCMVIPATVLVPEVEIPKWGAVYIPSIITLLNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGN-TKTAQPKSAKKVPR  455
             RSLH+  FW+LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+ +KT     A + PR
Sbjct  415   RSLHLLVFWILFENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDASKTKVAAKAARKPR  474

Query  454   FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              R+G+RLHL E+ VG Y+ FCG Y++ FG N+Y++YLFLQ ++F ++GFGY+G FV+ S
Sbjct  475   IRIGDRLHLLELGVGAYLFFCGCYDVAFGKNHYFIYLFLQAIAFFIVGFGYVGTFVSHS  533



>ref|XP_008241312.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Prunus mume]
Length=534

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/521 (64%), Positives = 427/521 (82%), Gaps = 4/521 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             GA D  +  +GVLW + +A +IVP+LR+ + LCL+M +M+ +E++Y+  V   +KLF R 
Sbjct  16    GARDDFSMQMGVLWSKIRAPLIVPLLRITIVLCLIMSVMLFIERLYMAIVIVLIKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+Y WEP+K  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RIIIQV
Sbjct  76    PDKRYNWEPMK--DDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTD  VK +V+ EC+RWA KG+NIKYE RDNR G+KAG+LK+G+K SYVK C+YVAI
Sbjct  134   LDDSTDSTVKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGLKRSYVKHCDYVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+ DFL RTIPFLVHNP++ LVQ RWK+VN+NEC++TR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPESDFLCRTIPFLVHNPELALVQTRWKFVNSNECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKFV+LG ++VK+
Sbjct  254   GSSTHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSIKVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WKK+++IY+FFFV KI+AH+ 
Sbjct  314   ELPSTFKAYRYQQHRWSCGPANLFRKMVMEIIRNKKVSLWKKVHVIYSFFFVRKIIAHIN  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
              F++YC+VLPATVL+PE+ +P WG +Y+P++  LL  +  PRSLH+  FW+LFENVM+LH
Sbjct  374   AFVFYCIVLPATVLVPEVVVPKWGGIYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAK--KVPRFRLGERLHLWEIIVGFYM  401
             RT  T IGLLE  R++EW+VTEK G+       +AK  + PR R+GERLHL E+ VG Y+
Sbjct  434   RTKATIIGLLEASRVNEWIVTEKLGDALKTLTVAAKLPRKPRIRIGERLHLLELAVGCYL  493

Query  400   LFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              FCG Y+  FG NY+Y++L++Q ++F +IGFGY+G FV  S
Sbjct  494   FFCGTYDFAFGKNYFYLFLYIQAMAFYIIGFGYVGTFVPNS  534



>ref|XP_011024272.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Populus 
euphratica]
Length=530

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/517 (67%), Positives = 434/517 (84%), Gaps = 3/517 (1%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             D I    G++W   K  +IVPVL+++V +CL M IM+ +E+VY+G V  ++KLF R P K
Sbjct  16    DDITGQFGLIWQVLKEPLIVPVLKLLVVVCLGMSIMLFIERVYMGIVIVFVKLFGRKPNK  75

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
              YKWEP+K  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP +RIIIQVLDD
Sbjct  76    MYKWEPMK--DDIEVGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPPDRIIIQVLDD  133

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP +K+LV+ EC+RWA KG+NIKYE RDNRKG+KAG+LK+GMKHSYVK C+YVAIFDA
Sbjct  134   STDPAIKSLVELECQRWASKGINIKYEIRDNRKGYKAGALKEGMKHSYVKQCDYVAIFDA  193

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF+P+P++L+RTIPFLVHNP+I LVQARWK+VN++EC++TR+QEMS+D HF+VEQEVGSA
Sbjct  194   DFQPEPNYLWRTIPFLVHNPEIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSA  253

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              +AFFGFNGTAG+WRI+A+++AGGWKDRTTVEDMDL  RA LKGWKFV++GD++VK+ELP
Sbjct  254   TYAFFGFNGTAGVWRISAVNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDLKVKNELP  313

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKAYRYQQHRWSCGPANLFKKM  EI++NKKV++WKK Y+IY+FFFV KIVAH++TF+
Sbjct  314   STFKAYRYQQHRWSCGPANLFKKMAIEIVKNKKVSLWKKCYVIYSFFFVRKIVAHIVTFV  373

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+VLP+TVL+PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+LFENVM+LHRT 
Sbjct  374   FYCVVLPSTVLVPEVSVPKWGAVYIPSIVTLLNAVGTPRSLHLMVFWILFENVMSLHRTK  433

Query  565   GTFIGLLEVGRIHEWVVTEKQGNTKTAQ-PKSAKKVPRFRLGERLHLWEIIVGFYMLFCG  389
              TFIGLLEVGR++EWVVTEK G+   A+ P  A K PR R+GERLHL E+  G Y+ FCG
Sbjct  434   ATFIGLLEVGRVNEWVVTEKLGDALKAKLPAKATKKPRIRIGERLHLLELCAGAYLFFCG  493

Query  388   WYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              Y+  FG N YY++LFLQ ++F + GFGYIG FV  S
Sbjct  494   CYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVPNS  530



>ref|XP_011018871.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Populus 
euphratica]
Length=532

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/522 (64%), Positives = 431/522 (83%), Gaps = 2/522 (0%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             A +GA D +     ++W Q KA +IVP+LR+ V +CL+M +M+ +E+VY+G V   +KLF
Sbjct  13    AFQGARDDVTMQFALIWGQIKAPLIVPLLRLAVAICLIMSLMLFIERVYMGIVIVLVKLF  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              R P ++YKWEP+K  DD E GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RII
Sbjct  73    GRKPDRRYKWEPMK--DDVEAGNSTYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRII  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTDP +K +V+ EC+RWA KG+NIKYE RD+R G+K+G+LK+GMK SYVKSC+Y
Sbjct  131   IQVLDDSTDPTIKDMVELECQRWASKGINIKYEIRDSRNGYKSGALKEGMKRSYVKSCDY  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+PDFL RTIPFLVHNP++GLVQ RWK+VNA+EC++TR+QEMS+D HF+VE
Sbjct  191   VAIFDADFQPEPDFLRRTIPFLVHNPELGLVQTRWKFVNADECLMTRMQEMSLDYHFTVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA LKGW+F++L  V+
Sbjct  251   QEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWEFLYLSSVK  310

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+ KAYRYQQHRWSCGPANLF+KM  EI+ NKKVT WKK+++IY+FF V KIVA
Sbjct  311   VKNELPSTLKAYRYQQHRWSCGPANLFRKMLMEIITNKKVTSWKKVHVIYSFFLVRKIVA  370

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TFI+YC+VLPATVL+PE+++P WGA+Y+P++  +L  +  PRSLH+  FW+LFENVM
Sbjct  371   HLVTFIFYCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSLHLLVFWILFENVM  430

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFY  404
             +LHRT  TFIGLLE GR++EW+VTEK G+   ++   A K PRFR GERLHL E+  G Y
Sbjct  431   SLHRTKATFIGLLEAGRVNEWIVTEKLGDALKSKANKASKKPRFRFGERLHLLELGTGAY  490

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             + FCG Y+++FG N+Y++YL+ Q ++F ++G G +G FV  S
Sbjct  491   LFFCGCYDVVFGKNHYFIYLYAQAIAFFIVGLGCVGTFVPRS  532



>ref|XP_007203625.1| hypothetical protein PRUPE_ppa004037mg [Prunus persica]
 gb|EMJ04824.1| hypothetical protein PRUPE_ppa004037mg [Prunus persica]
Length=534

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/521 (64%), Positives = 426/521 (82%), Gaps = 4/521 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             GA D  +  +GVLW + +A +IVP+LR+ + LCL+M +M+ +E++Y+G V   +KLF R 
Sbjct  16    GARDDFSMQMGVLWSKIRAPLIVPLLRITIVLCLIMSVMLFIERLYMGIVIVLIKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+Y WEP+K  DD E+GNS YP VLVQIPM NE+ VYQLSI AAC LSWP++RIIIQV
Sbjct  76    PDKRYNWEPMK--DDVELGNSAYPMVLVQIPMYNEREVYQLSIRAACGLSWPSDRIIIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTD  VK +V+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMK SYVK C+YVAI
Sbjct  134   LDDSTDSTVKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+ DFL RTIPFLVHNP+I LVQ RWK+VN+NEC++TR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPESDFLCRTIPFLVHNPEIALVQTRWKFVNSNECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKFV+LG ++VK+
Sbjct  254   GSSTHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGSIKVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WKK+++IY+FFFV KI+AH+ 
Sbjct  314   ELPSTFKAYRYQQHRWSCGPANLFRKMVMEIIRNKKVSLWKKIHVIYSFFFVRKIIAHIN  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
              F++YC+VLPATVL+PE+ +P WG +Y+P++  LL  +  PRSLH+  FW+LFENVM+LH
Sbjct  374   AFVFYCIVLPATVLVPEVVVPKWGGIYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAK--KVPRFRLGERLHLWEIIVGFYM  401
             RT  T IGLLE  R++EW+VTEK G+       +AK  + PR R+GERLHL E+ VG Y+
Sbjct  434   RTKATIIGLLEASRVNEWIVTEKLGDALKTLTVAAKLPRKPRIRIGERLHLLELAVGCYL  493

Query  400   LFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              FCG Y+  FG NY +++L++Q ++F +IGFGY+G FV  S
Sbjct  494   FFCGTYDFAFGKNYVFLFLYIQAMAFYIIGFGYVGTFVPNS  534



>ref|XP_009403735.1| PREDICTED: probable mannan synthase 9 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=528

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/511 (65%), Positives = 421/511 (82%), Gaps = 3/511 (1%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             LG++W Q KA VIVP+LR+ V+LCL M +M+ +EKVY+  V   +KL RR P  +YKWEP
Sbjct  20    LGMVWEQVKAPVIVPLLRIAVFLCLAMSVMLFVEKVYMATVILAVKLLRRRPETRYKWEP  79

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             +  EDD E G++ YP VLVQIPM NEK VYQLSIGAAC LSWP++R+IIQVLDDSTDP +
Sbjct  80    M--EDDMERGSAAYPMVLVQIPMFNEKEVYQLSIGAACGLSWPSDRLIIQVLDDSTDPAI  137

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K +VQ ECRRWA KGVNI+YE RDNR G+KAG+LK GMKH YVK C+YV IFDADF+PDP
Sbjct  138   KEMVQVECRRWASKGVNIRYEIRDNRVGYKAGALKMGMKHRYVKDCDYVVIFDADFQPDP  197

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFL RTIPFL+HNP IGLVQ RW++VNA+EC++TR+QEMS+D HF++EQEVGS+ +AFFG
Sbjct  198   DFLCRTIPFLIHNPQIGLVQGRWRFVNADECLMTRMQEMSLDYHFAIEQEVGSSTYAFFG  257

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKF+FL D+ VKSELPS+FKA+
Sbjct  258   FNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFIFLNDLGVKSELPSTFKAF  317

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             R+QQHRWSCGPANLF+KM  EI +NKKV++W K+Y+IY+FFF+ KIV H++TFI+YCLV+
Sbjct  318   RHQQHRWSCGPANLFRKMVVEISKNKKVSLWTKVYVIYSFFFIRKIVGHIVTFIFYCLVI  377

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             PATV +PE++IP+WG +Y+P++  +L  +  PRSLH+  FW+LFENVM+LHRT  T  GL
Sbjct  378   PATVFVPEVEIPMWGLVYLPSVITMLNSVGTPRSLHLLVFWVLFENVMSLHRTKATLSGL  437

Query  547   LEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIF  371
             L++GR++EWVVTEK G+  KT  P  A K PR R+G+RLH  E+  G Y+ FC  Y+L +
Sbjct  438   LDLGRVNEWVVTEKLGDIMKTKLPTKAAKKPRVRIGDRLHKMELFTGAYLFFCACYDLKY  497

Query  370   GDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             G N+Y++YLFLQ ++F ++GFGY+G ++  S
Sbjct  498   GKNHYFLYLFLQSITFFIVGFGYVGTYIPQS  528



>ref|XP_002873112.1| ATCSLA09 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49371.1| ATCSLA09 [Arabidopsis lyrata subsp. lyrata]
Length=534

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/534 (63%), Positives = 439/534 (82%), Gaps = 7/534 (1%)
 Frame = -1

Query  1885  GNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILME  1706
             G+S+++ I      +  G  D I   + ++  Q +A +IVPVLR+ VY+CL M +M+ +E
Sbjct  4     GDSTTSVI----PDSFMGYRDDITMQMSMVLDQIRAPLIVPVLRLGVYICLTMSVMLFVE  59

Query  1705  KVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSI  1526
             +VY+G V + +KLF R P K++K+EP+K  DD E+GNS YP VLVQIPM NE+ VYQLSI
Sbjct  60    RVYMGIVISLVKLFGRKPDKRFKYEPMK--DDIELGNSVYPMVLVQIPMFNEREVYQLSI  117

Query  1525  GAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSL  1346
             GAAC LSWP++RI+IQVLDDSTDP +K LV+ EC RWA KGVNIKYE RDNRKG+KAG+L
Sbjct  118   GAACGLSWPSDRIVIQVLDDSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRKGYKAGAL  177

Query  1345  KQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLT  1166
             K+GMK SYVKSC+YVAIFDADF+P+PDFL+RT+P+L+HNP + LVQARWK+VN++EC++T
Sbjct  178   KEGMKKSYVKSCDYVAIFDADFQPEPDFLWRTVPYLLHNPKLALVQARWKFVNSDECLMT  237

Query  1165  RLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRA  986
             R+QEMS+D HF+VEQEVGS+ +AFFGFNGTAGIWRI+AL++AGGWKDRTTVEDMDL  RA
Sbjct  238   RMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRA  297

Query  985   GLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKL  806
              LKGWKF++LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM FEIM NK VT+WKK+
Sbjct  298   SLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKV  357

Query  805   YLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRS  626
             ++IY+FF V K+VAH++TFI+YC++LPATVL+PE+ +P WGA+Y+P++  LL  +  PRS
Sbjct  358   HVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRS  417

Query  625   LHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKT-AQPKSAKKVPRFR  449
             LH+  FW+LFENVM+LHRT  TFIGLLE GR++EW+VTEK G+ K  +  K+ KKV RFR
Sbjct  418   LHLMVFWILFENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDVKAKSATKTPKKVLRFR  477

Query  448   LGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              G+R+H+ E+ VG Y+LF G Y+  FG N+YY+YLF Q ++F + GFG IG  V
Sbjct  478   FGDRIHVLELGVGMYLLFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIV  531



>ref|XP_010694523.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Beta 
vulgaris subsp. vulgaris]
Length=526

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/524 (64%), Positives = 431/524 (82%), Gaps = 3/524 (1%)
 Frame = -1

Query  1846  AAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKL  1667
             +  +G    +   + + WVQAKA ++VP+L++ V LCL M IM+ +E+VY+G V   +K+
Sbjct  5     STFQGGNVDVTNQIELFWVQAKAPLLVPLLKLFVTLCLGMSIMLFVERVYMGFVILLVKI  64

Query  1666  FRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRI  1487
             F R P K+Y WEP+K  DD EIGNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RI
Sbjct  65    FGRKPEKKYNWEPLK--DDLEIGNSTYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRI  122

Query  1486  IIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCE  1307
             ++QVLDDSTDP  K LV+ EC RWA KG+NIKYE RDNR G+KAG+LK+GMKHSYVK C+
Sbjct  123   VVQVLDDSTDPVTKNLVEMECHRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKECD  182

Query  1306  YVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSV  1127
             +VAIFDADF+P+PDFL+RTIPFLVHNP I LVQARWK+VNA+EC++TR+QEMS+D HF+V
Sbjct  183   FVAIFDADFQPEPDFLWRTIPFLVHNPQIALVQARWKFVNADECLMTRMQEMSLDYHFTV  242

Query  1126  EQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDV  947
             EQEVGS+ +AFFGFNGTAG+WRI+A+++AGGWKDRTTVEDMDL  RA LKGWKFV++G++
Sbjct  243   EQEVGSSTYAFFGFNGTAGVWRISAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGEL  302

Query  946   RVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIV  767
             +VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI++NKKV+IWKK+++IY+FFFV KIV
Sbjct  303   KVKNELPSTFKAYRYQQHRWSCGPANLFRKMVNEIIKNKKVSIWKKVHVIYSFFFVRKIV  362

Query  766   AHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENV  587
             AHV+TFI+YC+VLP TVL+PE+++P WGA+Y+P +  LL  +  PRSLH+  FW+LFENV
Sbjct  363   AHVVTFIFYCVVLPTTVLVPEVEVPKWGAIYIPMIITLLNAVGTPRSLHLVVFWILFENV  422

Query  586   MALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVG  410
             M+LHRT  TFIGLLE GR++EWVVTEK G+  K      + K PR R+ +++++ E++VG
Sbjct  423   MSLHRTKATFIGLLEAGRVNEWVVTEKLGDALKNKFDTKSFKKPRSRIIDKIYMLELVVG  482

Query  409   FYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              Y+ FCG Y++  G N+Y++YLFLQ  +F + GFGY+G  V TS
Sbjct  483   AYLFFCGCYDIALGKNHYFIYLFLQSFAFFIAGFGYVGIIVPTS  526



>gb|AES60635.2| cellulose synthase-like protein A1 [Medicago truncatula]
Length=523

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/524 (64%), Positives = 435/524 (83%), Gaps = 5/524 (1%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             A +GA + +      LW Q +  +IVP+LRV V++CL M +M+L+E+VY+G V +Y+KLF
Sbjct  3     AFQGARNGLGLQHEFLWRQIREPLIVPLLRVAVFVCLGMSLMMLVERVYMGIVISYVKLF  62

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              R P K+YKWE IK  DD E+GNS YP VLVQ+PM NE+ VYQLSIGAAC LSWP++RII
Sbjct  63    GRKPEKRYKWETIK--DDVELGNSNYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRII  120

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQ+LDDSTDP +K LVQ ECRRW  KGVNIKYE RDNR G+KAG+LK+GMKHSYVK C+Y
Sbjct  121   IQILDDSTDPTIKELVQVECRRWRSKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDY  180

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+PDFL+RTIPFLV+NPDIGLVQARWK+VNA+EC++TR+QEMS++ HF+VE
Sbjct  181   VAIFDADFQPEPDFLWRTIPFLVNNPDIGLVQARWKFVNADECLMTRMQEMSLNYHFTVE  240

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKF++L D++
Sbjct  241   QEVGSSSYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSDLQ  300

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+ KA+RYQQHRWSCGPANLF+KM  EI+ NKKV++WKK+Y++Y+FFFV KIVA
Sbjct  301   VKNELPSTLKAFRYQQHRWSCGPANLFRKMVMEIVTNKKVSLWKKIYVVYSFFFVRKIVA  360

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H+ TF++YC+VLPATV++PE+ +P WGA+Y+P++  LL  +  PRS H+  FW+LFEN M
Sbjct  361   HINTFVFYCIVLPATVMVPEVVVPKWGAVYIPSIITLLNAVGTPRSFHLLVFWILFENTM  420

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNT--KTAQPKSAKKVPRFRLGERLHLWEIIVG  410
             +LHRT  T IGLLE  R++EW+VTEK G+     A  K  KK+ RFR+G+R+H+ E++VG
Sbjct  421   SLHRTKATIIGLLEASRVNEWIVTEKLGDAFKGKASGKGLKKL-RFRIGDRIHMLELVVG  479

Query  409   FYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             FY+L CG Y+L++G N+++++L++Q  +F ++ FGY+G FV  S
Sbjct  480   FYLLLCGCYDLMYGKNHFFIFLYIQAFAFFIMAFGYVGTFVPNS  523



>ref|XP_008462529.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=536

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/535 (63%), Positives = 441/535 (82%), Gaps = 8/535 (1%)
 Frame = -1

Query  1873  SAAIMFSSEAAVRGAGDAIAPYLGVL-WVQAKALVIVPVLRVMVYLCLVMLIMILMEKVY  1697
             S+A +  +E A  G  D ++  +  L W   +A ++VP+LR+ V+LCL+M +M+ +E+VY
Sbjct  5     SSATLLPTETAFEGTIDDMSFQVSSLPWDTIRAPLVVPLLRLSVFLCLIMSLMLFVERVY  64

Query  1696  LGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAA  1517
             +G V +++KLF R P K+YKWEP+K  DD E+GNS YP VL+QIPM NEK VYQLSIGAA
Sbjct  65    MGIVISFVKLFGRKPEKRYKWEPMK--DDIELGNSVYPMVLIQIPMYNEKEVYQLSIGAA  122

Query  1516  CNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQG  1337
             C LSWP++RIIIQVLDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+G
Sbjct  123   CGLSWPSDRIIIQVLDDSTDPIIKDLVEMECQRWASKGINIKYEIRDNRNGYKAGALKEG  182

Query  1336  MKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQ  1157
             +K SYVK C++VAIFDADF+P+PDFL+RT+PFL+HNP+I LVQARWK+VNANEC LTR+Q
Sbjct  183   LKRSYVKQCDFVAIFDADFQPEPDFLWRTVPFLLHNPNIALVQARWKFVNANECFLTRMQ  242

Query  1156  EMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLK  977
             EMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA LK
Sbjct  243   EMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLK  302

Query  976   GWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLI  797
             GWKF++LGD++VK+ELPSS KAYRYQQHRWSCGPANL +KM  EI+ NKKV+ WKK+++I
Sbjct  303   GWKFLYLGDLKVKNELPSSLKAYRYQQHRWSCGPANLLRKMIMEIITNKKVSAWKKVHVI  362

Query  796   YAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHM  617
             Y+FFFV K+VAH+ TF++YCLVLPATVL+PE+++P WG++Y+P++  LL  +  PRSLH+
Sbjct  363   YSFFFVRKVVAHINTFVFYCLVLPATVLVPEVEVPKWGSVYIPSIITLLNAVGTPRSLHL  422

Query  616   TAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVP---RFRL  446
               +W+LFENVMA+HRT GT IGLLE  R++EW+VTEK G+   ++PK A K P   RF +
Sbjct  423   LVYWILFENVMAMHRTKGTIIGLLEASRVNEWIVTEKLGD--ASKPKLAAKTPKKTRFWI  480

Query  445   GERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             GER+ +WE+ VG Y+  CG Y++ FG N Y+++LFLQ ++F ++GFG++G  V++
Sbjct  481   GERVLMWELGVGAYLFICGIYDIFFGKNQYFIFLFLQAIAFCIVGFGFVGTHVSS  535



>ref|XP_010243535.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Nelumbo 
nucifera]
Length=533

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/521 (64%), Positives = 435/521 (83%), Gaps = 3/521 (1%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +G  D IA  LG +W Q KA +IVP+L++ V++CL+M IM+ +E+VY+G V   +K+F R
Sbjct  15    QGTRDDIAGQLGFIWEQIKAPLIVPLLKIAVFVCLIMSIMLFVERVYMGIVIILVKVFGR  74

Query  1657  TPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQ  1478
              P K+YKWEP+K  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RIIIQ
Sbjct  75    KPEKRYKWEPMK--DDVEMGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQ  132

Query  1477  VLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVA  1298
             VLDDSTD  +K+LV+ EC+RWA KG+NI+YE RDNR G+KAG+LK+GMK SYV+ C+YVA
Sbjct  133   VLDDSTDSTIKSLVELECQRWASKGINIRYEIRDNRNGYKAGALKEGMKRSYVRECDYVA  192

Query  1297  IFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQE  1118
             IFDADF+P+PDFL+RTIPFLVHNPDI LVQARWK+VN++EC++TR+QEMS++ HF+VEQE
Sbjct  193   IFDADFQPEPDFLWRTIPFLVHNPDIALVQARWKFVNSDECLMTRMQEMSLNYHFTVEQE  252

Query  1117  VGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVK  938
             VGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKFV++G ++VK
Sbjct  253   VGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGGLQVK  312

Query  937   SELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHV  758
             +ELPS+FKAYRYQQHRWSCGPANLF+KM  E++RNKKVT+WKK ++IY+FFFV KIVAH+
Sbjct  313   NELPSTFKAYRYQQHRWSCGPANLFRKMVMEVVRNKKVTLWKKFHVIYSFFFVRKIVAHI  372

Query  757   LTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMAL  578
             +TF++YC+V+P TVL+PE+++P WG++Y+P++  +L  +   RSLH+  FW+LFENVM+L
Sbjct  373   VTFVFYCVVMPLTVLVPEVEVPKWGSVYIPSIITILNSVGTLRSLHLLVFWILFENVMSL  432

Query  577   HRTIGTFIGLLEVGRIHEWVVTEKQGN-TKTAQPKSAKKVPRFRLGERLHLWEIIVGFYM  401
             HRT  TFIGLLE GR++EWVVTEK G+  K      A K PR R+GERLHL E+ VG ++
Sbjct  433   HRTKATFIGLLEAGRVNEWVVTEKLGDALKVKAASKAAKKPRVRIGERLHLLELGVGMFL  492

Query  400   LFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              F   Y+L +G N+Y++YL+LQ ++F ++GFGY+G FV  S
Sbjct  493   FFIACYDLAYGKNHYFLYLYLQSLAFFIVGFGYVGTFVPNS  533



>gb|KFK24842.1| hypothetical protein AALP_AA8G031700 [Arabis alpina]
Length=533

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/517 (65%), Positives = 431/517 (83%), Gaps = 3/517 (1%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             D I   + +++ Q +A +IVPVLR+ VY+CLVM +M+ +E+VY+G V + +KLF R P K
Sbjct  19    DDITMQMSMVFDQIRAPLIVPVLRLGVYICLVMSVMLFVERVYMGIVISLVKLFGRKPDK  78

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             ++K+EPIK  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RI+IQVLDD
Sbjct  79    RFKYEPIK--DDIELGNSVYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVLDD  136

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP +K LV+ EC RWA KGVNIKYE RDNR G+KAG+LK+GMK SYVKSC+YVAIFDA
Sbjct  137   STDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAIFDA  196

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF+P+PD+L+RT+P+L+HNP + LVQARWK+VN++EC++TR+QEMS+D HF+VEQEVGS+
Sbjct  197   DFQPEPDYLWRTVPYLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSS  256

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              +AFFGFNGTAGIWRI+AL++AGGWKDRTTVEDMDL  RA LKGWKF++LG ++VK+ELP
Sbjct  257   TYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELP  316

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKAYRYQQHRWSCGPANLF+KM FEIM NK VT+WKK+++IY+FF V K+VAH++TFI
Sbjct  317   STFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIVTFI  376

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC++LPATVL+PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+LFENVM+LHRT 
Sbjct  377   FYCVILPATVLVPEVTVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLHRTK  436

Query  565   GTFIGLLEVGRIHEWVVTEKQGNTKT-AQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCG  389
              TFIGLLE GR++EW+VTEK G+ K  +  K+ KK+ RFR G+R+H+ E+ VG Y+ F G
Sbjct  437   ATFIGLLEGGRVNEWIVTEKLGDLKAKSASKAPKKIIRFRFGDRIHVLELGVGMYLFFVG  496

Query  388   WYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              Y+  FG N+YY+YLF Q ++F + GFG IG  V  S
Sbjct  497   CYDAFFGKNHYYLYLFAQSIAFFIAGFGQIGTIVPNS  533



>ref|XP_010543471.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Tarenaya 
hassleriana]
Length=533

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/517 (65%), Positives = 427/517 (83%), Gaps = 3/517 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G  D +   + ++W Q +A +IVP+LR+ VY+CLVM +M+ +E+VY+G V + +KLF R 
Sbjct  16    GYRDGLTMQVSMVWDQMRAPLIVPLLRLAVYVCLVMSVMLFVERVYMGIVISLVKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YKWEP+K  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RIIIQV
Sbjct  76    PEKRYKWEPMK--DDIELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K LV+ EC RWA KGVNIKYE RDNR G+KAG+LK+GMK SYVKSC+YVAI
Sbjct  134   LDDSTDPTIKDLVELECHRWASKGVNIKYEIRDNRSGYKAGALKEGMKKSYVKSCDYVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL+RTIPFLVHNP + LVQARWK+VNA+EC++TR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLWRTIPFLVHNPRLALVQARWKFVNADECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKF++LG ++VK+
Sbjct  254   GSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+ KAYRYQQHRWSCGPANLF KM  EI+ NK V++WKK ++IY+FF V KIVAH++
Sbjct  314   ELPSTLKAYRYQQHRWSCGPANLFMKMILEIITNKNVSLWKKCHVIYSFFVVRKIVAHIV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF++YC+VLPATV++PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+LFENVM+LH
Sbjct  374   TFVFYCVVLPATVMVPEVTVPKWGAVYIPSIITLLNAVGTPRSLHLMVFWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKS-AKKVPRFRLGERLHLWEIIVGFYML  398
             RT  TFIGL+  GR++EW+VTEK G+   A+  S A + PRFR GER+H+ E+ VG Y+L
Sbjct  434   RTKATFIGLIGAGRVNEWIVTEKLGDAIKAKSASKAPRKPRFRFGERMHVLELGVGMYLL  493

Query  397   FCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
               G Y+L FG N+YY+YLF Q  +F V+GFG +G FV
Sbjct  494   LVGVYDLSFGKNHYYLYLFAQAFAFFVMGFGQVGTFV  530



>ref|XP_010558212.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Tarenaya 
hassleriana]
Length=526

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/517 (65%), Positives = 428/517 (83%), Gaps = 3/517 (1%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             D I   + +LW Q +  ++ P+LR+ VY+CL M +M+ +E+VY+G V + LKLF R P K
Sbjct  12    DGITAQVSMLWDQMRTPLVAPLLRLAVYVCLAMSVMLFVERVYMGIVISLLKLFGRKPEK  71

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +YKWEP+K  DD E+G+S YP VLVQIPM NE+ VYQLSIGAAC LSWP++RIIIQVLDD
Sbjct  72    RYKWEPMK--DDIELGDSAYPVVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDD  129

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP +K LV+ EC+RWA KGVNIKYE RDNRKG+KAG+LK+GMK SYVKSC+YVAIFDA
Sbjct  130   STDPTIKDLVEMECQRWASKGVNIKYEVRDNRKGYKAGALKEGMKKSYVKSCDYVAIFDA  189

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF+P+PDFL+RTIPFLVHNP + LVQARWK+VN++EC++TR+QE+S+D HF+VEQEVGS+
Sbjct  190   DFQPEPDFLWRTIPFLVHNPSLALVQARWKFVNSDECLMTRMQEISLDYHFTVEQEVGSS  249

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKF++LG ++VK+ELP
Sbjct  250   TYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNELP  309

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKAYRYQQHRWSCGPANLF+KM FEI+ NK V++WKK+++IY+FF V KIVAH++TFI
Sbjct  310   STFKAYRYQQHRWSCGPANLFRKMLFEIITNKNVSVWKKVHVIYSFFVVRKIVAHIVTFI  369

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+VLPATVL+PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW++FENVM+LHRT 
Sbjct  370   FYCVVLPATVLVPEVTVPKWGAVYIPSIITLLNAIGTPRSLHLLVFWIMFENVMSLHRTK  429

Query  565   GTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAK-KVPRFRLGERLHLWEIIVGFYMLFCG  389
              TFIGLLE GR++EW+VTEK G+   ++ KS   K PRFR GER+H+ E+ VG Y+   G
Sbjct  430   ATFIGLLEAGRVNEWIVTEKLGDALKSKVKSPHPKKPRFRFGERIHVLEVGVGMYLFIVG  489

Query  388   WYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
               +++ G N YY+YLF Q  +F V+GFG +G FV  S
Sbjct  490   CCDVMLGKNRYYLYLFGQSFAFFVMGFGLVGTFVPHS  526



>ref|XP_007145259.1| hypothetical protein PHAVU_007G223800g [Phaseolus vulgaris]
 gb|ESW17253.1| hypothetical protein PHAVU_007G223800g [Phaseolus vulgaris]
Length=523

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/523 (63%), Positives = 432/523 (83%), Gaps = 3/523 (1%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             A  GA D I+  +G++W Q K  V+VP+LRV V++CL M IM+L+E+VY+G V   +KLF
Sbjct  3     AFEGARDDISSQVGLIWSQVKEPVMVPLLRVAVFVCLGMSIMMLVERVYMGFVICLVKLF  62

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              R P K+YKWE +K  +D E+GNS YP VLVQ+PM NE+ VYQLSIGAAC LSWP++RII
Sbjct  63    GRRPEKRYKWESLK--EDVELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRII  120

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             +Q+LDDSTDP +K LVQ EC RWA KGVNIKYE RDNR G+KAG+LK+GMK SYVK C+Y
Sbjct  121   VQILDDSTDPSIKELVQMECSRWASKGVNIKYEVRDNRNGYKAGALKEGMKRSYVKQCDY  180

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+PDFL+RT+PFLV+NP++GLVQARWK+VNANEC++TR+QEMS+D HF+VE
Sbjct  181   VAIFDADFQPEPDFLWRTVPFLVNNPELGLVQARWKFVNANECLMTRMQEMSLDYHFTVE  240

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKF++L +++
Sbjct  241   QEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLANLK  300

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+ KAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WKK+Y++Y+FFFV K+VA
Sbjct  301   VKNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIIRNKKVSLWKKIYVVYSFFFVRKVVA  360

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H+ TF++YC+VLPATV++PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+LFEN M
Sbjct  361   HLNTFVFYCIVLPATVVVPEVAVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENTM  420

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEK-QGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGF  407
             +LHRT  T IGLLE  R++EW+VTEK     K      A K  RFR+G+R+H+ E++VGF
Sbjct  421   SLHRTKATIIGLLEASRVNEWIVTEKLGDALKGKGGGKAAKKIRFRIGDRIHMLELLVGF  480

Query  406   YMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             Y+ FCG Y+++FG N +Y++L++Q ++F ++ FGY+G  V  S
Sbjct  481   YLFFCGCYDVMFGKNRFYIFLYIQSIAFFIMAFGYVGTIVPNS  523



>ref|NP_195996.1| glucomannan 4-beta-mannosyltransferase 9 [Arabidopsis thaliana]
 sp|Q9LZR3.1|CSLA9_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 9; AltName: 
Full=Cellulose synthase-like protein A9; Short=AtCslA9; 
AltName: Full=Glucomannan synthase; AltName: Full=Mannan synthase 
9; AltName: Full=Protein RESISTANT TO AGROBACTERIUM TRANSFORMATION 
4 [Arabidopsis thaliana]
 emb|CAB82941.1| putative protein [Arabidopsis thaliana]
 dbj|BAB08601.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL31192.1| AT5g03760/F17C15_180 [Arabidopsis thaliana]
 gb|AAN31089.1| At5g03760/F17C15_180 [Arabidopsis thaliana]
 gb|AED90651.1| glucomannan 4-beta-mannosyltransferase 9 [Arabidopsis thaliana]
 gb|AHL38649.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=533

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/517 (64%), Positives = 429/517 (83%), Gaps = 3/517 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G  D I   + ++  Q +A +IVP LR+ VY+CL M +M+ +E+VY+G V + +KLF R 
Sbjct  16    GYRDDITMQMSMVLDQIRAPLIVPALRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K++K+EPIK  DD E+GNS YP VL+QIPM NE+ VYQLSIGAAC LSWP++RI+IQV
Sbjct  76    PDKRFKYEPIK--DDIELGNSAYPMVLIQIPMFNEREVYQLSIGAACGLSWPSDRIVIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K LV+ EC RWA KGVNIKYE RDNR G+KAG+LK+GMK SYVKSC+YVAI
Sbjct  134   LDDSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+ DFL+RT+P+L+HNP + LVQARWK+VN++EC++TR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEADFLWRTVPYLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ +AFFGFNGTAGIWRI+AL++AGGWKDRTTVEDMDL  RA LKGWKF++LG ++VK+
Sbjct  254   GSSTYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYRYQQHRWSCGPANLF+KM FEIM NK VT+WKK+++IY+FF V K+VAH++
Sbjct  314   ELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TFI+YC++LPATVL+PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+LFENVM+LH
Sbjct  374   TFIFYCVILPATVLVPEVTVPKWGAVYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKT-AQPKSAKKVPRFRLGERLHLWEIIVGFYML  398
             RT  TFIGLLE GR++EW+VTEK G+ K  +  K++KKV RFR G+R+H+ E+ VG Y+L
Sbjct  434   RTKATFIGLLEGGRVNEWIVTEKLGDVKAKSATKTSKKVIRFRFGDRIHVLELGVGMYLL  493

Query  397   FCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             F G Y+  FG N+YY+YLF Q ++F + GFG IG  V
Sbjct  494   FVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIV  530



>dbj|BAE98718.1| hypothetical protein [Arabidopsis thaliana]
Length=533

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/517 (64%), Positives = 428/517 (83%), Gaps = 3/517 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G  D I   + ++  Q +A +IVP LR+ VY+CL M +M+ +E+VY+G V + +KLF R 
Sbjct  16    GYRDDITMQMSMVLDQIRAPLIVPALRLGVYICLTMSVMLFVERVYMGIVISLVKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K++K+EPIK  DD E+GNS YP VL+QIPM NE+ VYQLSIGAAC LSWP++RI+IQV
Sbjct  76    PDKRFKYEPIK--DDIELGNSAYPMVLIQIPMFNEREVYQLSIGAACGLSWPSDRIVIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K LV+ EC RWA KGVNIKYE RDNR G+KAG+LK+GMK SYVKSC+YVAI
Sbjct  134   LDDSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEGMKKSYVKSCDYVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+ DFL+RT+P+L+HNP + LVQARWK+VN++EC++TR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEADFLWRTVPYLLHNPKLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ +AFFGFNGTAGIWRI+AL++AGGWKDRTTVEDMDL  RA LKGWKF++LG ++VK+
Sbjct  254   GSSTYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYRYQQHRWSCGPANLF+KM FEIM NK VT+WKK+++IY+FF V K+VAH++
Sbjct  314   ELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVIYSFFVVRKLVAHIV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TFI+YC++LPATVL+PE+ +P WGA Y+P++  LL  +  PRSLH+  FW+LFENVM+LH
Sbjct  374   TFIFYCVILPATVLVPEVTVPKWGAFYIPSVITLLNAVGTPRSLHLMVFWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKT-AQPKSAKKVPRFRLGERLHLWEIIVGFYML  398
             RT  TFIGLLE GR++EW+VTEK G+ K  +  K++KKV RFR G+R+H+ E+ VG Y+L
Sbjct  434   RTKATFIGLLEGGRVNEWIVTEKLGDVKAKSATKTSKKVIRFRFGDRIHVLELGVGMYLL  493

Query  397   FCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             F G Y+  FG N+YY+YLF Q ++F + GFG IG  V
Sbjct  494   FVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIV  530



>ref|XP_006381326.1| hypothetical protein POPTR_0006s11810g [Populus trichocarpa]
 gb|ERP59123.1| hypothetical protein POPTR_0006s11810g [Populus trichocarpa]
Length=532

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/522 (63%), Positives = 429/522 (82%), Gaps = 2/522 (0%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             A +GA D +     ++W Q KA +IVP+LR+ V +CL+M +M+ +E+VY+G V   +KLF
Sbjct  13    AFQGARDDVTMQFAMIWGQIKAPLIVPLLRLAVAICLIMSLMLFIERVYMGIVIVLVKLF  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              R P ++YKWEP+K  DD E GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RII
Sbjct  73    GRKPDRRYKWEPMK--DDVEAGNSTYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRII  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTDP +K +V+ EC+RWA KG+NIKYE RD+R G+K+G+LK+GMK SYVKSC+Y
Sbjct  131   IQVLDDSTDPTIKDMVELECQRWASKGINIKYEVRDSRNGYKSGALKEGMKRSYVKSCDY  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+PDFL RTIPFLVHNP++GLVQ RWK+VNA+EC++TR+QEMS+D HF+VE
Sbjct  191   VAIFDADFQPEPDFLRRTIPFLVHNPELGLVQTRWKFVNADECLMTRMQEMSLDYHFTVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA LKGW+F++L  V+
Sbjct  251   QEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWEFLYLSSVK  310

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+ KAYRYQQHRWSCGPANLF+KM  EI+ NK +T WKK+++IY+FF V KIVA
Sbjct  311   VKNELPSTLKAYRYQQHRWSCGPANLFRKMFMEIITNKAMTSWKKVHVIYSFFLVRKIVA  370

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TFI+YC+VLPATVL+PE+++P WGA+Y+P++  +L  +  PRSLH+  FW+LFENVM
Sbjct  371   HLVTFIFYCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSLHLLVFWILFENVM  430

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFY  404
             +LHRT  TFIGLLE GR++EW+VTEK G+   ++   A K PRFR GERLHL E+  G Y
Sbjct  431   SLHRTKATFIGLLEAGRVNEWIVTEKLGDALKSKANKAAKKPRFRFGERLHLLELGTGAY  490

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             + FCG Y+++FG N+Y++YL+ Q ++F ++G G +G  V  S
Sbjct  491   LFFCGCYDVVFGKNHYFIYLYAQAIAFFIVGLGCVGTIVPRS  532



>ref|XP_009130779.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Brassica 
rapa]
Length=532

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/533 (63%), Positives = 430/533 (81%), Gaps = 5/533 (1%)
 Frame = -1

Query  1876  SSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVY  1697
              SAA++  S    R   D I   + ++  Q +A +IVPVLR+ VY+CL M +M+ +E+VY
Sbjct  5     DSAAVIPDSFMGYR---DDITMQMTMILDQIRAPLIVPVLRLAVYICLTMSVMLFVERVY  61

Query  1696  LGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAA  1517
             +G V + +KLF R P K++KWEP+K  DD E GNS YP VLVQIPM NE+ VYQLSIGAA
Sbjct  62    MGIVISLVKLFGRKPEKRFKWEPMK--DDIEHGNSVYPMVLVQIPMYNEREVYQLSIGAA  119

Query  1516  CNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQG  1337
             C LSWP++RI+IQVLDDSTDP +K LV++EC RWA KG+NIKYE RDNR G+KAG+LK+G
Sbjct  120   CGLSWPSDRIVIQVLDDSTDPTIKDLVEKECSRWASKGINIKYEIRDNRNGYKAGALKEG  179

Query  1336  MKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQ  1157
             MK SYVKSC+YVAIFDADF+P+PD+L+RT+PFL+HNP + LVQARWK+VN++EC++TR+Q
Sbjct  180   MKKSYVKSCDYVAIFDADFQPEPDYLWRTVPFLLHNPKLALVQARWKFVNSDECLMTRMQ  239

Query  1156  EMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLK  977
             EMS+D HF+VEQEVGS+ +AFFGFNGTAGIWRI+AL +AGGWKDRTTVEDMDL  RA LK
Sbjct  240   EMSLDYHFTVEQEVGSSTYAFFGFNGTAGIWRISALSEAGGWKDRTTVEDMDLAVRASLK  299

Query  976   GWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLI  797
             GWKF++LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM FEIM NK VT+WKK+++I
Sbjct  300   GWKFLYLGSLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVI  359

Query  796   YAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHM  617
             Y+FF V KIVAH++TFI+YC++LPATVL+PE+ +P WGA+Y+P++  LL  +  PRSLH+
Sbjct  360   YSFFVVRKIVAHIVTFIFYCVILPATVLVPEVTVPKWGAVYIPSIITLLNAVGTPRSLHL  419

Query  616   TAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGER  437
               FW+LFENVM+LHRT  TFIGLLE GR++EW+VTEK G+ K        K  RFR G+R
Sbjct  420   MVFWILFENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDLKAKSATKTLKKLRFRFGDR  479

Query  436   LHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             +H+ E+ VG Y+ F G Y++ FG N+YY+YLF Q ++F + G G IG  V  S
Sbjct  480   IHVLELGVGMYLFFVGCYDVFFGKNHYYLYLFAQAIAFFIAGLGQIGTIVPNS  532



>ref|XP_006287469.1| hypothetical protein CARUB_v10000681mg [Capsella rubella]
 gb|EOA20367.1| hypothetical protein CARUB_v10000681mg [Capsella rubella]
Length=533

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/533 (64%), Positives = 437/533 (82%), Gaps = 6/533 (1%)
 Frame = -1

Query  1885  GNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILME  1706
             G+S+++ I      +  G  D I   + ++  Q +A +IVPVLR+ VY+CL M +M+ +E
Sbjct  4     GDSTTSVI----PDSFMGYRDDITMQMSMVLDQIRAPLIVPVLRLAVYICLTMSVMLFVE  59

Query  1705  KVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSI  1526
             +VY+G V + +KLF R P K++K+EPIK  DD E+GNS YP VLVQIPM NE+ VYQLSI
Sbjct  60    RVYMGIVISLVKLFGRKPDKRFKYEPIK--DDLELGNSVYPMVLVQIPMFNEREVYQLSI  117

Query  1525  GAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSL  1346
             GAAC LSWP++RI+IQVLDDSTDP +K LV+ EC RWA KGVNIKYE RDNR G+KAG+L
Sbjct  118   GAACGLSWPSDRIVIQVLDDSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGAL  177

Query  1345  KQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLT  1166
             K+GMK SYVKSC+YVAIFDADF+P+PD+L+RT+PFL+HNP + LVQARWK+VN++EC++T
Sbjct  178   KEGMKKSYVKSCDYVAIFDADFQPEPDYLWRTVPFLLHNPKLALVQARWKFVNSDECLMT  237

Query  1165  RLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRA  986
             R+QEMS+D HF+VEQEVGS+ +AFFGFNGTAGIWRI+AL++AGGWKDRTTVEDMDL  RA
Sbjct  238   RMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRA  297

Query  985   GLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKL  806
              LKGWKF++LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM FEIM NK VT+WKK+
Sbjct  298   SLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKV  357

Query  805   YLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRS  626
             ++IY+FF V KIVAH++TFI+YC+VLPATVL+PE+ +P WGA+Y+P++  LL  +  PRS
Sbjct  358   HVIYSFFVVRKIVAHIVTFIFYCVVLPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRS  417

Query  625   LHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRL  446
             LH+  FW+LFENVM+LHRT  TFIGLLE GR++EW+VTEK G+ K    K+ KK+ RFR 
Sbjct  418   LHLMVFWILFENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDLKAKSAKAPKKILRFRF  477

Query  445   GERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             G+R+H+ E+ VG Y+LF G Y+  FG N+YY+YLF Q ++F + GFG IG  V
Sbjct  478   GDRIHVLELGVGMYLLFVGCYDAFFGKNHYYIYLFAQAIAFFIAGFGQIGTIV  530



>ref|XP_004143300.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN48231.1| hypothetical protein Csa_6G450360 [Cucumis sativus]
Length=537

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/535 (62%), Positives = 438/535 (82%), Gaps = 8/535 (1%)
 Frame = -1

Query  1873  SAAIMFSSEAAVRGA-GDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVY  1697
             S+  +  +E A  G   D     + + W   +A ++VP+LR+ V+LCL+M +M+ +E+VY
Sbjct  6     SSEALLPTETAFEGTINDMSFQVISLPWDAIRAPLVVPLLRLSVFLCLIMSLMLFVERVY  65

Query  1696  LGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAA  1517
             +G V +++KLF R P K++KWEP+K  DD E+GNS YP VL+QIPM NEK VYQLSIGAA
Sbjct  66    MGIVISFVKLFGRKPEKRFKWEPMK--DDIELGNSVYPMVLIQIPMYNEKEVYQLSIGAA  123

Query  1516  CNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQG  1337
             C LSWP++RIIIQVLDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+G
Sbjct  124   CGLSWPSDRIIIQVLDDSTDPMIKDLVEMECQRWASKGINIKYEIRDNRNGYKAGALKEG  183

Query  1336  MKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQ  1157
             +K SYVK C++VAIFDADF+P+PDFL+RT+PFL+HNP+I LVQARWK+VNANEC LTR+Q
Sbjct  184   LKRSYVKQCDFVAIFDADFQPEPDFLWRTVPFLLHNPNIALVQARWKFVNANECFLTRMQ  243

Query  1156  EMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLK  977
             EMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA LK
Sbjct  244   EMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLK  303

Query  976   GWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLI  797
             GWKF++LGD++VK+ELPSS KAYRYQQHRWSCGPANL +KM  EI+ NKKVT WKK+++I
Sbjct  304   GWKFLYLGDLKVKNELPSSLKAYRYQQHRWSCGPANLLRKMIMEIITNKKVTAWKKVHVI  363

Query  796   YAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHM  617
             Y+FFFV K+VAH+ TF++YC+VLPATVL+PE+++P WG++Y+P++  LL  +  PRSLH+
Sbjct  364   YSFFFVRKVVAHINTFVFYCIVLPATVLVPEVEVPKWGSVYIPSIITLLNAVGTPRSLHL  423

Query  616   TAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKV---PRFRL  446
               +W+LFENVMA+HRT GT IGLLE  R++EW+VTEK G+   ++PK A K    PRF +
Sbjct  424   LVYWILFENVMAMHRTKGTIIGLLEASRVNEWIVTEKLGD--ASKPKLAAKTPKKPRFWI  481

Query  445   GERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             GER+ +WE+ VG Y+  CG Y++ FG N Y+++LFLQ ++F ++GFG++G  V++
Sbjct  482   GERVLMWELGVGAYLFICGIYDIFFGKNQYFIFLFLQAIAFCIVGFGFVGTHVSS  536



>ref|XP_010490868.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Camelina 
sativa]
Length=534

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/534 (63%), Positives = 437/534 (82%), Gaps = 7/534 (1%)
 Frame = -1

Query  1885  GNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILME  1706
             G+S+++ I      +  G  D +   + ++  Q +A +IVPVLR+ VY+CL M +M+ +E
Sbjct  4     GDSTTSVI----PDSFMGYRDDLTTQMSMVLNQIRAPLIVPVLRLAVYICLTMSVMLFVE  59

Query  1705  KVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSI  1526
             +VY+G V + +KLF R P K++K+E IK  DD E+GNS YP VLVQIPM NE+ VYQLSI
Sbjct  60    RVYMGIVISLVKLFGRKPDKRFKYEAIK--DDMELGNSVYPMVLVQIPMYNEREVYQLSI  117

Query  1525  GAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSL  1346
             GAAC LSWP++RI+IQVLDDSTDP +K LV+ EC RWA KGVNIKYE RDNR G+KAG+L
Sbjct  118   GAACGLSWPSDRIVIQVLDDSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGAL  177

Query  1345  KQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLT  1166
             K+GMK SYVKSC+YVAIFDADF+P+ DFL+RT+PFL+HNP + LVQARWK+VN++EC++T
Sbjct  178   KEGMKKSYVKSCDYVAIFDADFQPESDFLWRTVPFLLHNPKLALVQARWKFVNSDECLMT  237

Query  1165  RLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRA  986
             R+QEMS+D HF+VEQEVGS+ +AFFGFNGTAGIWRI+AL++AGGWKDRTTVEDMDL  RA
Sbjct  238   RMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRA  297

Query  985   GLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKL  806
              LKGWKF++LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM FEIM NK VT+WKK+
Sbjct  298   SLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKV  357

Query  805   YLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRS  626
             ++IY+FF V K+VAH++TFI+YC++LPATVL+PE+ +P WGA+Y+P++  LL  +  PRS
Sbjct  358   HVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRS  417

Query  625   LHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKT-AQPKSAKKVPRFR  449
             LH+  FW+LFENVM+LHRT  TFIGLLE GR++EW+VTEK G+ K  +  K+ KK+ RFR
Sbjct  418   LHLMVFWILFENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDLKAKSSGKTPKKLLRFR  477

Query  448   LGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              G+R+H+ E+ VG Y+LF G Y++ FG N+YY+YLF Q ++F + GFG IG  V
Sbjct  478   FGDRIHVLELGVGMYLLFVGCYDVFFGKNHYYLYLFAQAIAFFIAGFGQIGTIV  531



>ref|XP_002311972.2| 4-mannan synthase family protein [Populus trichocarpa]
 gb|EEE89339.2| 4-mannan synthase family protein [Populus trichocarpa]
Length=530

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/538 (64%), Positives = 437/538 (81%), Gaps = 17/538 (3%)
 Frame = -1

Query  1876  SSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLV----MLIMILM  1709
             SSA+ MF +        D +   +G++W     ++I P++  ++ L +V    M IM+ +
Sbjct  5     SSASNMFPA------GRDGVTGQIGLIW----QVIIEPLIVPVLKLLVVVCLGMSIMLFI  54

Query  1708  EKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLS  1529
             E+VY+G V  ++KLF + P K+YKWEPIK  DD E+GNS YP VLVQ+PM NEK VYQLS
Sbjct  55    ERVYMGVVIVFVKLFGKKPNKRYKWEPIK--DDIELGNSAYPMVLVQVPMYNEKEVYQLS  112

Query  1528  IGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGS  1349
             IGAAC LSWP++RIIIQVLDDSTDP +K++V+ EC+RWA KG+NIKYE RDNR G+KAG+
Sbjct  113   IGAACGLSWPSDRIIIQVLDDSTDPAIKSMVEVECQRWASKGINIKYEIRDNRNGYKAGA  172

Query  1348  LKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECML  1169
             LK+GMKHSYVK C+YVAIFDADF+P+PDFL+RTIPFL HNP+I LVQARWK+VN++EC++
Sbjct  173   LKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRTIPFLAHNPEIALVQARWKFVNSDECLM  232

Query  1168  TRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCR  989
             TR+QEMS+D HF+VEQEVGSA +AFFGFNGTAG+WRI+A+++AGGWK RTTVEDMDL  R
Sbjct  233   TRMQEMSLDYHFTVEQEVGSATYAFFGFNGTAGVWRISAVNEAGGWKARTTVEDMDLAVR  292

Query  988   AGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKK  809
             A LKGWKFV++GD++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI++NKKV++WKK
Sbjct  293   ASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAIEIVKNKKVSLWKK  352

Query  808   LYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPR  629
              Y+IY+FFFV KIVAH++TF++YC+VLPATVL+PE+ +P WGA+Y+P++  LL  +  PR
Sbjct  353   CYVIYSFFFVRKIVAHIVTFLFYCVVLPATVLVPEVTVPKWGAVYIPSVVTLLNAVGTPR  412

Query  628   SLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ-PKSAKKVPRF  452
             SLH+  FW+LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+   A+ P  A K PR 
Sbjct  413   SLHLMVFWILFENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALKAKLPAKATKKPRI  472

Query  451   RLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             R+GERLHL E+  G Y+ FCG Y+  FG N YY++LFLQ ++F + GFGYIG FV  S
Sbjct  473   RIGERLHLLELCAGAYLFFCGCYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVPHS  530



>emb|CDY11268.1| BnaA03g01040D [Brassica napus]
Length=532

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/538 (63%), Positives = 430/538 (80%), Gaps = 6/538 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             M+   SSA I      +  G  D I   + ++  Q +A +IVPVLR+ VY+CL M +M+ 
Sbjct  1     MELGDSSAVI----PDSFMGYRDDITMQMTMILDQIRAPLIVPVLRLAVYICLTMSVMLF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+G V + +KLF R P K++KWEP+K  DD E GNS YP VLVQIPM NE+ VYQL
Sbjct  57    VERVYMGIVISLVKLFGRKPEKRFKWEPMK--DDIEHGNSVYPMVLVQIPMYNEREVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RI+IQVLDDSTDP +K LV++EC RWA KG+NIKYE RDNR G+KAG
Sbjct  115   SIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEKECSRWASKGINIKYEIRDNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMK SYVKSC+YVAIFDADF+P+PD+L+RT+PFL+HNP + LVQARWK+VN++EC+
Sbjct  175   ALKEGMKKSYVKSCDYVAIFDADFQPEPDYLWRTVPFLLHNPKLALVQARWKFVNSDECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAGIWRI+AL +AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGIWRISALSEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKF++LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EIM NK VT+WK
Sbjct  295   RASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMALEIMTNKNVTLWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY+FF V KIVAH++TFI+YC+VLPATVL+PE+ +P WGA+Y+P++  LL  +  P
Sbjct  355   KVHVIYSFFVVRKIVAHIVTFIFYCVVLPATVLVPEVTVPKWGAVYIPSIITLLNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRF  452
             RSLH+  FW+LFENVM+LHRT  TFIGLLE GR++EW+VTEK G+ K        K  RF
Sbjct  415   RSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDLKAKSATKTLKKLRF  474

Query  451   RLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             R G+R+H+ E+ VG Y+ F G Y++ FG N+YY+YLF Q ++F + G G IG  V  S
Sbjct  475   RFGDRIHVLELGVGMYLFFVGCYDVFFGKNHYYLYLFAQAIAFFIAGLGQIGTIVPNS  532



>ref|XP_004151323.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 ref|XP_004165881.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=483

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/485 (68%), Positives = 408/485 (84%), Gaps = 3/485 (1%)
 Frame = -1

Query  1729  MLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNE  1550
             M +M+ +E+VY+G V  ++KLFR+ P K YKWEPIK  DD E+ +  YP VLVQIPM NE
Sbjct  1     MSLMLFVERVYMGIVILFVKLFRKNPHKTYKWEPIK--DDLELAHFAYPMVLVQIPMYNE  58

Query  1549  KRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNR  1370
             K VYQLSIGAAC LSWPT+RIIIQVLDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR
Sbjct  59    KEVYQLSIGAACGLSWPTDRIIIQVLDDSTDPSIKDLVELECKRWANKGINIKYEIRDNR  118

Query  1369  KGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYV  1190
              G+KAG+LK+GMKH+YVK C+YVAIFDADF+P+PDFL+RTIPFL++NP+I LVQARWK+V
Sbjct  119   NGYKAGALKEGMKHNYVKLCDYVAIFDADFQPEPDFLWRTIPFLINNPEIALVQARWKFV  178

Query  1189  NANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVE  1010
             N++EC++TR+QEMS+D HF VEQEVGSA +AFFGFNGTAG+WRIAAL++AGGWKDRTTVE
Sbjct  179   NSDECLMTRMQEMSLDYHFKVEQEVGSATYAFFGFNGTAGVWRIAALNEAGGWKDRTTVE  238

Query  1009  DMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNK  830
             DMDL  RA LKGWKFV++GD++VK+ELPS+FKAYRYQQHRWSCGPANL KKM  EIMRNK
Sbjct  239   DMDLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANLLKKMVIEIMRNK  298

Query  829   KVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltall  650
             KV++WKKLYLIY+FFFV KIVAH++TF++YC++LPATVL+PE+ +P WGA+Y+P+   LL
Sbjct  299   KVSLWKKLYLIYSFFFVRKIVAHIVTFVFYCVILPATVLVPEVSVPKWGAVYIPSTITLL  358

Query  649   tlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKS  473
               +  PRS H+  FW+LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+  KT     
Sbjct  359   NAVGTPRSFHLIIFWILFENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALKTKLGSK  418

Query  472   AKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGA  293
             A + PRFR+GERLH+ E+ VG Y+ FCGWY+L FG N Y++YLFLQ  +F + G GY+G 
Sbjct  419   APRKPRFRMGERLHMLELCVGGYLFFCGWYDLNFGKNGYFIYLFLQSFAFFIAGVGYVGT  478

Query  292   FVTTS  278
              V  S
Sbjct  479   LVPNS  483



>ref|XP_004164074.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=537

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/535 (62%), Positives = 438/535 (82%), Gaps = 8/535 (1%)
 Frame = -1

Query  1873  SAAIMFSSEAAVRGA-GDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVY  1697
             S+  +  +E A  G   D     + + W   +A ++VP+LR+ V+LCL+M +M+ +E+VY
Sbjct  6     SSEALLPTETAFEGTINDMSFQVISLPWDAIRAPLVVPLLRLSVFLCLIMSLMLFVERVY  65

Query  1696  LGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAA  1517
             +G V +++KLF R P K++KWEP+K  DD E+GNS YP VL+QIPM NEK VYQLSIGAA
Sbjct  66    MGIVISFVKLFGRKPEKRFKWEPMK--DDIELGNSVYPMVLIQIPMYNEKEVYQLSIGAA  123

Query  1516  CNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQG  1337
             C LSWP++RIIIQVLDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+G
Sbjct  124   CGLSWPSDRIIIQVLDDSTDPMIKDLVEMECQRWASKGINIKYEIRDNRNGYKAGALKEG  183

Query  1336  MKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQ  1157
             +K SYVK C++VAIFDADF+P+PDFL+RT+PFL+HNP+I LVQARWK+VNANEC LTR+Q
Sbjct  184   LKRSYVKQCDFVAIFDADFQPEPDFLWRTVPFLLHNPNIALVQARWKFVNANECFLTRMQ  243

Query  1156  EMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLK  977
             EMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA LK
Sbjct  244   EMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLK  303

Query  976   GWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLI  797
             GWKF++LGD++VK+ELPSS KAYRYQQHRWSCGPANL +KM  EI+ NKKVT WKK+++I
Sbjct  304   GWKFLYLGDLKVKNELPSSLKAYRYQQHRWSCGPANLLRKMIMEIITNKKVTAWKKVHVI  363

Query  796   YAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHM  617
             Y+FFFV K+VAH+ TF++YC+VLPATVL+PE+++P WG++Y+P++  LL  +  PRS+H+
Sbjct  364   YSFFFVRKVVAHINTFVFYCIVLPATVLVPEVEVPKWGSVYIPSIITLLNAVGTPRSIHL  423

Query  616   TAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKV---PRFRL  446
               +W+LFENVMA+HRT GT IGLLE  R++EW+VTEK G+   ++PK A K    PRF +
Sbjct  424   LVYWILFENVMAMHRTKGTIIGLLEASRVNEWIVTEKLGD--ASKPKLAAKTPKKPRFWI  481

Query  445   GERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             GER+ +WE+ VG Y+  CG Y++ FG N Y+++LFLQ ++F ++GFG++G  V++
Sbjct  482   GERVLMWELGVGAYLFICGIYDIFFGKNQYFIFLFLQAIAFCIVGFGFVGTHVSS  536



>gb|AFZ78578.1| cellulose synthase-like protein [Populus tomentosa]
Length=530

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/529 (65%), Positives = 438/529 (83%), Gaps = 4/529 (1%)
 Frame = -1

Query  1858  FSSEAAVRGAG-DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVS  1682
              SS + +  AG D +  +LG++W      +IVPVL+++V +CL M IM+ +E+VY+G V 
Sbjct  4     LSSASNIFPAGRDGVTGHLGLIWQVIMEPLIVPVLKLLVVVCLGMSIMLFIERVYMGVVI  63

Query  1681  AYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSW  1502
              ++KLF + P K+YKWEPIK  DD E+GNS YP VLVQ+PM NEK VYQLSIGAAC LSW
Sbjct  64    VFVKLFGKKPNKRYKWEPIK--DDIELGNSAYPMVLVQVPMYNEKEVYQLSIGAACGLSW  121

Query  1501  PTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSY  1322
             P++RIIIQVLDDSTDP +K++V+ EC+RWA KG+NIKYE RD+R G+KAG+LK+GMKHSY
Sbjct  122   PSDRIIIQVLDDSTDPAIKSMVEVECQRWASKGINIKYEIRDSRNGYKAGALKEGMKHSY  181

Query  1321  VKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMD  1142
             VK C+YVAIFDADF+P+PDFL+RTIPFL HNP+I LVQARWK+VN++EC++TR+QEMS+D
Sbjct  182   VKQCDYVAIFDADFQPEPDFLWRTIPFLAHNPEIALVQARWKFVNSDECLMTRMQEMSLD  241

Query  1141  RHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFV  962
              HF+VEQEVGSA +AFFGFNGTAG+WRI+A+++AGGWK RTTVEDMDL  RA L+GWKFV
Sbjct  242   YHFTVEQEVGSATYAFFGFNGTAGVWRISAVNEAGGWKARTTVEDMDLAVRASLQGWKFV  301

Query  961   FLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFF  782
             ++GD++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI++NKKV++WKK Y+IY+FFF
Sbjct  302   YVGDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAIEIVKNKKVSVWKKCYVIYSFFF  361

Query  781   VNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWM  602
             V KIVAH++TF++YC+VLPATVL PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+
Sbjct  362   VRKIVAHIVTFLFYCVVLPATVLFPEVTVPKWGAVYIPSVVTLLNAVGTPRSLHLMVFWI  421

Query  601   LFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ-PKSAKKVPRFRLGERLHLW  425
             LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+   A+ P  A K PR R+GERLHL 
Sbjct  422   LFENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALKAKLPAKATKKPRIRIGERLHLL  481

Query  424   EIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             E+  G Y+ FCG Y+  FG N YY++LFLQ ++F + GFGYIG FV  S
Sbjct  482   ELCAGAYLFFCGCYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVPRS  530



>ref|XP_010452272.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Camelina 
sativa]
Length=534

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/534 (63%), Positives = 436/534 (82%), Gaps = 7/534 (1%)
 Frame = -1

Query  1885  GNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILME  1706
             G+S+++ I      +  G  D +   + ++  Q +A +IVPVLR+ VY+CL M +M+ +E
Sbjct  4     GDSTTSVI----PDSFMGYRDDLTMQMSMVLDQIRAPLIVPVLRLGVYICLTMSVMLFVE  59

Query  1705  KVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSI  1526
             +VY+G V + +KLF R P K++K+E IK  DD E+GNS YP VLVQIPM NE+ VYQLSI
Sbjct  60    RVYMGIVISLVKLFGRKPDKRFKYEAIK--DDMELGNSVYPMVLVQIPMYNEREVYQLSI  117

Query  1525  GAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSL  1346
             GAAC LSWP++RI+IQVLDDSTDP +K LV+ EC RWA KGVNIKYE RDNR G+KAG+L
Sbjct  118   GAACGLSWPSDRIVIQVLDDSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGAL  177

Query  1345  KQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLT  1166
             K+GMK SYVKSC+YVAIFDADF+P+ DFL+RT+PFL+HNP + LVQARWK+VN++EC++T
Sbjct  178   KEGMKKSYVKSCDYVAIFDADFQPESDFLWRTVPFLLHNPKLALVQARWKFVNSDECLMT  237

Query  1165  RLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRA  986
             R+QEMS+D HF+VEQEVGS+ +AFFGFNGTAGIWRI+AL++AGGWKDRTTVEDMDL  RA
Sbjct  238   RMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRA  297

Query  985   GLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKL  806
              LKGWKF++LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM FEIM NK VT+WKK+
Sbjct  298   SLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKV  357

Query  805   YLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRS  626
             ++IY+FF V K+VAH++TFI+YC++LPATVL+PE+ +P WGA+Y+P++  LL  +  PRS
Sbjct  358   HVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRS  417

Query  625   LHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKT-AQPKSAKKVPRFR  449
             LH+  FW+LFENVM+LHRT  TFIGLLE GR++EW+VTEK G+ K  +  K+ KK+ RFR
Sbjct  418   LHLMVFWILFENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDLKAKSASKTPKKLLRFR  477

Query  448   LGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              G+R+H+ E+ VG Y+LF G Y+  FG N+YY+YLF Q ++F + GFG IG  V
Sbjct  478   FGDRIHVLELGVGMYLLFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTIV  531



>gb|KHG19821.1| Glucomannan 4-beta-mannosyltransferase 9 -like protein [Gossypium 
arboreum]
Length=529

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/519 (63%), Positives = 433/519 (83%), Gaps = 3/519 (1%)
 Frame = -1

Query  1831  AGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTP  1652
               D ++  + V+W Q KA +IVP+L++ V +CL+M +M+ +E+VY+G V A +KLF R P
Sbjct  13    TNDDLSMQMAVIWGQIKAPLIVPLLKLAVVVCLIMSVMLFVERVYMGIVIALVKLFGRKP  72

Query  1651  AKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVL  1472
              K++KWE IK  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RI+IQVL
Sbjct  73    DKRFKWEAIK--DDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIVIQVL  130

Query  1471  DDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIF  1292
             DDSTDP +K +V+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMKHSYVK C+YV IF
Sbjct  131   DDSTDPTIKDMVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDYVVIF  190

Query  1291  DADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVG  1112
             DADF+P+PDFL+RTIPFLVHNP++ LVQARWK+VN++EC++TR+QEMS+D HF+VEQEVG
Sbjct  191   DADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVG  250

Query  1111  SAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSE  932
             S+ ++FFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKF++LG ++VK+E
Sbjct  251   SSTYSFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVKNE  310

Query  931   LPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLT  752
             LPS+ KAYRYQQHRWSCGPANLF+KM  EI++NKKV+ WKK+++IY+FF V K+VAH++T
Sbjct  311   LPSTLKAYRYQQHRWSCGPANLFRKMVMEIIKNKKVSTWKKVHVIYSFFVVRKLVAHIVT  370

Query  751   FIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHR  572
             FI+YC+VLPATVL+PE+++P WGA+Y+P++  +L  +  PRS H+  FW+LFENVM+LHR
Sbjct  371   FIFYCVVLPATVLVPEVEVPKWGAVYIPSIITILNAVGTPRSFHLLVFWILFENVMSLHR  430

Query  571   TIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLF  395
             T  TFIGLLE GR++EW+VTEK G+  K+     A + PRFR GERLH+ E+ VG Y+ F
Sbjct  431   TKATFIGLLEAGRVNEWIVTEKLGDAFKSKAAAKAPRKPRFRFGERLHVLELCVGAYLFF  490

Query  394   CGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             CG Y+++FG N+Y++YLF Q ++F ++GFGY+G  V  S
Sbjct  491   CGCYDVVFGKNHYFIYLFAQAIAFFIMGFGYVGTIVPNS  529



>ref|XP_010110184.1| hypothetical protein L484_016805 [Morus notabilis]
 gb|EXC25422.1| hypothetical protein L484_016805 [Morus notabilis]
Length=541

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/531 (65%), Positives = 439/531 (83%), Gaps = 11/531 (2%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             A +GA + IA  + ++W QAKA VIVPVLR++V +CL M +M+ +EKVY+G    ++KLF
Sbjct  13    AFQGARNDIAGQMALVWEQAKAPVIVPVLRLLVVVCLAMSVMLFIEKVYMGVFITFVKLF  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
             R+ P K+YKWEPIK  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RII
Sbjct  73    RKRPEKRYKWEPIK--DDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRII  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTDP +K+LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMKHSYVK C+Y
Sbjct  131   IQVLDDSTDPTIKSLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKHSYVKHCDY  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+PDFL+RTIPFLVHNP+IGLVQARWK+VN++EC++TR+QEMS+D HF+VE
Sbjct  191   VAIFDADFQPEPDFLWRTIPFLVHNPEIGLVQARWKFVNSDECLMTRMQEMSLDYHFTVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS  ++FFGFNGTAG+WR++AL++AGGWKDRTTVEDMDL  RA L+GWKFV+L D++
Sbjct  251   QEVGSTAYSFFGFNGTAGVWRLSALNEAGGWKDRTTVEDMDLAVRASLRGWKFVYLSDLK  310

Query  943   --------VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAF  788
                     VKSELPS+FKA+RYQQHRWSCGPANLFKKM  EI+RNKKV+  KK +++Y+F
Sbjct  311   YQIFNETQVKSELPSTFKAFRYQQHRWSCGPANLFKKMAMEIVRNKKVSPLKKFHVLYSF  370

Query  787   FFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAF  608
             FFV KIVAH++TF++YC+VLPATVL PE+++P WGA+Y+P++  LL  +  PRS H+  F
Sbjct  371   FFVRKIVAHIVTFVFYCVVLPATVLAPEVEVPKWGAVYIPSVITLLNAVGTPRSFHLLIF  430

Query  607   WMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLH  431
             W+LFENVM+LHRT  TFIGLLE GR++EW+VT+K G+  KT     + K PRFR+GERLH
Sbjct  431   WILFENVMSLHRTKATFIGLLEAGRVNEWIVTDKLGDALKTKAGAKSFKKPRFRIGERLH  490

Query  430   LWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             L E+ VG Y+ FCG Y+L FG N Y++YLFLQ  +F + G GY+G FV ++
Sbjct  491   LLELTVGAYLFFCGCYDLSFGKNRYFIYLFLQSFAFFIAGVGYVGTFVPSA  541



>ref|XP_006398833.1| hypothetical protein EUTSA_v10013220mg [Eutrema salsugineum]
 dbj|BAJ34228.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ40286.1| hypothetical protein EUTSA_v10013220mg [Eutrema salsugineum]
Length=532

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/536 (63%), Positives = 433/536 (81%), Gaps = 11/536 (2%)
 Frame = -1

Query  1876  SSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVY  1697
              SAA++  S    R   D I   + ++  Q +A +IVPVLR+ VY+CL M +M+ +E+VY
Sbjct  5     DSAAVIPDSFMGYR---DDITMQMSMILDQIRAPLIVPVLRLGVYICLTMSVMLFVERVY  61

Query  1696  LGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAA  1517
             +G V + +KLF R P K++KWEP+K  DD E GNS YP VLVQIPM NE+ VYQLSIGAA
Sbjct  62    MGIVISLVKLFGRKPEKRFKWEPMK--DDIEHGNSVYPMVLVQIPMYNEREVYQLSIGAA  119

Query  1516  CNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQG  1337
             C LSWP++RI+IQVLDDSTD  +K LV+ EC RWA KGVNIKYE RDNR G+KAG+LK+G
Sbjct  120   CGLSWPSDRIVIQVLDDSTDQTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEG  179

Query  1336  MKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQ  1157
             MK SYVKSC+YVAIFDADF+P+ DFL++T+PFL+HNP + LVQARWK+VN++EC++TR+Q
Sbjct  180   MKKSYVKSCDYVAIFDADFQPESDFLWKTVPFLLHNPKLALVQARWKFVNSDECLMTRMQ  239

Query  1156  EMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLK  977
             EMS+D HF+VEQEVGS+ +AFFGFNGTAGIWRI+AL++AGGWKDRTTVEDMDL  RA LK
Sbjct  240   EMSLDYHFTVEQEVGSSTYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLK  299

Query  976   GWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLI  797
             GWKF++LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM FEIM NK VT+WKK+++I
Sbjct  300   GWKFLYLGSLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVI  359

Query  796   YAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHM  617
             Y+FF V K+VAH++TFI+YC++LPATVL+PE+ +P WGA+Y+P++  LL  +  PRSLH+
Sbjct  360   YSFFVVRKLVAHIVTFIFYCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRSLHL  419

Query  616   TAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVP---RFRL  446
               FW+LFENVM+LHRT  TFIGLLE GR++EW+VTEK G+ K    KSA K P   RFR 
Sbjct  420   MVFWILFENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDLKA---KSATKTPKKLRFRF  476

Query  445   GERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             G+R+H+ E+ VG Y+ F G Y+  FG N+YY+YLF Q ++F + GFG IG FV  S
Sbjct  477   GDRIHVLELGVGMYLFFVGCYDAFFGKNHYYLYLFAQAIAFFIAGFGQIGTFVPNS  532



>ref|XP_009122674.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Brassica 
rapa]
Length=532

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/535 (63%), Positives = 431/535 (81%), Gaps = 6/535 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             M+   SSA I      +  G  D I   + ++  Q +A +IVPVLR+ VY+CL M +M+ 
Sbjct  1     MELGDSSAVI----PDSFMGYRDDITMQISMILDQIRAPLIVPVLRLAVYICLTMSVMLF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+G V + +KLF R P K++KWEP+K  DD E+GNS YP VLVQIPM NE+ VYQL
Sbjct  57    VERVYMGIVISLVKLFGRKPEKRFKWEPMK--DDIELGNSVYPMVLVQIPMYNEREVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RI+IQVLDDSTDP +K LV+ EC RWA KGVNIKYE RDNR G+KAG
Sbjct  115   SIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMK SYVKSC+YVAIFDADF+P+PD+L++T+PFL+HNP + LVQARWK+VN++EC+
Sbjct  175   ALKEGMKKSYVKSCDYVAIFDADFQPEPDYLWKTVPFLLHNPKLALVQARWKFVNSDECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAGIWRI+AL++AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKF++LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM FEIM NK VT+WK
Sbjct  295   RASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY+FF V KIVAH++TFI+YC+VLPATVL+PE+ +P WGA+Y+P++  LL  +  P
Sbjct  355   KVHVIYSFFVVRKIVAHIVTFIFYCVVLPATVLVPEVIVPKWGAVYIPSIITLLNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRF  452
             RSLH+  FW+LFENVM+LHRT  TFIGLLE GR++EW+VTEK G+ K      A K  RF
Sbjct  415   RSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDLKAKSATKAPKKLRF  474

Query  451   RLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             R G+R+H+ E+ VG Y+   G Y+ +FG N+YY+YLF Q ++F + G G IG  V
Sbjct  475   RFGDRIHVLELGVGMYLFSIGCYDALFGKNHYYLYLFAQAIAFFIAGCGQIGTVV  529



>ref|XP_010423663.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Camelina 
sativa]
Length=534

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/534 (63%), Positives = 435/534 (81%), Gaps = 7/534 (1%)
 Frame = -1

Query  1885  GNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILME  1706
             G+S+++ I      +  G  D +   + ++  Q +A +IVPVLR+ VY+CL M +M+ +E
Sbjct  4     GDSTTSVI----PDSFMGYRDDLTTQMSMVLDQIRAPLIVPVLRLGVYICLTMSVMLFVE  59

Query  1705  KVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSI  1526
             +VY+G V + +KLF R P K++K+E IK  DD E+GNS YP VLVQIPM NE+ VYQLSI
Sbjct  60    RVYMGIVISLVKLFGRKPDKRFKYEAIK--DDMELGNSVYPMVLVQIPMYNEREVYQLSI  117

Query  1525  GAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSL  1346
             GAAC LSWP++RI+IQVLDDSTDP +K LV+ EC RWA KGVNIKYE RDNR G+KAG+L
Sbjct  118   GAACGLSWPSDRIVIQVLDDSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGAL  177

Query  1345  KQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLT  1166
             K+GMK SYVKSC+YVAIFDADF+P+ DFL+RT+PFL+HNP + LVQARWK+VN++EC++T
Sbjct  178   KEGMKKSYVKSCDYVAIFDADFQPESDFLWRTVPFLLHNPKLALVQARWKFVNSDECLMT  237

Query  1165  RLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRA  986
             R+QEMS+D HF+VEQEVGS+ +AFFGFNGTAGIWRI+AL++AGGWKDRTTVEDMDL  RA
Sbjct  238   RMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRA  297

Query  985   GLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKL  806
              LKGWKF++LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM FEIM NK VT+WKK+
Sbjct  298   SLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKV  357

Query  805   YLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRS  626
             ++IY+FF V K+VAH++TFI+YC++LPATVL+PE+ +P WGA+Y+P++  LL  +  PRS
Sbjct  358   HVIYSFFVVRKLVAHIVTFIFYCVILPATVLVPEVSVPKWGAVYIPSVITLLNAVGTPRS  417

Query  625   LHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKT-AQPKSAKKVPRFR  449
             LH+  FW+LFENVM+LHRT  TFIGLLE GR++EW+VTEK G+ K  +  K+ KK+ RFR
Sbjct  418   LHLMVFWILFENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDLKAKSASKTPKKLLRFR  477

Query  448   LGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              G+R+H+ E+ VG Y+LF G Y+   G N+YY+YLF Q ++F + GFG IG  V
Sbjct  478   FGDRIHVLELGVGIYLLFVGCYDAFLGKNHYYLYLFAQAIAFFIAGFGQIGTIV  531



>gb|KEH42109.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=522

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/518 (62%), Positives = 421/518 (81%), Gaps = 2/518 (0%)
 Frame = -1

Query  1831  AGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTP  1652
             A + +   L  +W + +  +IVP+LR  V++CL M +MIL+E VY+G V   +KLF+RTP
Sbjct  7     ASEGVGMQLAFIWRKIREPLIVPMLRAAVFICLSMSLMILVEIVYMGIVICLVKLFKRTP  66

Query  1651  AKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVL  1472
              K+YKWE IK  DD E+ NS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RIIIQ+L
Sbjct  67    EKRYKWETIK--DDVELENSNYPIVLVQIPMYNEREVYQLSIGAACELSWPSDRIIIQIL  124

Query  1471  DDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIF  1292
             DDSTDP +K LVQ+ECRRW  KGVNIKYE RDNR G+KAG+LK+GMKHS+V  CEYVAIF
Sbjct  125   DDSTDPTIKELVQEECRRWRNKGVNIKYEVRDNRNGYKAGALKEGMKHSHVLQCEYVAIF  184

Query  1291  DADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVG  1112
             DADF+P+PDFL +TIPFLV+NP+IGLVQARWK+VNANEC++TR+Q+MS+D HF+VEQEVG
Sbjct  185   DADFQPEPDFLCQTIPFLVNNPEIGLVQARWKFVNANECLMTRMQKMSLDYHFTVEQEVG  244

Query  1111  SAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSE  932
             S+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA L+GWKF++L +++VK+E
Sbjct  245   SSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLSVRASLEGWKFLYLSNIQVKNE  304

Query  931   LPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLT  752
             LPS+  AYRYQQHRWSCGPANLF+KM  EI+ NKKV++WKK Y++Y+FFFV KIV H+ T
Sbjct  305   LPSTLNAYRYQQHRWSCGPANLFRKMIMEILTNKKVSLWKKTYMVYSFFFVRKIVVHINT  364

Query  751   FIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHR  572
             F+ YC+VLPATV++PE+ +P WG +Y+PT+  LL  +  PRSLH+  FW+LFEN M+L+R
Sbjct  365   FVLYCIVLPATVMVPEIVVPKWGTVYIPTIITLLNAVAAPRSLHLVVFWILFENTMSLNR  424

Query  571   TIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFC  392
                T IG+LE  R++EW+VTEK GN    Q     +  +F++G R+H+ E+ VGFY+LFC
Sbjct  425   AKATIIGILETSRVNEWIVTEKLGNALKDQDSKGLEKLQFKIGNRIHMSELFVGFYLLFC  484

Query  391   GWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             G Y+L++G NYYY++L++Q ++F ++ FGY+G FV  S
Sbjct  485   GCYDLMYGKNYYYIFLYMQAIAFFLLAFGYVGTFVPNS  522



>emb|CDX70286.1| BnaA10g26350D [Brassica napus]
Length=532

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/535 (63%), Positives = 430/535 (80%), Gaps = 6/535 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             M+   SSA I      +  G  D     + ++  Q +A +IVPVLR+ VY+CL M +M+ 
Sbjct  1     MELGDSSAVI----PDSFMGYRDDFTMQMSMILDQIRAPLIVPVLRLAVYICLTMSVMLF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+G V + +KLF R P K++KWEP+K  DD E+GNS YP VLVQIPM NE+ VYQL
Sbjct  57    VERVYMGIVISLVKLFGRKPEKRFKWEPMK--DDIELGNSVYPMVLVQIPMYNEREVYQL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++RI+IQVLDDSTDP +K LV+ EC RWA KGVNIKYE RDNR G+KAG
Sbjct  115   SIGAACGLSWPSDRIVIQVLDDSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMK SYVKSC+YVAIFDADF+P+PD+L+RT+PFL+HNP + LVQARWK+VN++EC+
Sbjct  175   ALKEGMKKSYVKSCDYVAIFDADFQPEPDYLWRTVPFLLHNPKLALVQARWKFVNSDECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAGIWRI+AL++AGGWKDRTTVEDMDL  
Sbjct  235   MTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA LKGWKF++LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM FEIM NK VT+WK
Sbjct  295   RASLKGWKFLYLGSLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+++IY+FF V KIVAH++TFI+YC+VLPATVL+PE+ +P WGA+Y+P++  LL  +  P
Sbjct  355   KVHVIYSFFVVRKIVAHIVTFIFYCVVLPATVLVPEVIVPKWGAVYIPSIITLLNAVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRF  452
             RSLH+  FW+LFENVM+LHRT  TFIGLLE GR++EW+VTEK G+ K      A K  RF
Sbjct  415   RSLHLMVFWILFENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDLKAKSATKAPKKLRF  474

Query  451   RLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             R G+R+H+ E+ VG Y+   G Y+ +FG N+YY+YLF Q ++F + G G IG  V
Sbjct  475   RFGDRIHVLELGVGMYLFSIGCYDALFGKNHYYLYLFAQAIAFFIAGCGQIGTVV  529



>ref|XP_011010407.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Populus euphratica]
Length=530

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/529 (65%), Positives = 435/529 (82%), Gaps = 4/529 (1%)
 Frame = -1

Query  1858  FSSEAAVRGAG-DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVS  1682
              SS + +  AG D +   +G++W      + VPVL+++V +CL M IMI +E+VY+G V 
Sbjct  4     LSSASNIFPAGRDGVTGQIGLIWQVIMEPLTVPVLKLLVVVCLGMSIMIFIERVYMGVVI  63

Query  1681  AYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSW  1502
              ++KLF + P K+YKWEPIK  DD E+GNS YP VLVQ+PM NEK VYQLSIGAAC LSW
Sbjct  64    VFVKLFGKKPNKRYKWEPIK--DDIELGNSAYPMVLVQVPMYNEKEVYQLSIGAACGLSW  121

Query  1501  PTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSY  1322
             P++RIIIQVLDDSTDP +K+LV+ EC+RWA KG+ IKYE RDNR G+KAG+LK+GMKHSY
Sbjct  122   PSDRIIIQVLDDSTDPAIKSLVEVECQRWASKGITIKYEMRDNRNGYKAGALKEGMKHSY  181

Query  1321  VKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMD  1142
             VK C ++AIFDADF+P+PDFL+RTIPFL HNP+I LVQARWK+VN++EC++TR+QEMS+D
Sbjct  182   VKQCFFLAIFDADFQPEPDFLWRTIPFLAHNPEIALVQARWKFVNSDECLMTRMQEMSLD  241

Query  1141  RHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFV  962
              HF+VEQEVGSA +AFFGFNGTAG+WRI+A+++AGGWKDRTTVEDMDL  RA LKGWKFV
Sbjct  242   YHFTVEQEVGSATYAFFGFNGTAGVWRISAVNEAGGWKDRTTVEDMDLAVRASLKGWKFV  301

Query  961   FLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFF  782
             ++GD++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI++NKKV++WKK Y+IY+FFF
Sbjct  302   YVGDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAIEIVKNKKVSVWKKCYVIYSFFF  361

Query  781   VNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWM  602
             V KIVAH++TF++YC+VLPATVL+PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+
Sbjct  362   VRKIVAHIVTFLFYCVVLPATVLVPEVTVPKWGAVYIPSVVTLLNAVGTPRSLHLMVFWI  421

Query  601   LFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ-PKSAKKVPRFRLGERLHLW  425
             LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+   A+ P  A K PR R+GERLHL 
Sbjct  422   LFENVMSLHRTKATFIGLLEGGRVNEWVVTEKIGDALKAKLPAKATKKPRIRIGERLHLL  481

Query  424   EIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             E   G Y+ FCG Y+  FG N YY++LFLQ ++F + GFGYIG FV  S
Sbjct  482   EFCAGAYLFFCGCYDFAFGKNRYYIFLFLQSIAFFIAGFGYIGTFVPHS  530



>ref|XP_009335111.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
 ref|XP_009335114.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=517

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/511 (67%), Positives = 431/511 (84%), Gaps = 3/511 (1%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             +G++  QAKA +IVP+L+++V LCL M +M+ +EKVY+G V   +KLFRR P K++KWE 
Sbjct  9     IGLVLQQAKAPLIVPLLKLVVVLCLGMSVMLFVEKVYMGIVITLIKLFRRKPEKKWKWEA  68

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             +K  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RIIIQVLDDSTDP +
Sbjct  69    VK--DDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPAI  126

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K LV+ E +RWA KG+NIKYE R NR G+KAG+LK+GMKHSYVK C+YVAIFDADF+P+P
Sbjct  127   KDLVELEVQRWASKGINIKYEIRGNRNGYKAGALKEGMKHSYVKHCDYVAIFDADFQPEP  186

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFL+RTIPFL+HNP++GLVQ RWK+VN++EC++TR+QEMS+D HF+VEQEVGSA HAFFG
Sbjct  187   DFLWRTIPFLIHNPEVGLVQTRWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSATHAFFG  246

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA L GWKFV+L DV+VK+ELPS+FKAY
Sbjct  247   FNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLGGWKFVYLSDVKVKNELPSTFKAY  306

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             RYQQHRWSCGPANLF+KM  EI+RNKKV+  KKL++IY+FFFV KIVAH++TF++YC++L
Sbjct  307   RYQQHRWSCGPANLFRKMVMEIVRNKKVSPMKKLHVIYSFFFVRKIVAHIVTFVFYCIIL  366

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             PATVL+PE+++P+WGA+Y+P++  LL  +  PRSLH+  FW+LFENVM+LHRT  TFIGL
Sbjct  367   PATVLVPEVQVPIWGAVYIPSIITLLNAVGTPRSLHLMIFWILFENVMSLHRTKATFIGL  426

Query  547   LEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIF  371
              E GR++EWVVTEK G+  KT     A + PR R+GERLH+ E+IVGFY+ FCG Y+L F
Sbjct  427   FEAGRVNEWVVTEKLGDALKTKSGGKAARRPRSRIGERLHMLELIVGFYLFFCGCYDLAF  486

Query  370   GDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             G N Y+++LF+Q ++F + G GY+G FV  S
Sbjct  487   GKNGYFIFLFIQSIAFFIAGVGYVGTFVPNS  517



>ref|XP_004496174.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=529

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/528 (63%), Positives = 424/528 (80%), Gaps = 3/528 (1%)
 Frame = -1

Query  1858  FSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSA  1679
              S+ A        I   +  +W Q +  +IVP+L+V+V+LCL M IM+ +EKVY+G V  
Sbjct  4     LSTIATFENVHYGIVSQMSFIWEQVRVPLIVPMLKVLVFLCLAMSIMLFVEKVYMGIVIV  63

Query  1678  YLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWP  1499
             ++KLF   P K YKWEP+K  DD E+GNS +P VLVQIPM NEK VYQLSIGAAC LSWP
Sbjct  64    FVKLFGHKPDKHYKWEPLK--DDLELGNSAFPMVLVQIPMYNEKEVYQLSIGAACGLSWP  121

Query  1498  TNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYV  1319
             ++RIIIQVLDDSTDP +K +V+ EC+RW  KG+NIKYE R+NR G+KAG+LK+GMKHSYV
Sbjct  122   SDRIIIQVLDDSTDPIIKNMVEVECKRWGRKGINIKYEIRENRNGYKAGALKEGMKHSYV  181

Query  1318  KSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDR  1139
             K C+YVAIFDADF+PDP+FL+RTIPFL  N  + LVQARW++VNA+EC++TR+QEMS+D 
Sbjct  182   KLCDYVAIFDADFQPDPNFLHRTIPFLDQNQKVALVQARWQFVNADECLMTRMQEMSLDY  241

Query  1138  HFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVF  959
             HF VEQEVGS+ HAFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RAGL+GWKFV+
Sbjct  242   HFLVEQEVGSSTHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLRGWKFVY  301

Query  958   LGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFV  779
             L D++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNK+V++WKK Y+IY+FFFV
Sbjct  302   LSDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAMEIIRNKRVSMWKKFYVIYSFFFV  361

Query  778   NKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWML  599
              KI+AHV+TF +YC++LPATVL+PE+++P WGA+Y+P +  LL  +  PRSLH+   W+L
Sbjct  362   RKIIAHVVTFTFYCVILPATVLVPEVEVPKWGAVYIPCIITLLNAVGTPRSLHLLILWIL  421

Query  598   FENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWE  422
             FENVM++HRT  T IGLLEVGR++EWVVTEK G+  KT     A + PR RL  RLH  E
Sbjct  422   FENVMSMHRTKATLIGLLEVGRVNEWVVTEKLGDVLKTKSGGKAARKPRIRLDGRLHFLE  481

Query  421   IIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             + VG Y+ F G Y++ FG N+ ++YLF+Q ++F V+G GY+G FV +S
Sbjct  482   LGVGVYLFFIGCYDVAFGKNHCFIYLFMQSIAFFVVGVGYVGIFVPSS  529



>ref|XP_010112526.1| hypothetical protein L484_012804 [Morus notabilis]
 gb|EXC33914.1| hypothetical protein L484_012804 [Morus notabilis]
Length=574

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/558 (61%), Positives = 434/558 (78%), Gaps = 44/558 (8%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             GA D IA  +G++W Q KA +IVP+L++ V LCL+M +M+ +E+VY+G V   +KLF R 
Sbjct  16    GARDDIATQIGLIWGQIKAPLIVPLLQLAVVLCLIMSLMLFLERVYMGIVIVLVKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+Y WEPIK  DD E+GN  YP VLVQIPM NE  VYQLSIGAAC LSWP++RI IQV
Sbjct  76    PEKRYNWEPIK--DDLELGNLAYPMVLVQIPMYNEGEVYQLSIGAACGLSWPSDRITIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K LV+ EC+RWA KGVNIKYE RDNR G+KAG+LK+GMK SYVK C+YVAI
Sbjct  134   LDDSTDPTIKDLVELECQRWASKGVNIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL+RT+PFLVHNP+IGLVQARWK+VNA+EC++TR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLWRTVPFLVHNPEIGLVQARWKFVNADECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNG------------------------------------------TAGIWR  1061
             GS+ +AFFGFNG                                          TAG+WR
Sbjct  254   GSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLWTAGVWR  313

Query  1060  IAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSC  881
             IAAL++AGGWKDRTTVEDMDL  RA LKGWKFV+L +++VK+ELPS+ KAYRYQQHRWSC
Sbjct  314   IAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLCNLKVKNELPSTLKAYRYQQHRWSC  373

Query  880   GPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPEL  701
             GPANLF+KM  EI RNKKVT+WKK+++IY+FFFV KIVAH++TF++YC+VLPATVL+PE+
Sbjct  374   GPANLFRKMVMEIARNKKVTLWKKVHVIYSFFFVRKIVAHIITFVFYCVVLPATVLVPEV  433

Query  700   KIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEW  521
              +P WGA+Y+P++  LL  +  PRSLH+  FW+LFENVM+LHRT  T IGLLE  R++EW
Sbjct  434   HVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATIIGLLEASRVNEW  493

Query  520   VVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLF  341
             VVTEK G+    +   A K PRF++GERLHL E+ VG Y+ FCGWY+++FG N++++YLF
Sbjct  494   VVTEKLGDALKGKAAKAPKKPRFKIGERLHLLELGVGVYLFFCGWYDVLFGKNHFFIYLF  553

Query  340   LQGVSFLVIGFGYIGAFV  287
             +Q ++F ++GFGY+G FV
Sbjct  554   VQAIAFFIMGFGYVGTFV  571



>ref|XP_006345855.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Solanum 
tuberosum]
Length=486

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/488 (67%), Positives = 410/488 (84%), Gaps = 6/488 (1%)
 Frame = -1

Query  1729  MLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNE  1550
             M +M+ +EKVY+G V  ++K+ R+ P K+YKWEPIK  DD E+ NS YP VL+QIPM NE
Sbjct  1     MSLMLFVEKVYMGIVIVFIKILRQKPEKKYKWEPIK--DDLELANSSYPMVLIQIPMYNE  58

Query  1549  KRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNR  1370
             + VYQLSIGAACNLSWP +RI+IQVLDDSTDP +K +V+QEC+RWA KGVNIKYE RDNR
Sbjct  59    REVYQLSIGAACNLSWPADRILIQVLDDSTDPIIKGMVEQECKRWASKGVNIKYEIRDNR  118

Query  1369  KGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYV  1190
             KG+KAG+LK+GMKH+YVK C++VAIFDADF+P+ DFL RT+PFLVHNP+IGLVQARWK+V
Sbjct  119   KGYKAGALKEGMKHNYVKMCDFVAIFDADFQPEFDFLLRTVPFLVHNPEIGLVQARWKFV  178

Query  1189  NANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVE  1010
             N++EC+LTR+QEMS+D HF VEQEVGS+ HAFFGFNGTAG+WRI+AL++AGGWKDRTTVE
Sbjct  179   NSDECLLTRMQEMSLDYHFKVEQEVGSSNHAFFGFNGTAGVWRISALNEAGGWKDRTTVE  238

Query  1009  DMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNK  830
             DMDL  RAGLKGWKFV++GD++VK+ELPS+FKAYRYQQHRWSCGPANLFKKM  EI  NK
Sbjct  239   DMDLAVRAGLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANLFKKMVGEIASNK  298

Query  829   KVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltall  650
             KV+IWKK YLIY+FFFV KI+AH++TFI+YC+++P TVLIPE+++P+WGA+Y+P+   LL
Sbjct  299   KVSIWKKFYLIYSFFFVRKIIAHIVTFIFYCVIMPTTVLIPEVQVPIWGAVYIPSTITLL  358

Query  649   tlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGN-TKTAQPKS  473
               +  PRS ++  FW+LFENVM+LHRT  TFIGL EVG+++EWVVTEK G+  K      
Sbjct  359   NAVGTPRSFYLLIFWILFENVMSLHRTRATFIGLFEVGKVNEWVVTEKLGDGIKAKTSMK  418

Query  472   AKKVPRFRLGE---RLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGY  302
               K  RFR+GE   ++H  E+ VG Y++ CGWY+  FG N +Y+YLFLQG++FLV GFGY
Sbjct  419   VSKKSRFRIGEWYNKVHFAEVFVGLYLMLCGWYDYSFGKNRFYIYLFLQGMAFLVAGFGY  478

Query  301   IGAFVTTS  278
             IG FV  S
Sbjct  479   IGVFVPNS  486



>gb|ABG34548.1| cellulose synthase-like A2 [Pinus taeda]
Length=534

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/537 (61%), Positives = 423/537 (79%), Gaps = 4/537 (1%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MD  S S+A +       +G  D I   + +LW Q +A ++ P+L + +Y CL+M +M+ 
Sbjct  1     MDRLSYSSANILPQ--TFQGTRDDIVEQIALLWQQIRAPLVAPLLNICIYFCLLMSVMLF  58

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
             +E+VY+  V   +KLF + P K+YKW  IK  +D E+GNS YP VLVQIPM NE+ VYQL
Sbjct  59    IERVYMAVVIVLIKLFGKKPEKRYKWGAIK--EDVELGNSVYPMVLVQIPMYNEREVYQL  116

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP+NR+IIQVLDDSTD  +K LV+ EC++WA KG+NIKYE R NR G+KAG
Sbjct  117   SIGAACALSWPSNRVIIQVLDDSTDLTIKDLVEMECQKWASKGINIKYEIRGNRNGYKAG  176

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+GMKHSYV+ C+YV IFDADF+PD DFL RTIPFLVHNP++ LVQARWK+VNA+EC+
Sbjct  177   ALKEGMKHSYVRECDYVVIFDADFQPDRDFLSRTIPFLVHNPELALVQARWKFVNADECL  236

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             +TR+QEMS+D HF+VEQEVGSA HAFFGFNGTAG+WRI AL++AGGWKDRTTVEDMDL  
Sbjct  237   MTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIKALNEAGGWKDRTTVEDMDLAV  296

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA L+GWKFVF+GD+ VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+ NKKV+ WK
Sbjct  297   RASLRGWKFVFVGDLGVKNELPSTFKAYRYQQHRWSCGPANLFRKMVREIIANKKVSAWK  356

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K ++IY FFFV KIVAH++TF++YC+V+P TVL+PE+++P WGA+Y+P+   LL  +  P
Sbjct  357   KFHVIYGFFFVRKIVAHIVTFVFYCVVIPTTVLVPEVQLPKWGAVYIPSTITLLNAVSTP  416

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRF  452
             RSLH+  FW+LFENVM+LHRT  T IGL E GR++EWVVTEK G+    +     K  + 
Sbjct  417   RSLHLLVFWILFENVMSLHRTKATIIGLFEAGRVNEWVVTEKLGDALKHKTAKQMKRSQS  476

Query  451   RLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             R+GER+H+ E++ G Y+ FC  Y+L FG N++Y+YLFLQ  +F ++GFGYIG FV T
Sbjct  477   RIGERIHVLEVLTGVYLFFCASYDLAFGKNHFYIYLFLQAGAFFIMGFGYIGTFVPT  533



>gb|KGN63048.1| hypothetical protein Csa_2G386160 [Cucumis sativus]
Length=706

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/497 (68%), Positives = 413/497 (83%), Gaps = 6/497 (1%)
 Frame = -1

Query  1729  MLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNE  1550
             M +M+ +E+VY+G V  ++KLFR+ P K YKWEPIK  DD E+ +  YP VLVQIPM NE
Sbjct  1     MSLMLFVERVYMGIVILFVKLFRKNPHKTYKWEPIK--DDLELAHFAYPMVLVQIPMYNE  58

Query  1549  KRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNR  1370
             K VYQLSIGAAC LSWPT+RIIIQVLDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR
Sbjct  59    KEVYQLSIGAACGLSWPTDRIIIQVLDDSTDPSIKDLVELECKRWANKGINIKYEIRDNR  118

Query  1369  KGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYV  1190
              G+KAG+LK+GMKH+YVK C+YVAIFDADF+P+PDFL+RTIPFL++NP+I LVQARWK+V
Sbjct  119   NGYKAGALKEGMKHNYVKLCDYVAIFDADFQPEPDFLWRTIPFLINNPEIALVQARWKFV  178

Query  1189  NANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVE  1010
             N++EC++TR+QEMS+D HF VEQEVGSA +AFFGFNGTAG+WRIAAL++AGGWKDRTTVE
Sbjct  179   NSDECLMTRMQEMSLDYHFKVEQEVGSATYAFFGFNGTAGVWRIAALNEAGGWKDRTTVE  238

Query  1009  DMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNK  830
             DMDL  RA LKGWKFV++GD++VK+ELPS+FKAYRYQQHRWSCGPANL KKM  EIMRNK
Sbjct  239   DMDLAVRASLKGWKFVYVGDLKVKNELPSTFKAYRYQQHRWSCGPANLLKKMVIEIMRNK  298

Query  829   KVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltall  650
             KV++WKKLYLIY+FFFV KIVAH++TF++YC++LPATVL+PE+ +P WGA+Y+P+   LL
Sbjct  299   KVSLWKKLYLIYSFFFVRKIVAHIVTFVFYCVILPATVLVPEVSVPKWGAVYIPSTITLL  358

Query  649   tlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKS  473
               +  PRS H+  FW+LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+  KT     
Sbjct  359   NAVGTPRSFHLIIFWILFENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGDALKTKLGSK  418

Query  472   AKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGA  293
             A + PRFR+GERLH+ E+ VG Y+ FCGWY+L FG N Y++YLFLQ  +F + G GY+G 
Sbjct  419   APRKPRFRMGERLHMLELCVGGYLFFCGWYDLNFGKNGYFIYLFLQSFAFFIAGVGYVG-  477

Query  292   FVTTS*LTFGRLRSSLE  242
               T S L    L S +E
Sbjct  478   --TLSSLRVAVLDSPIE  492



>ref|XP_004143299.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN48230.1| hypothetical protein Csa_6G450350 [Cucumis sativus]
Length=537

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/507 (64%), Positives = 420/507 (83%), Gaps = 10/507 (2%)
 Frame = -1

Query  1783  KALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAE  1604
             K++++VP+LR  VY+CL M +M+L+E+VY+G V   +KLF+R P K+YKWEP+  EDD E
Sbjct  35    KSVIVVPLLRGAVYICLTMSLMLLIERVYMGIVIGLVKLFKRKPEKRYKWEPM--EDDLE  92

Query  1603  IGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQEC  1424
             +GNS YP VLVQIPM NEK VYQLSIGAAC+LSWP++RIIIQVLDDSTDP VK LV++EC
Sbjct  93    LGNSVYPMVLVQIPMYNEKEVYQLSIGAACDLSWPSDRIIIQVLDDSTDPTVKGLVEKEC  152

Query  1423  RRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIP  1244
              RWA KG+ IKYE RDNR G+KAG+LK+G+K SYVK C+YV IFDADF+P+PDFL RT+P
Sbjct  153   ERWASKGITIKYEIRDNRNGYKAGALKEGLKRSYVKLCDYVVIFDADFQPEPDFLRRTVP  212

Query  1243  FLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIW  1064
             FL+HNP I LVQARWK+VNANEC++TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+W
Sbjct  213   FLIHNPKIALVQARWKFVNANECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVW  272

Query  1063  RIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWS  884
             RIAAL++AGGWKDRTTVEDMDL  RA LKGWKF++LG+++VK+ELPS+ KA+RYQQHRWS
Sbjct  273   RIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGNIQVKNELPSTLKAFRYQQHRWS  332

Query  883   CGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPE  704
             CGPANLF+KM  EI+ N +VT WKK+++IY+FFFV K+VAH+ TFI+YCLVLPATVL+ +
Sbjct  333   CGPANLFRKMVVEIITNNRVTTWKKVHVIYSFFFVRKVVAHINTFIFYCLVLPATVLVQD  392

Query  703   LKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHE  524
             +++P WG +Y+P +  LL  +  PRS H+  +W+LFENVMA+HRT GT IGLLE  R++E
Sbjct  393   VEVPKWGYVYIPAIITLLNSVGTPRSFHLLVYWILFENVMAMHRTKGTIIGLLEASRVNE  452

Query  523   WVVTEKQGNTKTAQPKSAK------KVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDN  362
             W+VTEK G+   ++PKS          PR R+GER+ +WE+ VG Y+L CG Y++ FG N
Sbjct  453   WIVTEKLGD--ASKPKSTDLRTPLIATPRLRIGERVLMWELGVGMYLLLCGVYDIFFGKN  510

Query  361   YYYVYLFLQGVSFLVIGFGYIGAFVTT  281
              +Y++LFLQ ++F ++GFGY+G +V +
Sbjct  511   QFYIFLFLQAITFFIVGFGYVGTYVPS  537



>ref|XP_004170553.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
Length=537

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/507 (64%), Positives = 420/507 (83%), Gaps = 10/507 (2%)
 Frame = -1

Query  1783  KALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAE  1604
             K++++VP+LR  VY+CL M +M+L+E+VY+G V   +KLF+R P K+YKWEP+  EDD E
Sbjct  35    KSVIVVPLLRGAVYICLTMSLMLLIERVYMGIVIGLVKLFKRKPEKRYKWEPM--EDDLE  92

Query  1603  IGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQEC  1424
             +GNS YP VLVQIPM NEK VYQLSIGAAC+LSWP++RIIIQVLDDSTDP VK LV++EC
Sbjct  93    LGNSVYPMVLVQIPMYNEKEVYQLSIGAACDLSWPSDRIIIQVLDDSTDPTVKGLVEKEC  152

Query  1423  RRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIP  1244
              RWA KG+ IKYE RDNR G+KAG+LK+G+K SYVK C+YV IFDADF+P+PDFL RT+P
Sbjct  153   ERWASKGITIKYEIRDNRNGYKAGALKEGLKRSYVKLCDYVVIFDADFQPEPDFLRRTVP  212

Query  1243  FLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIW  1064
             FL+HNP I LVQARWK+VNANEC++TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+W
Sbjct  213   FLIHNPKIALVQARWKFVNANECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVW  272

Query  1063  RIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWS  884
             RIAAL++AGGWKDRTTVEDMDL  RA LKGWKF++LG+++VK+ELPS+ KA+RYQQHRWS
Sbjct  273   RIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGNIQVKNELPSTLKAFRYQQHRWS  332

Query  883   CGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPE  704
             CGPANLF+KM  EI+ N +VT WKK+++IY+FFFV K+VAH+ TFI+YCLVLPATVL+ +
Sbjct  333   CGPANLFRKMVVEIITNNRVTTWKKVHVIYSFFFVRKVVAHINTFIFYCLVLPATVLVQD  392

Query  703   LKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHE  524
             +++P WG +Y+P +  LL  +  PRS H+  +W+LFENVMA+HRT GT IGLLE  R++E
Sbjct  393   VEVPKWGYVYIPAIITLLNSVGTPRSFHLLVYWILFENVMAMHRTKGTIIGLLEASRVNE  452

Query  523   WVVTEKQGNTKTAQPKSAK------KVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDN  362
             W+VTEK G+   ++PKS          PR R+GER+ +WE+ VG Y+L CG Y++ FG N
Sbjct  453   WIVTEKLGD--ASKPKSTDLRTPLIATPRLRIGERVLMWELGVGMYLLLCGVYDIFFGKN  510

Query  361   YYYVYLFLQGVSFLVIGFGYIGAFVTT  281
              +Y++LFLQ ++F ++GFGY+G +V +
Sbjct  511   QFYIFLFLQAITFFIVGFGYVGTYVPS  537



>ref|XP_009361452.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Pyrus 
x bretschneideri]
Length=483

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/485 (67%), Positives = 409/485 (84%), Gaps = 3/485 (1%)
 Frame = -1

Query  1729  MLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNE  1550
             M +M+ +EKVY+G V   +KLFRR P K++KWE +K  DD E+GNS YP VLVQIPM NE
Sbjct  1     MSVMLFVEKVYMGIVITLIKLFRRKPEKKWKWEAVK--DDVELGNSAYPMVLVQIPMYNE  58

Query  1549  KRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNR  1370
             K VYQLSIGAAC LSWP++RIIIQVLDDSTDP +K LV+ E +RWA KG++IKYE R NR
Sbjct  59    KEVYQLSIGAACGLSWPSDRIIIQVLDDSTDPAIKDLVELEVQRWASKGISIKYEIRGNR  118

Query  1369  KGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYV  1190
              G+KAG+LK+GMKHSYVK C+YVAIFDADF+P+PDFL+RTIPFL+HNP++GLVQ RWK+V
Sbjct  119   NGYKAGALKEGMKHSYVKHCDYVAIFDADFQPEPDFLWRTIPFLIHNPEVGLVQTRWKFV  178

Query  1189  NANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVE  1010
             N++EC++TR+QEMS+D HF+VEQEVGSA HAFFGFNGTAG+WRIAAL++AGGWKDRTTVE
Sbjct  179   NSDECLMTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAALNEAGGWKDRTTVE  238

Query  1009  DMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNK  830
             DMDL  RA L GWKFV+L DV+VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNK
Sbjct  239   DMDLAVRASLGGWKFVYLSDVKVKNELPSTFKAYRYQQHRWSCGPANLFRKMVMEIVRNK  298

Query  829   KVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltall  650
             KV+  KK ++IY+FFFV KIVAH++TF++YC++LPATVL+PE+++P+WGA+Y+P++  LL
Sbjct  299   KVSPMKKFHVIYSFFFVRKIVAHIVTFVFYCIILPATVLVPEVQVPIWGAVYIPSIITLL  358

Query  649   tlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKS  473
               +  PRSLH+  FW+LFENVM+LHRT  TFIGL E GR++EWVVTEK G+  KT     
Sbjct  359   NAVGTPRSLHLMIFWILFENVMSLHRTKATFIGLFEAGRVNEWVVTEKLGDALKTKSGGK  418

Query  472   AKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGA  293
             A + PR R+GERLH+ E+IVGFY+ FCG Y+L FG N Y+++LF+Q ++F + G GY+G 
Sbjct  419   AARRPRSRIGERLHMLELIVGFYLFFCGCYDLAFGKNGYFIFLFIQSIAFFIAGVGYVGT  478

Query  292   FVTTS  278
             FV  S
Sbjct  479   FVPNS  483



>ref|XP_004307031.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Fragaria 
vesca subsp. vesca]
Length=483

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/485 (67%), Positives = 407/485 (84%), Gaps = 3/485 (1%)
 Frame = -1

Query  1729  MLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNE  1550
             M +++ +EKVY+G V   +K+FRR P K++KWE IK  DD E+GNS YP VLVQIPM NE
Sbjct  1     MSVLLFVEKVYMGIVIMLVKVFRRRPEKRWKWEAIK--DDVELGNSAYPMVLVQIPMYNE  58

Query  1549  KRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNR  1370
             K VYQLSIGAAC LSWP++RII+QVLDDSTDP +K LV+ E +RWA KG+NIKYE RDNR
Sbjct  59    KEVYQLSIGAACGLSWPSDRIIVQVLDDSTDPLIKDLVEVEVQRWASKGINIKYEIRDNR  118

Query  1369  KGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYV  1190
              G+KAG+LK+GMKHSYVK C+YVAIFDADF+P+PDFL+RTIPFL+HNPDI LVQ RWK+V
Sbjct  119   HGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRTIPFLLHNPDIALVQTRWKFV  178

Query  1189  NANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVE  1010
             NA+EC++TR+QEMS+D HF+VEQEVGSA HAFFGFNGTAG+WRI AL++AGGWKDRTTVE
Sbjct  179   NADECLMTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAGVWRITALNEAGGWKDRTTVE  238

Query  1009  DMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNK  830
             DMDL  RA L+GWKFV++ D++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNK
Sbjct  239   DMDLAVRASLRGWKFVYISDIKVKNELPSTFKAYRYQQHRWSCGPANLFRKMIMEILRNK  298

Query  829   KVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltall  650
             KV+  KK ++IY+FFFV KIVAH++TF++YC++LPATVL+PE+++P+WGA+Y+P+   LL
Sbjct  299   KVSPLKKFHVIYSFFFVRKIVAHIVTFVFYCVILPATVLVPEVQVPIWGAVYIPSTITLL  358

Query  649   tlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKS  473
               +  PRSLH+  FW+LFENVM+LHRT  TFIGL E GR+ EWVVTEK G+  KT     
Sbjct  359   NAVGTPRSLHLLIFWILFENVMSLHRTKATFIGLFEAGRVDEWVVTEKLGDALKTKSAVK  418

Query  472   AKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGA  293
             A + PR R+GERLHL E+IVG Y+ FCG Y+L +G N +++YLFLQ ++F + G GY+G 
Sbjct  419   AHRKPRVRIGERLHLLELIVGLYLFFCGCYDLAYGKNRFFIYLFLQSIAFFIAGVGYVGT  478

Query  292   FVTTS  278
             FV +S
Sbjct  479   FVPSS  483



>ref|XP_009403734.1| PREDICTED: probable mannan synthase 9 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=555

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/538 (61%), Positives = 421/538 (78%), Gaps = 30/538 (6%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             LG++W Q KA VIVP+LR+ V+LCL M +M+ +EKVY+  V   +KL RR P  +YKWEP
Sbjct  20    LGMVWEQVKAPVIVPLLRIAVFLCLAMSVMLFVEKVYMATVILAVKLLRRRPETRYKWEP  79

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             +  EDD E G++ YP VLVQIPM NEK VYQLSIGAAC LSWP++R+IIQVLDDSTDP +
Sbjct  80    M--EDDMERGSAAYPMVLVQIPMFNEKEVYQLSIGAACGLSWPSDRLIIQVLDDSTDPAI  137

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K +VQ ECRRWA KGVNI+YE RDNR G+KAG+LK GMKH YVK C+YV IFDADF+PDP
Sbjct  138   KEMVQVECRRWASKGVNIRYEIRDNRVGYKAGALKMGMKHRYVKDCDYVVIFDADFQPDP  197

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFL RTIPFL+HNP IGLVQ RW++VNA+EC++TR+QEMS+D HF++EQEVGS+ +AFFG
Sbjct  198   DFLCRTIPFLIHNPQIGLVQGRWRFVNADECLMTRMQEMSLDYHFAIEQEVGSSTYAFFG  257

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKF+FL D+ VKSELPS+FKA+
Sbjct  258   FNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFIFLNDLGVKSELPSTFKAF  317

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNK---------------------------KVTIWKK  809
             R+QQHRWSCGPANLF+KM  EI +NK                           KV++W K
Sbjct  318   RHQQHRWSCGPANLFRKMVVEISKNKVCSLCVRNTHNFSRDSDWLCDASLTMQKVSLWTK  377

Query  808   LYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPR  629
             +Y+IY+FFF+ KIV H++TFI+YCLV+PATV +PE++IP+WG +Y+P++  +L  +  PR
Sbjct  378   VYVIYSFFFIRKIVGHIVTFIFYCLVIPATVFVPEVEIPMWGLVYLPSVITMLNSVGTPR  437

Query  628   SLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRF  452
             SLH+  FW+LFENVM+LHRT  T  GLL++GR++EWVVTEK G+  KT  P  A K PR 
Sbjct  438   SLHLLVFWVLFENVMSLHRTKATLSGLLDLGRVNEWVVTEKLGDIMKTKLPTKAAKKPRV  497

Query  451   RLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             R+G+RLH  E+  G Y+ FC  Y+L +G N+Y++YLFLQ ++F ++GFGY+G ++  S
Sbjct  498   RIGDRLHKMELFTGAYLFFCACYDLKYGKNHYFLYLFLQSITFFIVGFGYVGTYIPQS  555



>gb|EMS67675.1| hypothetical protein TRIUR3_27071 [Triticum urartu]
Length=522

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/505 (64%), Positives = 415/505 (82%), Gaps = 1/505 (0%)
 Frame = -1

Query  1795  WVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKE  1616
             W Q +  VIVP+LR  V LC+ M  M+  EKVY+  V   L+L  R P +Q +WEP++  
Sbjct  17    WQQVRGPVIVPLLRASVLLCVAMSAMLFTEKVYMAVVVLALRLLGRRPKRQSRWEPMRDG  76

Query  1615  DDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALV  1436
             +D E+G++ YP VLVQIPM NE+ VY+LSIGAAC LSWP++RII+QVLDDSTDP VK LV
Sbjct  77    EDPELGSAAYPMVLVQIPMYNEREVYRLSIGAACGLSWPSDRIIVQVLDDSTDPVVKELV  136

Query  1435  QQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLY  1256
             Q EC+RWA KGVNIKYETR+NR G+KAG+LK+GMKH YVK C+ VAIFDADF+P+PDFL 
Sbjct  137   QVECQRWARKGVNIKYETRNNRCGYKAGALKEGMKHGYVKDCDLVAIFDADFQPEPDFLS  196

Query  1255  RTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGT  1076
             R++PFLVHNPDI LVQARWK+VNA+EC++TR+QEMS+D HF VEQEVGS+ +AFFGFNGT
Sbjct  197   RSVPFLVHNPDIALVQARWKFVNADECLMTRMQEMSLDYHFKVEQEVGSSTYAFFGFNGT  256

Query  1075  AGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQ  896
             AG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKFV+LGD++VK+ELPS+FKA+RYQQ
Sbjct  257   AGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLKVKNELPSTFKAFRYQQ  316

Query  895   HRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATV  716
             HRWSCGPANLF+KM  EI+ NKKVT+WKK++++Y FFF+ K+VAH++TF++YCLV+PATV
Sbjct  317   HRWSCGPANLFRKMVMEIITNKKVTLWKKIHVVYNFFFLRKVVAHIVTFVFYCLVIPATV  376

Query  715   LIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVG  536
             L+PE+++P WG +Y+P +  LL+++  PRS+H+  FW LFENVM+LHR   TFIGLLE  
Sbjct  377   LVPEVEVPKWGCVYIPAIITLLSVVGTPRSVHLVIFWALFENVMSLHRAKATFIGLLEAH  436

Query  535   RIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNY  359
              ++EWVVTEK G+T KT  P  A K  R  +GERLHLWE+ V  Y+  CG Y++ FG+N+
Sbjct  437   TVNEWVVTEKLGDTVKTKMPSKALKKLRMGIGERLHLWELGVAAYLFICGCYSISFGNNH  496

Query  358   YYVYLFLQGVSFLVIGFGYIGAFVT  284
             Y+++L +Q ++F ++G GY+G FVT
Sbjct  497   YFIFLLMQSIAFFIVGVGYVGTFVT  521



>ref|XP_008363208.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Malus domestica]
Length=483

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/482 (67%), Positives = 404/482 (84%), Gaps = 3/482 (1%)
 Frame = -1

Query  1729  MLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNE  1550
             M +M+ +EKVY+G V   +KLFRR P K++KWE +K  DD E+GNS YP VL+QIPM NE
Sbjct  1     MSVMLFVEKVYMGIVITLIKLFRRKPEKKWKWEAVK--DDVELGNSAYPMVLLQIPMYNE  58

Query  1549  KRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNR  1370
             K VYQLSIGAAC LSWP++R+IIQVLDDSTDP +K LV+ E +RWAGKG+NIKYE RDNR
Sbjct  59    KEVYQLSIGAACGLSWPSDRVIIQVLDDSTDPAIKDLVELEVKRWAGKGINIKYEIRDNR  118

Query  1369  KGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYV  1190
              G+KAG+LK+GMKHSYVK C++VAIFDADF+PDPDFL+RTIPFL+HN D+ LVQ RWK+V
Sbjct  119   NGYKAGALKEGMKHSYVKQCDFVAIFDADFQPDPDFLWRTIPFLIHNSDVALVQTRWKFV  178

Query  1189  NANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVE  1010
             N++EC++TR+QEMS+D HF+VEQEVGSA HAFFGFNG AG+WRIAAL++AGGWKDRTTVE
Sbjct  179   NSDECLMTRMQEMSLDYHFTVEQEVGSATHAFFGFNGMAGVWRIAALNEAGGWKDRTTVE  238

Query  1009  DMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNK  830
             DMDL  RA L+GWKF++L D++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNK
Sbjct  239   DMDLAVRASLRGWKFIYLSDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAMEIVRNK  298

Query  829   KVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltall  650
             KV+  KK ++IY+FFFV KIVAHV+TF++YC++LPATV +PE+++P+WGA+Y+P+   LL
Sbjct  299   KVSPMKKFHVIYSFFFVRKIVAHVVTFVFYCIILPATVFVPEIQVPIWGAVYIPSTITLL  358

Query  649   tlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKS  473
               +  PRSLH+  FW+LFENVM+LHRT  T IGL E GR++EWVVTEK G+  KT     
Sbjct  359   NAVGTPRSLHLLIFWILFENVMSLHRTKATLIGLFEAGRVNEWVVTEKLGDALKTKSGAK  418

Query  472   AKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGA  293
             A + PR R+GERLH+ E+IVGFY+ FCG Y+L FG N Y++ LF+Q ++F + G GY+G 
Sbjct  419   ASRKPRIRIGERLHMLELIVGFYLFFCGCYDLSFGKNGYFIXLFIQSIAFFIAGVGYVGT  478

Query  292   FV  287
             FV
Sbjct  479   FV  480



>gb|KEH42113.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=523

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/523 (62%), Positives = 425/523 (81%), Gaps = 3/523 (1%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             A + A + +   L  +W   +  +IVP+LR  VYLCL + +++L+EKVY+  V  Y+KLF
Sbjct  3     AFKVASEGVVMQLEFIWKNIREPLIVPMLRWTVYLCLGLSLIMLVEKVYMAIVICYVKLF  62

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
             +RTP K+YK+E I  EDD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RII
Sbjct  63    KRTPEKRYKFEAI--EDDVELGNSYYPMVLVQIPMYNEREVYQLSIGAACELSWPSDRII  120

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQ+LDDSTDP +K LVQ+ECRRW  KGVNIKYE RDNR G+KAG+LK+GMKHS+V  CEY
Sbjct  121   IQILDDSTDPTIKELVQEECRRWRNKGVNIKYEVRDNRNGYKAGALKEGMKHSHVLQCEY  180

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+PDFL RTIPFLV+NP+IGLVQARWK+VNANEC++TR+Q+MS+D HF VE
Sbjct  181   VAIFDADFQPEPDFLRRTIPFLVNNPEIGLVQARWKFVNANECLMTRMQQMSLDYHFKVE  240

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA L+GWKF++L ++ 
Sbjct  241   QEVGSSAYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLEGWKFLYLCNLE  300

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+R+KKV++WKKLY++  FFFV KIV 
Sbjct  301   VKNELPSTFKAYRYQQHRWSCGPANLFRKMAMEILRSKKVSLWKKLYIVCNFFFVQKIVV  360

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H+ TF++YC++LPATV++PE+ +P WG +YVP++  LL  +  PRS ++  FW+LFEN +
Sbjct  361   HIHTFVFYCVLLPATVMVPEIVVPKWGTVYVPSIITLLKAVGTPRSFYLVIFWVLFENTI  420

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGF  407
             ALHRT  T IGLLE  R++EW+VTEK G+  K+       K PR ++ +R+H+ E+ VGF
Sbjct  421   ALHRTKATIIGLLETSRVNEWIVTEKLGDALKSKVGGKGIKKPRLKIADRIHMKELCVGF  480

Query  406   YMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             Y+LFCG Y+ ++G NY++++L++Q  +FL++ FGY+G FV  S
Sbjct  481   YLLFCGCYDFMYGKNYFFIFLYMQATAFLIVAFGYVGTFVPNS  523



>emb|CDY10358.1| BnaCnng02590D [Brassica napus]
Length=532

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/530 (64%), Positives = 429/530 (81%), Gaps = 5/530 (1%)
 Frame = -1

Query  1876  SSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVY  1697
              SAA++  S    R   D I   + ++  Q +A +IVPVLR+ VY+CL M +M+ +E+VY
Sbjct  5     DSAAVIPDSFMGYR---DDITMQMSMILDQIRAPLIVPVLRLAVYICLTMSVMLFVERVY  61

Query  1696  LGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAA  1517
             +G V + +KLF R P K++KWEP+K  DD E+GNS YP VLVQIPM NE+ VYQLSIGAA
Sbjct  62    MGIVISLVKLFGRKPEKRFKWEPMK--DDIELGNSVYPMVLVQIPMYNEREVYQLSIGAA  119

Query  1516  CNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQG  1337
             C LSWP++RI+IQVLDDSTDP +K LV+ EC RWA KGVNIKYE RDNR G+KAG+LK+G
Sbjct  120   CGLSWPSDRIVIQVLDDSTDPTIKDLVEMECSRWASKGVNIKYEIRDNRNGYKAGALKEG  179

Query  1336  MKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQ  1157
             MK SYVKSC+YVAIFDADF+P+PD+L+RT+PFL+HNP + LVQARWK+VN++EC++TR+Q
Sbjct  180   MKKSYVKSCDYVAIFDADFQPEPDYLWRTVPFLLHNPKLALVQARWKFVNSDECLMTRMQ  239

Query  1156  EMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLK  977
             EMS+D HF+VEQEVGS+ +AFFGFNGTAGIWRI+AL++AGGWKDRTTVEDMDL  RA LK
Sbjct  240   EMSLDYHFTVEQEVGSSTYAFFGFNGTAGIWRISALNEAGGWKDRTTVEDMDLAVRASLK  299

Query  976   GWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLI  797
             GWKF++LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM FEIM NK VT+WKK+++I
Sbjct  300   GWKFLYLGSLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAFEIMTNKNVTLWKKVHVI  359

Query  796   YAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHM  617
             Y+FF V KIVAH++TFI+YC+VLPATVL+PE+ +P WGA+Y+P++  LL  +  PRSLH+
Sbjct  360   YSFFVVRKIVAHIVTFIFYCVVLPATVLVPEVTVPKWGAVYIPSIITLLNAVGTPRSLHL  419

Query  616   TAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGER  437
               FW+LFENVM+LHRT  TFIGLLE GR++EW+VTEK G+ K      A K  RFR G+R
Sbjct  420   MVFWILFENVMSLHRTKATFIGLLEGGRVNEWIVTEKLGDLKAKSATKAPKKLRFRFGDR  479

Query  436   LHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             +H+ E+ VG Y+   G Y+ +FG N+YY+YLF Q  +F + G G IG  V
Sbjct  480   IHVLELGVGMYLFSIGCYDALFGKNHYYLYLFAQAFAFFIAGCGQIGTVV  529



>ref|XP_006424348.1| hypothetical protein CICLE_v10028164mg [Citrus clementina]
 gb|ESR37588.1| hypothetical protein CICLE_v10028164mg [Citrus clementina]
Length=537

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/521 (62%), Positives = 422/521 (81%), Gaps = 10/521 (2%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             + IA  +G++W   KA +IVP+L++ VY+CL M +M+ ME+VY+G V   +KLF   P K
Sbjct  19    EDIAGQIGLIWELLKAPLIVPLLKLGVYICLAMSLMLFMERVYMGIVIILVKLFWPKPEK  78

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +Y W+PI  EDD E+G+S +P VL+QIPM NEK VY++SIGAAC LSWP++R++IQVLDD
Sbjct  79    RYNWQPI--EDDVELGSSNFPVVLIQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDD  136

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP +K +V+QEC+RWA KG+NI+Y+ R+NR G+KAG+LK+G+K SYVK CEYVAIFDA
Sbjct  137   STDPAIKQMVEQECQRWAAKGINIRYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIFDA  196

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF P+PD+L R IP+LV N DI LVQARW++VNANEC+LTR+QEMS+D HF VEQEVGSA
Sbjct  197   DFRPEPDYLRRAIPYLVQNSDIALVQARWRFVNANECLLTRMQEMSLDYHFKVEQEVGSA  256

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKFV+LGD++VKSELP
Sbjct  257   THAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELP  316

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKA+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+AH++TF 
Sbjct  317   STFKAFRFQQHRWSCGPANLFRKMVMEIIRNKKVKFWKKVYVIYSFFFVRKIIAHMVTFS  376

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+VLP T+L+PE+++P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+LHRT 
Sbjct  377   FYCVVLPLTILVPEVQVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTK  436

Query  565   GTFIGLLEVGRIHEWVVTEKQGN---TKTAQPKS-----AKKVPRFRLGERLHLWEIIVG  410
              TFIGLLE GR +EWVVTEK G+    K A  K+     A K P+ +  ER+H  E+  G
Sbjct  437   ATFIGLLEAGRANEWVVTEKLGDALKNKAADAKNKTNTKAPKKPKIKFAERMHTLELGFG  496

Query  409   FYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              ++ FCG Y+ + G N Y++YLFLQ ++FL+ GFGYIG  V
Sbjct  497   VFLFFCGCYDFVHGKNNYFIYLFLQTITFLIAGFGYIGTIV  537



>ref|XP_008442792.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
melo]
Length=532

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/518 (61%), Positives = 420/518 (81%), Gaps = 3/518 (1%)
 Frame = -1

Query  1831  AGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTP  1652
             AGD I   L  +W   +A +I P+LRV++ +C  + IM  +E++Y+G V   +KL RRTP
Sbjct  17    AGDGIPALLLFVWDVVRAPLIAPLLRVIMVICSALSIMQFVERIYMGVVIVAVKLLRRTP  76

Query  1651  AKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVL  1472
              K+YKWEPIK  DD+E+GNS YP VL+QIPM NEK VYQ+SI AAC LSWP++R++IQVL
Sbjct  77    EKRYKWEPIK--DDSELGNSVYPMVLIQIPMFNEKEVYQMSIRAACGLSWPSDRMVIQVL  134

Query  1471  DDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIF  1292
             DDST P +K +V+ EC++WA KG+NIKYE RDNR G+KAG+LK+GMK SY K C+YV IF
Sbjct  135   DDSTIPAIKNMVELECKKWASKGINIKYEVRDNRTGYKAGALKEGMKRSYAKDCDYVVIF  194

Query  1291  DADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVG  1112
             DADF+P+ DFL+R+IPFLVHNP + L+QARW +VN++ECM+TRLQEMS+D HF+VEQEVG
Sbjct  195   DADFQPESDFLHRSIPFLVHNPQLALIQARWIFVNSDECMMTRLQEMSLDYHFTVEQEVG  254

Query  1111  SAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSE  932
             S+ HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKF++LGD++VK+E
Sbjct  255   SSTHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDLQVKNE  314

Query  931   LPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLT  752
             LPS+FKA+R+QQHRWSCGPANLF+KM  EI +NKKVT+WKK+Y+IY+FFFV KI+AH+  
Sbjct  315   LPSTFKAFRFQQHRWSCGPANLFRKMVLEIAKNKKVTLWKKVYVIYSFFFVRKIIAHINN  374

Query  751   FIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHR  572
             F+++C+ LPATV++PE+ IP WG +Y+PT T ++  +  P+S H+T FW++FENVM+LHR
Sbjct  375   FLFFCIALPATVVVPEVAIPRWGGVYIPTATTIINAIGTPKSFHLTIFWIMFENVMSLHR  434

Query  571   TIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKS-AKKVPRFRLGERLHLWEIIVGFYMLF  395
                T IGLLE  R +EWVVTEK G+    +  S A K P FR+GER+H+ E+ VG Y+ F
Sbjct  435   AKATLIGLLEGSRANEWVVTEKLGDILKGKTASKATKKPMFRIGERIHITELGVGAYLFF  494

Query  394   CGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             CG YN+++G+NY++V+L +Q +SF ++GFGY+G  V +
Sbjct  495   CGCYNMLYGENYFFVFLLVQAISFFIVGFGYVGTIVPS  532



>emb|CDP06989.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/535 (59%), Positives = 427/535 (80%), Gaps = 5/535 (1%)
 Frame = -1

Query  1873  SAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYL  1694
             SAA +       RG+   IA  +G++W   +A +IVP+LR+ VY+CL M +M+ +E++Y+
Sbjct  5     SAANLIPESFDFRGSTADIAGQIGLIWELIRAPLIVPLLRLAVYICLAMSLMLFIERLYM  64

Query  1693  GAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAAC  1514
             G V   +K+F + P K+YKWEP++  DD EIGN+ +P VLVQIPM NEK VY++SIGAAC
Sbjct  65    GIVIILVKIFWKKPEKRYKWEPMR--DDLEIGNAAFPMVLVQIPMFNEKEVYKISIGAAC  122

Query  1513  NLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGM  1334
             NLSWP++RI+IQVLDDSTDP +K +V++EC+RWA KG++ +Y+ R+ R G+KAG+LK+G+
Sbjct  123   NLSWPSDRIVIQVLDDSTDPIIKDMVEKECQRWASKGIHCRYQIRETRGGYKAGALKEGL  182

Query  1333  KHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQE  1154
             KH YVK CEYV IFDADF P+PDFL R IPFL+HN DI LVQARW++VN++EC+LTR+QE
Sbjct  183   KHDYVKDCEYVVIFDADFRPEPDFLRRAIPFLMHNSDIALVQARWRFVNSDECLLTRMQE  242

Query  1153  MSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKG  974
             MS+D HF+VEQEVGS+ HAFFGFNGT GIWRIAA+++AGGWKDRTTVEDMDL  RAGLKG
Sbjct  243   MSLDYHFTVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKG  302

Query  973   WKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIY  794
             WKFV+LGD++VKSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNKK+ +WKK+Y+IY
Sbjct  303   WKFVYLGDLQVKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKIAVWKKVYVIY  362

Query  793   AFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMT  614
             +FFFV K++AH++TF +YC+VLP T+L+PE+++P WGA+Y+P +   L  +  PRS+H+ 
Sbjct  363   SFFFVRKVIAHMVTFFFYCVVLPLTILVPEVEVPKWGAIYIPCIITALNSVGTPRSIHLL  422

Query  613   AFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPR---FRLG  443
              +W+LFENVM+LHRT  TFIGLLE  R +EWVVTEK G+    +    K  P+    ++G
Sbjct  423   FYWILFENVMSLHRTKATFIGLLEAKRANEWVVTEKLGDALKNKSNVVKAKPKKIGLKIG  482

Query  442   ERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             +R+HL E+    ++ FCG Y+ ++G N Y++YLFLQ ++F + GFGYIG  V TS
Sbjct  483   DRIHLTELGFAVFLFFCGCYDFLYGKNNYFIYLFLQVITFTIAGFGYIGTIVPTS  537



>ref|XP_008232088.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Prunus 
mume]
Length=477

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/484 (68%), Positives = 404/484 (83%), Gaps = 7/484 (1%)
 Frame = -1

Query  1729  MLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNE  1550
             M +M+++EKVY+G +   +KLFRR P K +KWE IK  DD E+GNS YP VLVQIPM NE
Sbjct  1     MSLMLVVEKVYMGIMIILIKLFRR-PVKHWKWEAIK--DDVELGNSAYPMVLVQIPMYNE  57

Query  1549  KRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNR  1370
             + VYQLSIGAAC LSWP++RIIIQVLDDSTDP +K LV  EC+RWA KG+NIKYE RD+R
Sbjct  58    REVYQLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLVVLECQRWASKGINIKYEIRDDR  117

Query  1369  KGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYV  1190
              GFKAGSLK+GMKHSYVK C+YVAIFDADF+P+PDFLYRTIPFLVHN DI LVQARWK+V
Sbjct  118   NGFKAGSLKEGMKHSYVKLCDYVAIFDADFQPEPDFLYRTIPFLVHNSDIALVQARWKFV  177

Query  1189  NANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVE  1010
             N++EC++TR+QEMS+D HF+VEQEVGSA +AFFGFNGTAG+WRIAAL++AGGWKD TTVE
Sbjct  178   NSDECLMTRMQEMSLDYHFTVEQEVGSATYAFFGFNGTAGVWRIAALNEAGGWKDCTTVE  237

Query  1009  DMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNK  830
             DMDL  RA L+GWKFV+L D++VK+ELPS+FKAYR QQHRWSCGPANLF+KM  EI+RNK
Sbjct  238   DMDLAVRASLRGWKFVYLSDLKVKNELPSTFKAYRSQQHRWSCGPANLFRKMVMEIVRNK  297

Query  829   KVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltall  650
             KV+  KK ++IY+FFFV KIVAH++TF++Y ++LPATVL+PE+ +P+WGA+Y+P+   LL
Sbjct  298   KVSPLKKFHVIYSFFFVRKIVAHIVTFVFYSVILPATVLVPEVHVPMWGAVYIPSTITLL  357

Query  649   tlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSA  470
               +  PRSLH+  FW+LFENVM+LHRT  TFIGL E GR++EWVVTEK G++    P+  
Sbjct  358   NAVGTPRSLHLLIFWILFENVMSLHRTKATFIGLFEAGRVNEWVVTEKLGDSLKKDPRK-  416

Query  469   KKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAF  290
                PR R+GERLH+ E+IVGFY+ FCG Y+L F  N Y++YLF+Q V+F + GFGY+G F
Sbjct  417   ---PRLRIGERLHMLELIVGFYVFFCGCYDLAFVKNGYFIYLFIQSVAFFIAGFGYVGTF  473

Query  289   VTTS  278
             V  S
Sbjct  474   VPNS  477



>ref|XP_010067160.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Eucalyptus 
grandis]
 gb|KCW65234.1| hypothetical protein EUGRSUZ_G02715 [Eucalyptus grandis]
Length=482

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/484 (67%), Positives = 403/484 (83%), Gaps = 2/484 (0%)
 Frame = -1

Query  1729  MLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNE  1550
             M  M+ +E+VY+G V  ++KL RR P KQYKWE +   +D E G+S YP VLVQIPM NE
Sbjct  1     MSTMLFVERVYMGIVIFFIKLLRRRPEKQYKWEAMG--EDIEAGSSAYPMVLVQIPMYNE  58

Query  1549  KRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNR  1370
             K VYQLSIGAAC LSWP +RIIIQVLDDSTDP +K L + EC+RWA KG+NIKYE RDNR
Sbjct  59    KEVYQLSIGAACGLSWPADRIIIQVLDDSTDPTIKELKKLECQRWASKGINIKYEIRDNR  118

Query  1369  KGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYV  1190
             KG+KAG+LK+GMKHSYVK C+YVAIFDADF+P+PDFL+RTIPFLVHNP+IGLVQARWK+V
Sbjct  119   KGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFLWRTIPFLVHNPEIGLVQARWKFV  178

Query  1189  NANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVE  1010
             N++EC++TR+QEMS+D HF+VEQEVGSA +AFFGFNGTAG+WRI+AL++AGGWKDRTTVE
Sbjct  179   NSDECLMTRMQEMSLDYHFTVEQEVGSATYAFFGFNGTAGVWRISALNEAGGWKDRTTVE  238

Query  1009  DMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNK  830
             DMDL  RA LKGWKFV++ D++VKSELPS+FKAYRYQQHRWSCGPANLF+KM  EI++NK
Sbjct  239   DMDLAVRASLKGWKFVYVSDLKVKSELPSTFKAYRYQQHRWSCGPANLFRKMAVEIIQNK  298

Query  829   KVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltall  650
             KV++WKK Y+IY+FFFV KIVAHV+TF++YC+V+PATVL+PE+++P WGA+Y+P    LL
Sbjct  299   KVSMWKKFYVIYSFFFVRKIVAHVVTFVFYCIVMPATVLVPEVEVPKWGAVYIPCTVTLL  358

Query  649   tlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSA  470
               +  PRSLH+  FW+LFENVMALHRT  TFIGLLE GR++EWVVT+K G+    +P  A
Sbjct  359   NSVGTPRSLHLLVFWVLFENVMALHRTKATFIGLLEAGRVNEWVVTQKLGDALKTKPGKA  418

Query  469   KKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAF  290
              +  R  +G+R+H+ E+ VG Y+  CG Y+L  G N Y++YLFLQ  +F V G GY+G F
Sbjct  419   HRRLRIWIGQRVHVVELCVGAYLFVCGCYDLAHGKNRYFLYLFLQSFAFFVAGIGYVGTF  478

Query  289   VTTS  278
             + +S
Sbjct  479   IPSS  482



>ref|XP_004497598.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=523

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/521 (62%), Positives = 425/521 (82%), Gaps = 3/521 (1%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +GA D ++  L  +W Q +  +IVP+LRV V+LCL M +M+L+E+VY+G V   +KLF R
Sbjct  5     QGASDEVSLQLEFIWRQVREPLIVPILRVAVFLCLTMSLMMLVERVYMGIVICLVKLFDR  64

Query  1657  TPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQ  1478
              P KQYKWE  K  DD E+GNS YP VLVQ+PM NE+ VYQLSIGAAC LSWP++RIIIQ
Sbjct  65    KPEKQYKWESFK--DDVELGNSNYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQ  122

Query  1477  VLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVA  1298
             +LDDSTDP +K LV+ EC +W  KGVNIKYE RDNR G+KAG+LK+GMKHSYVK C+YVA
Sbjct  123   ILDDSTDPTIKELVELECHKWRSKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDYVA  182

Query  1297  IFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQE  1118
             IFDADF+P+PDFL+RTIPF V+NP+IGLVQARWK+VNA+EC++TR+QEMS+D HF VEQE
Sbjct  183   IFDADFQPEPDFLWRTIPFFVNNPEIGLVQARWKFVNADECLMTRMQEMSLDYHFRVEQE  242

Query  1117  VGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVK  938
             VGS+ +AFFGFNGTAG+WR  AL++AGGWKDRTTVEDMDL  RA LKGWKF++L +++VK
Sbjct  243   VGSSTYAFFGFNGTAGVWRTLALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSNLKVK  302

Query  937   SELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHV  758
             +ELPS+ KAYRYQQHRWSCGPANLF+KM  EI+ NKKV+ WKK+Y++Y+FFFV KIVAH+
Sbjct  303   NELPSTLKAYRYQQHRWSCGPANLFRKMFREIVTNKKVSFWKKIYVVYSFFFVRKIVAHI  362

Query  757   LTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMAL  578
              TF++YC+VLPATV++PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+LFEN M+L
Sbjct  363   NTFVFYCIVLPATVVVPEVVVPKWGAVYIPSIITLLNAVGTPRSLHLLLFWILFENTMSL  422

Query  577   HRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVP-RFRLGERLHLWEIIVGFYM  401
             HRT  T IGLLE  R++EWVVTEK G+    +         RFR+ +R+H+ E++VGFY+
Sbjct  423   HRTKATIIGLLEASRVNEWVVTEKLGDALKGKVGGKGLKTFRFRIVDRIHMLELLVGFYL  482

Query  400   LFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             LFCG Y+L++G N+++++L++Q ++F ++ FGY+G F+  S
Sbjct  483   LFCGCYDLMYGKNHFFIFLYIQALAFFIMAFGYVGTFIPNS  523



>ref|XP_004137864.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 ref|XP_004170538.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN59050.1| hypothetical protein Csa_3G748790 [Cucumis sativus]
Length=532

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/531 (60%), Positives = 425/531 (80%), Gaps = 7/531 (1%)
 Frame = -1

Query  1858  FSSEAAVRGA----GDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLG  1691
              S+ A   GA    GD I   L  +W   +A +I P+LRV++ +C  + IM  +E++Y+G
Sbjct  4     LSTSALFPGAFPTPGDGIPALLLFVWDVVRAPLIAPLLRVIMVICSALSIMQFVERIYMG  63

Query  1690  AVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACN  1511
              V   +KL RRTP K+YKWEPIK  DD+E+GNS YP VL+QIPM NEK VYQ+SI AAC 
Sbjct  64    VVIVAVKLLRRTPEKRYKWEPIK--DDSELGNSAYPMVLIQIPMFNEKEVYQMSIRAACG  121

Query  1510  LSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMK  1331
             LSWP++R+IIQVLDDST P +K +V+ EC++WA KG++IKYE RDNR G+KAG+LK+GMK
Sbjct  122   LSWPSDRMIIQVLDDSTIPAIKNMVELECKKWASKGIDIKYEVRDNRTGYKAGALKEGMK  181

Query  1330  HSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEM  1151
              SY K C+YV IFDADF+P+ DFL+R+IP+L+HNP + L+QARW +VN++ECM+TRLQEM
Sbjct  182   RSYAKDCDYVVIFDADFQPESDFLHRSIPYLIHNPQLALIQARWIFVNSDECMMTRLQEM  241

Query  1150  SMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGW  971
             S+D HF+VEQEVGS+ HAFFGFNGTAGIWRIAA+D+AGGWKDRTTVEDMDL  RA LKGW
Sbjct  242   SLDYHFTVEQEVGSSTHAFFGFNGTAGIWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGW  301

Query  970   KFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYA  791
             KF++LGD++VK+ELPS+FKA+R+QQHRWSCGPANLF+KM  EI +NK+VT+WKK+Y+IY+
Sbjct  302   KFLYLGDLQVKNELPSTFKAFRFQQHRWSCGPANLFRKMVMEIAKNKRVTLWKKVYVIYS  361

Query  790   FFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTA  611
             FFFV KI+AH+  F+++C+ LPATV++PE++IP WG +Y+PT T ++  +  P+S H+T 
Sbjct  362   FFFVRKIIAHINNFLFFCIALPATVVVPEVEIPTWGGVYIPTATTIINAIGTPKSFHLTI  421

Query  610   FWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKS-AKKVPRFRLGERL  434
             FW++FENVM+LHR   T IGLLE  R +EWVVTEK G+    +  S A K P FR+G+R+
Sbjct  422   FWIMFENVMSLHRAKATIIGLLEGSRANEWVVTEKLGDILKGKTASKATKKPIFRIGDRI  481

Query  433   HLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             H+ E+ VG Y+ FCG YN+++G+NY++V+L +Q +SF ++GFGYIG  V +
Sbjct  482   HITELGVGAYLFFCGCYNMLYGENYFFVFLLVQAISFFIVGFGYIGTIVPS  532



>ref|XP_006484970.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Citrus 
sinensis]
Length=537

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/521 (61%), Positives = 423/521 (81%), Gaps = 10/521 (2%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             + IA  +G++W   KA +IVP+L++ VY+CL M +M+ ME+VY+G V   +KLF + P K
Sbjct  19    EDIAGQIGLIWELLKAPLIVPLLKLGVYICLAMSLMLFMERVYMGIVIILVKLFWQKPEK  78

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +Y W+PI  EDD E+G+S +P VL+QIPM NEK VY++SIGAAC LSWP++R++IQVLDD
Sbjct  79    RYNWQPI--EDDVELGSSNFPVVLIQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDD  136

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP +K +V+QEC+RWA KG+NI+Y+ R+NR G+KAG+LK+G+K SYVK CEYVAIFDA
Sbjct  137   STDPAIKQMVEQECQRWAAKGINIRYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIFDA  196

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF P+PD+L R IP+LV N DI LVQARW++VN++EC+LTR+QEMS+D HF VEQEVGSA
Sbjct  197   DFRPEPDYLRRAIPYLVQNSDIALVQARWRFVNSDECLLTRMQEMSLDYHFKVEQEVGSA  256

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKFV+LGD++VKSELP
Sbjct  257   THAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELP  316

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKA+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+AH++TF 
Sbjct  317   STFKAFRFQQHRWSCGPANLFRKMVMEIIRNKKVKFWKKVYVIYSFFFVRKIIAHMVTFS  376

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+VLP T+L+PE+++P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+LHRT 
Sbjct  377   FYCVVLPLTILVPEVQVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTK  436

Query  565   GTFIGLLEVGRIHEWVVTEKQGN---TKTAQPKS-----AKKVPRFRLGERLHLWEIIVG  410
              TFIGLLE GR +EWVVTEK G+    K A  K+     A K P+ +  +R+H  E+  G
Sbjct  437   ATFIGLLEAGRANEWVVTEKLGDALKNKAADAKNKTNTKAPKKPKIKFADRMHTLELGFG  496

Query  409   FYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              ++ FCG Y+ + G N Y++YLFLQ ++FL+ GFGYIG  V
Sbjct  497   VFLFFCGCYDFVHGKNNYFIYLFLQTITFLIAGFGYIGTIV  537



>ref|XP_008659807.1| PREDICTED: probable mannan synthase 9 [Zea mays]
Length=526

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/518 (62%), Positives = 417/518 (81%), Gaps = 3/518 (1%)
 Frame = -1

Query  1840  VRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFR  1661
             V  AG + +     LW Q K+ V+VP+LRV V LCL M  M+  EKVY+  V A  +L  
Sbjct  10    VPAAGYSRSDVAAALWQQLKSPVVVPLLRVSVALCLAMSAMLFAEKVYMAVVVAASRLLG  69

Query  1660  RTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIII  1481
             R P ++Y+W+PI+  DD E   + YP VLVQIPM NE+ VY++SIGAAC LSWP++RII+
Sbjct  70    RRPERRYRWQPIRDGDDLE-AAAAYPMVLVQIPMFNEREVYKVSIGAACGLSWPSDRIIV  128

Query  1480  QVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYV  1301
             QVLDDSTDP VK LV+ EC RWA KGVN+KYE RD+R+G+KAG+L++GMK +Y + C+ V
Sbjct  129   QVLDDSTDPVVKELVRAECWRWASKGVNVKYEVRDSRRGYKAGALREGMKRAYARGCDLV  188

Query  1300  AIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQ  1121
             AIFDADF+P+PDFL+R +PFL+HNPD+ LVQARWK+VNA+EC++TR+QEMS+D HF+VEQ
Sbjct  189   AIFDADFQPEPDFLWRAVPFLLHNPDLALVQARWKFVNADECLMTRMQEMSLDYHFAVEQ  248

Query  1120  EVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRV  941
             EVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKFV++GD+ V
Sbjct  249   EVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYIGDLMV  308

Query  940   KSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAH  761
             KSELPS+ KAYRYQQHRWSCGPANLF+K   EI+RNKKVT+WKK+++IY FF V KIVAH
Sbjct  309   KSELPSTLKAYRYQQHRWSCGPANLFRKTLVEIVRNKKVTLWKKIHVIYNFFLVRKIVAH  368

Query  760   VLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMA  581
              +TF++YC+V+P TVL+PE+++P WG++Y+PT+  LL+ +  PRS H+  FW LFENVM+
Sbjct  369   AVTFVFYCIVIPTTVLVPEVQVPKWGSVYIPTVITLLSAVATPRSAHLVVFWTLFENVMS  428

Query  580   LHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYM  401
             LHRT  TFIGLLE GR++EWVVTEK G+    + K   K PR R+G+RLH+ E+ V  Y+
Sbjct  429   LHRTKATFIGLLEAGRVNEWVVTEKLGD--ALRTKVPGKKPRMRIGDRLHVLELGVAAYL  486

Query  400   LFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             LFCG Y++ FG+N YY++LFLQ ++F ++G GY+G FV
Sbjct  487   LFCGCYDIAFGNNRYYIFLFLQSIAFFIVGIGYVGTFV  524



>ref|XP_006656269.1| PREDICTED: probable mannan synthase 9-like [Oryza brachyantha]
Length=520

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/517 (63%), Positives = 413/517 (80%), Gaps = 5/517 (1%)
 Frame = -1

Query  1822  AIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQ  1643
             A A  +  +W Q KA V+VP+LR+ V  CL M +M+ +EKVYL AV   + LF R P ++
Sbjct  2     AAAGQIAAMWEQVKAPVVVPLLRLSVAACLAMSVMLFVEKVYLTAVLVAVHLFGRRPERR  61

Query  1642  YKWEPIKKEDDAEIGNS----GYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             Y+ +PI   DD E+G++     +P VLVQIPM NE+ VY+LSIGAAC LSWP++R+I+QV
Sbjct  62    YRCDPIVAGDDPELGDADADAAFPMVLVQIPMYNEREVYKLSIGAACGLSWPSDRVIVQV  121

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K +VQ ECRRW  KGV IKYE RDNR G+KAG+L++GMKH YV+ C++VAI
Sbjct  122   LDDSTDPVIKEMVQVECRRWESKGVRIKYEIRDNRVGYKAGALREGMKHGYVRDCDFVAI  181

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+PDPDFL RTIPFL+HNPD+ LVQARWK+VNANEC++TR+QEMS+D HF VEQEV
Sbjct  182   FDADFQPDPDFLARTIPFLLHNPDVALVQARWKFVNANECLMTRMQEMSLDYHFKVEQEV  241

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAG+WRI+A+++AGGWKDRTTVEDMDL  RAGLKGWKFV+LGD+ VKS
Sbjct  242   GSSTHAFFGFNGTAGVWRISAMNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYLGDLMVKS  301

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKA+RYQQHRWSCG ANLF+KM  EI RNKKVT+WKK+YLIY FF V KI+ H++
Sbjct  302   ELPSTFKAFRYQQHRWSCGRANLFRKMFVEIFRNKKVTLWKKIYLIYNFFLVRKIIGHIV  361

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF++YCLV+PATVLIPE++IP WG +Y+P++  +L  +  PRSLH+  FW+LFENVM+LH
Sbjct  362   TFVFYCLVVPATVLIPEVEIPRWGYVYLPSIVTILNSIGTPRSLHLLIFWVLFENVMSLH  421

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYML  398
             RT  T IGLLE GR++EWVVTEK G+  K   P  A + PR R+G+RL+  E+    Y+ 
Sbjct  422   RTKATLIGLLETGRVNEWVVTEKLGDALKIKLPGKAFRRPRMRMGDRLNALELGFSAYLC  481

Query  397   FCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             FCG Y++ FG  YY ++LFLQ ++F +IG GY+G  V
Sbjct  482   FCGCYDIAFGKGYYSLFLFLQSITFFIIGVGYVGTIV  518



>ref|XP_004303037.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Fragaria 
vesca subsp. vesca]
Length=533

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/534 (60%), Positives = 423/534 (79%), Gaps = 6/534 (1%)
 Frame = -1

Query  1876  SSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVY  1697
             SSAAI+  S     GA D I    G++W   K  +I+P+LR+ V +CLVM +MI  E++Y
Sbjct  5     SSAAIIPDS---FIGARDDIFMQFGLVWNMIKEPLIIPLLRMAVAMCLVMSVMIFAERLY  61

Query  1696  LGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAA  1517
             +G V   + +F R P K+YKWEPIK  DD E+G+S YP VLVQIPM NE+ VYQLSIGA 
Sbjct  62    MGVVIILVHVFGRKPEKRYKWEPIK--DDVELGSSNYPMVLVQIPMFNEREVYQLSIGAC  119

Query  1516  CNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQG  1337
             C+L+WP++R+IIQVLDDSTDP  KA+V++EC+RWAGKG+NIKYE RDNR G+K+G+LK+G
Sbjct  120   CSLTWPSDRLIIQVLDDSTDPTCKAMVERECQRWAGKGINIKYEIRDNRTGYKSGALKEG  179

Query  1336  MKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQ  1157
             +K SY K+C+YVAIFDADF+P+PDFL R+IPF VHNP++ LVQARW++VN NEC++TR Q
Sbjct  180   LKRSYAKNCDYVAIFDADFQPEPDFLSRSIPFFVHNPNVALVQARWRFVNNNECLMTRFQ  239

Query  1156  EMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLK  977
             EMS+D HF +EQEVGS+ HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA LK
Sbjct  240   EMSLDYHFKIEQEVGSSTHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLK  299

Query  976   GWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLI  797
             GWKFV+LG ++VKSELPS+FKA+R+QQHRWSCGPANLFKKM  EI+ NKKV++W+K+++I
Sbjct  300   GWKFVYLGTLQVKSELPSTFKAFRHQQHRWSCGPANLFKKMVMEIITNKKVSVWQKVHVI  359

Query  796   YAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHM  617
             Y+FFFV KI+AH+  F +YC+VLPAT+L+PE+ +P WG +Y+PT+  LL  +  PRS+H+
Sbjct  360   YSFFFVRKIIAHIFAFFFYCIVLPATILVPEVTVPKWGGVYIPTIITLLNSVGTPRSIHL  419

Query  616   TAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGN-TKTAQPKSAKKVPRFRLGE  440
               FW+LFENVM+LHRT  T IG+LE  R++EW+VTEK G+  K      A K  R  +G+
Sbjct  420   VVFWILFENVMSLHRTKATIIGILEFSRVNEWIVTEKLGDFLKNKVGAKAPKKFRLNIGD  479

Query  439   RLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             RLH  E+ VG Y+ FC  Y+ +FG + Y+++ + Q ++F ++GFGY+G  V TS
Sbjct  480   RLHFLELAVGCYLFFCACYDFVFGKDNYFIFFYTQSLAFFIMGFGYVGTIVPTS  533



>ref|XP_004965827.1| PREDICTED: probable mannan synthase 9-like [Setaria italica]
Length=538

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/523 (61%), Positives = 419/523 (80%), Gaps = 7/523 (1%)
 Frame = -1

Query  1828  GDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPA  1649
             GDA A  +  +W Q K+ V+VP+LR+ V LCL M +M+  EKVYL AV    +L  R P 
Sbjct  17    GDA-AGQVAAVWQQLKSPVVVPLLRLAVALCLAMSVMLFAEKVYLAAVVLATRLLGRRPE  75

Query  1648  KQYKWEPIKKEDDAEI-----GNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              +Y+WEPI+  +D ++     G++ YP VLVQIPM NE+ VY +SIGAAC LSWP +RII
Sbjct  76    LRYRWEPIRGGEDGDLEAAAGGSAAYPMVLVQIPMYNEREVYGVSIGAACGLSWPADRII  135

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             +QVLDDSTDP ++ LV+ EC RWA KGVNI+YE RD+R+G+KAG+L++GMK  Y + C+ 
Sbjct  136   VQVLDDSTDPAIRELVRAECERWASKGVNIRYEVRDSRRGYKAGALREGMKRGYARGCDM  195

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+PDFL R +PFLVHNPD+ LVQARWK+VNA+EC++TR+QE+S+D HF+VE
Sbjct  196   VAIFDADFQPEPDFLQRAVPFLVHNPDLALVQARWKFVNADECLMTRMQEISLDYHFTVE  255

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKFVFLGD+ 
Sbjct  256   QEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVFLGDLM  315

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+ KAYRYQQHRWSCGPANLF+KM  EI+RNKKVT+WKK+++IY FF V KI+A
Sbjct  316   VKNELPSTLKAYRYQQHRWSCGPANLFRKMLMEIVRNKKVTLWKKIHVIYNFFLVRKIIA  375

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TF++YC+V+PATVL+PE++IP WG++Y+PT+  LL  +  PRS+H+  FW+LFENVM
Sbjct  376   HIVTFVFYCIVIPATVLVPEVEIPRWGSVYIPTIITLLNAVGTPRSVHLIVFWILFENVM  435

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGF  407
             ALHR   TFIGLLE GR++EWVVTEK G+  +   P    K PR R+ +RLH+ E+ VG 
Sbjct  436   ALHRMKATFIGLLEAGRVNEWVVTEKLGDALRMKMPGKGFKKPRMRIVDRLHILELCVGA  495

Query  406   YMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             Y+ FCG Y++  G+N+YY++LFLQ ++F ++G GY+G FV  S
Sbjct  496   YLFFCGCYDVTVGNNHYYIFLFLQSIAFFIVGLGYVGTFVPHS  538



>gb|ACF33171.1| mannan synthase [Coffea canephora]
Length=537

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/535 (59%), Positives = 424/535 (79%), Gaps = 5/535 (1%)
 Frame = -1

Query  1873  SAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYL  1694
             SAA +       RG+   IA  +G++W   +A +IVP+LR+ VY+CL M +M+ +E+ Y+
Sbjct  5     SAANLIPESFDFRGSTADIAGQIGLIWELIRAPLIVPLLRLAVYICLAMSLMLFIERPYM  64

Query  1693  GAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAAC  1514
             G V   +K+F + P K+YKWEP++  DD EIGN+ +P VLVQIPM NEK VY++SIGAAC
Sbjct  65    GIVIILVKIFWKKPEKRYKWEPMR--DDLEIGNAAFPMVLVQIPMFNEKEVYKISIGAAC  122

Query  1513  NLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGM  1334
             NLSWP++RI+IQVLDDSTDP +K +V++EC+RWA KG + +Y+ R+ R G+KAG+LK+G+
Sbjct  123   NLSWPSDRIVIQVLDDSTDPIIKDMVEKECQRWASKGTHCRYQIRETRGGYKAGALKEGL  182

Query  1333  KHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQE  1154
             KH YVK CEYV IFDADF P+PDFL R IPFL+HN DI LVQARW++VN++EC+LTR+QE
Sbjct  183   KHDYVKDCEYVVIFDADFRPEPDFLRRAIPFLMHNSDIALVQARWRFVNSDECLLTRMQE  242

Query  1153  MSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKG  974
             MS+D HF+VEQEVGS+ HAFFGFNGT GIWRIAA+++AGGWKDRTTVEDMDL  RAGLKG
Sbjct  243   MSLDYHFTVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKG  302

Query  973   WKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIY  794
             WKFV+LGD +VKSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNKK+ +WKK+Y+IY
Sbjct  303   WKFVYLGDPQVKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKIAVWKKVYVIY  362

Query  793   AFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMT  614
             +FFFV K++AH++TF +YC+VLP T+L+PE+++P WGA+Y+P +   L  +  PRS+H+ 
Sbjct  363   SFFFVRKVIAHMVTFFFYCVVLPLTILVPEVEVPKWGAIYIPCIITALNSVGTPRSIHLL  422

Query  613   AFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPR---FRLG  443
              +W+LFENVM+LHRT  TFIGLLE  R +EWVVTEK G+    +    K  P+    ++G
Sbjct  423   FYWILFENVMSLHRTKATFIGLLEAKRANEWVVTEKLGDALKNKSNVVKAKPKKIGLKIG  482

Query  442   ERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             +R+HL E+    ++ FCG Y+ ++G N Y++YLFLQ ++F + GFGYIG  V TS
Sbjct  483   DRIHLTELGFAVFLFFCGCYDFLYGKNNYFIYLFLQVITFTIAGFGYIGTIVPTS  537



>ref|XP_010683891.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9 [Beta vulgaris 
subsp. vulgaris]
Length=533

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/498 (64%), Positives = 412/498 (83%), Gaps = 3/498 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G  D I   +G++W Q KA   VP+L++ V +CL M IM+ +E+VY+G V   LKLF R 
Sbjct  16    GDRDDITGQIGLIWEQIKAPFFVPILKLAVLICLGMSIMLFIERVYMGIVITLLKLFGRK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YKWE IK  DD E+G+S YP VLVQIPM NEK VYQLSIGAAC LSWP++RIIIQV
Sbjct  76    PEKRYKWETIK--DDVELGSSVYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTD  +K LV  EC+RWA KG+NIKYE RDNR G+KAG+LK+GMKH+YVK+C+YVAI
Sbjct  134   LDDSTDSTIKELVAMECKRWASKGINIKYEIRDNRNGYKAGALKEGMKHNYVKNCDYVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL+R++PFL+HNP + LVQARWK+VN++EC++TR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLWRSVPFLMHNPQLALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ +AFFGFNGTAG+WRI+A+++AGGWKDRTTVEDMDL  RA LKGWKF++LG ++VK+
Sbjct  254   GSSTYAFFGFNGTAGVWRISAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLQVKN  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKAYR+QQHRWSCGPANLF+KM  EI+RN+KV++WKK+++IY+FF + K++AHV+
Sbjct  314   ELPSTFKAYRFQQHRWSCGPANLFRKMVSEIIRNEKVSLWKKVHVIYSFFTIRKVIAHVV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF +YC+VLPATVL PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+LFENVM+LH
Sbjct  374   TFAFYCIVLPATVLAPEVVVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYML  398
             RT  T IGL+E  R++EWVVTEK G+  K        K PRFR GERLH+ E+ VG Y+L
Sbjct  434   RTKATLIGLMEGVRVNEWVVTEKLGDALKFKSAAKGSKKPRFRFGERLHILELGVGAYLL  493

Query  397   FCGWYNLIFGDNYYYVYL  344
             FCGWYNL+FG N++++YL
Sbjct  494   FCGWYNLLFGKNHFFIYL  511



>gb|KEH42110.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=523

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/524 (61%), Positives = 425/524 (81%), Gaps = 5/524 (1%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             A + A + +   L  +W   +  +IVP+LR  VYLCL + +++L+EKVY+  V  Y+KLF
Sbjct  3     AFKVASEGVGMQLEFIWKNIREPLIVPMLRWTVYLCLGLSLIMLVEKVYMAIVICYVKLF  62

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
             +RTP K YK++ I  EDD E+GNS YP VLVQ+PM NE+ VYQLSIGAAC LSWP++RII
Sbjct  63    KRTPEKCYKFKAI--EDDVELGNSNYPMVLVQVPMYNEREVYQLSIGAACELSWPSDRII  120

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQ+LDDSTDP +K  VQ+ECRRW  KGVNIKYE RDNR G+KAG+LK+GMKHS+V  CEY
Sbjct  121   IQILDDSTDPTIKEFVQEECRRWRNKGVNIKYEVRDNRNGYKAGALKEGMKHSHVLQCEY  180

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+PDFL RTIPFLV+NP+IGLVQARWK+VNANEC++TR+Q+MS+D HF VE
Sbjct  181   VAIFDADFQPEPDFLLRTIPFLVNNPEIGLVQARWKFVNANECLMTRMQQMSLDYHFKVE  240

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKF++L +++
Sbjct  241   QEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSNLQ  300

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+ KAYRYQQHRWSCGPANLF+K+  EI+ +KKV++ KKL+++Y+FFF+ KIV 
Sbjct  301   VKNELPSTLKAYRYQQHRWSCGPANLFRKIVMEIVTSKKVSLLKKLHIVYSFFFIRKIVV  360

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             HV TF++YC++LPATV++PE+ +P WG +YVP++  LL  +  PRS ++  FW+LFEN +
Sbjct  361   HVHTFVFYCILLPATVMVPEVVVPKWGTVYVPSIITLLKAVGTPRSFYLVIFWVLFENTI  420

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQP--KSAKKVPRFRLGERLHLWEIIVG  410
             ALHRT  T IGLLE  R++EW+VTEK G+    +   K  KK+ RF++ +R+HL E+ VG
Sbjct  421   ALHRTKATIIGLLETSRVNEWIVTEKLGDALKGKDGGKELKKL-RFKIVDRIHLSELFVG  479

Query  409   FYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             FY+LFCG Y+L+ G N ++++L++Q ++F ++ FGY+G FV+ S
Sbjct  480   FYLLFCGCYDLMHGKNQFFIFLYIQAIAFFILAFGYVGTFVSNS  523



>ref|XP_006481909.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Citrus 
sinensis]
Length=533

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/534 (62%), Positives = 439/534 (82%), Gaps = 6/534 (1%)
 Frame = -1

Query  1885  GNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILME  1706
             G  ++A ++ +S  A+RG  D IA  L +LW   KA +IVP L + V+LCL+M +M+L+E
Sbjct  2     GQLAAATVLPNS--ALRGTDD-IAAQLSLLWGWIKAPLIVPFLNIAVFLCLIMSLMLLIE  58

Query  1705  KVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSI  1526
             +VY+  V   LKL  R+P  +YK+EP+K  +D E+GNS YP VLVQIPM NE+ VYQLSI
Sbjct  59    RVYMSIVILLLKLSGRSPETRYKFEPMK--EDIELGNSSYPMVLVQIPMFNEREVYQLSI  116

Query  1525  GAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSL  1346
             GAAC LSWP++R+IIQVLDDSTD  +K +V+ EC+RWA KG+NIKYE RDNRKG+KAG+L
Sbjct  117   GAACGLSWPSDRLIIQVLDDSTDLTIKDMVELECQRWASKGINIKYEVRDNRKGYKAGAL  176

Query  1345  KQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLT  1166
             ++GMK  YVKSC++V IFDADF+P+ DFL RTIPFLVHNP + LVQARW++VNA+EC++T
Sbjct  177   REGMKRGYVKSCDFVVIFDADFQPESDFLTRTIPFLVHNPQLALVQARWEFVNADECLMT  236

Query  1165  RLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRA  986
             RLQEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA
Sbjct  237   RLQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRA  296

Query  985   GLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKL  806
              LKGWKF++LG V+VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WKK+
Sbjct  297   SLKGWKFLYLGTVKVKNELPSTFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVSLWKKV  356

Query  805   YLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRS  626
             ++IY+FFFV KI+AH++TF+ YC+VLPATV+IPE+++P W A+Y+PT+  +L  +  PRS
Sbjct  357   HVIYSFFFVRKIIAHIITFVLYCVVLPATVVIPEVQVPKWAAVYIPTVITMLNAVGTPRS  416

Query  625   LHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAK-KVPRFR  449
             +H+  FW+LFENVM+LHRT+ TFIGLLE  R++EW+VTEK G    A+  +   ++ RF 
Sbjct  417   IHLLVFWILFENVMSLHRTMATFIGLLEGVRVNEWIVTEKLGGALKAKAAAKAPRIRRFF  476

Query  448   LGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              G+R++L E+ VG ++  CG Y+++FG+N+Y++YLF+Q ++F V+GFGY+G +V
Sbjct  477   FGDRIYLLELGVGAFLFSCGCYDVLFGNNHYFIYLFVQALAFFVMGFGYVGIYV  530



>ref|XP_006430317.1| hypothetical protein CICLE_v10011455mg [Citrus clementina]
 gb|ESR43557.1| hypothetical protein CICLE_v10011455mg [Citrus clementina]
Length=533

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/534 (61%), Positives = 437/534 (82%), Gaps = 6/534 (1%)
 Frame = -1

Query  1885  GNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILME  1706
             G  ++A ++ +S     G  D IA  L +LW   KA +IVP+L + V+LCL+M +M+L+E
Sbjct  2     GQLAAATVLPNSAL---GGTDDIAVQLSLLWGWIKAPLIVPLLNIAVFLCLIMSLMLLIE  58

Query  1705  KVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSI  1526
             +VY+  V   LKL  R+P  +YK++P+K  +D E+GNS YP VLVQIPM NE+ VYQLSI
Sbjct  59    RVYMSIVILLLKLSGRSPETRYKFQPMK--EDVELGNSSYPMVLVQIPMFNEREVYQLSI  116

Query  1525  GAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSL  1346
             GAAC LSWP++R+IIQVLDDSTD  +K +V+ EC+RWA KG+NIKYE RDNRKG+KAG+L
Sbjct  117   GAACGLSWPSDRLIIQVLDDSTDLTIKDMVELECQRWASKGINIKYEVRDNRKGYKAGAL  176

Query  1345  KQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLT  1166
             ++GMK  YVKSC++V IFDADF+P+ DFL RTIPFLVHNP + LVQARW++VNA+EC++T
Sbjct  177   REGMKRGYVKSCDFVVIFDADFQPESDFLTRTIPFLVHNPQLALVQARWEFVNADECLMT  236

Query  1165  RLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRA  986
             RLQEMS+D HF+VEQEVGS+ HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA
Sbjct  237   RLQEMSLDYHFTVEQEVGSSTHAFFGFNGTAGVWRIAAVNEAGGWKDRTTVEDMDLAVRA  296

Query  985   GLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKL  806
              LKGWKF++LG ++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WKK+
Sbjct  297   SLKGWKFLYLGTIKVKNELPSTFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVSLWKKV  356

Query  805   YLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRS  626
             ++IY+FFFV KI+AH++TF+ YC+VLPATV+IPE+++P W A+Y+PT+  +L  +  PRS
Sbjct  357   HVIYSFFFVRKIIAHIITFVLYCVVLPATVVIPEVQVPKWAAVYIPTVITILNAVGTPRS  416

Query  625   LHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAK-KVPRFR  449
             +H+  FW+LFENVM+LHRT+ TFIGLLE  R++EW+VTEK G    A+  +   ++ RF 
Sbjct  417   IHLLVFWILFENVMSLHRTMATFIGLLEGVRVNEWIVTEKLGGALKAKAAAKAPRLRRFF  476

Query  448   LGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              G+R++L E+ VG ++  CG Y+++FG+N+Y++YLF+Q ++F V+GFGY+G +V
Sbjct  477   FGDRIYLLELGVGAFLFSCGCYDVLFGNNHYFIYLFVQALAFFVMGFGYVGIYV  530



>sp|Q67VS7.1|CSLA9_ORYSJ RecName: Full=Probable mannan synthase 9; AltName: Full=Cellulose 
synthase-like protein A9; AltName: Full=OsCslA9 [Oryza 
sativa Japonica Group]
 gb|AAL25128.1|AF432499_1 cellulose synthase-like protein OsCslA9 [Oryza sativa]
 dbj|BAD37742.1| putative glycosyltransferase 1 [Oryza sativa Japonica Group]
 gb|EEC81007.1| hypothetical protein OsI_23768 [Oryza sativa Indica Group]
 gb|EEE66045.1| hypothetical protein OsJ_22033 [Oryza sativa Japonica Group]
Length=527

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/523 (62%), Positives = 412/523 (79%), Gaps = 7/523 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
              AG  +   +  +W Q KA V+VP+LR+ V  CL M +M+ +EKVY+  V   + LF R 
Sbjct  3     AAGAVLPEQIAAMWEQVKAPVVVPLLRLSVAACLAMSVMLFVEKVYMSVVLVGVHLFGRR  62

Query  1654  PAKQYKWEPI----KKEDDAEIG--NSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTN  1493
             P ++Y+ +PI       DD E+   N+ +P VL+QIPM NE+ VY+LSIGAAC LSWP++
Sbjct  63    PDRRYRCDPIVAAGADNDDPELADANAAFPMVLIQIPMYNEREVYKLSIGAACGLSWPSD  122

Query  1492  RIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKS  1313
             R+I+QVLDDSTDP +K +VQ EC+RW  KGV IKYE RDNR G+KAG+L++GMKH YV+ 
Sbjct  123   RVIVQVLDDSTDPVIKEMVQVECKRWESKGVRIKYEIRDNRVGYKAGALREGMKHGYVRD  182

Query  1312  CEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHF  1133
             C+YVAIFDADF+PDPDFL RTIPFLVHNPDI LVQARWK+VNANEC++TR+QEMS+D HF
Sbjct  183   CDYVAIFDADFQPDPDFLARTIPFLVHNPDIALVQARWKFVNANECLMTRMQEMSLDYHF  242

Query  1132  SVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLG  953
              VEQEVGS+ HAFFGFNGTAG+WRI+A+++AGGWKDRTTVEDMDL  RAGLKGWKFV+LG
Sbjct  243   KVEQEVGSSTHAFFGFNGTAGVWRISAMNEAGGWKDRTTVEDMDLAVRAGLKGWKFVYLG  302

Query  952   DVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNK  773
             D+ VKSELPS+FKA+RYQQHRWSCGPANLF+KM  EI  NKKVT+WKK+Y+IY FF V K
Sbjct  303   DLMVKSELPSTFKAFRYQQHRWSCGPANLFRKMLVEIATNKKVTLWKKIYVIYNFFLVRK  362

Query  772   IVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFE  593
             I+ H++TF++YCLV+PATVLIPE++IP WG +Y+P++  +L  +  PRSLH+  FW+LFE
Sbjct  363   IIGHIVTFVFYCLVVPATVLIPEVEIPRWGYVYLPSIVTILNSIGTPRSLHLLIFWVLFE  422

Query  592   NVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEII  416
             NVM+LHRT  T IGLLE GR++EWVVTEK G+  K   P  A + PR R+G+R++  E+ 
Sbjct  423   NVMSLHRTKATLIGLLETGRVNEWVVTEKLGDALKLKLPGKAFRRPRMRIGDRVNALELG  482

Query  415   VGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
                Y+ FCG Y++ +G  YY ++LFLQ ++F +IG GY+G  V
Sbjct  483   FSAYLSFCGCYDIAYGKGYYSLFLFLQSITFFIIGVGYVGTIV  525



>ref|XP_009337395.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=549

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/537 (59%), Positives = 421/537 (78%), Gaps = 19/537 (4%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +G  + IA  LG++W   KA +IVP+L V VY+ L M +M+  E+VY+G V   +KLF +
Sbjct  15    QGTTNDIAGQLGLIWELIKAPLIVPLLTVGVYVSLAMSLMLFFERVYMGVVIVLVKLFWK  74

Query  1657  TPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQ  1478
              P ++YK+EPI  +DD E+G+S +P VL+QIPM NE+ VY++SIGAAC LSWP++R++IQ
Sbjct  75    KPEERYKYEPI--QDDLEVGSSNFPVVLIQIPMFNEREVYKVSIGAACGLSWPSDRLVIQ  132

Query  1477  VLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVA  1298
             VLDDSTDP +K +V+ EC+RWA KG+NI+Y+ R+ R G+KAG+LK+G+K SYVK CEYVA
Sbjct  133   VLDDSTDPTIKQMVELECQRWASKGINIRYQIRETRGGYKAGALKEGLKRSYVKHCEYVA  192

Query  1297  IFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQE  1118
             IFDADF P+PD+L R IPFLVHNPDI LVQARW++VN++EC+LTR+QEMS+D HF+VEQE
Sbjct  193   IFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQE  252

Query  1117  VGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVK  938
             VGSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++VK
Sbjct  253   VGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVK  312

Query  937   SELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHV  758
             SELPS+F A+R+QQHRWSCGPANLF+KM  EI+R KKVT+WKK Y IY+FFFV KI+AH+
Sbjct  313   SELPSTFNAFRFQQHRWSCGPANLFRKMAMEIIRTKKVTLWKKFYTIYSFFFVRKIIAHM  372

Query  757   LTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMAL  578
             +TF +YC+VLP T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+L
Sbjct  373   VTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSL  432

Query  577   HRTIGTFIGLLEVGRIHEWVVTEKQGN-----------TKTAQPKSAK------KVPRFR  449
             HRT  T IGLLE  R +EWVVTEK G+            KTA     K      K PRF+
Sbjct  433   HRTKATLIGLLETARSNEWVVTEKLGDIVKNKAAEAAKNKTADANKTKPASKLFKKPRFK  492

Query  448   LGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              G RLHL E+  G ++  CG Y+ + G N Y++YLFLQ ++FL+ GFGY+G  + +S
Sbjct  493   FGNRLHLLELGFGVFLFICGCYDFVHGKNNYFIYLFLQTITFLICGFGYVGTIIPSS  549



>ref|XP_006606289.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Glycine max]
Length=472

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/471 (67%), Positives = 397/471 (84%), Gaps = 3/471 (1%)
 Frame = -1

Query  1687  VSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNL  1508
             V  ++KLFR  P K+YKWEP++  DD E GNS YP VLVQIPM NEK VYQLSIGAAC L
Sbjct  4     VHCFMKLFRYKPEKKYKWEPLR--DDLEFGNSAYPMVLVQIPMYNEKEVYQLSIGAACGL  61

Query  1507  SWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKH  1328
             SWP++R+IIQVLDDSTDP +K +V+ EC+RWA KGVNIKYE R+NR G+KAG+LK+GMKH
Sbjct  62    SWPSDRVIIQVLDDSTDPIIKNMVEVECQRWASKGVNIKYEIRENRNGYKAGALKEGMKH  121

Query  1327  SYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMS  1148
             SYV  C+YVAIFDADF+P+P+FL+RTIPFL +NP++ LVQARWK+VNA+EC++TR+QEMS
Sbjct  122   SYVNLCDYVAIFDADFQPEPNFLWRTIPFLAYNPEVALVQARWKFVNADECLMTRMQEMS  181

Query  1147  MDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWK  968
             +D HF VEQEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RAGLKG K
Sbjct  182   LDYHFLVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGGK  241

Query  967   FVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAF  788
             FV+L D++VKSELPS+FKAYRYQQHRWSCGPANLFKKM  EIMRNKKV++WKKLY+IY+F
Sbjct  242   FVYLSDLKVKSELPSTFKAYRYQQHRWSCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSF  301

Query  787   FFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAF  608
             FFV KIVAHV+TF++YC+++PATVL+PE+++P WGA+Y+P++  LL  +  PRS+H+  F
Sbjct  302   FFVRKIVAHVVTFVFYCVIMPATVLVPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVF  361

Query  607   WMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLH  431
             W+LFENVM++HRT  T  GLLE GR++EWVVTEK G+  KT     A + PR R+GERLH
Sbjct  362   WILFENVMSMHRTKATLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAARKPRIRIGERLH  421

Query  430   LWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
               E++VG Y+ FC  Y+L +G N+Y++YLFLQ ++F V G GY+G FV  S
Sbjct  422   FLELLVGAYLFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPNS  472



>ref|XP_002269677.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Vitis vinifera]
Length=533

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/521 (61%), Positives = 420/521 (81%), Gaps = 4/521 (1%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +G    IA  +G++W   KA +IVP+LRV VY+CL M +M+ +E++Y+G V   +K+F +
Sbjct  15    QGTRLDIAGQIGLVWELVKAPLIVPLLRVAVYICLTMSLMLFVERLYMGIVIILVKIFWK  74

Query  1657  TPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQ  1478
              P K+YKWEP++  +D E GNS +P V+VQIPM NEK VY+LSIGAAC LSWP +R++IQ
Sbjct  75    KPDKRYKWEPLR--EDLESGNSNFPHVVVQIPMYNEKEVYKLSIGAACGLSWPADRLVIQ  132

Query  1477  VLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVA  1298
             VLDDSTDP +K LV+ EC+RWA KG+NI+Y+ R+NR G+KAG+L++G+K SYVK CEYVA
Sbjct  133   VLDDSTDPAIKNLVETECQRWAAKGINIRYQIRENRVGYKAGALREGLKRSYVKHCEYVA  192

Query  1297  IFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQE  1118
             IFDADF+P+PD+L R IPFLV+N DI LVQ RW++VNA+EC++TR+QEMS+D HF+VEQE
Sbjct  193   IFDADFQPEPDYLKRAIPFLVYNSDIALVQGRWRFVNADECLMTRMQEMSLDYHFTVEQE  252

Query  1117  VGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVK  938
             VGSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKFV+LGD++VK
Sbjct  253   VGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVK  312

Query  937   SELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHV  758
             SELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FF V KIVAH+
Sbjct  313   SELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFLVRKIVAHM  372

Query  757   LTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMAL  578
             +TF  YC+VLP T+LIPE++IP+WG +Y+P++   L  +  PRS+H+  +W+LFENVM+ 
Sbjct  373   VTFCLYCVVLPLTILIPEVEIPIWGIVYIPSIITTLNAVGTPRSIHLLFYWILFENVMSF  432

Query  577   HRTIGTFIGLLEVGRIHEWVVTEKQGNT--KTAQPKSAKKVPRFRLGERLHLWEIIVGFY  404
             HRT  T IGLLE GR +EWVVTEK G+T    A  K+A K PRF++G+R++  E+    +
Sbjct  433   HRTKATLIGLLEAGRANEWVVTEKLGDTLKNKANTKAAAKRPRFKIGDRINTMELGFSAF  492

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             + FC  Y+ ++G  Y+YVYLFLQ +++ ++G GY+G  V +
Sbjct  493   LFFCACYDFLYGKYYFYVYLFLQTITYFIVGIGYVGTIVPS  533



>gb|KDP34366.1| hypothetical protein JCGZ_11249 [Jatropha curcas]
Length=538

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/522 (61%), Positives = 415/522 (80%), Gaps = 8/522 (2%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             D     +G++W   K  +IVP+L + VY+CL M +M+ ME++Y+G V   +KLF + P K
Sbjct  19    DDFGAQIGLIWELIKTPLIVPLLTLGVYVCLAMSLMLFMERLYMGIVIILVKLFWKKPEK  78

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +YKWEPI  +DD E GNS +P VLVQIPM NE+ VY+LSIGAA NLSWP +R++IQVLDD
Sbjct  79    RYKWEPI--QDDLESGNSNFPAVLVQIPMFNEREVYKLSIGAASNLSWPADRLVIQVLDD  136

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STD E+K +V+ EC+RWA KGVNI Y+ R+ R G+KAG+LK+G+K SYVK CEYV IFDA
Sbjct  137   STDQEIKKMVELECQRWASKGVNIVYQIRETRGGYKAGALKEGLKRSYVKHCEYVVIFDA  196

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF+P+PDFL R IPFLVHNPDI LVQARW++VNA+EC+LTR+QEMS+D HF+VEQEVGSA
Sbjct  197   DFQPEPDFLRRAIPFLVHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSA  256

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+GWKFV+LGD+ VKSELP
Sbjct  257   THAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLHVKSELP  316

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKA+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+AH++TF 
Sbjct  317   STFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFW  376

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+VLP T+L+PE+K+P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+LHRT 
Sbjct  377   FYCVVLPLTILVPEVKVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTK  436

Query  565   GTFIGLLEVGRIHEWVVTEKQGNT--KTAQPKSAKKVP----RFRLGERLHLWEIIVGFY  404
              T IGLLE GR +EWVVTEK GNT  K A+ K     P    RF+ G+RL+  E+    +
Sbjct  437   ATLIGLLEAGRANEWVVTEKLGNTLQKNAEAKKNNLKPPRKLRFKFGDRLNTLELGFAAF  496

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             +  CG Y+ + G N Y+VYLFLQ ++F + G GY+G  + +S
Sbjct  497   LFLCGCYDFVNGKNNYFVYLFLQTITFFITGIGYVGTIIPSS  538



>ref|XP_009794211.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana 
sylvestris]
Length=526

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/526 (60%), Positives = 421/526 (80%), Gaps = 3/526 (1%)
 Frame = -1

Query  1852  SEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYL  1673
             +E+  +     IA  +G++W   KA ++VP+LR  VY+CLVM +M+ +E++Y+G V   +
Sbjct  2     AESTFQATASDIAGQIGMMWEVLKAPLLVPLLRAAVYICLVMELMLFIERLYMGIVIVIV  61

Query  1672  KLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTN  1493
             KLF + P K+YKWEP+  +DD EIG++ +P VLVQIPM NE+ VY++SIGAACNLSWP++
Sbjct  62    KLFMKKPDKRYKWEPMA-DDDLEIGSADFPKVLVQIPMFNEREVYKISIGAACNLSWPSD  120

Query  1492  RIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKS  1313
             R++IQVLDDSTDP +K +V+ EC RWA KG+NI Y+ R++R G+KAG+LK+G+KH+YVK 
Sbjct  121   RLVIQVLDDSTDPIIKDMVETECLRWASKGLNITYQIRESRGGYKAGALKEGLKHNYVKD  180

Query  1312  CEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHF  1133
             CEYV IFDADF P+PDFL R+IPFLVHNP+I LVQ RW++VNANEC+LTR+QEMS+D HF
Sbjct  181   CEYVVIFDADFRPEPDFLRRSIPFLVHNPEIALVQGRWRFVNANECLLTRMQEMSLDYHF  240

Query  1132  SVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLG  953
             +VEQEVGS+ HAFFGFNGT GIWRIAA+++AGGWKDRTTVEDMDL  RA LKGWKFV+LG
Sbjct  241   TVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLG  300

Query  952   DVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNK  773
             D++VKSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNK+V +WKK Y+IY+FFFV K
Sbjct  301   DLQVKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNVWKKFYVIYSFFFVRK  360

Query  772   IVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFE  593
             I+AH++TF ++C+VLP T+L+PE+++PLWGA+Y+P +   L  +  PRS+H+  +W+LFE
Sbjct  361   IIAHMVTFFFFCVVLPLTLLVPEVEVPLWGAIYIPCIITTLNSVGTPRSIHLLFYWILFE  420

Query  592   NVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKS--AKKVPRFRLGERLHLWEI  419
             NVMA HRT  TFIGLLE  R +EWVVTEK G+T   + KS  AKK      G+R+   E+
Sbjct  421   NVMAFHRTKATFIGLLEAKRANEWVVTEKLGDTLKNKEKSKPAKKARGPLFGDRILPQEL  480

Query  418   IVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
                 ++ FCG Y++++G   Y++Y+FLQ ++F + GFGY+G  V +
Sbjct  481   GFAVFLFFCGLYDVLYGKRVYFIYVFLQVITFTIAGFGYVGTIVPS  526



>ref|XP_008385455.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Malus domestica]
Length=549

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/537 (59%), Positives = 420/537 (78%), Gaps = 19/537 (4%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +G    IA  LG++W   KA +IVP+L V VY+ L M +M+  E+VY+G V   +KLF +
Sbjct  15    QGTTYDIAGQLGLIWELIKAPLIVPLLTVGVYVSLAMSLMLFFERVYMGVVIVLVKLFWK  74

Query  1657  TPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQ  1478
              P ++YK+EPI  +DD E+G+S +P VL+QIPM NE+ VY++SIGAAC LSWP++R++IQ
Sbjct  75    KPEERYKYEPI--QDDLEVGSSNFPVVLIQIPMFNEREVYKVSIGAACGLSWPSDRLVIQ  132

Query  1477  VLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVA  1298
             VLDDSTDP +K +V+ EC+RWA KG+NI+Y+ R+ R G+KAG+LK+G+K SYVK CEYVA
Sbjct  133   VLDDSTDPTIKQMVELECQRWASKGINIRYQIRETRGGYKAGALKEGLKRSYVKHCEYVA  192

Query  1297  IFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQE  1118
             IFDADF P+PD+L R IPFLVHNPDI LVQARW++VN++EC+LTR+QEMS+D HF+VEQE
Sbjct  193   IFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQE  252

Query  1117  VGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVK  938
             VGSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++VK
Sbjct  253   VGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVK  312

Query  937   SELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHV  758
             SELPS+F A+R+QQHRWSCGPANLF+KM  EI+R KKVT+WKK Y IY+FFFV KI+AH+
Sbjct  313   SELPSTFNAFRFQQHRWSCGPANLFRKMAMEIIRTKKVTVWKKFYTIYSFFFVRKIIAHM  372

Query  757   LTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMAL  578
             +TF +YC+VLP T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+L
Sbjct  373   VTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSL  432

Query  577   HRTIGTFIGLLEVGRIHEWVVTEKQGN-----------TKTAQPKSAK------KVPRFR  449
             HRT  T IGLLE  R +EWVVTEK G+            KTA     K      K PRF+
Sbjct  433   HRTKATLIGLLETARSNEWVVTEKLGDIVKNKAAEAAKNKTADANKTKPASKLFKRPRFK  492

Query  448   LGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              G RLHL E+  G ++  CG Y+ + G N Y++YLFLQ ++FL+ GFGY+G  + +S
Sbjct  493   FGNRLHLLELGFGVFLFICGCYDFVHGKNNYFIYLFLQTITFLICGFGYVGTIIPSS  549



>ref|XP_006384673.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
 gb|ERP62470.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
Length=540

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/538 (60%), Positives = 423/538 (79%), Gaps = 8/538 (1%)
 Frame = -1

Query  1873  SAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYL  1694
             S  IM       + +   I+  L ++W   KA +IVP+L + VY+ L M +M+LME+VY+
Sbjct  5     SQKIMIPESFQFQVSSYDISGQLKLIWDLIKAPLIVPLLTLGVYISLAMSLMLLMERVYM  64

Query  1693  GAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAAC  1514
             G V  ++KLF + P K+YKWEP+  +DD E GN  +P VLVQIPM NEK VY+LSIGAA 
Sbjct  65    GIVIIFVKLFWKKPEKRYKWEPM--QDDIESGNLNFPVVLVQIPMFNEKEVYKLSIGAAS  122

Query  1513  NLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGM  1334
             NLSWP +R++IQVLDDSTDP +K +V+ EC+RWA KG+NI+Y+ R+NR G+KAG+LK+G+
Sbjct  123   NLSWPADRLVIQVLDDSTDPAIKQMVELECQRWASKGINIRYQIRENRTGYKAGALKEGL  182

Query  1333  KHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQE  1154
             K SYVK CEYV IFDADF+P+PDFL R IPFLVHNPD+ LVQARW++VNA+EC+LTR+QE
Sbjct  183   KRSYVKHCEYVCIFDADFQPEPDFLRRAIPFLVHNPDVALVQARWRFVNADECLLTRMQE  242

Query  1153  MSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKG  974
             MS+D HF+VEQEVGSA HAFFGFNGTAG+WRIAA++DAGGWKDRTTVEDMDL  RA L+G
Sbjct  243   MSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINDAGGWKDRTTVEDMDLAVRASLRG  302

Query  973   WKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIY  794
             WKFV+LGD+ VKSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNK+V  WKK+Y+IY
Sbjct  303   WKFVYLGDLHVKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNFWKKVYVIY  362

Query  793   AFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMT  614
             +FFFV KI+AH++TF +YC+VLP T+L+PE+K+P+WGA+Y+P++  +L  +  PRS+H+ 
Sbjct  363   SFFFVRKIIAHMVTFCFYCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLL  422

Query  613   AFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT--KTAQPKSAK-KVP---RF  452
              +W+LFENVM+LHRT    IGLLE GR++EWVVTEK GNT  K A  + A  K P   RF
Sbjct  423   FYWILFENVMSLHRTKAALIGLLEAGRVNEWVVTEKLGNTLQKAADARKANTKAPRKFRF  482

Query  451   RLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             +  +R++  E+    ++  CG Y+ + G N Y++YL+LQ V+F + G GY+G  + +S
Sbjct  483   KFTDRINTLELGFAAFLFLCGCYDFVNGKNNYFIYLWLQTVTFFITGIGYVGTIIPSS  540



>ref|XP_002527445.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF34937.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=535

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/519 (61%), Positives = 415/519 (80%), Gaps = 8/519 (2%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             D I   + ++W   KA +IVP+L++ VY+CL M +M+ ME++Y+G V   +KLF + P K
Sbjct  19    DDIGAQISLIWELIKAPLIVPLLQLGVYICLTMSLMLFMERLYMGIVIVLVKLFWKKPEK  78

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +YKWEPI  +DD E GNS +P VLVQIPM NE+ VY++SIGAA NLSWP +R++IQVLDD
Sbjct  79    RYKWEPI--QDDLESGNSNFPVVLVQIPMFNEREVYKVSIGAASNLSWPADRLVIQVLDD  136

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDPE+K +V+ EC+RWA KGVNI Y+ R+ R G+KAG+LK+G+K  YVK CEYV IFDA
Sbjct  137   STDPEIKQMVELECQRWASKGVNITYQIRETRGGYKAGALKEGLKRGYVKHCEYVTIFDA  196

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF+P+PDFL R IPFLV+NPDI LVQARW++VNA+EC+LTR+QEMS+D HF+VEQEVGSA
Sbjct  197   DFQPEPDFLRRAIPFLVNNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSA  256

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+GWKFV+LGD++VKSELP
Sbjct  257   THAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLQVKSELP  316

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKA+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+AH++TF 
Sbjct  317   STFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFW  376

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+VLP T+L+PE+K+P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+LHRT 
Sbjct  377   FYCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTK  436

Query  565   GTFIGLLEVGRIHEWVVTEKQGNT--KTAQPKSAK----KVPRFRLGERLHLWEIIVGFY  404
              T IGLLE GR +EWVVT+K GNT  K A  K A     K PRF   +RL+  E+    +
Sbjct  437   ATLIGLLEAGRANEWVVTQKIGNTLQKNADAKKAGLKVFKRPRFTFTDRLNTLELGFAAF  496

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             +  CG Y+ + G N Y+VYLFLQ ++F + G GY+G  +
Sbjct  497   LFLCGCYDFVHGKNNYFVYLFLQTITFFITGVGYVGTII  535



>ref|XP_003560565.2| PREDICTED: probable mannan synthase 9 [Brachypodium distachyon]
Length=488

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/486 (65%), Positives = 406/486 (84%), Gaps = 5/486 (1%)
 Frame = -1

Query  1729  MLIMILMEKVYLGAVSAYLKLFRRT-PAKQYKWEPIKKE--DDAEIGNSG-YPTVLVQIP  1562
             M +M+ +EK Y+ AV   ++LFRR  P +QY+WEP++++  DD E+G +G YP VLVQIP
Sbjct  1     MSVMLFVEKAYMAAVILAMRLFRRCRPERQYRWEPMREDEGDDLELGGNGDYPVVLVQIP  60

Query  1561  MCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYET  1382
             M NE+ VYQLSIGAAC LSWP++RII+QVLDDSTDP +K LVQ EC+RWA KGVNIKYE 
Sbjct  61    MYNEREVYQLSIGAACGLSWPSDRIIVQVLDDSTDPAIKELVQVECQRWARKGVNIKYEI  120

Query  1381  RDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQAR  1202
             R+NR+G+KAG+LK+GMKHSYV+ C+ VAIFDADF+PD DFL R +PFLVHNPD+ LVQAR
Sbjct  121   RENRRGYKAGALKEGMKHSYVRDCDLVAIFDADFQPDADFLRRAVPFLVHNPDVALVQAR  180

Query  1201  WKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDR  1022
             WK+VNA+EC++TR+QEMS+D HF+VEQ VGS+I+AFFGFNGTAG+WRIAA+++AGGWKDR
Sbjct  181   WKFVNADECLMTRMQEMSLDYHFTVEQVVGSSIYAFFGFNGTAGVWRIAAVNEAGGWKDR  240

Query  1021  TTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEI  842
             TTVEDMDL  RA LKGWKFVFLGD+ VKSELPS+FKA+RYQQHRWSCGPANLF+KM  +I
Sbjct  241   TTVEDMDLAVRASLKGWKFVFLGDLMVKSELPSTFKAFRYQQHRWSCGPANLFRKMLMDI  300

Query  841   MRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtl  662
             +RNKKVT+W+K+++IY FF V KI+ HV+TF++ CLV+PATVL+PE++IP WG +Y+P++
Sbjct  301   VRNKKVTLWRKIHVIYNFFLVRKIIGHVVTFVFCCLVIPATVLVPEVEIPKWGYIYIPSI  360

Query  661   talltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTA  485
               LL  +  PRS+H+  FW LFENVM+LHRT  TFIGLLE+GR++EWVVTEK G+  K  
Sbjct  361   ITLLNAVGTPRSVHLLVFWTLFENVMSLHRTKATFIGLLEIGRVNEWVVTEKLGDALKMK  420

Query  484   QPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFG  305
              P    K  R R+GERLHL E+ V  Y+ FCG Y++ FG+N+Y+++LF+Q ++F V+G G
Sbjct  421   TPSKVPKKLRMRIGERLHLLELGVAAYLFFCGCYDISFGNNHYFIFLFMQSITFFVVGVG  480

Query  304   YIGAFV  287
             Y+G FV
Sbjct  481   YVGTFV  486



>ref|XP_002312893.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
 gb|EEE86848.1| glycosyl transferase family 2 family protein [Populus trichocarpa]
Length=537

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/536 (59%), Positives = 422/536 (79%), Gaps = 10/536 (2%)
 Frame = -1

Query  1873  SAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYL  1694
             S  +M       + +   IA  L ++W   KA +IVP+L + VY+CL M +M+ ME+VY+
Sbjct  5     SPKVMIPESFQFQVSSSDIAGQLTLIWELLKAPLIVPLLTLGVYICLAMSLMLFMERVYM  64

Query  1693  GAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAAC  1514
             G V   +KLF + P K+YKWEP+  +DD E GN  +P VLVQIPM NE+ VY+LSIGAA 
Sbjct  65    GIVIILVKLFWKKPDKRYKWEPM--QDDLESGNLNFPVVLVQIPMFNEREVYKLSIGAAS  122

Query  1513  NLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGM  1334
             NLSWP +R++IQVLDDSTDP +K +V+ EC+RWA KG+NI+Y+ R+NR G+KAG+LK+G+
Sbjct  123   NLSWPADRLVIQVLDDSTDPAIKQMVELECQRWASKGINIRYQIRENRTGYKAGALKEGL  182

Query  1333  KHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQE  1154
             K SYVK CEYV IFDADF+P+PD+L R IPFL+HNP+I LVQ RW++VNA+EC+LTR+QE
Sbjct  183   KRSYVKHCEYVCIFDADFQPEPDYLRRAIPFLIHNPEIALVQGRWRFVNADECLLTRMQE  242

Query  1153  MSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKG  974
             MS+D HF+VEQEVGSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+G
Sbjct  243   MSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRG  302

Query  973   WKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIY  794
             WKF++LGD++VKSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY
Sbjct  303   WKFLYLGDLQVKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIY  362

Query  793   AFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMT  614
             +FFFV KI+AH++TF +YC+VLP T+L+PE+K+P+WGA+Y+P++  +L  +  PRS+H+ 
Sbjct  363   SFFFVRKIIAHMVTFSFYCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLL  422

Query  613   AFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-------KTAQPKSAKKVPR  455
              +W+LFENVM+LHRT  TFIGLLE GR +EWVVTEK GNT       K + PK+ +K  R
Sbjct  423   FYWILFENVMSLHRTKATFIGLLEAGRANEWVVTEKLGNTLQKAAEAKKSNPKAPRKF-R  481

Query  454   FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             F+  +RL+  E+    ++  CG Y+ + G N Y+VYL+LQ V+F + G GY+G  +
Sbjct  482   FKFTDRLNTLELGFSAFLFLCGCYDFVNGKNCYFVYLWLQTVTFFITGIGYVGTII  537



>ref|XP_010278246.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nelumbo 
nucifera]
Length=527

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/515 (62%), Positives = 414/515 (80%), Gaps = 4/515 (1%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             D +A  LG +W Q K  +IVP+L++ V LCLV  +++ ME+VY+G V  Y+K F R P K
Sbjct  17    DDLAGQLGFIWQQIKTPLIVPLLKLAVGLCLVFAVLLFMERVYMGIVITYVKWFGRKPEK  76

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +YKWEPIK  DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RIIIQVLDD
Sbjct  77    RYKWEPIK--DDPELGNSVYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIIIQVLDD  134

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP +K++V+ EC RWA KG+NIKYE R+NR G+KAG+LK+G+K SY K C+YV IFDA
Sbjct  135   STDPTIKSMVELECHRWASKGINIKYEIRENRVGYKAGALKEGLKRSYSKQCDYVVIFDA  194

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF+P+PDFL+R+IPFLVHNPDI LVQARW +VNA+ECM+TR+QEMS+D HF+VEQEVGS+
Sbjct  195   DFQPEPDFLWRSIPFLVHNPDIALVQARWVFVNADECMMTRMQEMSLDYHFTVEQEVGSS  254

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              +AFFGFNGTAGIWRIAA++ AGGWKDRTTVEDMDL  RA LKGWKF+++GD++VKSELP
Sbjct  255   TYAFFGFNGTAGIWRIAAIEAAGGWKDRTTVEDMDLAVRASLKGWKFLYVGDLQVKSELP  314

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+F A+R+QQ RWSCGPANLF+KM  EI+RNK VT +KK Y+IY+FF V KI+AH++TF+
Sbjct  315   STFNAFRHQQDRWSCGPANLFRKMAMEIIRNKNVTTFKKFYVIYSFFLVRKIIAHIITFV  374

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+VLP TVLIPE+++P WG++Y+P +  LL  +  PRS+H+  FW+LFENVMALHR+ 
Sbjct  375   FYCIVLPLTVLIPEVEVPKWGSIYMPCIITLLNSVGTPRSVHLLFFWVLFENVMALHRSK  434

Query  565   GTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGW  386
              T  GLL   + + WVVTEK G +KT   K+ KK PRFR+ ERLHL E+  G ++     
Sbjct  435   ATIAGLLGAKKANVWVVTEKLG-SKTTNSKAPKK-PRFRIRERLHLTELAFGLFLALVSC  492

Query  385   YNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             Y+ ++G N Y+++L LQ ++F ++GFGY+G  + +
Sbjct  493   YDFVYGKNNYFIFLSLQAITFFIVGFGYVGTIIPS  527



>ref|XP_011005673.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Populus 
euphratica]
Length=540

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/538 (59%), Positives = 423/538 (79%), Gaps = 8/538 (1%)
 Frame = -1

Query  1873  SAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYL  1694
             S  IM       + +   I+  L ++W   KA +IVP+L + VY+ L M +M+ ME+VY+
Sbjct  5     SQKIMIPESFQFQVSSYDISGQLKLIWELIKAPLIVPLLTLGVYISLAMSLMLFMERVYM  64

Query  1693  GAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAAC  1514
             G V   +KLF + P K+YKWEP+  +DD E GN  +P VLVQIPM NEK VY+LSIGAA 
Sbjct  65    GIVIILVKLFWKKPEKRYKWEPM--QDDIESGNLNFPVVLVQIPMFNEKEVYKLSIGAAS  122

Query  1513  NLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGM  1334
             NLSWP +R++IQVLDDSTDP +K +V+ EC+RWA KG+NI+Y+ R+NR G+KAG+LK+G+
Sbjct  123   NLSWPADRLVIQVLDDSTDPAIKQMVELECQRWASKGINIRYQIRENRTGYKAGALKEGL  182

Query  1333  KHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQE  1154
             K SYVK CEYV IFDADF+P+PDFL R IPFLVHNPD+ LVQARW++VNA+EC+LTR+QE
Sbjct  183   KRSYVKHCEYVCIFDADFQPEPDFLRRAIPFLVHNPDVALVQARWRFVNADECLLTRMQE  242

Query  1153  MSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKG  974
             MS+D HF+VEQEVGSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+G
Sbjct  243   MSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRG  302

Query  973   WKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIY  794
             WKFV+LGD++VKSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNK+V  WKK+Y+IY
Sbjct  303   WKFVYLGDLQVKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVKFWKKVYVIY  362

Query  793   AFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMT  614
             +FFFV KI+AH++TF +YC+VLP T+L+PE+K+P+WGA+Y+P++  +L  +  PRS+H+ 
Sbjct  363   SFFFVRKIIAHMVTFCFYCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLL  422

Query  613   AFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT--KTAQPKSAK-KVP---RF  452
              +W+LFENVM+LHRT  T IGLLE GR++EWVVTEK GNT  K A  + A  K P   RF
Sbjct  423   FYWILFENVMSLHRTKATLIGLLEAGRVNEWVVTEKLGNTVQKAADARKANTKAPRKFRF  482

Query  451   RLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             +  +RL+  E+    ++  CG ++ + G N Y++YL+LQ V+F + G GY+G  + +S
Sbjct  483   KFTDRLNTLELGFAAFLFLCGCFDFVNGKNNYFIYLWLQTVTFFITGIGYVGTIIPSS  540



>ref|XP_010038980.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Eucalyptus 
grandis]
Length=533

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/520 (61%), Positives = 413/520 (79%), Gaps = 3/520 (1%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             A  GA D IA  + +LW   KA +++P+L + + LC  M +M+ +EKVY+  V   +K+ 
Sbjct  13    AFLGARDDIAVQIQLLWTLFKAPLLIPLLNMAILLCSSMSLMLFIEKVYMSIVILLVKVL  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              + P K+Y+WEP+K  DD E GNS YPTVLVQIPM NE+ VYQ SIGAAC LSWP++R+I
Sbjct  73    GQEPEKRYRWEPMK--DDIEAGNSAYPTVLVQIPMYNEREVYQFSIGAACGLSWPSDRMI  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDST+P +K +V+ EC+RW  KGVNIKYE RD+R G+KAG+L++GMK SY K C++
Sbjct  131   IQVLDDSTNPTIKDMVKLECQRWQSKGVNIKYEIRDSRNGYKAGALREGMKRSYAKQCDF  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAI DADF+P PDFL RTIPFLVHNP++ LVQARW +VN++EC++TR+QEMS+D HF+VE
Sbjct  191   VAIIDADFQPKPDFLRRTIPFLVHNPELALVQARWTFVNSDECLMTRMQEMSLDYHFTVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS+ +AFFGFNGTAG+WRI+A+++AGGWK+RTTVEDMDL  RA LKGWKFV++G ++
Sbjct  251   QEVGSSTYAFFGFNGTAGVWRISAINEAGGWKERTTVEDMDLAVRASLKGWKFVYVGSLK  310

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VKSELPS+ KAYRYQQHRWSCGPANLF+KM F+I++NKKV+ WKKLY+IY+FF V KIVA
Sbjct  311   VKSELPSTLKAYRYQQHRWSCGPANLFRKMVFDIIKNKKVSTWKKLYVIYSFFMVRKIVA  370

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TF++YC+VLPATVL PE+ +P W ++Y+P++   L  L  PRSLH+  FW+LFENVM
Sbjct  371   HIVTFLFYCIVLPATVLTPEVAVPKWASIYIPSIITALNALSTPRSLHLMVFWILFENVM  430

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGF  407
             +LHRT  T IGLLE  R++EW+VTEK G+  K     S  +  R R  ER H  EI VG 
Sbjct  431   SLHRTKATIIGLLEGNRVNEWIVTEKLGDALKNKAITSFAERTRLRFTERFHFLEIGVGV  490

Query  406   YMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             Y+ FCG Y++ FG N+Y+++L++Q V+F ++GFGY+G FV
Sbjct  491   YLCFCGCYDVAFGKNHYFLFLYVQAVAFFIMGFGYVGIFV  530



>ref|XP_011044347.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Populus 
euphratica]
Length=537

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/535 (59%), Positives = 420/535 (79%), Gaps = 8/535 (1%)
 Frame = -1

Query  1873  SAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYL  1694
             S  +M       + +   IA  L ++W   KA +IVP+L + VY+CL M +M+ ME+VY+
Sbjct  5     SPKVMIPESFQFQVSSSDIAGQLTLIWELIKAPLIVPLLTLGVYICLAMSLMLFMERVYM  64

Query  1693  GAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAAC  1514
             G V   +KLF + P K+YKWEP+  +DD E GN  +P VLVQIPM NE+ VY+LSIGAA 
Sbjct  65    GIVIILVKLFWKKPDKRYKWEPM--QDDLESGNLNFPVVLVQIPMFNEREVYKLSIGAAS  122

Query  1513  NLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGM  1334
             NLSWP +R++IQVLDDSTDP +K +V+ EC+RWA KG+NI+Y+ R+NR G+K+G+LK+G+
Sbjct  123   NLSWPADRLVIQVLDDSTDPAIKQMVELECQRWASKGINIRYQIRENRTGYKSGALKEGL  182

Query  1333  KHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQE  1154
             K SYVK CEYV IFDADF+P+PD+L R IPFL+HNPDI LVQ RW++VNA+EC+LTR+QE
Sbjct  183   KRSYVKHCEYVCIFDADFQPEPDYLRRAIPFLIHNPDIALVQGRWRFVNADECLLTRMQE  242

Query  1153  MSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKG  974
             MS+D HF+VEQEVGSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+G
Sbjct  243   MSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRG  302

Query  973   WKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIY  794
             WKF++LGD++VKSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK Y+IY
Sbjct  303   WKFLYLGDLQVKSELPSTFKAFRFQQHRWSCGPANLFRKMAMEIVRNKKVRFWKKFYVIY  362

Query  793   AFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMT  614
             +FFFV KI+AH++TF +YC+VLP T+L+PE+K+P+WGA+Y+P++  +L  +  PRS+H+ 
Sbjct  363   SFFFVRKIIAHMVTFSFYCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLL  422

Query  613   AFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT--KTAQPKSAK-KVP---RF  452
              +W+LFENVM+LHRT  TFIGLLE GR +EWVVTEK GNT  K A+ K +  K P   RF
Sbjct  423   FYWILFENVMSLHRTKATFIGLLEAGRANEWVVTEKLGNTLQKAAEAKKSNLKAPRKFRF  482

Query  451   RLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             +  +RL+  E+    ++  CG Y+   G N Y++YL+LQ V+F + G GY+G  +
Sbjct  483   KFTDRLNTLELGFSAFLFLCGCYDFANGKNNYFIYLWLQTVTFFITGIGYVGTII  537



>gb|AFZ78579.1| cellulose synthase-like protein [Populus tomentosa]
Length=540

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/538 (59%), Positives = 421/538 (78%), Gaps = 8/538 (1%)
 Frame = -1

Query  1873  SAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYL  1694
             S  IM       + +   I+  L ++W   KA +IVP+L + VY+ L M +M+ ME+VY+
Sbjct  5     SQKIMIPESFQFQVSSYDISDQLKLIWELIKAPLIVPLLTLGVYISLAMSLMLFMERVYM  64

Query  1693  GAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAAC  1514
             G V   +KLF + P K+YKWEP+  +DD E GN  +P VLVQIPM NEK VY+LSIGAA 
Sbjct  65    GIVIILVKLFWKKPEKRYKWEPM--QDDIESGNLNFPVVLVQIPMFNEKEVYKLSIGAAS  122

Query  1513  NLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGM  1334
             NLSWP +R++IQVLDDSTDP +K +V+ EC+RWA KG++I+Y+ R+NR G+KAG+LK+G+
Sbjct  123   NLSWPADRLVIQVLDDSTDPAIKQMVELECQRWASKGIDIRYQIRENRTGYKAGALKEGL  182

Query  1333  KHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQE  1154
             K SYVK CEYV IFDADF+P+PDFL R IPFLVHNPD+ LVQARW++VNA+EC+LTR+QE
Sbjct  183   KRSYVKHCEYVCIFDADFQPEPDFLRRAIPFLVHNPDVALVQARWRFVNADECLLTRMQE  242

Query  1153  MSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKG  974
             MS+D HF+VEQEVGSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+G
Sbjct  243   MSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRG  302

Query  973   WKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIY  794
             WKFV+LGD+ VKSELPS+F+A+R+QQHRWSCGPANLF+KM  EI+RNK+V  WKK+Y+IY
Sbjct  303   WKFVYLGDLHVKSELPSTFQAFRFQQHRWSCGPANLFRKMVMEIVRNKRVKFWKKVYVIY  362

Query  793   AFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMT  614
             +FFFV KI+AH++TF +YC+VLP T+L+PE+K+P+WGA+Y+P++  +L  +  PRS+H+ 
Sbjct  363   SFFFVRKIIAHMVTFCFYCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLL  422

Query  613   AFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT--KTAQPKSAK-KVP---RF  452
              +W+LFENVM+LHRT  T IGLLE GR++EWVVTEK GNT  K A  + A  K P   RF
Sbjct  423   FYWILFENVMSLHRTKATLIGLLEAGRVNEWVVTEKLGNTLQKAADARKANTKAPRKFRF  482

Query  451   RLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             +  ERL+  E+    ++  CG Y+ + G N Y++YL+LQ V+F + G GY+G    +S
Sbjct  483   KFTERLNTLELGFAAFLFLCGCYDFVNGKNNYFIYLWLQTVTFFITGIGYVGTIFPSS  540



>ref|XP_011089999.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Sesamum 
indicum]
Length=536

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/523 (60%), Positives = 410/523 (78%), Gaps = 6/523 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G    IA  LG+LW   +  +I P+LRV VY+CL M IM+ ME++Y+G V   +KLF + 
Sbjct  16    GYTADIAGQLGLLWELIRVPLIAPLLRVCVYICLAMSIMVFMERLYMGVVIVLVKLFWKK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YKWEP+K  DD E+G++ +P VLVQIPM NEK VY++SIGAACNLSWP +R++IQV
Sbjct  76    PEKRYKWEPMK--DDLEMGSAAFPMVLVQIPMFNEKEVYKISIGAACNLSWPADRLVIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTD  +K +V++EC RWA KG+NI+Y+ R+ R G+KAG+LK+G+KH YVK CEYV I
Sbjct  134   LDDSTDLVIKDMVEKECIRWASKGINIRYQIRETRGGYKAGALKEGLKHDYVKECEYVVI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF P+PDFL R +PFL+HN DI LVQARW++VNA+EC+LTR+QEMS+D HF+VEQEV
Sbjct  194   FDADFRPEPDFLRRAVPFLIHNRDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GSA HAFFGFNGT GIWRIAA+++AGGWKDRTTVEDMDL  RAGLKGWKFV+LGD++VKS
Sbjct  254   GSATHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFVYLGDLQVKS  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKA+R+QQHRWSCGPANLF+KM  +I  NKKV+++KK Y+IY+FFFV K++AH+ 
Sbjct  314   ELPSTFKAFRFQQHRWSCGPANLFRKMVMDIATNKKVSLYKKFYVIYSFFFVRKLIAHMF  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF +YC+VLP ++L+PE+ +P WGA+Y+P +   L  +  PRS H+  +W+LFENVM+ H
Sbjct  374   TFFFYCVVLPLSILVPEVDVPKWGAIYIPCIITTLNSVGTPRSFHLLFYWVLFENVMSFH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFR----LGERLHLWEIIVGF  407
             RT  TFIGLLE  R++EWVVTEK G+T   +  S    PR      LG+R+ L E+    
Sbjct  434   RTKATFIGLLEAKRVNEWVVTEKLGDTLKNKSHSKSAAPRRSLSKFLGDRIQLQELGFAL  493

Query  406   YMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             ++  CG Y+ ++G N Y++YLFLQ ++F + GFGYIG  V +S
Sbjct  494   FLFICGCYDFLYGKNNYFIYLFLQVITFTIAGFGYIGTIVPSS  536



>ref|XP_009590983.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=526

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/526 (60%), Positives = 419/526 (80%), Gaps = 3/526 (1%)
 Frame = -1

Query  1852  SEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYL  1673
             +E+  +     IA  +G++W   KA ++VP+LR  VY+CLVM +M+ +E++Y+G V   +
Sbjct  2     AESTFQATASDIAGQIGMMWEVLKAPLLVPLLRAAVYICLVMELMLFIERLYMGIVIIIV  61

Query  1672  KLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTN  1493
             KLF + P K+YKWEP+  +DD EIG++ +P VLVQIPM NE+ VY++SIGAACNLSWP++
Sbjct  62    KLFMKKPDKRYKWEPMA-DDDLEIGSADFPKVLVQIPMFNEREVYKISIGAACNLSWPSD  120

Query  1492  RIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKS  1313
             R++IQVLDDSTDP +K +V+ EC RWA KG+NI Y+ R++R G+KAG+LK+G+KH+YVK 
Sbjct  121   RLVIQVLDDSTDPIIKDMVETECLRWASKGLNITYQIRESRGGYKAGALKEGLKHNYVKD  180

Query  1312  CEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHF  1133
             CEYV IFDADF P+PDFL R+IPFLVHN +I LVQ RW++VNANEC+LTR+QEMS+D HF
Sbjct  181   CEYVVIFDADFRPEPDFLRRSIPFLVHNREIALVQGRWRFVNANECLLTRMQEMSLDYHF  240

Query  1132  SVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLG  953
             +VEQEVGS+ HAFFGFNGT GIWRIAA+++AGGWKDRTTVEDMDL  RA LKGWKFV+LG
Sbjct  241   TVEQEVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLG  300

Query  952   DVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNK  773
             D++VKSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNK+V  WKK Y+IY+FFFV K
Sbjct  301   DLQVKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNFWKKFYVIYSFFFVRK  360

Query  772   IVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFE  593
             I+AH++TF ++C+VLP T+L+PE+++PLWGA+Y+P +   L  +  PRS+H+  +W+LFE
Sbjct  361   IIAHMVTFFFFCVVLPLTLLVPEVEVPLWGAIYIPCIITTLNSVGTPRSIHLLFYWILFE  420

Query  592   NVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKS--AKKVPRFRLGERLHLWEI  419
             NVMA HRT  TFIGLLE  R +EWVVTEK G+T   + KS  AKK      G+R+   E+
Sbjct  421   NVMAFHRTKATFIGLLEAKRANEWVVTEKLGDTLKNKEKSKPAKKARGPLFGDRILPQEL  480

Query  418   IVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
                 ++ FCG Y++++G   Y++Y+FLQ ++F + GFGY+G  V +
Sbjct  481   GFAVFLFFCGLYDVLYGKRVYFIYVFLQVITFTIAGFGYVGTIVPS  526



>ref|NP_850952.1| putative mannan synthase 3 [Arabidopsis thaliana]
 ref|NP_173762.4| putative mannan synthase 3 [Arabidopsis thaliana]
 sp|Q9LQC9.1|CSLA3_ARATH RecName: Full=Probable mannan synthase 3; AltName: Full=Cellulose 
synthase-like protein A3; Short=AtCslA3 [Arabidopsis thaliana]
 gb|AAF79586.1|AC007945_6 F28C11.11 [Arabidopsis thaliana]
 gb|AAM20620.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15522.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30391.1| putative mannan synthase 3 [Arabidopsis thaliana]
 gb|AEE30392.1| putative mannan synthase 3 [Arabidopsis thaliana]
 gb|AHL38929.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=556

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/507 (63%), Positives = 399/507 (79%), Gaps = 2/507 (0%)
 Frame = -1

Query  1798  LWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKK  1619
             +W Q +  V +P+L+ +V +CLVM +++ +E+VY+  V  ++KL RRTP K +KWEPI  
Sbjct  50    IWKQTRIFVFIPILKCLVTICLVMSLLLFIERVYMSIVVVFVKLLRRTPEKVHKWEPIN-  108

Query  1618  EDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKAL  1439
             +DD E+ N+ YP VL+QIPM NEK V QLSIGAAC LSWP +R+I+QVLDDSTDP  K L
Sbjct  109   DDDLELANTNYPMVLIQIPMYNEKEVCQLSIGAACRLSWPLDRMIVQVLDDSTDPASKEL  168

Query  1438  VQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFL  1259
             V  EC +WA KG+NI  E RDNR G+KAG+LK GM H+YVK CE+VAIFDADF+PDPDFL
Sbjct  169   VNAECDKWARKGINIMSEIRDNRIGYKAGALKAGMMHNYVKQCEFVAIFDADFQPDPDFL  228

Query  1258  YRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNG  1079
              RTIPFL+HN +I LVQ RWK+VNANEC++TR+QEMS++ HF  EQE GS+IHAFFGFNG
Sbjct  229   ERTIPFLIHNHEISLVQCRWKFVNANECLMTRMQEMSLNYHFVAEQESGSSIHAFFGFNG  288

Query  1078  TAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQ  899
             TAG+WRIAAL++AGGWKDRTTVEDMDL  RA L GWKFV++ DV VK+ELPS+FKAYR+Q
Sbjct  289   TAGVWRIAALNEAGGWKDRTTVEDMDLAVRACLHGWKFVYVHDVEVKNELPSTFKAYRFQ  348

Query  898   QHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPAT  719
             QHRWSCGPANL++KMT EI++NKKV+ WKKLYLIY FFF+ KIV H+ TF++YCL+LP T
Sbjct  349   QHRWSCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPTT  408

Query  718   VLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEV  539
             VL PEL++P W  +Y PT   +L  +  PRSLH+  FW+LFENVM++HRT  TFIGLLE 
Sbjct  409   VLFPELQVPKWATVYFPTTITILNAIATPRSLHLLVFWILFENVMSMHRTKATFIGLLEA  468

Query  538   GRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDN  362
             GR++EWVVTEK G+T K+     A      R G+RL+  E++VG Y+ FCG Y+  +G +
Sbjct  469   GRVNEWVVTEKLGDTLKSKLIGKATTKLYTRFGQRLNWRELVVGLYIFFCGCYDFAYGGS  528

Query  361   YYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             Y+YVYLFLQ  +F V G GYIG FV T
Sbjct  529   YFYVYLFLQSCAFFVAGVGYIGTFVPT  555



>gb|ACV71015.1| UPA15 [Capsicum annuum]
Length=528

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/525 (59%), Positives = 418/525 (80%), Gaps = 4/525 (1%)
 Frame = -1

Query  1846  AAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKL  1667
             + V+     I   +G++W   KA ++VP+L+V VY+C+VM +M+ +E++Y+G V   +K+
Sbjct  5     STVQATIGDIGGQIGMMWEVLKAPLLVPMLKVAVYICIVMELMLFIERLYMGIVIILVKV  64

Query  1666  FRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRI  1487
             F + P K+YKWEP+  +DD EIG+ G+P VLVQIPM NEK VY++SIGAACNLSWP++R+
Sbjct  65    FMKKPDKRYKWEPMD-DDDLEIGSGGFPKVLVQIPMFNEKEVYKISIGAACNLSWPSDRL  123

Query  1486  IIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCE  1307
             +IQVLDDSTDP VK +V+ EC RWA KG+NI Y+ R+ R G+KAG+LK+G+KH+YVK CE
Sbjct  124   VIQVLDDSTDPIVKDMVETECLRWASKGLNITYQIRETRGGYKAGALKEGLKHNYVKDCE  183

Query  1306  YVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSV  1127
             YV IFDADF P+PDFL R+IPFL+HNP I LVQ RW++VNANEC+LTR+QEMS+D HF+V
Sbjct  184   YVVIFDADFRPEPDFLRRSIPFLIHNPKIALVQGRWRFVNANECLLTRMQEMSLDYHFTV  243

Query  1126  EQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDV  947
             EQEVGS+ HAFFGFNGT GIWRIAA+D+AGGWKDRTTVEDMDL  RA LKGWKFV+LGD+
Sbjct  244   EQEVGSSTHAFFGFNGTGGIWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDL  303

Query  946   RVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIV  767
             +VKSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNK+V +WKK Y+IY+FFFV KI+
Sbjct  304   QVKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNVWKKFYVIYSFFFVRKII  363

Query  766   AHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENV  587
             AH++TF ++C+VLP T+L+PE+++P+W A+Y+P +   L  +  PRS+H+  +W+LFENV
Sbjct  364   AHMVTFFFFCVVLPLTLLVPEVEVPIWAAIYIPCIITTLNSVGTPRSIHLLFYWILFENV  423

Query  586   MALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFR---LGERLHLWEII  416
             MA HRT  TFIGLLE  R +EWVVTEK G+    + K+AK V + R    G+R+   E+ 
Sbjct  424   MAYHRTKATFIGLLEAKRANEWVVTEKLGDALKNKDKAAKPVKKARGPLFGDRILPQELG  483

Query  415   VGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
                ++ FCG Y++++G   Y+VY+FLQ ++F + GFGY+G  V +
Sbjct  484   FAVFLFFCGLYDVLYGKRQYFVYVFLQVITFTIAGFGYVGTIVPS  528



>ref|XP_006400777.1| hypothetical protein EUTSA_v10013221mg [Eutrema salsugineum]
 gb|ESQ42230.1| hypothetical protein EUTSA_v10013221mg [Eutrema salsugineum]
Length=532

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/538 (59%), Positives = 426/538 (79%), Gaps = 9/538 (2%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MDG S      F       G    +   LG++W   KA VIVP+L++ VY+CL+M +M+L
Sbjct  1     MDGVSPK----FVLPETFDGVRMEMTGQLGMIWELVKAPVIVPLLQLAVYICLIMSVMLL  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
              E+VY+G V   +KLF + P K+YK+EPI   DD E+G+S +P VLVQIPM NE+ VY+L
Sbjct  57    CERVYMGIVIVLVKLFWKKPDKRYKFEPI--HDDEELGSSNFPVVLVQIPMFNEREVYKL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++R++IQVLDDSTDP VK +V+ EC+RWA KG+NI+Y+ R+NR G+KAG
Sbjct  115   SIGAACGLSWPSDRLVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+G+K SYVK CEYV IFDADF+P+PDFL R+IPFL+HN +I LVQARW++VN+NEC+
Sbjct  175   ALKEGLKRSYVKHCEYVVIFDADFQPEPDFLRRSIPFLIHNSNIALVQARWRFVNSNECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             LTR+QEMS+D HF+VEQEVGS+ HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  
Sbjct  235   LTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA L+GWKF++LGD++VKSELPS+F+A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WK
Sbjct  295   RASLRGWKFLYLGDLQVKSELPSTFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+Y+IY+FFFV KI+AH +TF +YC+VLP T+L+PE+K+P+WG++Y+P++  +L  +  P
Sbjct  355   KVYVIYSFFFVRKIIAHWVTFCFYCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ--PKSAKKVP  458
             RS+H+  +W+LFENVM+LHRT  T IGL E GR +EWVVT K G+ ++A+   K  KK P
Sbjct  415   RSIHLLFYWILFENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGLKKFP  474

Query  457   R-FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             R F+L +RL+  E+    ++  CG Y+ + G N Y++YLFLQ +SF + G G+IG +V
Sbjct  475   RIFKLPDRLNTLELGFAAFLFVCGCYDFVHGKNNYFIYLFLQTMSFFISGLGWIGTYV  532



>ref|XP_003551076.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
 gb|KHN21460.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=533

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/523 (59%), Positives = 418/523 (80%), Gaps = 6/523 (1%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
              ++G  + +   + +LW   K  +IVP+L++ VY+CL M +M+ ME++Y+G V   +KLF
Sbjct  13    TIQGVSEHVTGQIELLWELVKVPLIVPLLKLGVYICLAMSLMLFMERLYMGIVIILVKLF  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              + P ++Y ++P+  +DD E+G+  +PTVL+QIPM NEK VY++SIGAAC LSWP++R++
Sbjct  73    WKKPEQRYNYKPL--QDDVELGSFIFPTVLIQIPMFNEKEVYKVSIGAACGLSWPSDRLV  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTD  +K +V+QEC RWA KG+NI Y+ R+NR G+KAG+LK+G+K SYV+ CEY
Sbjct  131   IQVLDDSTDTVIKEMVEQECLRWASKGINITYQIRENRTGYKAGALKEGLKRSYVEHCEY  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF P+PDFL R IPFLV NP+I LVQARW++VNANEC+LTR+QEMS+D HF+VE
Sbjct  191   VAIFDADFRPEPDFLRRAIPFLVGNPEIALVQARWRFVNANECLLTRMQEMSLDYHFTVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGSA HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++
Sbjct  251   QEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQ  310

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
              KSELPS+ +A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+A
Sbjct  311   AKSELPSTLRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVKFWKKVYVIYSFFFVRKIIA  370

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TF +YC+VLP T+L+PE+++P+WGA+Y+P++   L  +  PRS+H+  +W+LFEN M
Sbjct  371   HMVTFFFYCVVLPLTILVPEVRVPIWGAVYIPSIITTLNSVGTPRSIHLLFYWILFENAM  430

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKS----AKKVPRFRLGERLHLWEII  416
             +LHRT  TFIGLLE GR +EWVVTEK G++   + KS    A +  RF+ GERLHL E+ 
Sbjct  431   SLHRTKATFIGLLEAGRANEWVVTEKLGDSVNNKNKSNVTKAIRKSRFKFGERLHLLELG  490

Query  415   VGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
                ++  CG Y+ + G N Y++YLFLQ ++F ++GFGY+G  V
Sbjct  491   FAAFLFLCGCYDYVHGKNNYFLYLFLQTITFSIVGFGYVGTIV  533



>ref|NP_197666.1| glucomannan 4-beta-mannosyltransferase 2 [Arabidopsis thaliana]
 sp|Q9FNI7.1|CSLA2_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 2; AltName: 
Full=Cellulose synthase-like protein A2; Short=AtCslA2; 
AltName: Full=Glucomannan synthase; AltName: Full=Mannan synthase 
2 [Arabidopsis thaliana]
 dbj|BAB11680.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL25573.1| AT5g22740/MDJ22_16 [Arabidopsis thaliana]
 gb|AAL24334.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM13292.1| glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AED93069.1| glucomannan 4-beta-mannosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38612.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=534

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/540 (59%), Positives = 428/540 (79%), Gaps = 9/540 (2%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MDG S      F       G    I   LG++W   KA VIVP+L++ VY+CL+M +M+L
Sbjct  1     MDGVSPK----FVLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSVMLL  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
              E+VY+G V   +KLF + P K+YK+EPI   DD E+G+S +P VLVQIPM NE+ VY+L
Sbjct  57    CERVYMGIVIVLVKLFWKKPDKRYKFEPI--HDDEELGSSNFPVVLVQIPMFNEREVYKL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++R++IQVLDDSTDP VK +V+ EC+RWA KG+NI+Y+ R+NR G+KAG
Sbjct  115   SIGAACGLSWPSDRLVIQVLDDSTDPTVKQMVEVECQRWASKGINIRYQIRENRVGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+G+K SYVK CEYV IFDADF+P+PDFL R+IPFL+HNP+I LVQARW++VN++EC+
Sbjct  175   ALKEGLKRSYVKHCEYVVIFDADFQPEPDFLRRSIPFLMHNPNIALVQARWRFVNSDECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             LTR+QEMS+D HF+VEQEVGS+ HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  
Sbjct  235   LTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA L+GWKF++LGD++VKSELPS+F+A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WK
Sbjct  295   RASLRGWKFLYLGDLQVKSELPSTFRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+Y+IY+FFFV KI+AH +TF +YC+VLP T+L+PE+K+P+WG++Y+P++  +L  +  P
Sbjct  355   KVYVIYSFFFVRKIIAHWVTFCFYCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ--PKSAKKVP  458
             RS+H+  +W+LFENVM+LHRT  T IGL E GR +EWVVT K G+ ++A+   K  K+ P
Sbjct  415   RSIHLLFYWILFENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGIKRFP  474

Query  457   R-FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             R F+L +RL+  E+    ++  CG Y+ + G N Y++YLFLQ +SF + G G+IG +V +
Sbjct  475   RIFKLPDRLNTLELGFAAFLFVCGCYDFVHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  534



>ref|XP_010535659.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Tarenaya 
hassleriana]
Length=532

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/520 (61%), Positives = 416/520 (80%), Gaps = 6/520 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G    I   +G++W   KA VIVP+LR+ VYLCL M +M+LME++Y+G V   +KLF + 
Sbjct  15    GVRSEITGQIGMIWELVKAPVIVPLLRLAVYLCLAMSLMLLMERLYMGIVIILVKLFWKK  74

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YK+EPI  +DD E G+S +P VLVQIPM NE+ VY+LSIGAAC LSWP++R++IQV
Sbjct  75    PDKRYKFEPI--QDDEEFGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDRLVIQV  132

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP VK +V+ EC+RWA KGVNI Y+ R+ R G+KAG+LK+G+K SYVK CEYV I
Sbjct  133   LDDSTDPTVKHMVEMECQRWASKGVNIVYQIRETRGGYKAGALKEGLKRSYVKHCEYVVI  192

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P PDFL R+IPFL+HN DI LVQARW++VNA+EC+LTR+QEMS+D HF VEQEV
Sbjct  193   FDADFQPKPDFLRRSIPFLIHNSDIALVQARWRFVNADECLLTRMQEMSLDYHFKVEQEV  252

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++VKS
Sbjct  253   GSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKS  312

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKA+R+QQHRWSCGPANLFKKM  EI+ NKKV  WKK+Y+IY+FFFV KI+AH +
Sbjct  313   ELPSTFKAFRFQQHRWSCGPANLFKKMVMEIISNKKVRFWKKVYVIYSFFFVRKIIAHWV  372

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF +YC+VLP T+L+PE+++P+WG++Y+P++  +L  +  PRS+H+  +W+LFENVM+LH
Sbjct  373   TFCFYCVVLPLTILVPEVEVPMWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLH  432

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPR----FRLGERLHLWEIIVGF  407
             RT  T IGLL+ GR +EWVVT K G+  +A+  +AK V +    F+L +RL+  E+    
Sbjct  433   RTKATLIGLLDAGRANEWVVTAKLGSGVSAKVSNAKGVKKLTRFFKLPDRLNTLELGFAA  492

Query  406   YMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             ++  CG Y+ + G N YYVYLFLQ  SF + GFG++G +V
Sbjct  493   FLFVCGCYDFVHGKNSYYVYLFLQTASFFITGFGWVGTYV  532



>ref|XP_002874083.1| hypothetical protein ARALYDRAFT_489123 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50342.1| hypothetical protein ARALYDRAFT_489123 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/521 (60%), Positives = 423/521 (81%), Gaps = 5/521 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G    I   LG++W   KA VIVP+L++ VY+CL+M +M+L E+VY+G V   +KLF + 
Sbjct  16    GVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSVMLLCERVYMGIVIVLVKLFWKK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YK+EPI   DD E+G+S +P VLVQIPM NE+ VY+LSIGAAC LSWP++R++IQV
Sbjct  76    PDKRYKFEPI--HDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDRLVIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP VK +V+ EC+RWA KG+NI+Y+ R+NR G+KAG+LK+G+K SYVK CEYV I
Sbjct  134   LDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHCEYVVI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL R+IPFL+HNP+I LVQARW++VN++EC+LTR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLRRSIPFLMHNPNIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++VKS
Sbjct  254   GSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKS  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+F+A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+AH +
Sbjct  314   ELPSTFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKIIAHWV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF +YC+VLP T+L+PE+K+P+WG++Y+P++  +L  +  PRS+H+  +W+LFENVM+LH
Sbjct  374   TFCFYCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ--PKSAKKVPR-FRLGERLHLWEIIVGFY  404
             RT  T IGL E GR +EWVVT K G+ ++A+   K  K+ PR F+L +RL+  E+    +
Sbjct  434   RTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGLKRFPRIFKLPDRLNTLELGFAAF  493

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             +  CG Y+ + G N Y++YLFLQ +SF + G G+IG +V +
Sbjct  494   LFVCGCYDFVHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  534



>ref|XP_002890585.1| hypothetical protein ARALYDRAFT_889889 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66844.1| hypothetical protein ARALYDRAFT_889889 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/530 (61%), Positives = 410/530 (77%), Gaps = 5/530 (1%)
 Frame = -1

Query  1870  AAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLG  1691
             AA+  +++  VR     I   +  +W Q +  V +P+L+ +V +CLVM +++ +E+VY+ 
Sbjct  29    AALSDTTDDVVRSG---IIGEIIYIWKQTRIFVFIPILKCLVTICLVMSLLLFIERVYMS  85

Query  1690  AVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACN  1511
              V  ++KL RRTP K +KWE I  +DD E+ N+ YP VL+QIPM NEK V QLSIGAAC 
Sbjct  86    IVVVFVKLLRRTPEKVHKWEAIN-DDDLELANTNYPMVLIQIPMYNEKEVCQLSIGAACR  144

Query  1510  LSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMK  1331
             LSWP +R+IIQVLDDSTDP  K LV  EC +WA KG+NI  E RDNR G+KAG+LK GM 
Sbjct  145   LSWPLDRMIIQVLDDSTDPASKELVNAECDKWARKGINIMSEIRDNRIGYKAGALKAGMM  204

Query  1330  HSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEM  1151
             H+YVK CE+VAIFDADF+PDPDFL RTIPFL+HN +I LVQ RWK+VNANEC++TR+QEM
Sbjct  205   HNYVKQCEFVAIFDADFQPDPDFLERTIPFLIHNHEISLVQCRWKFVNANECLMTRMQEM  264

Query  1150  SMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGW  971
             S++ HF  EQE GS+IHAFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA L GW
Sbjct  265   SLNYHFVAEQESGSSIHAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRACLHGW  324

Query  970   KFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYA  791
             KFV++ DV VK+ELPS+FKAYR+QQHRWSCGPANL++KMT EI++NKKV+ WKKLYLIY 
Sbjct  325   KFVYVHDVEVKNELPSTFKAYRFQQHRWSCGPANLWRKMTMEILQNKKVSAWKKLYLIYN  384

Query  790   FFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTA  611
             FFF+ KIV H+ TF++YCL+LP TVL PEL++P W  +Y PT   +L  +  PRSLH+  
Sbjct  385   FFFIRKIVVHIFTFVFYCLILPTTVLFPELQVPKWATVYFPTTITILNAIATPRSLHLLV  444

Query  610   FWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLH  431
             FW+LFENVM++HRT  TFIGLLE GR++EWVVTEK G+T  ++  +  K+   R G+R++
Sbjct  445   FWILFENVMSMHRTKATFIGLLEAGRVNEWVVTEKLGDTLKSKLIATTKLYT-RFGQRIN  503

Query  430   LWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
               E++VG Y+ FCG Y+  +G +Y+YVYLFLQ  +F V G GYIG FV +
Sbjct  504   WRELVVGLYIFFCGCYDFAYGGSYFYVYLFLQSCAFFVAGVGYIGTFVPS  553



>ref|XP_007015961.1| Cellulose synthase-like A02 isoform 1 [Theobroma cacao]
 gb|EOY33580.1| Cellulose synthase-like A02 isoform 1 [Theobroma cacao]
Length=537

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/522 (60%), Positives = 417/522 (80%), Gaps = 12/522 (2%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             D I   +G++W   KA +IVP+L++ VY+CL+M +M+ ME+VY+G V   +KLF + P K
Sbjct  19    DDITGQIGLIWELIKAPLIVPLLQLGVYICLIMSLMLFMERVYMGIVIILVKLFWKKPEK  78

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +Y +E I  +DD E+G+S +P VLVQIPM NEK VY++SIGAAC LSWP++R++IQVLDD
Sbjct  79    RYNFELI--QDDVELGSSNFPVVLVQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDD  136

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP +K +V+QEC+RWA KG+NI Y+ R+NR G+KAG+LK+G+K SYVK CEYVAIFDA
Sbjct  137   STDPAIKLMVEQECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIFDA  196

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF P+PDFL R+IPFL  NPDI LVQARW++VNA+EC+LTR+QEMS+D HF+VEQEVGSA
Sbjct  197   DFRPEPDFLRRSIPFLARNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSA  256

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  R+ L+GWKFV+LGD++VKSELP
Sbjct  257   THAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRSSLRGWKFVYLGDLQVKSELP  316

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKA+R+QQHRWSCGPANLF+KM +EI++NKKV  WKK+Y+IY+FFFV KI+AH++TF 
Sbjct  317   STFKAFRFQQHRWSCGPANLFRKMVWEIIQNKKVKFWKKVYVIYSFFFVRKIIAHMVTFF  376

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+VLP T+L+PE+K+P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+LHRT 
Sbjct  377   FYCVVLPLTILVPEVKVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTK  436

Query  565   GTFIGLLEVGRIHEWVVTEKQG---------NTKTAQPKSAKKVPRFRLGERLHLWEIIV  413
              TFIGLLE GR +EWVVTEK G                K+ +K  RF+  +RL+  E+  
Sbjct  437   ATFIGLLEAGRANEWVVTEKLGDAVKKAADAAKNKTNAKAPRKF-RFKFTDRLNTLELGF  495

Query  412   GFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
               ++  CG Y+ + G N Y+VYLFLQ ++F + G GY+G  +
Sbjct  496   AAFLFICGCYDFVHGKNNYFVYLFLQTITFFITGIGYVGTII  537



>ref|XP_004241301.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum 
lycopersicum]
Length=533

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/521 (60%), Positives = 412/521 (79%), Gaps = 4/521 (1%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +G    IA  +G++W   KA +IVP+LR  VY+CL M +M+ +E++Y+G V   +KLF +
Sbjct  15    QGTAADIAGQIGLMWELIKAPLIVPLLRAAVYICLAMELMLFIERLYMGIVIVLVKLFMK  74

Query  1657  TPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQ  1478
              P K+Y WEP++  DD EIGN G+P VLVQIPM NEK VY++SIGAACNLSWP +R++IQ
Sbjct  75    KPDKRYNWEPMR--DDLEIGNEGFPMVLVQIPMFNEKEVYKISIGAACNLSWPADRLVIQ  132

Query  1477  VLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVA  1298
             VLDDSTDP +K LV++EC RWA KG+NI+Y+ R+NR G+KAG+LK+G+K  YVK CEYV 
Sbjct  133   VLDDSTDPLIKDLVEKECLRWANKGINIRYQIRENRGGYKAGALKEGLKRDYVKDCEYVV  192

Query  1297  IFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQE  1118
             IFDADF P+PDFL R IPFLVHN +I LVQ RW++VNANEC+LTR+QEMS+D HF+VEQE
Sbjct  193   IFDADFRPEPDFLRRAIPFLVHNSEIALVQGRWRFVNANECLLTRMQEMSLDYHFTVEQE  252

Query  1117  VGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVK  938
             VGS+ HAFFGFNGT G+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKF++LGD++VK
Sbjct  253   VGSSTHAFFGFNGTGGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDLQVK  312

Query  937   SELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHV  758
             SELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNK+V IWKK Y+IY+FFFV KI+AH+
Sbjct  313   SELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNIWKKFYVIYSFFFVRKIIAHM  372

Query  757   LTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMAL  578
             +TF ++C+VLP ++L+PE++IP WGA+Y+P +   L  +  PRS+H+  +W+LFENVMA 
Sbjct  373   VTFFFFCVVLPLSLLVPEVEIPTWGAIYIPCIITTLNSVGTPRSIHLLFYWILFENVMAF  432

Query  577   HRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRL-GERLHLWEIIVGFY  404
              RT  TFIGLLE  R +EWVVTEK G+  K  +     K PR  L G+R+   E+    +
Sbjct  433   QRTKATFIGLLEAKRANEWVVTEKLGDALKNKEKTKQTKKPRGSLFGDRILPQELGFAVF  492

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             + FCG Y++++G + Y++Y+FLQ ++F + GFGYIG  V +
Sbjct  493   LFFCGCYDVLYGKSQYFLYIFLQVITFTIAGFGYIGTIVPS  533



>gb|KFK39910.1| hypothetical protein AALP_AA3G305000 [Arabis alpina]
Length=537

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/522 (60%), Positives = 420/522 (80%), Gaps = 6/522 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G    I   LG++W   KA VIVP+L+  VYLCL+M +M+L E+VY+G V   +KLF + 
Sbjct  18    GVRMEITGQLGMIWELVKAPVIVPLLQFAVYLCLIMSVMLLCERVYMGIVIVLVKLFWKK  77

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YK+EPI   DD E+G+S +P VLVQIPM NE+ VY+LSIGAAC L+WP++R++IQV
Sbjct  78    PNKRYKFEPI--HDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLAWPSDRLVIQV  135

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP VK +V+ EC+RWA KG+NI+Y+ R+NR G+KAG+LK+G+K SYVK CE+V I
Sbjct  136   LDDSTDPTVKQMVEVECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHCEFVVI  195

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL R+IPFL+HNP+I LVQARW++VN+NEC+LTR+QEMS+D HF+VEQEV
Sbjct  196   FDADFQPEPDFLRRSIPFLIHNPNIALVQARWRFVNSNECLLTRMQEMSLDYHFTVEQEV  255

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++VKS
Sbjct  256   GSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKS  315

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+F+A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+AH +
Sbjct  316   ELPSTFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKIIAHWV  375

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF +YC+VLP T+L+PE+K+P+WG++Y+P++  +L  +  PRS+H+  +W+LFENVM+LH
Sbjct  376   TFCFYCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLH  435

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKT---AQPKSAKKVPR-FRLGERLHLWEIIVGF  407
             RT  T IGL E GR +EWVVT K G+ +T      K  K+ PR F+L +RL+  E+    
Sbjct  436   RTKATLIGLFEAGRANEWVVTAKLGSGQTNAKGNTKGLKRFPRIFKLPDRLNTLELGFAA  495

Query  406   YMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             ++  CG Y+ + G N Y++YLFLQ +SF + G G+IG +V +
Sbjct  496   FLFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYVPS  537



>ref|XP_006287471.1| hypothetical protein CARUB_v10000683mg [Capsella rubella]
 gb|EOA20369.1| hypothetical protein CARUB_v10000683mg [Capsella rubella]
Length=533

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/538 (59%), Positives = 426/538 (79%), Gaps = 9/538 (2%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MDG S      F       G    I   LG++W   KA VIVP+L++ VY+CLVM +M+L
Sbjct  1     MDGVSPK----FVLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLVMSVMLL  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
              E+VY+G V   +KLF + P K+YK++PI   DD E+G+S +P VLVQIPM NE+ VY+L
Sbjct  57    CERVYMGIVIVLVKLFWKKPDKRYKFDPI--HDDEELGSSNFPVVLVQIPMFNEREVYKL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++R++IQVLDDSTDP VK +V+ EC+RWA KG+NI+Y+ R+NR G+KAG
Sbjct  115   SIGAACGLSWPSDRLVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+G+K SYVK CEYV IFDADF+P+PDFL R+IPFL+HNP+I LVQARW++VN++EC+
Sbjct  175   ALKEGLKRSYVKHCEYVVIFDADFQPEPDFLRRSIPFLIHNPNIALVQARWRFVNSDECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             LTR+QEMS+D HF+VEQEVGS+ HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  
Sbjct  235   LTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA L+GWKF++LGD++VKSELPS+F+A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WK
Sbjct  295   RASLRGWKFLYLGDLQVKSELPSTFRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+Y+IY+FFFV KI+AH +TF +YC+VLP T+L+PE+ +P+WG++Y+P++  +L  +  P
Sbjct  355   KVYVIYSFFFVRKIIAHWVTFCFYCVVLPLTILVPEVYVPIWGSVYIPSIITILNSVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ--PKSAKKVP  458
             RS+H+  +W+LFENVM+LHRT  T IGL E GR +EWVVT K G+ ++A+   K  K+ P
Sbjct  415   RSIHLLFYWILFENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGLKRFP  474

Query  457   R-FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             R F+L +RL+  E+    ++  CG Y+ + G N Y++YLFLQ +SF + G G+IG +V
Sbjct  475   RIFKLPDRLNTLELGFAAFLFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYV  532



>ref|XP_006347222.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum 
tuberosum]
Length=533

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/521 (60%), Positives = 413/521 (79%), Gaps = 4/521 (1%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +G    IA  +G++W   KA +IVP+LR  VY+CL M +M+ +E++Y+G V   +KLF +
Sbjct  15    QGTAADIAGQIGLMWELIKAPLIVPLLRAAVYICLAMELMLFIERLYMGIVIVLVKLFMK  74

Query  1657  TPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQ  1478
              P K+YKWEP++  DD EIGN G+P VLVQIPM NEK VY++SIGAACNLSWP++R+IIQ
Sbjct  75    KPDKRYKWEPMR--DDLEIGNEGFPMVLVQIPMFNEKEVYKISIGAACNLSWPSDRLIIQ  132

Query  1477  VLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVA  1298
             VLDDSTD  +K LV++EC RWA KG+NI+Y+ R+NR G+KAG+LK+G+K  YVK CEYV 
Sbjct  133   VLDDSTDHLIKDLVEKECLRWANKGINIRYQIRENRGGYKAGALKEGLKRDYVKDCEYVV  192

Query  1297  IFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQE  1118
             IFDADF P+PDFL R IPFLVHN +I LVQ RW++VNANEC+LTR+QEMS+D HF+VEQE
Sbjct  193   IFDADFRPEPDFLRRAIPFLVHNSEIALVQGRWRFVNANECLLTRMQEMSLDYHFTVEQE  252

Query  1117  VGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVK  938
             VGS+ HAFFGFNGT G+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKF++LGD++VK
Sbjct  253   VGSSTHAFFGFNGTGGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDLQVK  312

Query  937   SELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHV  758
             SELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNK+V IWKK Y+IY+FFFV KI+AH+
Sbjct  313   SELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNIWKKFYVIYSFFFVRKIIAHM  372

Query  757   LTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMAL  578
             +TF ++C+VLP ++L+PE++IP WGA+Y+P +   L  +  PRS+H+  +W+LFENVMA 
Sbjct  373   VTFFFFCVVLPLSLLVPEVEIPTWGAIYIPCIITTLNSVGTPRSIHLLFYWILFENVMAF  432

Query  577   HRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRL-GERLHLWEIIVGFY  404
              RT  TFIGLLE  R +EWVVTEK G+  K  +     K PR  L G+R+   E+    +
Sbjct  433   QRTKATFIGLLEAKRANEWVVTEKLGDALKNKEKTKQTKKPRGSLFGDRILPQELGFAVF  492

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             + FCG Y++++G + Y++Y+FLQ ++F + GFGYIG  V +
Sbjct  493   LFFCGCYDVLYGKSQYFLYIFLQVITFTIAGFGYIGTIVPS  533



>ref|XP_010089159.1| hypothetical protein L484_003290 [Morus notabilis]
 gb|EXB37420.1| hypothetical protein L484_003290 [Morus notabilis]
Length=541

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/529 (61%), Positives = 428/529 (81%), Gaps = 12/529 (2%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +  G  IA  +G++W   KA +IVP+LR+ VY+CL M +M+ ME++Y+G V   +KLF +
Sbjct  15    QNPGYDIASQIGLMWELIKAPLIVPLLRLGVYICLAMSLMLFMERLYMGIVIILVKLFWK  74

Query  1657  TPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQ  1478
              P K+YK+EPI  +DD E+G+S +P VL+QIPM NEK VY++SIGAAC LSWP++R++IQ
Sbjct  75    KPEKRYKFEPI--QDDVEMGSSNFPVVLIQIPMFNEKEVYKISIGAACGLSWPSDRLVIQ  132

Query  1477  VLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVA  1298
             VLDDSTDP +K +V+ EC+RWA KG+NI Y+ R+NR G+KAG+LK+G+K SYVK CEYVA
Sbjct  133   VLDDSTDPVIKQMVELECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVKHCEYVA  192

Query  1297  IFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQE  1118
             I DADF P+PDFL R+IPFLVHNPDI LVQARW++VN++EC+LTR+QEMS+D HF+VEQE
Sbjct  193   ILDADFRPEPDFLRRSIPFLVHNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQE  252

Query  1117  VGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVK  938
             VGSA HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  RA L+GWKFV+LG+++ K
Sbjct  253   VGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGELQAK  312

Query  937   SELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHV  758
             SELPS+FKA+R+QQHRWSCGPANLF+KM  EI++NKKV  WKK+Y+IY+FFFV KI+AH+
Sbjct  313   SELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVKNKKVKFWKKVYVIYSFFFVRKIIAHM  372

Query  757   LTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMAL  578
             +TFI+YC+VLP T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+L
Sbjct  373   VTFIFYCVVLPLTILVPEVHVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSL  432

Query  577   HRTIGTFIGLLEVGRIHEWVVTEKQGNT--KTAQPKSAK--------KVPRFRLGERLHL  428
             HRT  TFIGLLE GR +EWVVTEK G+T  K A+  +A         K PRF+ G+RLHL
Sbjct  433   HRTKATFIGLLEAGRANEWVVTEKLGDTLKKKAESDAANKKTPFKLFKKPRFKFGDRLHL  492

Query  427   WEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
              E+  G ++  CG Y+ + G N Y+VYLFLQ  +FL+ GFGY+G  + +
Sbjct  493   LELGFGVFLFLCGCYDFVHGKNNYFVYLFLQTFTFLICGFGYVGTIIPS  541



>emb|CBI40224.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/448 (69%), Positives = 380/448 (85%), Gaps = 1/448 (0%)
 Frame = -1

Query  1618  EDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKAL  1439
             +DD E+GNS YP VLVQIPM NEK VYQLSIGAAC LSWP+ RIIIQVLDDSTDP +K L
Sbjct  2     KDDVELGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSERIIIQVLDDSTDPTIKDL  61

Query  1438  VQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFL  1259
             V+ EC+RWA KG+NIKYE R NR G+KAG+LK+GMKHSYVK C+YVAIFDADF+P+PDFL
Sbjct  62    VEMECQRWASKGINIKYEIRGNRHGYKAGALKEGMKHSYVKQCDYVAIFDADFQPEPDFL  121

Query  1258  YRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNG  1079
             +RTIPFLVHNP+IGLVQARWK+VN++EC++TR+QEMS+D HF+VEQEVGS+ HAFFGFNG
Sbjct  122   WRTIPFLVHNPEIGLVQARWKFVNSDECLMTRMQEMSLDYHFTVEQEVGSSSHAFFGFNG  181

Query  1078  TAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQ  899
             TAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKFV++G ++VK+ELPS+FKAYRYQ
Sbjct  182   TAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGALKVKNELPSTFKAYRYQ  241

Query  898   QHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPAT  719
             QHRWSCGPANLFKKM  EI RNKKV +WKK+Y+IY+FFFV KIVAH++TF++YC+V PAT
Sbjct  242   QHRWSCGPANLFKKMAIEIARNKKVNLWKKVYVIYSFFFVRKIVAHIVTFLFYCVVFPAT  301

Query  718   VLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEV  539
             V  PE+++P+WGA+Y+P+   LL  +  PRSLH+  FW+LFENVM+LHRT  TF+GLLEV
Sbjct  302   VFFPEVEVPMWGAVYIPSTITLLNAVGTPRSLHLLVFWILFENVMSLHRTKATFMGLLEV  361

Query  538   GRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDN  362
             GR++EWVVTEK G+  K        K PR R+GER+HL E+ VG Y+ FCG Y++ +G N
Sbjct  362   GRVNEWVVTEKLGDALKMKSSTKTSKKPRIRIGERMHLLELGVGAYLFFCGCYDVTYGKN  421

Query  361   YYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              +++YLF Q ++F + GFGY+G FV  S
Sbjct  422   GFFIYLFFQSMAFFIAGFGYVGTFVPNS  449



>ref|XP_010031452.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW50751.1| hypothetical protein EUGRSUZ_J00420 [Eucalyptus grandis]
Length=527

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/513 (61%), Positives = 412/513 (80%), Gaps = 4/513 (1%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             + IA  LG++W   KA +IVPVLR+ VY+CL M +M+ ME+VY+G V   +KLF + P K
Sbjct  19    EDIAGQLGMVWELIKAPLIVPVLRLSVYVCLAMALMLFMERVYMGIVIVLVKLFWKKPEK  78

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +Y WEPI  E+D E G+S +P VLVQIPM NEK VY++SIGAAC LSWP +R++IQVLDD
Sbjct  79    RYNWEPI--EEDLESGSSNFPFVLVQIPMYNEKEVYKISIGAACGLSWPADRLVIQVLDD  136

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP +K +V+ EC+RWA KG+NI Y+ R+ R G+KAG+LK+G+K SYVK CE+VAIFDA
Sbjct  137   STDPVIKQMVELECQRWASKGINIVYQIRETRGGYKAGALKEGLKRSYVKHCEFVAIFDA  196

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF P+PD+L R IP+ + NPD+ LVQARW++VN+NEC+LTR+QEMS+D HF+VEQEVGSA
Sbjct  197   DFRPEPDYLKRAIPYFLRNPDLALVQARWRFVNSNECLLTRMQEMSLDYHFTVEQEVGSA  256

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              HAFFGFNGTAG+WRI A+++AGGWKDRTTVEDMDL  RA L+GWKFV+LGD++VKSELP
Sbjct  257   THAFFGFNGTAGVWRIGAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLQVKSELP  316

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKA+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+AH++TF 
Sbjct  317   STFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMVTFF  376

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+VLP T+ +PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM++HRT 
Sbjct  377   FYCVVLPLTIWVPEVHVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSMHRTK  436

Query  565   GTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGW  386
              TFIGLLE GR +EWVVTEK G+  T + KS K    F   +RLHL E+  G ++   G 
Sbjct  437   ATFIGLLEAGRANEWVVTEKLGD--TLKNKSKKLRFTFNFADRLHLLELGFGVFLFVTGC  494

Query  385   YNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             Y+ ++G N Y+VYL+LQ ++F + GFGYIG  V
Sbjct  495   YDFLYGKNNYFVYLWLQTITFFIAGFGYIGTIV  527



>ref|XP_006589371.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Glycine max]
Length=502

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/463 (68%), Positives = 388/463 (84%), Gaps = 3/463 (1%)
 Frame = -1

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
             R  P K+YKWEP++  DD E GNS YP VLVQIPM NEK VYQLSIGAAC LSWP++RII
Sbjct  42    RYKPEKKYKWEPLR--DDLEFGNSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRII  99

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTDP +K +V+ EC+RWA KGVNIKYE R NR G+KAG+LK+GMKHSYV  C+Y
Sbjct  100   IQVLDDSTDPIIKNMVEMECQRWASKGVNIKYEIRKNRNGYKAGALKEGMKHSYVNLCDY  159

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+P+FL+RTIPFL HNP++ LVQARWK+VNA+EC++TR+QEMS+D HF VE
Sbjct  160   VAIFDADFQPEPNFLWRTIPFLAHNPEVALVQARWKFVNADECLMTRMQEMSLDYHFLVE  219

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RAGLKG KFV+L D++
Sbjct  220   QEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRAGLKGGKFVYLSDLK  279

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VKSELPS+FKAYRYQQHRWSCGPANLFKKM  EIMRNKKV++WKKLY+IY+FFFV KIVA
Sbjct  280   VKSELPSTFKAYRYQQHRWSCGPANLFKKMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVA  339

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             HV+TF++YC+++PATVL PE+++P WGA+Y+P++  LL  +  PRS+H+  FW+LFENVM
Sbjct  340   HVVTFVFYCVIMPATVLFPEVEVPKWGAVYIPSIITLLNAVGTPRSIHLLVFWILFENVM  399

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGF  407
             ++HRT  T  GLLE GR++EWVVTEK G+  KT     A +  R R+GERLH  E++VG 
Sbjct  400   SMHRTKATLTGLLEAGRVNEWVVTEKLGDALKTKSGGKAARKSRIRIGERLHFLELLVGA  459

Query  406   YMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             Y+ FC  Y+L +G N+Y++YLFLQ ++F V G GY+G FV  S
Sbjct  460   YLFFCACYDLKYGKNHYFIYLFLQSMAFFVAGVGYVGTFVPNS  502



>gb|KHN48194.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=511

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/518 (63%), Positives = 421/518 (81%), Gaps = 13/518 (3%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             + +G  D I+  +G++W Q K  VIVP+LRV V+LCL M +M+L+E+VY+G V   +KLF
Sbjct  3     SFQGDRDDISYQMGLIWSQVKEPVIVPMLRVSVFLCLAMSLMMLVERVYMGIVICLVKLF  62

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              R P K+YKWEP+K  DD E+GNS YP VLVQ+PM NE+ VYQLSIGAAC LSWP++RII
Sbjct  63    GRRPEKRYKWEPMK--DDVELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRII  120

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDST+P +K LVQ EC RWA KGVNIKYE RDNR G+KAG+LK+GMK SYVK C+Y
Sbjct  121   IQVLDDSTNPTIKELVQMECSRWASKGVNIKYEVRDNRDGYKAGALKEGMKRSYVKQCDY  180

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+PDFL+RT+PFLV+NP++GLVQARWK+VNANEC++TR+QEMS+D HF+VE
Sbjct  181   VAIFDADFQPEPDFLWRTVPFLVNNPELGLVQARWKFVNANECLMTRMQEMSLDYHFTVE  240

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS  +AFFGFNGTAG+WRI+AL ++GGW  RTTVEDMDL  RA L+GWKF++L +++
Sbjct  241   QEVGSCTYAFFGFNGTAGVWRISALYESGGWNHRTTVEDMDLAVRASLRGWKFLYLPNLK  300

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+  AYR+QQHRWSCGPANLF KM  EIMRN+KV+++KK+Y+IY+FFFV K+VA
Sbjct  301   VKNELPSTLNAYRFQQHRWSCGPANLFMKMFMEIMRNRKVSLYKKIYVIYSFFFVRKVVA  360

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             HV TF++YC+VLPATV++PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+LFEN M
Sbjct  361   HVNTFMFYCIVLPATVVVPEVVVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENTM  420

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFY  404
             +LHRT  T IGLLE  R +EW+VT+     K   PKS     RFR+    H+ E++VGFY
Sbjct  421   SLHRTKATIIGLLEGSRANEWIVTQ-----KGKPPKS-----RFRIRIH-HMLELLVGFY  469

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAF  290
             + FCG Y+++FG N YY++L++Q ++F ++ FGY+G F
Sbjct  470   LFFCGCYDIMFGKNRYYIFLYIQSIAFFIMAFGYVGIF  507



>ref|XP_006307154.1| hypothetical protein CARUB_v10008745mg [Capsella rubella]
 gb|EOA40052.1| hypothetical protein CARUB_v10008745mg [Capsella rubella]
Length=555

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/507 (63%), Positives = 396/507 (78%), Gaps = 2/507 (0%)
 Frame = -1

Query  1798  LWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKK  1619
             +W Q +  V +P+L+ +V +CLVM  ++ +E+VY+  V  ++KL RRTP K +KWE IK 
Sbjct  49    IWKQTRIFVFIPILKCLVTICLVMSFLLFIERVYMSIVVVFVKLLRRTPEKVHKWEAIK-  107

Query  1618  EDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKAL  1439
             +DD E+ N+ YP VL+QIPM NEK V QLSIGAAC LSWP +R+I+QVLDDSTDP  K L
Sbjct  108   DDDLELANTNYPMVLIQIPMYNEKEVCQLSIGAACRLSWPLDRMIVQVLDDSTDPASKEL  167

Query  1438  VQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFL  1259
             V  EC +WA KG+NI  E RDNR G+KAG+LK GM H+YVK CE+VAIFDADF+PDPDFL
Sbjct  168   VNAECDKWARKGINIMSEIRDNRIGYKAGALKAGMMHNYVKQCEFVAIFDADFQPDPDFL  227

Query  1258  YRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNG  1079
              RTIPFL+HN +I LVQ RWK+VNANEC++TR+QEMS++ HF  EQE GS+IHAFFGFNG
Sbjct  228   ERTIPFLIHNHEISLVQCRWKFVNANECLMTRMQEMSLNYHFVAEQESGSSIHAFFGFNG  287

Query  1078  TAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQ  899
             TAG+WRIAAL++AGGWKDRTTVEDMDL  RA L GWKFV++ DV VK+ELPS+FKAYR+Q
Sbjct  288   TAGVWRIAALNEAGGWKDRTTVEDMDLAVRACLHGWKFVYVHDVEVKNELPSTFKAYRFQ  347

Query  898   QHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPAT  719
             QHRWSCGPANL++KMT EI++NKKV+ WKKLYLIY FFF+ KIV H+ TF++YCL+LP T
Sbjct  348   QHRWSCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPTT  407

Query  718   VLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEV  539
             VL PEL++P W  +Y PT   +L  +  PRS H+  FW+LFENVM++HRT  TFIGLLE 
Sbjct  408   VLFPELQVPKWATVYFPTTITILNAIATPRSFHLLVFWILFENVMSMHRTKATFIGLLEA  467

Query  538   GRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDN  362
             GR++EWVVTEK G+T K+     A      R G+RL+  E++VG Y+  CG Y+  +G +
Sbjct  468   GRVNEWVVTEKLGDTLKSKLIAKATTKLYTRFGQRLNWRELVVGLYIFLCGCYDFAYGGS  527

Query  361   YYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             Y+YVYLFLQ  +F V G GYIG FV T
Sbjct  528   YFYVYLFLQSCAFFVAGVGYIGTFVPT  554



>ref|XP_003542549.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
Length=511

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/518 (62%), Positives = 421/518 (81%), Gaps = 13/518 (3%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             + +G  D I+  +G++W Q K  VIVP+LRV V+LCL M +M+L+E+VY+G V   +KLF
Sbjct  3     SFQGDRDDISYQMGLIWSQVKEPVIVPMLRVAVFLCLAMSLMMLVERVYMGIVICLVKLF  62

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              R P K+YKWEP+K  DD E+GNS YP VLVQ+PM NE+ VYQLSIGAAC LSWP++RII
Sbjct  63    SRRPEKRYKWEPMK--DDVELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRII  120

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDST+P +K LVQ EC RWA KGVNIKYE RDNR G+KAG+LK+GMK SYVK C+Y
Sbjct  121   IQVLDDSTNPTIKELVQMECSRWASKGVNIKYEVRDNRDGYKAGALKEGMKRSYVKQCDY  180

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+PDFL+RT+PFLV+NP++GLVQARWK+VNANEC++TR+QEMS+D HF+VE
Sbjct  181   VAIFDADFQPEPDFLWRTVPFLVNNPELGLVQARWKFVNANECLMTRMQEMSLDYHFTVE  240

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS  +AFFGFNGTAG+WRI+AL ++GGW  RTTVEDMDL  RA L+GWKF++L +++
Sbjct  241   QEVGSCTYAFFGFNGTAGVWRISALYESGGWNHRTTVEDMDLAVRASLRGWKFLYLPNLK  300

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+  AYR+QQHRWSCGPANLF KM  EIMRN+KV+++KK+Y+IY+FFFV K+VA
Sbjct  301   VKNELPSTLNAYRFQQHRWSCGPANLFMKMFMEIMRNRKVSLYKKIYVIYSFFFVRKVVA  360

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H+ TF++YC+VLPATV++PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+LFEN M
Sbjct  361   HLNTFMFYCIVLPATVVVPEVVVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENTM  420

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFY  404
             +LHRT  T IGLLE  R +EW+VT+     K   PKS     RFR+    H+ E++VGFY
Sbjct  421   SLHRTKATIIGLLEGSRANEWIVTQ-----KGKPPKS-----RFRIRIH-HMLELLVGFY  469

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAF  290
             + FCG Y+++FG N YY++L++Q ++F ++ FGY+G F
Sbjct  470   LFFCGCYDIMFGKNRYYIFLYIQSIAFFIMAFGYVGIF  507



>gb|KEH43412.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=530

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/528 (62%), Positives = 413/528 (78%), Gaps = 2/528 (0%)
 Frame = -1

Query  1858  FSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSA  1679
              SS          I   +  +W QA+  +IVPVL+++V LCL M +M+ +E+VY+G V  
Sbjct  4     LSSTTRFESVHYGIVNQMNFIWQQARVPLIVPVLKLLVVLCLTMSVMLFVERVYMGIVIV  63

Query  1678  YLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWP  1499
             +LKLF   P K YKWE +K +DD E+GNS +P VLVQIPM NEK VYQLSIGAAC LSWP
Sbjct  64    FLKLFGHKPEKHYKWEALK-DDDIELGNSAFPMVLVQIPMYNEKEVYQLSIGAACGLSWP  122

Query  1498  TNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYV  1319
             ++RIIIQVLDDSTDP +K +V+ EC RW  KG+NIKYE R+NR G+KAG+LK+GMKHSYV
Sbjct  123   SDRIIIQVLDDSTDPIIKNMVEIECERWRRKGINIKYEIRENRNGYKAGALKEGMKHSYV  182

Query  1318  KSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDR  1139
             K C+YVAIFDADF+P+ +FLYRTIPFL  NP +GLVQARW++VNA+EC++TR+QEMS+D 
Sbjct  183   KLCDYVAIFDADFQPESNFLYRTIPFLDQNPQVGLVQARWQFVNADECLMTRMQEMSLDY  242

Query  1138  HFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVF  959
             HF VEQEVGS  HAFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKFV+
Sbjct  243   HFLVEQEVGSITHAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFVY  302

Query  958   LGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFV  779
             L D++VKSELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKVT+ KK Y+IY+FFFV
Sbjct  303   LSDLKVKSELPSTFKAYRYQQHRWSCGPANLFRKMAMEIIRNKKVTMLKKFYVIYSFFFV  362

Query  778   NKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWML  599
              KI+AHV+TF +YC++LPATVL+PE+++P WGA+Y+P +  LL  +  PRS H+   W+L
Sbjct  363   RKIIAHVVTFTFYCVILPATVLVPEVEVPKWGAVYIPCIITLLNAVGTPRSFHLVILWIL  422

Query  598   FENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWE  422
             FENVM++HRT  T IGL E GR++EWVVTEK G+  K      A + PR  +  R+H  E
Sbjct  423   FENVMSMHRTKATLIGLFEAGRVNEWVVTEKLGDALKIKSGGKAARKPRITIDGRIHFLE  482

Query  421   IIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             + VG Y+  CG Y+L FG N  Y+YLFLQ ++F V+G GY+G +V  S
Sbjct  483   LGVGAYLFLCGCYDLAFGKNQCYIYLFLQSIAFFVVGVGYVGIYVPRS  530



>ref|XP_003535285.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Glycine 
max]
Length=511

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/522 (62%), Positives = 422/522 (81%), Gaps = 13/522 (2%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             + +G+ D I+  +G++W Q K  VIVP+LRV V+LCL M +M+L+E+VY+G V   +KLF
Sbjct  3     SFQGSRDDISYQMGLIWSQVKEPVIVPMLRVSVFLCLAMSLMMLVERVYMGIVICLVKLF  62

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              R P K+YKWEP+K  DD E+GNS YP VLVQ+PM NE+ VYQLSIGAAC LSWP++RII
Sbjct  63    GRRPEKRYKWEPMK--DDVELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRII  120

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDST+P +K LVQ EC RWA KGVNIKYE RDNR G+KAG+LK+GMK +YVK C+Y
Sbjct  121   IQVLDDSTNPTIKELVQMECSRWASKGVNIKYEVRDNRDGYKAGALKEGMKRNYVKQCDY  180

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+PDPDFL+RT+PFLV+NP++ LVQARWK+VNANEC++TR+QEMS+D HF+VE
Sbjct  181   VAIFDADFQPDPDFLWRTVPFLVNNPELALVQARWKFVNANECLMTRMQEMSLDYHFTVE  240

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS  +AFFGFNGTAG+WRI+AL ++GGW  RTTVEDMDL  RA L+GWKF++L +++
Sbjct  241   QEVGSCTYAFFGFNGTAGVWRISALYESGGWNHRTTVEDMDLAVRASLRGWKFLYLPNLK  300

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+  AYR+QQHRWSCGPANLF KM  EIMRN+KV+++KK+Y+IY+FFFV K+VA
Sbjct  301   VKNELPSTLNAYRFQQHRWSCGPANLFMKMFMEIMRNRKVSLYKKIYVIYSFFFVRKVVA  360

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H+ TF++YC+VLPATV++PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+LFEN M
Sbjct  361   HINTFMFYCIVLPATVVVPEVVVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENTM  420

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFY  404
             +LHRT  T IGLLE  R +EW+VT+     K   PKS     RFR+    H+ E++VGFY
Sbjct  421   SLHRTKATIIGLLEGSRANEWIVTQ-----KGKPPKS-----RFRIRIH-HMLELLVGFY  469

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             + FCG Y+++FG N YY++L++Q ++F ++ FGY+G F   S
Sbjct  470   LFFCGCYDIMFGKNRYYIFLYIQSIAFFIMAFGYVGIFDPNS  511



>ref|XP_010525608.1| PREDICTED: probable mannan synthase 3 isoform X1 [Tarenaya hassleriana]
 ref|XP_010525609.1| PREDICTED: probable mannan synthase 3 isoform X1 [Tarenaya hassleriana]
Length=546

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/510 (62%), Positives = 398/510 (78%), Gaps = 7/510 (1%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             +G +W Q + +V++PVL+  + LCL+M +M+ +E+VY+  V   +KL RR P   +KWE 
Sbjct  39    IGHIWKQTRIIVLIPVLKFFITLCLLMSLMVFVERVYMSVVVVIVKLLRRKPETVHKWEA  98

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             +K  DD E+G++ YP VL+QIPM NEK V QLSIGAAC LSWP +R+I+QVLDDSTD + 
Sbjct  99    LK--DDIELGHATYPMVLIQIPMYNEKEVCQLSIGAACTLSWPLDRMIVQVLDDSTDQDS  156

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K LV  E  +WA KG+NI  E RDNR G+KAG+LK GMKHSYVK CEYV IFDADF+PDP
Sbjct  157   KDLVNIEVAKWANKGINIMSEIRDNRNGYKAGALKAGMKHSYVKKCEYVVIFDADFQPDP  216

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFL RTIPFLVHNP+I LVQ RWK+VNANEC++TR+QEMS++ HF  EQE GS+ HAFFG
Sbjct  217   DFLTRTIPFLVHNPEIALVQTRWKFVNANECLMTRMQEMSLNYHFLAEQESGSSTHAFFG  276

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA L GWKFV++ D+ VK+ELPS+FKAY
Sbjct  277   FNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRACLNGWKFVYVHDIEVKNELPSTFKAY  336

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             R+QQHRWSCGPANLFKKMT EI+ NK+V++WKKLYLIY+FFFV KIV H+ TF++YCL+L
Sbjct  337   RFQQHRWSCGPANLFKKMTVEIIENKRVSLWKKLYLIYSFFFVRKIVVHIFTFVFYCLIL  396

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             P +V   E++IP W ++Y+PT   LL  +  PRSLH+  FW+LFENVM++HRT  T IGL
Sbjct  397   PTSVFFSEIEIPKWASVYIPTTITLLNAVATPRSLHLLVFWILFENVMSMHRTKATLIGL  456

Query  547   LEVGRIHEWVVTEKQGNTKTAQPKSAKKVP---RFRLGERLHLWEIIVGFYMLFCGWYNL  377
             L+ GR++EWVVTEK G+  T + K   KVP   R   GER+H  E++ G Y+  CG Y+ 
Sbjct  457   LDAGRVNEWVVTEKLGD--TLKMKLISKVPTKRRSEFGERIHWRELVAGLYIFLCGCYDF  514

Query  376   IFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              FG  ++YVYLFLQ V+F V GFGY+G FV
Sbjct  515   AFGKTFFYVYLFLQSVAFFVAGFGYVGTFV  544



>ref|XP_009126562.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Brassica 
rapa]
Length=534

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/540 (59%), Positives = 424/540 (79%), Gaps = 9/540 (2%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MDG S      F       G    I   LG++W   KA VIVP+L++ VY+CL+M IM+L
Sbjct  1     MDGVSPK----FVLPETFDGVKMEITGQLGMIWELVKAPVIVPLLQLAVYICLLMSIMLL  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
              E+VY+G V   +KLF + P K+YK+EPI   DD E+G+S +P VLVQIPM NE+ VY+L
Sbjct  57    CERVYMGIVIVLVKLFWKKPEKRYKFEPI--HDDEELGSSNFPVVLVQIPMFNEREVYKL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAA  LSWP++R++IQVLDDSTDP VK +V+ EC+RWA KG+NI Y+ R+NR G+KAG
Sbjct  115   SIGAASGLSWPSDRLVIQVLDDSTDPTVKQMVEMECQRWASKGINITYQIRENRVGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+G+K SYVK CEYV IFDADF+P+PDFL R+IPFLVHNP+I LVQARW++VN++EC+
Sbjct  175   ALKEGLKRSYVKHCEYVVIFDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             LTR+QEMS+D HF+VEQEVGS+ HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  
Sbjct  235   LTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA L+GWKF++LGD++VKSELPS+F+A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WK
Sbjct  295   RASLRGWKFLYLGDLQVKSELPSTFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+Y+IY+FFFV K++AH +TF +YC+VLP T+L+PE+K+P+WG++Y+P++  +L  +  P
Sbjct  355   KVYVIYSFFFVRKVIAHWVTFCFYCVVLPLTILVPEVKVPIWGSVYIPSIITVLNSVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ--PKSAKKVP  458
             RS+H+  +W+LFENVM+LHRT  T IGL E GR +EWVVT K G+ + A+   K  KK P
Sbjct  415   RSIHLLFYWILFENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQGAKGNTKGLKKFP  474

Query  457   R-FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             R F+L +RL+  E+    ++  CG Y+   G N Y++YLFLQ +SF + G G+IG +V +
Sbjct  475   RIFKLPDRLNTLELGFAAFLFVCGCYDYAHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  534



>ref|XP_009629011.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/521 (60%), Positives = 419/521 (80%), Gaps = 4/521 (1%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +G    IA  +G++W   KA +IVP+LRV +Y+CL M +M+ +E++Y+G V   +KLF +
Sbjct  15    QGTAADIAGQIGLMWELIKAPLIVPLLRVAIYICLAMELMLFIERLYMGIVIILVKLFLK  74

Query  1657  TPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQ  1478
              P K+YKWE ++  +D EIGN+G+P VLVQIPM NEK VY++SIGAACNLSWP++R++IQ
Sbjct  75    KPDKRYKWEAMR--EDLEIGNAGFPMVLVQIPMFNEKEVYKVSIGAACNLSWPSDRLVIQ  132

Query  1477  VLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVA  1298
             VLDDSTDP +K LV++EC RWA KG+NI+Y+ R++R G+KAG+LK+G+K  YVK CEYV 
Sbjct  133   VLDDSTDPLIKDLVEKECLRWASKGINIRYQIRESRGGYKAGALKEGLKRDYVKDCEYVV  192

Query  1297  IFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQE  1118
             IFDADF P+PDFL R IPFLVHN +I LVQ RW++VN+NEC+LTR+QEMS+D HF+VEQE
Sbjct  193   IFDADFRPEPDFLRRAIPFLVHNSEIALVQGRWRFVNSNECLLTRMQEMSLDYHFTVEQE  252

Query  1117  VGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVK  938
             VGS+ HAFFGFNGT G+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKF++LGD++VK
Sbjct  253   VGSSTHAFFGFNGTGGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDLQVK  312

Query  937   SELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHV  758
             SELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNK+V IWKK Y+IY+FFFV KI+AH+
Sbjct  313   SELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNIWKKFYVIYSFFFVRKIIAHM  372

Query  757   LTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMAL  578
             +TF ++C+VLP ++L+PE++IP+W A+Y+P +  +L  +  PRS+H+  +W+LFENVMA 
Sbjct  373   VTFFFFCVVLPLSLLVPEVEIPVWAAIYIPCIITILNSVGTPRSIHLLFYWILFENVMAF  432

Query  577   HRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAK-KVPRFRL-GERLHLWEIIVGFY  404
             HRT  TFIGLLE  R +EWVVTEK G+    + K+ + K PR  L G+R+   E+    +
Sbjct  433   HRTKATFIGLLEAKRANEWVVTEKLGDALKNKDKTKQTKKPRGSLFGDRILPQELGFALF  492

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             + FCG Y++++G + Y++Y+FLQ V+F + GFGYIG  V +
Sbjct  493   LFFCGCYDVLYGKSQYFLYIFLQVVTFTIAGFGYIGTIVPS  533



>ref|XP_010525610.1| PREDICTED: probable mannan synthase 3 isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/510 (62%), Positives = 398/510 (78%), Gaps = 7/510 (1%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             +G +W Q + +V++PVL+  + LCL+M +M+ +E+VY+  V   +KL RR P   +KWE 
Sbjct  25    IGHIWKQTRIIVLIPVLKFFITLCLLMSLMVFVERVYMSVVVVIVKLLRRKPETVHKWEA  84

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             +K  DD E+G++ YP VL+QIPM NEK V QLSIGAAC LSWP +R+I+QVLDDSTD + 
Sbjct  85    LK--DDIELGHATYPMVLIQIPMYNEKEVCQLSIGAACTLSWPLDRMIVQVLDDSTDQDS  142

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K LV  E  +WA KG+NI  E RDNR G+KAG+LK GMKHSYVK CEYV IFDADF+PDP
Sbjct  143   KDLVNIEVAKWANKGINIMSEIRDNRNGYKAGALKAGMKHSYVKKCEYVVIFDADFQPDP  202

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFL RTIPFLVHNP+I LVQ RWK+VNANEC++TR+QEMS++ HF  EQE GS+ HAFFG
Sbjct  203   DFLTRTIPFLVHNPEIALVQTRWKFVNANECLMTRMQEMSLNYHFLAEQESGSSTHAFFG  262

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA L GWKFV++ D+ VK+ELPS+FKAY
Sbjct  263   FNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRACLNGWKFVYVHDIEVKNELPSTFKAY  322

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             R+QQHRWSCGPANLFKKMT EI+ NK+V++WKKLYLIY+FFFV KIV H+ TF++YCL+L
Sbjct  323   RFQQHRWSCGPANLFKKMTVEIIENKRVSLWKKLYLIYSFFFVRKIVVHIFTFVFYCLIL  382

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             P +V   E++IP W ++Y+PT   LL  +  PRSLH+  FW+LFENVM++HRT  T IGL
Sbjct  383   PTSVFFSEIEIPKWASVYIPTTITLLNAVATPRSLHLLVFWILFENVMSMHRTKATLIGL  442

Query  547   LEVGRIHEWVVTEKQGNTKTAQPKSAKKVP---RFRLGERLHLWEIIVGFYMLFCGWYNL  377
             L+ GR++EWVVTEK G+  T + K   KVP   R   GER+H  E++ G Y+  CG Y+ 
Sbjct  443   LDAGRVNEWVVTEKLGD--TLKMKLISKVPTKRRSEFGERIHWRELVAGLYIFLCGCYDF  500

Query  376   IFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              FG  ++YVYLFLQ V+F V GFGY+G FV
Sbjct  501   AFGKTFFYVYLFLQSVAFFVAGFGYVGTFV  530



>ref|XP_010493365.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
 ref|XP_010493366.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
Length=533

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/519 (60%), Positives = 420/519 (81%), Gaps = 5/519 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G    I   LG++W   KA VIVP+L++ VY+CLVM +M+L E+VY+G V   +KLF + 
Sbjct  16    GVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLVMSVMLLCERVYMGIVIVLVKLFWKK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YK++PI   DD E+G+S +P VLVQIPM NE+ VY+LSIGAAC LSWP++R++IQV
Sbjct  76    PDKRYKFDPI--HDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDRLVIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP VK +V+ EC+RWA KG+NI+Y+ R+NR G+KAG+LK+G+K SYVK CEYV I
Sbjct  134   LDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHCEYVVI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL R+IPFL+HN +I LVQARW++VN++EC+LTR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLRRSIPFLIHNSNIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++VKS
Sbjct  254   GSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKS  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+F+A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+AH +
Sbjct  314   ELPSTFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKIIAHWV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF +YC+VLP T+L+PE+ +P+WG++Y+P++  +L  +  PRS+H+  +W+LFENVM+LH
Sbjct  374   TFCFYCVVLPLTILVPEVYVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ--PKSAKKVPR-FRLGERLHLWEIIVGFY  404
             RT  T IGL E GR +EWVVT K G+ ++A+   K  K+ PR F+L +RL+  E+    +
Sbjct  434   RTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGLKRFPRIFKLPDRLNTLELGFAAF  493

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             +  CG Y+ + G N Y++YLFLQ +SF + G G+IG +V
Sbjct  494   LFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYV  532



>ref|XP_010912225.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Elaeis guineensis]
Length=500

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/534 (60%), Positives = 413/534 (77%), Gaps = 39/534 (7%)
 Frame = -1

Query  1876  SSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVY  1697
             SS AI+     A +GA D I   +G++W Q KA VIVP+LR+ V+LCL M +M+ +EKVY
Sbjct  5     SSTAIL---PEAFQGARDDITEQMGLVWQQIKAPVIVPLLRLTVFLCLAMSVMLFVEKVY  61

Query  1696  LGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAA  1517
             +  V   +KL  + P K+Y+WEP++  DD E+GNS YP VL+QIPM NEK          
Sbjct  62    MAVVIVIVKLLGKRPEKRYRWEPMR--DDLELGNSAYPMVLLQIPMYNEK----------  109

Query  1516  CNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQG  1337
                                    + LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+G
Sbjct  110   -----------------------EDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEG  146

Query  1336  MKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQ  1157
             MKHSYVK C+YVAIFDADF+P+PDFL+RTIPFLVHNP++ LVQARWK+VN++EC++TR+Q
Sbjct  147   MKHSYVKDCDYVAIFDADFQPEPDFLFRTIPFLVHNPELALVQARWKFVNSDECLMTRMQ  206

Query  1156  EMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLK  977
             EMS+D HF+VEQEVGS  +AFFGFNGTAG+WRI+AL +AGGWKDRTTVEDMDL  RA LK
Sbjct  207   EMSLDYHFTVEQEVGSLTYAFFGFNGTAGVWRISALREAGGWKDRTTVEDMDLAVRASLK  266

Query  976   GWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLI  797
             GWKFVFLGD++VK+ELPS+ KAYRYQQHRWSCGPANLF+KM  EI+RNKKV+++KK+++I
Sbjct  267   GWKFVFLGDLKVKNELPSTLKAYRYQQHRWSCGPANLFRKMLLEIVRNKKVSLFKKVHVI  326

Query  796   YAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHM  617
             Y FFFV KIVAH++TF++YCLV+PATVL+PE++IP WGA+Y+P++  LL  +  PRSLH+
Sbjct  327   YNFFFVRKIVAHIVTFVFYCLVIPATVLVPEVQIPKWGAVYIPSIITLLNAVGTPRSLHL  386

Query  616   TAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGE  440
               FW+LFENVM+LHRT  TFIGLLEVGR++EWVVTEK G+  K      A + PR R+G+
Sbjct  387   LVFWILFENVMSLHRTKATFIGLLEVGRVNEWVVTEKLGDALKMKMAAKAARKPRIRIGD  446

Query  439   RLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             RLHL E+ VG Y+ FCG Y++ FG N++++YLFLQ  +F ++GFGY+G FV+ S
Sbjct  447   RLHLLELGVGAYLFFCGCYDVAFGKNHFFIYLFLQATAFFIVGFGYVGTFVSHS  500



>ref|XP_010454539.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 isoform X2 
[Camelina sativa]
Length=533

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/538 (59%), Positives = 425/538 (79%), Gaps = 9/538 (2%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             MDG S      F       G    I   LG++W   KA VIVP+L++ VY+CLVM +M+L
Sbjct  1     MDGVSPK----FVLPETFDGVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLVMSVMLL  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
              E+VY+G V   +KLF + P K+YK++PI   DD E+G+S +P VLVQIPM NE+ VY+L
Sbjct  57    CERVYMGIVIVLVKLFWKKPDKRYKFDPI--HDDEELGSSNFPVVLVQIPMFNEREVYKL  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++R++IQVLDDSTDP VK +V+ EC+RWA KG+NI+Y+ R+NR G+KAG
Sbjct  115   SIGAACGLSWPSDRLVIQVLDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+G+K SYVK CEYV IFDADF+P+PDFL R+IPFL+HN +I LVQARW++VN++EC+
Sbjct  175   ALKEGLKRSYVKHCEYVVIFDADFQPEPDFLRRSIPFLMHNSNIALVQARWRFVNSDECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             LTR+QEMS+D HF+VEQEVGS+ HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  
Sbjct  235   LTRMQEMSLDYHFTVEQEVGSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA L+GWKF++LGD++VKSELPS+F+A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WK
Sbjct  295   RASLRGWKFLYLGDLQVKSELPSTFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K+Y+IY+FFFV KI+AH +TF +YC+VLP T+L+PE+ +P+WG++Y+P++  +L  +  P
Sbjct  355   KVYVIYSFFFVRKIIAHWVTFCFYCVVLPLTILVPEVYVPIWGSVYIPSIITILNSVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ--PKSAKKVP  458
             RS+H+  +W+LFENVM+LHRT  T IGL E GR +EWVVT K G+ ++A+   K  K+ P
Sbjct  415   RSIHLLFYWILFENVMSLHRTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGLKRFP  474

Query  457   R-FRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             R F+L +RL+  E+    ++  CG Y+ + G N Y++YLFLQ +SF + G G+IG +V
Sbjct  475   RIFKLPDRLNTLELGFAAFLFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYV  532



>emb|CAN82595.1| hypothetical protein VITISV_013708 [Vitis vinifera]
Length=534

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/522 (60%), Positives = 415/522 (80%), Gaps = 5/522 (1%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +G    IA  +G++W   KA +IVP+LRV VY+CL M +M+ +E++Y+G V   +K+F +
Sbjct  15    QGTRLDIAGQIGLVWELVKAPLIVPLLRVAVYICLTMSLMLFVERLYMGIVIILVKIFWK  74

Query  1657  TPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQ  1478
              P K+YKWEP++  +D E GNS +P V+VQIPM NEK VY+LSIGAAC LSWP +R++IQ
Sbjct  75    KPDKRYKWEPLR--EDLESGNSNFPHVVVQIPMYNEKEVYKLSIGAACGLSWPADRLVIQ  132

Query  1477  VLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG-SLKQGMKHSYVKSCEYV  1301
             VLDDSTDP +K LV+ EC+RWA KG+NI+Y+ R+NR G+KAG S ++     YVK CEYV
Sbjct  133   VLDDSTDPTIKNLVETECQRWAAKGINIRYQIRENRVGYKAGGSERRPEAERYVKHCEYV  192

Query  1300  AIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQ  1121
             AIFDADF+P+PD+L R IPFLV+N DI LVQ RW++VNA+EC++TR+QEMS+D HF+VEQ
Sbjct  193   AIFDADFQPEPDYLKRAIPFLVYNSDIALVQGRWRFVNADECLMTRMQEMSLDYHFTVEQ  252

Query  1120  EVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRV  941
             EVGSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKFV+LGD++V
Sbjct  253   EVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQV  312

Query  940   KSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAH  761
             KSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FF V KIVAH
Sbjct  313   KSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFLVRKIVAH  372

Query  760   VLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMA  581
             ++TF  YC+VLP T+LIPE++IP+WG +Y+P++   L  +  PRS+H+  +W+LFENVM+
Sbjct  373   MVTFCLYCVVLPLTILIPEVEIPIWGIVYIPSIITTLNAVGTPRSIHLLFYWILFENVMS  432

Query  580   LHRTIGTFIGLLEVGRIHEWVVTEKQGNT--KTAQPKSAKKVPRFRLGERLHLWEIIVGF  407
              HRT  T IGLLE GR +EWVVTEK G+T    A  K+A K PRF++G+R++  E+    
Sbjct  433   FHRTKATLIGLLEAGRANEWVVTEKLGDTLKNKANTKAAAKRPRFKIGDRINTMELGFSA  492

Query  406   YMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             ++ FC  Y+ ++G  Y+YVYLFLQ +++ ++G GY+G  V +
Sbjct  493   FLFFCACYDFLYGKYYFYVYLFLQTITYFIVGIGYVGTIVPS  534



>ref|XP_004251009.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Solanum 
lycopersicum]
Length=524

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/526 (59%), Positives = 415/526 (79%), Gaps = 7/526 (1%)
 Frame = -1

Query  1846  AAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKL  1667
             + V+     IA  +G++W   KA ++VP+L+  VY+C+VM +M+ +E++Y+G V   +K+
Sbjct  2     STVQATASDIAGQIGMMWEVLKAPLLVPLLKSAVYICIVMELMLFVERLYMGIVIVLVKI  61

Query  1666  FRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRI  1487
             F + P K+YKW P+  +DD EIG++ +P VLVQIPM NEK VY++SIGAACNLSWP++R+
Sbjct  62    FMKKPDKRYKWIPMA-DDDLEIGSADFPKVLVQIPMFNEKEVYKISIGAACNLSWPSDRL  120

Query  1486  IIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCE  1307
             +IQVLDDSTDP VK +V+ EC RWA KG+NI Y+ R+ R G+KAG+LK+G+KH+YVK CE
Sbjct  121   VIQVLDDSTDPIVKDMVETECLRWASKGLNITYQIRETRGGYKAGALKEGLKHNYVKDCE  180

Query  1306  YVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSV  1127
             YV IFDADF P+PDFL R+IPFL+HNP+I LVQ RW++VN+NEC+LTR+QEMS+D HF+V
Sbjct  181   YVVIFDADFRPEPDFLRRSIPFLIHNPEIALVQGRWRFVNSNECLLTRMQEMSLDYHFTV  240

Query  1126  EQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDV  947
             EQEVGS+ HAFFGFNGT GIWRIAA+D+AGGWKDRTTVEDMDL  RA LKGWKFV+LGD+
Sbjct  241   EQEVGSSTHAFFGFNGTGGIWRIAAIDEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDL  300

Query  946   RVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIV  767
             +VKSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNK+V  WKK Y+IY+FFFV KI+
Sbjct  301   QVKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIIRNKRVNFWKKFYVIYSFFFVRKII  360

Query  766   AHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENV  587
             AH++TF ++C+VLP T+L+PE+++P+W A+Y+P +   L  +  PRS+H+  +W+LFENV
Sbjct  361   AHMVTFFFFCVVLPLTLLVPEVEVPIWAAIYIPCIITTLNSVGTPRSIHLLFYWILFENV  420

Query  586   MALHRTIGTFIGLLEVGRIHEWVVTEKQG----NTKTAQPKSAKKVPRFRLGERLHLWEI  419
             MA HRT  TFIGLLE  R +EWVVTEK G    N   ++P    + P F  G+R+   E+
Sbjct  421   MAYHRTKATFIGLLEAKRANEWVVTEKLGDALKNKDKSKPVKKARGPLF--GDRILPQEL  478

Query  418   IVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
                 ++ FCG Y++++G   Y+VY+FLQ ++F + GFGYIG  V +
Sbjct  479   GFAAFLFFCGLYDVLYGKRQYFVYVFLQVITFTIAGFGYIGTIVPS  524



>ref|XP_010421063.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Camelina 
sativa]
 ref|XP_010454538.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 isoform X1 
[Camelina sativa]
Length=533

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/519 (60%), Positives = 420/519 (81%), Gaps = 5/519 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G    I   LG++W   KA VIVP+L++ VY+CLVM +M+L E+VY+G V   +KLF + 
Sbjct  16    GVRMEITGQLGMIWELVKAPVIVPLLQLAVYICLVMSVMLLCERVYMGIVIVLVKLFWKK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YK++PI   DD E+G+S +P VLVQIPM NE+ VY+LSIGAAC LSWP++R++IQV
Sbjct  76    PDKRYKFDPI--HDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDRLVIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP VK +V+ EC+RWA KG+NI+Y+ R+NR G+KAG+LK+G+K SYVK CEYV I
Sbjct  134   LDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHCEYVVI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL R+IPFL+HN +I LVQARW++VN++EC+LTR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLRRSIPFLMHNSNIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++VKS
Sbjct  254   GSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKS  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+F+A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+AH +
Sbjct  314   ELPSTFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKIIAHWV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF +YC+VLP T+L+PE+ +P+WG++Y+P++  +L  +  PRS+H+  +W+LFENVM+LH
Sbjct  374   TFCFYCVVLPLTILVPEVYVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ--PKSAKKVPR-FRLGERLHLWEIIVGFY  404
             RT  T IGL E GR +EWVVT K G+ ++A+   K  K+ PR F+L +RL+  E+    +
Sbjct  434   RTKATLIGLFEAGRANEWVVTAKLGSGQSAKGNTKGLKRFPRIFKLPDRLNTLELGFAAF  493

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             +  CG Y+ + G N Y++YLFLQ +SF + G G+IG +V
Sbjct  494   LFVCGCYDFVHGKNNYFIYLFLQTLSFFISGLGWIGTYV  532



>ref|XP_010477641.1| PREDICTED: probable mannan synthase 3 [Camelina sativa]
 ref|XP_010477642.1| PREDICTED: probable mannan synthase 3 [Camelina sativa]
Length=556

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/507 (62%), Positives = 396/507 (78%), Gaps = 2/507 (0%)
 Frame = -1

Query  1798  LWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKK  1619
             +W Q +  V++P+L+ +V +CLVM  ++ +E+VY+  V  ++KL RRTP K +KWE I  
Sbjct  50    IWKQTRIFVLIPILKCLVTICLVMSFLVFIERVYMSIVVVFVKLLRRTPQKVHKWEAIN-  108

Query  1618  EDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKAL  1439
             +DD E+ N+ +P VL+QIPM NEK V QLSIGAAC LSWP +R+I+QVLDDSTDP  K L
Sbjct  109   DDDLELANTNFPMVLIQIPMYNEKEVCQLSIGAACRLSWPLDRMIVQVLDDSTDPASKEL  168

Query  1438  VQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFL  1259
             V  EC +WA KG+NI  E RDNR G+KAG+LK GM H+YVK CE+VAIFDADF+PDPDFL
Sbjct  169   VNAECDKWARKGINIMSEIRDNRIGYKAGALKAGMMHNYVKQCEFVAIFDADFQPDPDFL  228

Query  1258  YRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNG  1079
              RTIPFL+HN DI LVQ RWK+VNANEC++TR+QEMS++ HF  EQE GS+IHAFFGFNG
Sbjct  229   ERTIPFLIHNHDISLVQCRWKFVNANECLMTRMQEMSLNYHFIAEQESGSSIHAFFGFNG  288

Query  1078  TAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQ  899
             TAG+WRIAAL++AGGWKDRTTVEDMDL  RA L GWKFV++ DV VK+ELPS+FKAYR+Q
Sbjct  289   TAGVWRIAALNEAGGWKDRTTVEDMDLAVRACLHGWKFVYVHDVEVKNELPSTFKAYRFQ  348

Query  898   QHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPAT  719
             QHRWSCGPANL +KMT EI++NKKV+ WKKLYLIY FFF+ KIV H+ TF++YCL+LP +
Sbjct  349   QHRWSCGPANLCRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPTS  408

Query  718   VLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEV  539
             VL PEL++P W  +Y PT   LL  +  PRS H+  FW+LFENVM++HRT  TFIGLLE 
Sbjct  409   VLFPELQVPKWATVYFPTTITLLNAIATPRSFHLLVFWILFENVMSMHRTKATFIGLLEA  468

Query  538   GRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDN  362
             GR++EWVVTEK G+T K+     A      R G+R++  E++VG Y+  CG Y++ +G +
Sbjct  469   GRVNEWVVTEKLGDTLKSKLITKATTKLYTRFGQRINWRELVVGLYIFLCGCYDVAYGRS  528

Query  361   YYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             Y+YVYLFLQ  +F V G G+IG FV T
Sbjct  529   YFYVYLFLQSCAFFVAGVGFIGTFVPT  555



>emb|CAN74357.1| hypothetical protein VITISV_042153 [Vitis vinifera]
Length=533

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/473 (66%), Positives = 394/473 (83%), Gaps = 3/473 (1%)
 Frame = -1

Query  1840  VRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFR  1661
             ++G  D I+  LGV+W Q KA VIVP++ + V +CL M +M+  E+VYL  V   +KLF 
Sbjct  14    LQGTRDDISEQLGVVWSQIKAPVIVPLMSIAVAVCLAMSLMLFFERVYLSIVIVLVKLFG  73

Query  1660  RTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIII  1481
             R P K YKWEP+K  DD E+G S YP VLVQIPM NEK VYQLSIGAAC LSWP++RIII
Sbjct  74    RKPDKSYKWEPMK--DDVELGXSAYPMVLVQIPMYNEKEVYQLSIGAACGLSWPSDRIII  131

Query  1480  QVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYV  1301
             QVLDDSTDP +K LV+ EC+RWA KG+NIKYE R+NR G+KAG+LK+GMKHSYVK C+YV
Sbjct  132   QVLDDSTDPTIKDLVELECQRWASKGINIKYEIRNNRNGYKAGALKEGMKHSYVKECDYV  191

Query  1300  AIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQ  1121
             AIFDADF+P+PDFL+RT+PFLVHN +I LVQARWK+VN++EC++TR+QEMS+D HF+VEQ
Sbjct  192   AIFDADFQPEPDFLWRTVPFLVHNXEIALVQARWKFVNSDECLMTRMQEMSLDYHFTVEQ  251

Query  1120  EVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRV  941
             EVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA LKGWKFV+LG ++V
Sbjct  252   EVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGTLKV  311

Query  940   KSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAH  761
             K+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI+RNKKV++WKK+++IY+FF V K+VAH
Sbjct  312   KNELPSTFKAYRYQQHRWSCGPANLFRKMVMEIVRNKKVSLWKKVHVIYSFFIVRKLVAH  371

Query  760   VLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMA  581
             ++TF++YC+VLPATVL+P++++P WGA+Y+PT+  +L  +  PRSLH+  FW+LFENVM+
Sbjct  372   IVTFVFYCVVLPATVLVPDVEVPRWGAVYIPTIITILNAVGTPRSLHLMVFWILFENVMS  431

Query  580   LHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLW  425
             LHRT  TFIGLLE GR++EWVVTEK G+  K      A K PRF++GE    W
Sbjct  432   LHRTKATFIGLLEGGRVNEWVVTEKLGDALKVKAATKAPKKPRFKIGESSICW  484



>ref|XP_008458630.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Cucumis 
melo]
Length=539

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/527 (60%), Positives = 418/527 (79%), Gaps = 11/527 (2%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G GD     + ++W   KA +IVPVLR+MVY+ L M +M+  E++Y+G V   +KLF + 
Sbjct  16    GRGD-FTEQIWLIWELIKAPLIVPVLRLMVYISLAMSLMLFFERLYMGIVIILVKLFWKK  74

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YK+EPI  +DD E+G+S +P VL+QIPM NE+ VY++SIGAAC LSWP +R++IQV
Sbjct  75    PEKRYKYEPI--QDDLELGSSNFPHVLIQIPMFNEREVYKISIGAACGLSWPADRLVIQV  132

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K +V+QEC RWA KG+NI Y+ R+ R G+KAG+LK+G+K SYVK CEYVAI
Sbjct  133   LDDSTDPVIKQMVEQECLRWASKGINITYQIRETRGGYKAGALKEGLKRSYVKHCEYVAI  192

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF P+PD+L R IPFLVHNPDI LVQARW++VNA+EC+LTR+QEMS+D HF+VEQEV
Sbjct  193   FDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEV  252

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+GWKFV+LGD++VKS
Sbjct  253   GSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLQVKS  312

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+AH++
Sbjct  313   ELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVKFWKKVYVIYSFFFVRKIIAHMV  372

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF +YC+VLP T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+LH
Sbjct  373   TFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLH  432

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGN----TKTAQPKSAKKVPRFRL----GERLHLWEI  419
             RT  T IGLLE GR +EWVVTEK G+       A  K+  K+P+ RL    G+R++  E+
Sbjct  433   RTKATLIGLLEAGRANEWVVTEKLGDALKNKAAADKKAGGKIPKIRLRCKFGDRINTLEL  492

Query  418   IVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
                 ++  CG Y+ + G N Y++YLFLQ  SFL+ G GY+G  + +S
Sbjct  493   GFAAFLFLCGCYDFVHGKNNYFIYLFLQTFSFLITGIGYVGTIIPSS  539



>ref|XP_004294040.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Fragaria 
vesca subsp. vesca]
Length=540

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/527 (60%), Positives = 421/527 (80%), Gaps = 10/527 (2%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G+   IA  +G++W   KA +IVP+LRV VY+ L M +M+ +E+VY+G V   +K+F + 
Sbjct  16    GSSFDIAGQIGLIWELIKAPLIVPLLRVGVYVSLAMALMLFVERVYMGIVIVLVKMFWKK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+Y +EPI  ++D E+G+S +P VLVQIPM NE+ VY++SIGAAC LSWP++R++IQV
Sbjct  76    PEKRYNYEPI--QEDLELGSSNFPVVLVQIPMFNEREVYKISIGAACGLSWPSDRLVIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K +V+ EC+RWA KG+NI Y+ R++R G+KAG+LK+G+K SYVK CEYVAI
Sbjct  134   LDDSTDPTIKKMVEAECQRWASKGINIVYQIRESRGGYKAGALKEGLKRSYVKHCEYVAI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
              DADF P+PD+L R IPFLVHNP+I LVQARW++VN++EC+LTR+QEMS+D HF+VEQEV
Sbjct  194   MDADFRPEPDYLRRAIPFLVHNPEIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RAGL+GWKF++LGD++VKS
Sbjct  254   GSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRAGLRGWKFLYLGDLQVKS  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+F A+R+QQHRWSCGPANLF+KM +EI  NKKVT+WKK Y+IY+FFFV KI+AH++
Sbjct  314   ELPSTFNAFRFQQHRWSCGPANLFRKMVWEIAMNKKVTLWKKFYVIYSFFFVRKIIAHMV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF +YC+VLP T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+LH
Sbjct  374   TFFFYCVVLPLTILVPEVHVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNT--------KTAQPKSAKKVPRFRLGERLHLWEI  419
             RT  T IGL E GR +EWVVTEK G+T        K        K P+F+ G RLH+ E+
Sbjct  434   RTKATLIGLFEAGRANEWVVTEKLGDTVKKAADAAKNKPAPKFFKKPKFKFGNRLHMLEL  493

Query  418   IVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
               G ++ FCG Y+ + G N Y+VYLFLQ ++FL+ GFGY+G  + +S
Sbjct  494   GFGLFLFFCGCYDYVHGKNNYFVYLFLQTITFLICGFGYVGTIIPSS  540



>gb|KHF98868.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=537

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/521 (61%), Positives = 418/521 (80%), Gaps = 10/521 (2%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             D I   LG++W   K  +IVP+L++ VY+CL M +M+ ME+VY+G V   +KLF + P K
Sbjct  19    DDITGQLGLIWELIKTPLIVPLLQLGVYICLAMSLMLFMERVYMGIVIILVKLFWKKPEK  78

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +Y +E I  +DD E+G+S +P VL+QIPM NEK VY++SIGAAC LSWP++R++IQVLDD
Sbjct  79    RYNFELI--QDDVELGSSNFPVVLIQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDD  136

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP +K +V+QEC+RWA KG+NI Y+ R+NR G+KAG+LK+G+K SYVK CEYVAIFDA
Sbjct  137   STDPAIKLMVEQECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIFDA  196

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF P+PDFL R+IPFLV+NPDI LVQARW++VNA+EC+LTR+QEMS+D HF+VEQEVGSA
Sbjct  197   DFRPEPDFLRRSIPFLVNNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSA  256

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  RA L+GWKFV+LGD++VKSELP
Sbjct  257   THAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLQVKSELP  316

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKA+R+QQHRWSCGPANLF+KM +EI++NKKV  WKK+Y+IY+FFFV KI+AH++TF 
Sbjct  317   STFKAFRFQQHRWSCGPANLFRKMVWEIIQNKKVKFWKKVYVIYSFFFVRKIIAHMVTFC  376

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+VLP T+LIPE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+LHRT 
Sbjct  377   FYCVVLPLTILIPEVWVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTK  436

Query  565   GTFIGLLEVGRIHEWVVTEKQG-----NTKTAQPKSAKKVPR---FRLGERLHLWEIIVG  410
              TFIGLLE GR +EWVVTEK G         A+ K+  K PR   F+  +RL+  E+   
Sbjct  437   ATFIGLLEAGRANEWVVTEKLGDAVKKAADAAKNKNNAKAPRKLKFKFTDRLNTLELGFA  496

Query  409   FYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              ++  CG Y+ + G N Y+VYLFLQ ++F + G GY+G  +
Sbjct  497   AFLFLCGCYDFVHGKNNYFVYLFLQTITFFITGIGYVGTII  537



>ref|XP_010520406.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Tarenaya 
hassleriana]
Length=536

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/523 (60%), Positives = 415/523 (79%), Gaps = 6/523 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G    I   LG++W   KA VIVP+LR+ VYLCL M +M+  E++Y+G V   +KLF + 
Sbjct  16    GVKSEITGQLGMIWELVKAPVIVPLLRLAVYLCLAMSLMLFFERLYMGVVIILVKLFWKK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YK+EPI  ++D E+GNS +P VLVQIPM NE+ VY+LSIGAAC LSWP++R++IQV
Sbjct  76    PEKRYKFEPI--QEDEELGNSNFPVVLVQIPMFNEREVYKLSIGAACGLSWPSDRLVIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP VK +V+ EC+RWA KG+NI+Y+ R+NR G+KAG+LK+G+K SYVK  EYV I
Sbjct  134   LDDSTDPTVKQMVEMECQRWASKGLNIRYQIRENRVGYKAGALKEGLKRSYVKHSEYVVI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL R+IPFLVHNPDI LVQARW++VNA+EC+LTR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLRRSIPFLVHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAGIWRIAA++DAGGWKDRTTVEDMDL  RA L+GWKF++LGD++V+S
Sbjct  254   GSSTHAFFGFNGTAGIWRIAAINDAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVRS  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+F+A+R+QQHRWSCGPANLF+KM  EI+ NK+V  WKK+Y+IY+FFFV KI+AH +
Sbjct  314   ELPSTFRAFRFQQHRWSCGPANLFRKMVMEIISNKRVKFWKKVYVIYSFFFVRKIIAHWV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF +YC+VLP T+L+PE+++P+WG++Y+P++  +L  +  PRS+H+  +W+LFENVM+LH
Sbjct  374   TFCFYCVVLPLTILVPEVQVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQ----GNTKTAQPKSAKKVPRFRLGERLHLWEIIVGF  407
             RT  + IGLLE GR +EWVVT K     G+       + K +  F+L +RL+  E+    
Sbjct  434   RTKASLIGLLEAGRANEWVVTAKLGSGVGSKAANAKGAKKLIRFFKLPDRLNTLELGFAA  493

Query  406   YMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             ++  CG Y+ + G N YYVYLFLQ  S+ + GFG+IG +V  S
Sbjct  494   FLFTCGCYDFVHGKNSYYVYLFLQTASYFITGFGWIGTYVPNS  536



>ref|XP_010498857.1| PREDICTED: probable mannan synthase 3 [Camelina sativa]
 ref|XP_010498858.1| PREDICTED: probable mannan synthase 3 [Camelina sativa]
Length=555

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/507 (62%), Positives = 394/507 (78%), Gaps = 2/507 (0%)
 Frame = -1

Query  1798  LWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKK  1619
             +W Q +  V +P+L+ +V +CLVM  ++ +E+VY+  V  ++KL RR+P K  KWE I  
Sbjct  49    IWKQTRIFVFIPILKCLVTICLVMSFLVFIERVYMSIVVVFVKLLRRSPQKVNKWEAIN-  107

Query  1618  EDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKAL  1439
             +DD E+ N+ +P VL+QIPM NEK V QLSIGAAC LSWP +R+I+QVLDDSTDP  K L
Sbjct  108   DDDLELANTNFPMVLIQIPMYNEKEVCQLSIGAACRLSWPLDRMIVQVLDDSTDPASKEL  167

Query  1438  VQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFL  1259
             V  EC +WA KG+NI  E RDNR G+KAG+LK GM H+YVK CE+VAIFDADF+PDPDFL
Sbjct  168   VNAECDKWARKGINIMSEIRDNRIGYKAGALKAGMMHNYVKQCEFVAIFDADFQPDPDFL  227

Query  1258  YRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNG  1079
              RTIPFL+HN DI LVQ RWK+VNANEC++TR+QEMS++ HF  EQE GS+IHAFFGFNG
Sbjct  228   ERTIPFLIHNHDISLVQCRWKFVNANECLMTRMQEMSLNYHFIAEQESGSSIHAFFGFNG  287

Query  1078  TAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQ  899
             TAG+WRIAAL++AGGWKDRTTVEDMDL  RA L GWKFV++ DV VK+ELPS+FKAYR+Q
Sbjct  288   TAGVWRIAALNEAGGWKDRTTVEDMDLAVRACLHGWKFVYVHDVEVKNELPSTFKAYRFQ  347

Query  898   QHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPAT  719
             QHRWSCGPANL +KMT EI++NKKV+ WKKLYLIY FFF+ KIV H+ TF++YCL+LP T
Sbjct  348   QHRWSCGPANLCRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPTT  407

Query  718   VLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEV  539
             VL PEL++P W  +Y PT   LL  +  PRS H+  FW+LFENVM++HRT  TFIGLLE 
Sbjct  408   VLFPELQVPKWATVYFPTTITLLNAIATPRSFHLLVFWILFENVMSMHRTKATFIGLLEA  467

Query  538   GRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDN  362
             GR++EWVVTEK G+T K+     A      R G+RL+  E++VG Y+  CG Y++ +G +
Sbjct  468   GRVNEWVVTEKLGDTLKSKLITKATTKLYTRFGQRLNWRELVVGLYIFLCGCYDVAYGRS  527

Query  361   YYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             Y+YVYLFLQ  +F V G G+IG FV T
Sbjct  528   YFYVYLFLQSCAFFVAGVGFIGTFVPT  554



>ref|XP_008227108.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Prunus mume]
Length=540

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/530 (59%), Positives = 420/530 (79%), Gaps = 10/530 (2%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             + +G    IA  +G++W   KA +IVP+LRV VY+ L M +M+  E++Y+G V   +KLF
Sbjct  13    SFQGGTYDIAGQIGLIWELIKAPLIVPLLRVCVYISLAMSLMLFFERLYMGIVIILVKLF  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              + P K+YK+EPI  ++D E+G+S +P VL+QIPM NE+ VY++SIGAAC LSWP++R++
Sbjct  73    WKKPEKRYKYEPI--QEDLELGSSNFPVVLIQIPMFNEREVYKISIGAACGLSWPSDRLV  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTDP +K +V+ EC+RWA KG+NI+Y+ R+ R G+KAG+LK+G+K SYVK CEY
Sbjct  131   IQVLDDSTDPTIKQMVELECQRWASKGINIRYQIRETRGGYKAGALKEGLKRSYVKHCEY  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF P+PD+L R IPFLVHNPDI LVQARW++VN++EC+LTR+QEMS+D HF+VE
Sbjct  191   VAIFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++
Sbjct  251   QEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQ  310

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VKSELPS+F A+R+QQHRWSCGPANLF+KM  EI++ KKVT+WKK Y+IY+FFFV KI+A
Sbjct  311   VKSELPSTFNAFRFQQHRWSCGPANLFRKMVMEIVKTKKVTLWKKFYVIYSFFFVRKIIA  370

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TF +YC+VLP T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM
Sbjct  371   HMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVM  430

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGN--------TKTAQPKSAKKVPRFRLGERLHL  428
             +LHRT  T IGLLE GR +EWVVTEK G+                  K P+F+ G RLHL
Sbjct  431   SLHRTKATLIGLLETGRANEWVVTEKLGDIVKNKAAEAAKKPAPKFFKRPKFKFGNRLHL  490

Query  427   WEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              E+  G ++  CG Y+ + G N Y+VYLFLQ ++FL+ GFGY+G  + +S
Sbjct  491   LELGFGAFLFVCGCYDYVHGKNNYFVYLFLQTITFLICGFGYVGTIIPSS  540



>ref|XP_003538146.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
Length=542

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/532 (58%), Positives = 417/532 (78%), Gaps = 15/532 (3%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             ++ G    +A  + ++W   KA +IVP+L + VY+ L M +M+ ME+VY+G V   +KLF
Sbjct  13    SINGVNFDVAAQIKMVWEVMKAPLIVPLLNLAVYISLAMALMLFMERVYMGIVIILVKLF  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              + P ++YK+EP+  +DD E+GNS YP VLVQIPM NEK VY++SIGAACNLSWP +R++
Sbjct  73    WKKPHQRYKFEPL--QDDEELGNSNYPVVLVQIPMFNEKEVYKVSIGAACNLSWPADRLV  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTDP VK +V+ EC+RWA KG+NI Y+ R+ R G+KAG+LK+G+K +YVK CEY
Sbjct  131   IQVLDDSTDPTVKQMVEMECQRWASKGINIVYQIRETRGGYKAGALKEGLKRNYVKHCEY  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF P+PDFL R+IPFLV NPDI LVQARW++VN++EC+LTR+QEMS+D HF+VE
Sbjct  191   VAIFDADFRPEPDFLRRSIPFLVGNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGSA HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++
Sbjct  251   QEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQ  310

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
              KSELPS+ +A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+A
Sbjct  311   AKSELPSTLRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIA  370

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TF +YC+V+P T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM
Sbjct  371   HMVTFFFYCVVIPLTILVPEVHVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVM  430

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-------------KTAQPKSAKKVPRFRLG  443
             +LHRT  TFIGLLE GR +EWVVTEK G++             K    K+  K  R +  
Sbjct  431   SLHRTKATFIGLLEYGRANEWVVTEKLGDSVNNNKNKSGDAAKKNNAIKATPKKTRSKFV  490

Query  442   ERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             ERL+L E+    ++  CG Y+ + G + Y++YLFLQ ++F ++GFGY+G  V
Sbjct  491   ERLNLLELGFAAFLFVCGCYDYVHGKHNYFIYLFLQTLTFSIVGFGYVGTIV  542



>gb|KHN45690.1| Glucomannan 4-beta-mannosyltransferase 9 [Glycine soja]
Length=497

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/510 (63%), Positives = 415/510 (81%), Gaps = 13/510 (3%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             +G++W Q K  VIVP+LRV V+LCL M +M+L+E+VY+G V   +KLF R P K+YKWEP
Sbjct  1     MGLIWSQVKEPVIVPMLRVSVFLCLAMSLMMLVERVYMGIVICLVKLFGRRPEKRYKWEP  60

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             +K  DD E+GNS YP VLVQ+PM NE+ VYQLSIGAAC LSWP++RIIIQVLDDST+P +
Sbjct  61    MK--DDVELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQVLDDSTNPTI  118

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K LVQ EC RWA KGVNIKYE RDNR G+KAG+LK+GMK +YVK C+YVAIFDADF+PDP
Sbjct  119   KELVQMECSRWASKGVNIKYEVRDNRDGYKAGALKEGMKRNYVKQCDYVAIFDADFQPDP  178

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFL+RT+PFLV+NP++ LVQARWK+VNANEC++TR+QEMS+D HF+VEQEVGS  +AFFG
Sbjct  179   DFLWRTVPFLVNNPELALVQARWKFVNANECLMTRMQEMSLDYHFTVEQEVGSCTYAFFG  238

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRI+AL ++GGW  RTTVEDMDL  RA L+GWKF++L +++VK+ELPS+  AY
Sbjct  239   FNGTAGVWRISALYESGGWNHRTTVEDMDLAVRASLRGWKFLYLPNLKVKNELPSTLNAY  298

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             R+QQHRWSCGPANLF KM  EIMRN+KV+++KK+Y+IY+FFFV K+VAH+ TF++YC+VL
Sbjct  299   RFQQHRWSCGPANLFMKMFMEIMRNRKVSLYKKIYVIYSFFFVRKVVAHINTFMFYCIVL  358

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             PATV++PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+LFEN M+LHRT  T IGL
Sbjct  359   PATVVVPEVVVPKWGAVYIPSIITLLNAVGTPRSLHLLVFWILFENTMSLHRTKATIIGL  418

Query  547   LEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFG  368
             LE  R +EW+VT+     K   PKS     RFR+    H+ E++VGFY+ FCG Y+++FG
Sbjct  419   LEGSRANEWIVTQ-----KGKPPKS-----RFRIRIH-HMLELLVGFYLFFCGCYDIMFG  467

Query  367   DNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              N YY++L++Q ++F ++ FGY+G F   S
Sbjct  468   KNRYYIFLYIQSIAFFIMAFGYVGIFDPNS  497



>ref|XP_007027601.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
2, partial [Theobroma cacao]
 gb|EOY08103.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
2, partial [Theobroma cacao]
Length=485

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/477 (66%), Positives = 398/477 (83%), Gaps = 7/477 (1%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +G  D  +  + V+W Q KA +IVP+LR+ V +CL+M +M+ +E+VY+G V   +KLF R
Sbjct  15    QGTRDDFSMQMAVIWGQIKAPLIVPLLRLTVIVCLIMSLMLFIERVYMGIVIMLVKLFGR  74

Query  1657  TPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQ  1478
              P ++YKWEPIK  DD E+GNS YP VLVQIPM NE+ VYQLSIGAAC LSWP++RIIIQ
Sbjct  75    KPERRYKWEPIK--DDVELGNSAYPMVLVQIPMYNEREVYQLSIGAACGLSWPSDRIIIQ  132

Query  1477  VLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVA  1298
             VLDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMK SYVK C+YV 
Sbjct  133   VLDDSTDPTIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKHCDYVV  192

Query  1297  IFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQE  1118
             IFDADF+P+PDFL+RTIPFLVHNP++ LVQARWK+VNA+EC++TR+QEMS+D HF+VEQE
Sbjct  193   IFDADFQPEPDFLWRTIPFLVHNPELALVQARWKFVNADECLMTRMQEMSLDYHFTVEQE  252

Query  1117  VGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVK  938
             VGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA LKGWKF++LG ++VK
Sbjct  253   VGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLKVK  312

Query  937   SELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHV  758
             +ELPS+ KAYRYQQHRWSCGPANLF+KM  EI+ NKKV+ WKK+++IY+FF V K+VAH+
Sbjct  313   NELPSTLKAYRYQQHRWSCGPANLFRKMVMEIITNKKVSSWKKVHVIYSFFVVRKLVAHI  372

Query  757   LTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMAL  578
             +TFI+YC+VLPATVL+PE+++P WGA+Y+PT+  +L  +  PRSLH+  FW+LFENVM+L
Sbjct  373   VTFIFYCVVLPATVLVPEVEVPKWGAVYIPTIITILNAVGTPRSLHLLVFWILFENVMSL  432

Query  577   HRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKS-AKKVPRFRLGERLHLWEIIVG  410
             HRT  TFIGLLE GR++EW+VTEK G+   A+  + A + PRF    RLHL E+ VG
Sbjct  433   HRTKATFIGLLEAGRVNEWIVTEKLGDALKAKAGTKAPRKPRF----RLHLLELCVG  485



>gb|KHN38673.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=543

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/533 (58%), Positives = 417/533 (78%), Gaps = 16/533 (3%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             ++ G    +A  + ++W   KA +IVP+L + VY+ L M +M+ ME+VY+G V   +KLF
Sbjct  13    SINGVNFDVAAQIKMVWEVMKAPLIVPLLNLAVYISLAMALMLFMERVYMGIVIILVKLF  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              + P ++YK+EP+  +DD E+GNS YP VLVQIPM NEK VY++SIGAACNLSWP +R++
Sbjct  73    WKKPHQRYKFEPL--QDDEELGNSNYPVVLVQIPMFNEKEVYKVSIGAACNLSWPADRLV  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTDP VK +V+ EC+RWA KG+NI Y+ R+ R G+KAG+LK+G+K +YVK CEY
Sbjct  131   IQVLDDSTDPTVKQMVEMECQRWASKGINIVYQIRETRGGYKAGALKEGLKRNYVKHCEY  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF P+PDFL R+IPFLV NPDI LVQARW++VN++EC+LTR+QEMS+D HF+VE
Sbjct  191   VAIFDADFRPEPDFLRRSIPFLVGNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGSA HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++
Sbjct  251   QEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQ  310

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
              KSELPS+ +A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+A
Sbjct  311   AKSELPSTLRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIA  370

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TF +YC+V+P T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM
Sbjct  371   HMVTFFFYCVVIPLTILVPEVHVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVM  430

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNT--------------KTAQPKSAKKVPRFRL  446
             +LHRT  TFIGLLE GR +EWVVTEK G++              K    K+  K  R + 
Sbjct  431   SLHRTKATFIGLLEYGRANEWVVTEKLGDSVNNNNKNKSGDAAKKNNAIKATPKKTRSKF  490

Query  445   GERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              ERL+L E+    ++  CG Y+ + G + Y++YLFLQ ++F ++GFGY+G  V
Sbjct  491   VERLNLLELGFAAFLFVCGCYDYVHGKHNYFIYLFLQTLTFSIVGFGYVGTIV  543



>ref|XP_009603536.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X2 [Nicotiana tomentosiformis]
Length=494

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/530 (60%), Positives = 406/530 (77%), Gaps = 39/530 (7%)
 Frame = -1

Query  1864  IMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAV  1685
             ++FSS  A+  A + I   +G+ W Q +A +IVP++R+++++CL +  M+ +E++Y+G V
Sbjct  3     MIFSSSVALLNARNGITSQVGLFWQQTRAPLIVPLIRIVLFVCLALSFMLFVERLYMGIV  62

Query  1684  SAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLS  1505
              A++KL RR P K+YKWEP+KK DD E+GNS YP VLVQIPM NEK VYQLSIGAAC+LS
Sbjct  63    IAFIKLVRRKPEKKYKWEPMKK-DDLELGNSSYPVVLVQIPMYNEKEVYQLSIGAACSLS  121

Query  1504  WPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHS  1325
             WP NRI IQVLDDSTDP +KALV+QECR WA KG+NIKYE RDNRKG+KAG+L++GMKHS
Sbjct  122   WPANRIFIQVLDDSTDPAIKALVEQECRIWASKGINIKYEIRDNRKGYKAGALREGMKHS  181

Query  1324  YVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSM  1145
             YV  C +VAIFDADF+P+PDFL RTIPFLVHNPDIGLVQARW++                
Sbjct  182   YVNLCSHVAIFDADFQPEPDFLERTIPFLVHNPDIGLVQARWEF----------------  225

Query  1144  DRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKF  965
                                  GTAG+WR++AL++AGGWKDRTTVEDMDL  RAGL GWKF
Sbjct  226   ---------------------GTAGVWRMSALNEAGGWKDRTTVEDMDLAVRAGLNGWKF  264

Query  964   VFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFF  785
             V++GD++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI  NKKV++WKK YLIY+FF
Sbjct  265   VYVGDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAKEIATNKKVSVWKKFYLIYSFF  324

Query  784   FVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFW  605
             FV KI+AHV+TF+ YC+V+PATV +PE+++P WGA+Y+P+   LL +L   RS+++  +W
Sbjct  325   FVRKIIAHVVTFVLYCVVMPATVFVPEVQVPKWGAIYIPSAITLLNVLGSTRSMYLVVYW  384

Query  604   MLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHL  428
             +LFENVM+LHRT  TF+GL E GR++EW+VTEK G+  KT     A +  RFR+GER+H+
Sbjct  385   ILFENVMSLHRTKATFVGLFESGRVNEWIVTEKLGDALKTKMGSKASRKLRFRVGERVHV  444

Query  427   WEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              E+ VG ++LFCGWY+  FG + +YVYLFLQ  +F V+GFGYIG FV  S
Sbjct  445   LELFVGLHLLFCGWYDFSFGKSRFYVYLFLQAAAFFVVGFGYIGVFVPNS  494



>ref|XP_009793132.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X3 [Nicotiana sylvestris]
Length=494

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/530 (59%), Positives = 404/530 (76%), Gaps = 39/530 (7%)
 Frame = -1

Query  1864  IMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAV  1685
             ++FSS AA+  A + I   +G+ W Q KA +I P+LR+++++CL +  M+ +E++Y+G V
Sbjct  3     MIFSSSAALLSARNGITSQVGLFWQQTKAPLIAPLLRIVLFVCLALSFMLFVERLYMGIV  62

Query  1684  SAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLS  1505
              A++KL RR P K+YKWE +KK DD E+GNS YP VLVQIPM NEK VYQLSIGAACNLS
Sbjct  63    IAFIKLLRRKPEKKYKWESMKK-DDLELGNSSYPMVLVQIPMYNEKEVYQLSIGAACNLS  121

Query  1504  WPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHS  1325
             WP NRI IQVLDDSTDP +KALV+QECRRWA KGVNIKYE RDNRKG+KAG+L++GMKHS
Sbjct  122   WPANRIFIQVLDDSTDPAIKALVEQECRRWASKGVNIKYEIRDNRKGYKAGALREGMKHS  181

Query  1324  YVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSM  1145
             YVK C +VAIFDADF+P+PDFL R IPFLVHNP+IGLVQARW++                
Sbjct  182   YVKLCSHVAIFDADFQPEPDFLERAIPFLVHNPEIGLVQARWEF----------------  225

Query  1144  DRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKF  965
                                  GTAG+WR++AL++AGGWKDRTTVEDMDL  RAGL GWKF
Sbjct  226   ---------------------GTAGVWRMSALNEAGGWKDRTTVEDMDLAVRAGLNGWKF  264

Query  964   VFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFF  785
             V++ D++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI  NKKV++WKK YLIY+FF
Sbjct  265   VYVCDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAKEIATNKKVSVWKKFYLIYSFF  324

Query  784   FVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFW  605
             FV KI+AH++TF+ YC+V+PATV +PE+++P WGA+Y+P+   +L +L  PRS+++  +W
Sbjct  325   FVRKIIAHIVTFVLYCVVMPATVFVPEVQVPKWGAIYIPSAITILNVLGSPRSMYLVVYW  384

Query  604   MLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHL  428
             +LFENVM+LHRT  TF+GL E GR++EW+VTEK G+  KT       +  RFR+GER+HL
Sbjct  385   ILFENVMSLHRTKATFVGLFESGRVNEWIVTEKLGDALKTKVSSKTSRKLRFRVGERVHL  444

Query  427   WEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              E+ VG Y+ FCGWY+  FG + ++VYLFLQ  +F V+GFGY+G FV  S
Sbjct  445   LELFVGLYLWFCGWYDFSFGKSRFHVYLFLQAAAFFVVGFGYVGVFVPNS  494



>ref|XP_003539806.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine 
max]
 gb|KHN21108.1| Glucomannan 4-beta-mannosyltransferase 2 [Glycine soja]
Length=543

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/533 (58%), Positives = 416/533 (78%), Gaps = 16/533 (3%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             ++ G    +A  + ++W   KA +IVP+L + VY+ L M +M+ ME+VY+G V   +KLF
Sbjct  13    SINGVNFDVAAQIKMVWEVIKAPLIVPLLNLAVYISLAMALMLFMERVYMGIVIILVKLF  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              + P ++YK+EP+  +DD E+GNS YP VLVQIPM NEK VY++SIGAACNLSWP +R++
Sbjct  73    WKKPHQRYKFEPL--QDDEELGNSNYPVVLVQIPMFNEKEVYKVSIGAACNLSWPVDRLV  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTDP +K +V+ EC RWA KG+NI Y+ R+ R G+KAG+LK+G+K +YVK CEY
Sbjct  131   IQVLDDSTDPTIKQMVEMECNRWASKGINIVYQIRETRGGYKAGALKEGLKRNYVKHCEY  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF P+PDFL R+IPFLV NPDI LVQARW++VN++EC+LTR+QEMS+D HF+VE
Sbjct  191   VAIFDADFRPEPDFLRRSIPFLVGNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGSA HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++
Sbjct  251   QEVGSATHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQ  310

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
              KSELPS+ +A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+A
Sbjct  311   AKSELPSTLRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVKFWKKVYVIYSFFFVRKIIA  370

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TF +YC+V+P T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM
Sbjct  371   HMVTFFFYCVVIPLTILVPEVHVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVM  430

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNT--------------KTAQPKSAKKVPRFRL  446
             +LHRT  TFIGLLE GR +EWVVTEK G++              K    K+  K  R + 
Sbjct  431   SLHRTKATFIGLLEYGRANEWVVTEKLGDSVNNNNKNKSGDAAKKNNAIKATPKKTRSKF  490

Query  445   GERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              ERL+L E+    ++  CG Y+ + G + Y++YLFLQ ++F ++GFGY+G  V
Sbjct  491   VERLNLLELGFAVFLFVCGCYDYVHGKHNYFIYLFLQTLTFSIVGFGYVGTIV  543



>gb|EYU36982.1| hypothetical protein MIMGU_mgv1a004240mg [Erythranthe guttata]
Length=538

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/526 (60%), Positives = 409/526 (78%), Gaps = 9/526 (2%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +G    IA  +G+LW   KA +IVPVL V VY+CL M IM+ ME++Y+G V   +KLF R
Sbjct  15    QGYTPEIAGQIGLLWELIKAPLIVPVLTVCVYICLAMSIMVFMERLYMGVVIVLVKLFWR  74

Query  1657  TPAKQYKWEPIKKE-DDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIII  1481
              P K+YKWEP++++ DD E   + +P VLVQIPM NEK VY++SIGAACNLSWP +R++I
Sbjct  75    KPEKRYKWEPMEEDADDLEAAGANFPIVLVQIPMFNEKEVYKISIGAACNLSWPADRLVI  134

Query  1480  QVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYV  1301
             QVLDDSTD  VK +V++EC RWA KGVNIKY+ R++R G+KAG+LK+G+KH Y+K CEYV
Sbjct  135   QVLDDSTDFVVKDMVERECLRWASKGVNIKYQIRESRGGYKAGALKEGLKHDYIKQCEYV  194

Query  1300  AIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQ  1121
              IFDADF P+PDFL R +PFL+HNPDI LVQARW++VN+NECMLTR+QEMS+D HF VEQ
Sbjct  195   VIFDADFRPEPDFLKRAVPFLIHNPDIALVQARWRFVNSNECMLTRMQEMSLDYHFKVEQ  254

Query  1120  EVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRV  941
             EVGSA HAFFGFNGT GIWRI A+++AGGWKDRTTVEDMDL  RAGLKGWKF++LGD++V
Sbjct  255   EVGSATHAFFGFNGTGGIWRIGAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLQV  314

Query  940   KSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAH  761
             KSELPS+FKA+R+QQHRWSCGPANLF+KM  +I  NKKVT++KK Y+IY+FFFV KI+AH
Sbjct  315   KSELPSTFKAFRFQQHRWSCGPANLFRKMVMDIATNKKVTLYKKCYVIYSFFFVRKIIAH  374

Query  760   VLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMA  581
               TF +YCL+LP T+L+PE+ +P WG++Y+P +  +L  +  PRS H+  +W+LFENVM+
Sbjct  375   FFTFFFYCLILPLTILVPEVYVPKWGSIYIPCIITMLNSVGTPRSFHLLFYWVLFENVMS  434

Query  580   LHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFR------LGERLHLWEI  419
              HRT  T IGL E  R++EWVVTEK G+    + KS  K   F+      LG+R+ + E+
Sbjct  435   FHRTKATLIGLFEAKRVNEWVVTEKLGD--GVKNKSNNKSIGFKKSIFKFLGDRVSVHEL  492

Query  418   IVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
                 ++  CG Y+ ++  N Y++YLFLQ ++F + GFGY+G FV +
Sbjct  493   GFAAFLFVCGCYDFLYWKNNYFIYLFLQTITFTIAGFGYVGTFVPS  538



>gb|AFW87395.1| hypothetical protein ZEAMMB73_638072, partial [Zea mays]
Length=479

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/481 (63%), Positives = 395/481 (82%), Gaps = 3/481 (1%)
 Frame = -1

Query  1729  MLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNE  1550
             M  M+  EKVY+  V A  +L  R P ++Y+W+PI+  DD E   + YP VLVQIPM NE
Sbjct  1     MSAMLFAEKVYMAVVVAASRLLGRRPERRYRWQPIRDGDDLE-AAAAYPMVLVQIPMFNE  59

Query  1549  KRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNR  1370
             + VY++SIGAAC LSWP++RII+QVLDDSTDP VK LV+ EC RWA KGVN+KYE RD+R
Sbjct  60    REVYKVSIGAACGLSWPSDRIIVQVLDDSTDPVVKELVRAECWRWASKGVNVKYEVRDSR  119

Query  1369  KGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYV  1190
             +G+KAG+L++GMK +Y + C+ VAIFDADF+P+PDFL+R +PFL+HNPD+ LVQARWK+V
Sbjct  120   RGYKAGALREGMKRAYARGCDLVAIFDADFQPEPDFLWRAVPFLLHNPDLALVQARWKFV  179

Query  1189  NANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVE  1010
             NA+EC++TR+QEMS+D HF+VEQEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVE
Sbjct  180   NADECLMTRMQEMSLDYHFAVEQEVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVE  239

Query  1009  DMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNK  830
             DMDL  RA LKGWKFV++GD+ VKSELPS+ KAYRYQQHRWSCGPANLF+K   EI+RNK
Sbjct  240   DMDLAVRASLKGWKFVYIGDLMVKSELPSTLKAYRYQQHRWSCGPANLFRKTLVEIVRNK  299

Query  829   KVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltall  650
             KVT+WKK+++IY FF V KIVAH +TF++YC+V+P TVL+PE+++P WG++Y+PT+  LL
Sbjct  300   KVTLWKKIHVIYNFFLVRKIVAHAVTFVFYCIVIPTTVLVPEVQVPKWGSVYIPTVITLL  359

Query  649   tlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSA  470
             + +  PRS H+  FW LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+    + K  
Sbjct  360   SAVATPRSAHLVVFWTLFENVMSLHRTKATFIGLLEAGRVNEWVVTEKLGD--ALRTKVP  417

Query  469   KKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAF  290
              K PR R+G+RLH+ E+ V  Y+LFCG Y++ FG+N YY++LFLQ ++F ++G GY+G F
Sbjct  418   GKKPRMRIGDRLHVLELGVAAYLLFCGCYDIAFGNNRYYIFLFLQSIAFFIVGIGYVGTF  477

Query  289   V  287
             V
Sbjct  478   V  478



>ref|XP_004145779.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Cucumis 
sativus]
Length=539

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/527 (60%), Positives = 418/527 (79%), Gaps = 11/527 (2%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G GD     + ++W   KA +IVPVLR+MVY+ L M +M+  E++Y+G V   +KLF + 
Sbjct  16    GRGD-FTEQIWLIWELIKAPLIVPVLRLMVYISLAMSLMLFFERLYMGIVIILVKLFWKK  74

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YK+EPI  +DD E+G+S +P VL+QIPM NE+ VY++SIGAAC LSWP +R++IQV
Sbjct  75    PEKRYKYEPI--QDDLELGSSNFPHVLIQIPMFNEREVYKISIGAACGLSWPADRLVIQV  132

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K +V+QEC RWA KG+NI Y+ R+ R G+KAG+LK+G+K SYVK CEYVAI
Sbjct  133   LDDSTDPVIKQMVEQECLRWASKGINITYQIRETRGGYKAGALKEGLKRSYVKHCEYVAI  192

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF P+PD+L R IPFLV+NPDI LVQARW++VNA+EC+LTR+QEMS+D HF+VEQEV
Sbjct  193   FDADFRPEPDYLRRAIPFLVNNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEV  252

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+GWKFV+LGD++VKS
Sbjct  253   GSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDLQVKS  312

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+AH++
Sbjct  313   ELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIAHMV  372

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF +YC+VLP T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+LH
Sbjct  373   TFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLH  432

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGN----TKTAQPKSAKKVPRFRL----GERLHLWEI  419
             RT  T IGLLE GR +EWVVTEK G+       A  K+  K+P+ RL    G+R++  E+
Sbjct  433   RTKATLIGLLEAGRANEWVVTEKLGDALKNKAAADKKAGGKIPKVRLRCKFGDRINTLEL  492

Query  418   IVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
                 ++  CG Y+ + G N Y++YLFLQ  SFL+ G GY+G  + +S
Sbjct  493   GFAAFLFLCGCYDFVHGKNNYFIYLFLQTFSFLITGIGYVGTIIPSS  539



>ref|XP_007132379.1| hypothetical protein PHAVU_011G089900g [Phaseolus vulgaris]
 gb|ESW04373.1| hypothetical protein PHAVU_011G089900g [Phaseolus vulgaris]
Length=542

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/532 (58%), Positives = 419/532 (79%), Gaps = 15/532 (3%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             +++G    +   + ++W   KA +IVP++ V VY+CL M +M+ ME+VY+G V   +KLF
Sbjct  13    SIQGVNFDVTAQMRMVWEVIKAPLIVPLMNVAVYICLAMALMLFMERVYMGIVIILVKLF  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              + P ++YK+EP+  ++D E+GN+ +P VL+QIPM NE+ VY++SIGAACNLSWP++R++
Sbjct  73    WKKPHQRYKFEPL--QEDEELGNTNFPVVLIQIPMFNEREVYKVSIGAACNLSWPSDRLV  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTDP +K +V+ EC+RWA KG+NI Y+ R+ R G+KAG+LK+G+K SYVK CEY
Sbjct  131   IQVLDDSTDPTIKQMVEMECQRWASKGINIIYQIRETRGGYKAGALKEGLKRSYVKHCEY  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF P+PDFL R+IPFLV NPDI LVQARW++VN++EC+LTR+QEMS+D HF+VE
Sbjct  191   VAIFDADFRPEPDFLRRSIPFLVGNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGSA HAFFGFNGTAG+WRI A+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++
Sbjct  251   QEVGSATHAFFGFNGTAGVWRIGAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQ  310

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
              KSELPS+ +A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+A
Sbjct  311   AKSELPSTLRAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYSFFFVRKIIA  370

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TF ++C+V+P T+LIPE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM
Sbjct  371   HMVTFFFFCVVIPITILIPEVYVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVM  430

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQG-----NTKTAQPKSAK--------KVPRFRLG  443
             +LHRT  TFIGLLE GR +EWVVTEK G     NTK     +AK        K  R +  
Sbjct  431   SLHRTKATFIGLLEYGRANEWVVTEKLGDSVNSNTKNKTGDAAKKNNVSKAPKKTRSKFV  490

Query  442   ERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             ERL+  E+    ++ FCG Y+ + G + Y++YLFLQ ++F ++GFGY+G  V
Sbjct  491   ERLNFLELGFAAFLFFCGCYDFVHGKHNYFIYLFLQTITFSIVGFGYVGTIV  542



>dbj|BAK03076.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=518

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/509 (60%), Positives = 408/509 (80%), Gaps = 4/509 (1%)
 Frame = -1

Query  1795  WVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKE  1616
             W Q +A VIVP+L++ V +CL+M +++ +E++Y+  V   +KL  R P ++YK +PI ++
Sbjct  11    WSQVRAPVIVPLLKLAVAVCLLMSVLLFLERLYMAVVIVGVKLLGRRPERRYKCDPISED  70

Query  1615  DDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALV  1436
             DD E+G++ +P VLVQIPM NE+ VYQLSIGA C LSWP++R+++QVLDDSTDP +K +V
Sbjct  71    DDPELGSAAFPVVLVQIPMFNEREVYQLSIGAVCGLSWPSDRLVVQVLDDSTDPLIKEMV  130

Query  1435  QQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLY  1256
             + EC RWA KG+NI Y+ R++RKG+KAG+LK GMKH YV+ CEY+ IFDADF+PDPDFL+
Sbjct  131   RMECERWAHKGINITYQIREDRKGYKAGALKAGMKHGYVRECEYMVIFDADFQPDPDFLH  190

Query  1255  RTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGT  1076
             RTIP+L HNP+I LVQARW++VNA+EC++TR+QEMS+D HF VEQEV S++ AFFGFNGT
Sbjct  191   RTIPYLHHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFKVEQEVSSSVCAFFGFNGT  250

Query  1075  AGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQ  896
             AG+WRI+A+++AGGWKDRTTVEDMDL  RA LKGWKFV+LGDV+VKSELPS+FKA+R+QQ
Sbjct  251   AGVWRISAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAFRFQQ  310

Query  895   HRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATV  716
             HRWSCGPANLF+KM  EI+ NKKVTIWKK ++IY FF V KIVAH++TF +YC+++P T+
Sbjct  311   HRWSCGPANLFRKMLLEIVTNKKVTIWKKFHVIYNFFLVRKIVAHIVTFTFYCIIIPTTI  370

Query  715   LIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVG  536
              +PE+ IP WG +Y+PT+  LL  +  PRS H+  FW+LFENVM+LHRT  T IGLLE G
Sbjct  371   FVPEVHIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKATLIGLLEAG  430

Query  535   RIHEWVVTEKQGNT---KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGD  365
             R +EWVVTEK G+    K+A   SA+K    R+ ERL++ E+ VG ++  CGWY++ FG 
Sbjct  431   RANEWVVTEKLGSAMKMKSANKASARK-SFMRMWERLNVPELGVGAFLFSCGWYDVAFGK  489

Query  364   NYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             + +++YLF Q ++F V+G GY+G  V  S
Sbjct  490   DNFFIYLFFQSMAFFVVGVGYVGTIVPPS  518



>ref|XP_007208460.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
 gb|EMJ09659.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
Length=540

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/530 (59%), Positives = 419/530 (79%), Gaps = 10/530 (2%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             + +G    IA  +G++W   KA +IVP+LR+ VY+ L M +M+  E++Y+G V   +KLF
Sbjct  13    SFQGGTYDIAGQMGLIWELIKAPLIVPLLRICVYISLAMSLMLFFERLYMGIVIILVKLF  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              + P K+YK+E I  ++D E+G+S +P VL+QIPM NE+ VY++SIGAAC LSWP++R++
Sbjct  73    WKKPEKRYKYEAI--QEDLELGSSNFPVVLIQIPMFNEREVYKISIGAACGLSWPSDRLV  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTDP +K +V+ EC+RWA KG+NI+Y+ R+ R G+KAG+LK+G+K SYVK CEY
Sbjct  131   IQVLDDSTDPTIKQMVELECQRWASKGINIRYQIRETRGGYKAGALKEGLKRSYVKHCEY  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF P+PD+L R IPFLVHNPDI LVQARW++VN++EC+LTR+QEMS+D HF+VE
Sbjct  191   VAIFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++
Sbjct  251   QEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQ  310

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VKSELPS+F A+R+QQHRWSCGPANLF+KM  EI++ KKVT+WKK Y+IY+FFFV KI+A
Sbjct  311   VKSELPSTFNAFRFQQHRWSCGPANLFRKMVMEIVKTKKVTLWKKFYVIYSFFFVRKIIA  370

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TF +YC+VLP T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM
Sbjct  371   HMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVM  430

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGN--------TKTAQPKSAKKVPRFRLGERLHL  428
             +LHRT  T IGLLE GR +EWVVTEK G+                  K P+F+ G RLHL
Sbjct  431   SLHRTKATLIGLLETGRANEWVVTEKLGDIVKNKAAEAAKKPAPKFFKRPKFKFGNRLHL  490

Query  427   WEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              E+  G ++  CG Y+ + G N Y+VYLFLQ ++FL+ GFGY+G  + +S
Sbjct  491   LELGFGAFLFVCGCYDYVHGKNNYFVYLFLQTITFLICGFGYVGTIIPSS  540



>ref|XP_006349077.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum 
tuberosum]
Length=524

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/526 (58%), Positives = 412/526 (78%), Gaps = 7/526 (1%)
 Frame = -1

Query  1846  AAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKL  1667
             + V+     IA  +G++W   KA ++VP+L+  VY+C+ M +M+ +E++Y+G V   +K+
Sbjct  2     STVQATAADIAGQIGMMWEVLKAPLLVPLLKAAVYICIAMELMLFVERLYMGIVIVLVKI  61

Query  1666  FRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRI  1487
             F + P K+YKW P+  +DD EIG++ +P VLVQIPM NEK VY++SIGAACNLSWP++R+
Sbjct  62    FMKKPDKRYKWIPMA-DDDLEIGSADFPKVLVQIPMFNEKEVYKISIGAACNLSWPSDRL  120

Query  1486  IIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCE  1307
             +IQVLDDSTDP VK +V+ EC RW  KG+NI Y+ R+ R G+KAG+LK+G+KH+YVK CE
Sbjct  121   VIQVLDDSTDPIVKDMVETECLRWESKGLNITYQIRETRGGYKAGALKEGLKHNYVKDCE  180

Query  1306  YVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSV  1127
             YV IFDADF P+PDFL R+IPFL+HNP+I LVQ RW++VN+NEC+LTR+QEMS+D HF+V
Sbjct  181   YVVIFDADFRPEPDFLRRSIPFLIHNPEIALVQGRWRFVNSNECLLTRMQEMSLDYHFTV  240

Query  1126  EQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDV  947
             EQEVGS+ HAFFGFNGT GIWRIAA+++AGGWKDRTTVEDMDL  RA LKGWKFV+LGD+
Sbjct  241   EQEVGSSTHAFFGFNGTGGIWRIAAIEEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDL  300

Query  946   RVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIV  767
             +VKSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNK+V  WKK Y+IY+FFFV KI+
Sbjct  301   QVKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNFWKKFYVIYSFFFVRKII  360

Query  766   AHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENV  587
             AH++TF ++C+VLP T+L+PE+++P+W A+Y+P +   L  +  PRS+H+  +W+LFENV
Sbjct  361   AHMVTFFFFCVVLPLTLLVPEVEVPIWAAIYIPCIITTLNSVGTPRSIHLLFYWILFENV  420

Query  586   MALHRTIGTFIGLLEVGRIHEWVVTEKQG----NTKTAQPKSAKKVPRFRLGERLHLWEI  419
             MA HRT  TFIGL E  R +EWVVTEK G    N   ++P    + P F  G+R+   E+
Sbjct  421   MAYHRTKATFIGLFEAKRANEWVVTEKLGDALKNKDKSKPVKKARGPLF--GDRILPQEL  478

Query  418   IVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
                 ++ FCG Y++++G   Y+VY+FLQ ++F + GFGYIG  V +
Sbjct  479   GFAAFLFFCGLYDVLYGKRQYFVYVFLQVITFTIAGFGYIGTIVPS  524



>ref|XP_003571119.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1 [Brachypodium 
distachyon]
Length=518

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/509 (60%), Positives = 408/509 (80%), Gaps = 4/509 (1%)
 Frame = -1

Query  1795  WVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKE  1616
             W Q +A VIVP+LR+ V +CL M +++ +E++Y+  V   +KL  R P ++YK +PI ++
Sbjct  11    WSQVRAPVIVPLLRLAVAVCLGMSVLLFLERLYMAVVIVGVKLLGRRPDRRYKCDPISED  70

Query  1615  DDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALV  1436
             DD E+G++ +P VLVQIPM NE+ VYQLSIGA C LSWP++R+++QVLDDSTD  VK +V
Sbjct  71    DDPELGSAAFPVVLVQIPMFNEREVYQLSIGAVCGLSWPSDRLVVQVLDDSTDAVVKEMV  130

Query  1435  QQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLY  1256
             + EC RWA KG+NI Y+ R++RKG+KAG+LKQGMKH YV+ CEYV IFDADF+PDPDFL+
Sbjct  131   RMECERWAHKGINITYQIREDRKGYKAGALKQGMKHGYVRECEYVVIFDADFQPDPDFLH  190

Query  1255  RTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGT  1076
             RTIP+L HNP+I LVQARW++VNA+EC++TR+QEMS+D HF+VEQEV S++ AFFGFNGT
Sbjct  191   RTIPYLHHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFFGFNGT  250

Query  1075  AGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQ  896
             AG+WRI+A+++AGGWKDRTTVEDMDL  RA LKGWKFV+LGDV+VKSELPS+FKA+R+QQ
Sbjct  251   AGVWRISAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAFRFQQ  310

Query  895   HRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATV  716
             HRWSCGPANLF+KM  EI+ NKKVTIWKK ++IY FF V KIVAH++TF +YC+++P T+
Sbjct  311   HRWSCGPANLFRKMLLEIVTNKKVTIWKKFHVIYNFFLVRKIVAHIVTFTFYCIIIPTTI  370

Query  715   LIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVG  536
              +PE+ IP WG +Y+PT+  LL  +  PRS H+  FW+LFENVM+LHRT  T IGLLE G
Sbjct  371   FVPEVHIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLHRTKATLIGLLEAG  430

Query  535   RIHEWVVTEKQGNT---KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGD  365
             R++EWVVTEK GN    K+A   SA+K    R+ +RL++ E+ VG ++   GWY++ FG 
Sbjct  431   RVNEWVVTEKLGNAMKMKSASKASARK-SFMRIWDRLNVPELGVGAFLFSIGWYDVAFGK  489

Query  364   NYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             + +++YLF Q ++F ++G GY+G  V  S
Sbjct  490   DNFFIYLFFQSMAFFIVGVGYVGTIVPQS  518



>emb|CDO99850.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/448 (68%), Positives = 383/448 (85%), Gaps = 1/448 (0%)
 Frame = -1

Query  1618  EDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKAL  1439
             ++D E+GN GYP VLVQIPMCNEK VYQLSIGAAC LSWPT+RIIIQVLDDSTDP +KAL
Sbjct  2     KEDLEMGNLGYPMVLVQIPMCNEKEVYQLSIGAACGLSWPTDRIIIQVLDDSTDPAIKAL  61

Query  1438  VQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFL  1259
              +QEC+RWA KG+NIKYE R+NR G+KAG+L++GMKHSYVK C+YVAIFDADF+P+ +FL
Sbjct  62    KEQECKRWASKGINIKYEIRENRNGYKAGALREGMKHSYVKLCDYVAIFDADFQPEHNFL  121

Query  1258  YRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNG  1079
              RTIPFLVHNP++ LVQ RWK+VN++EC++TR+QEMS++ HF VEQEVGS  +AFFGFNG
Sbjct  122   RRTIPFLVHNPELALVQTRWKFVNSDECLMTRMQEMSLNYHFIVEQEVGSRTYAFFGFNG  181

Query  1078  TAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQ  899
             TAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKFV++G+V+VK+ELPS+FKAYR+Q
Sbjct  182   TAGVWRISALNEAGGWKDRTTVEDMDLAIRASLKGWKFVYVGEVQVKNELPSTFKAYRHQ  241

Query  898   QHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPAT  719
             QHRWSCGPANLF+KM  EI+R KKV+ WKK YLIY+FF V KIVAH++TFI+YC+VLPAT
Sbjct  242   QHRWSCGPANLFRKMAMEIVRCKKVSPWKKFYLIYSFFLVRKIVAHMVTFIFYCVVLPAT  301

Query  718   VLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEV  539
             ++IPE+++P+WGA+Y+P++  LL  +  PRS H+  FW+LFENVM+LHRT  TFIGLLE 
Sbjct  302   IVIPEVQVPVWGAVYIPSVITLLNAVGTPRSFHLVIFWILFENVMSLHRTKATFIGLLEA  361

Query  538   GRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDN  362
             GR++EW+VTEK G+  +T       K PRFR+G+RLHL E+ VGFY+ FCG Y++ FG +
Sbjct  362   GRVNEWIVTEKLGHVLQTKLGSKVPKKPRFRMGDRLHLLELFVGFYLFFCGCYDVAFGKS  421

Query  361   YYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             ++++YLFLQ  +F   GFGY+G FV +S
Sbjct  422   HFFIYLFLQSTAFFTAGFGYVGTFVPSS  449



>ref|XP_007208459.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
 gb|EMJ09658.1| hypothetical protein PRUPE_ppa003918mg [Prunus persica]
Length=516

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/518 (59%), Positives = 414/518 (80%), Gaps = 10/518 (2%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             +G++W   KA +IVP+LR+ VY+ L M +M+  E++Y+G V   +KLF + P K+YK+E 
Sbjct  1     MGLIWELIKAPLIVPLLRICVYISLAMSLMLFFERLYMGIVIILVKLFWKKPEKRYKYEA  60

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             I  ++D E+G+S +P VL+QIPM NE+ VY++SIGAAC LSWP++R++IQVLDDSTDP +
Sbjct  61    I--QEDLELGSSNFPVVLIQIPMFNEREVYKISIGAACGLSWPSDRLVIQVLDDSTDPTI  118

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K +V+ EC+RWA KG+NI+Y+ R+ R G+KAG+LK+G+K SYVK CEYVAIFDADF P+P
Sbjct  119   KQMVELECQRWASKGINIRYQIRETRGGYKAGALKEGLKRSYVKHCEYVAIFDADFRPEP  178

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             D+L R IPFLVHNPDI LVQARW++VN++EC+LTR+QEMS+D HF+VEQEVGSA HAFFG
Sbjct  179   DYLRRAIPFLVHNPDIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEVGSATHAFFG  238

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++VKSELPS+F A+
Sbjct  239   FNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELPSTFNAF  298

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             R+QQHRWSCGPANLF+KM  EI++ KKVT+WKK Y+IY+FFFV KI+AH++TF +YC+VL
Sbjct  299   RFQQHRWSCGPANLFRKMVMEIVKTKKVTLWKKFYVIYSFFFVRKIIAHMVTFFFYCVVL  358

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             P T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+LHRT  T IGL
Sbjct  359   PLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKATLIGL  418

Query  547   LEVGRIHEWVVTEKQGN--------TKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFC  392
             LE GR +EWVVTEK G+                  K P+F+ G RLHL E+  G ++  C
Sbjct  419   LETGRANEWVVTEKLGDIVKNKAAEAAKKPAPKFFKRPKFKFGNRLHLLELGFGAFLFVC  478

Query  391   GWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             G Y+ + G N Y+VYLFLQ ++FL+ GFGY+G  + +S
Sbjct  479   GCYDYVHGKNNYFVYLFLQTITFLICGFGYVGTIIPSS  516



>ref|XP_002963530.1| glycosyltransferase family 2 protein [Selaginella moellendorffii]
 gb|EFJ35401.1| glycosyltransferase family 2 protein [Selaginella moellendorffii]
Length=528

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/517 (60%), Positives = 407/517 (79%), Gaps = 9/517 (2%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             +  +W+Q +A  I P L+V V +CLVML+M+ +E++Y+  V   +KL  + P  +YKWEP
Sbjct  14    INAMWLQIRAPYIAPALQVGVNICLVMLLMLFVERLYMALVMVLVKLSGKRPENKYKWEP  73

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             IK  DD E GNS YP VLVQ+PM NE+ VYQLSIGAAC LSWP++RII+Q+LDDSTD  +
Sbjct  74    IK--DDLESGNSAYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIVQILDDSTDLTI  131

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K LV+ EC+RWA KGVNIKYE RDNR G+KAG+LK+GMK SYVK C+YVAIFDADF+P+P
Sbjct  132   KNLVELECQRWASKGVNIKYEIRDNRNGYKAGALKEGMKRSYVKDCDYVAIFDADFQPEP  191

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFL+RTIP+LVHN DIGLVQARWK+VNA+ECM+TR+QEMS+  HF+VEQ VGSA +AFFG
Sbjct  192   DFLWRTIPYLVHNADIGLVQARWKFVNADECMMTRMQEMSLSYHFTVEQSVGSATYAFFG  251

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRIAA+ +AGGW  RTTVEDMDL  RAGL+GWKFV+L D+ VK+ELPS+FKAY
Sbjct  252   FNGTAGVWRIAAISEAGGWNSRTTVEDMDLAVRAGLRGWKFVYLDDLSVKNELPSTFKAY  311

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             RYQQHRWSCGPANLF+KM   ++  KKV++ KK  ++Y+FF V KIVAH++TFI++C+V+
Sbjct  312   RYQQHRWSCGPANLFRKMIPGVLAAKKVSMLKKFSILYSFFLVRKIVAHLVTFIFFCVVV  371

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             P  VL+PE+ +P WG++Y+P++  LL  +  P+SL    FW+LFENVM++HRT  T  GL
Sbjct  372   PTCVLVPEVNLPKWGSIYLPSMITLLNCMATPKSLPFLVFWVLFENVMSMHRTKATITGL  431

Query  547   LEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGE-------RLHLWEIIVGFYMLFCG  389
             L++GR++EW+VTEK G+    +    K+ P+ ++GE       R H++ +IVG Y+ FC 
Sbjct  432   LDIGRVNEWIVTEKLGDALKIKFAKLKQKPKQKIGERQAYISRRFHVFHLIVGLYIFFCA  491

Query  388   WYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              Y+L FG + YY+YL+LQ V+F ++GFGYIG +V  +
Sbjct  492   SYDLAFGRDRYYIYLYLQAVAFFIMGFGYIGTYVPNT  528



>ref|XP_006416081.1| hypothetical protein EUTSA_v10007266mg [Eutrema salsugineum]
 gb|ESQ34434.1| hypothetical protein EUTSA_v10007266mg [Eutrema salsugineum]
Length=555

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/511 (61%), Positives = 399/511 (78%), Gaps = 4/511 (1%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             +G +W + +  + +P+L+ +V LCLVM  ++ +E+VY+  V   +K+ RRTP K +KWE 
Sbjct  46    IGYIWKETRIFLFIPILKFLVTLCLVMSFLLFIERVYMSIVVVIVKILRRTPEKVHKWEA  105

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             IK +DD E+ N+ YP VL+QIPM NEK V QLSIGAAC LSWP +R+I+QVLDDSTDP  
Sbjct  106   IK-DDDLELANTNYPMVLIQIPMYNEKEVCQLSIGAACRLSWPLDRMIVQVLDDSTDPAS  164

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K LV  EC +WA +G+ I  E RDNR G+KAG+LK GM H+YVK CE+VAIFDADF+PDP
Sbjct  165   KDLVNAECDKWARRGITIMSEIRDNRVGYKAGALKAGMMHNYVKQCEFVAIFDADFQPDP  224

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFL RTIPFL+HN +I LVQ+RWK+VNA+EC++TR+QEMS++ HF  EQE GS+IH FFG
Sbjct  225   DFLARTIPFLIHNHEIALVQSRWKFVNADECLMTRMQEMSLNYHFLAEQESGSSIHGFFG  284

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA L GWKFV++ DV VK+ELPS+FKAY
Sbjct  285   FNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRACLHGWKFVYVHDVEVKNELPSTFKAY  344

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             R+QQHRWSCGPANL++KMT EI++NKKV+ WKKLYLIY FFF+ KIV H+ TF++YCL+L
Sbjct  345   RFQQHRWSCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLIL  404

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             P  VL PEL++P W  +YVPT   +L  L  PRSLH+  FW+LFENVM++HRT  TFIGL
Sbjct  405   PTIVLFPELQVPKWATVYVPTTITILNALATPRSLHLLVFWILFENVMSMHRTKATFIGL  464

Query  547   LEVGRIHEWVVTEKQGNTKTAQ--PKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLI  374
             LE GR++EWVVTEK G+T  ++   K+  K+   R G+R++  E++VG Y+  CG Y+  
Sbjct  465   LEAGRVNEWVVTEKLGDTLRSKLIAKATTKLYT-RFGQRINWRELVVGLYIFLCGCYDFA  523

Query  373   FGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             +G +Y+YVYLFLQ  +F V G GYIG  V T
Sbjct  524   YGGSYFYVYLFLQACAFFVAGVGYIGTIVPT  554



>ref|XP_011088835.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Sesamum 
indicum]
Length=536

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/528 (59%), Positives = 411/528 (78%), Gaps = 10/528 (2%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             A  G    I   +G+LW   KA +IVP+L + VY+CL M +M+ +E++Y+G V   +KLF
Sbjct  13    AFPGYSSDIGGQIGLLWELIKAPLIVPLLNLAVYICLAMSVMVFVERLYMGIVIILVKLF  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              + P K+YKWEP+   DD E+G+  +P VLVQIPM NEK VY++SIGAACNL+WP++R++
Sbjct  73    WKKPEKRYKWEPMN--DDLEMGSETFPKVLVQIPMFNEKEVYKISIGAACNLAWPSDRLV  130

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTD  VK +V++EC RWA KG+NI+Y+ R++R G+KAG+LK+G+ H YVK CEY
Sbjct  131   IQVLDDSTDLLVKDMVERECIRWASKGINIRYQIRESRGGYKAGALKEGLTHDYVKECEY  190

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             V IFDADF P+PDFL R +PFL+HNPDI LVQARW++VNA+EC+LTR+QEMS+D HF+VE
Sbjct  191   VVIFDADFRPEPDFLRRAVPFLIHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVE  250

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGSA HAFFGFNGT GIWRIAA++DAGGWKDRTTVEDMDL  RAGLKGWKF++LGD++
Sbjct  251   QEVGSATHAFFGFNGTGGIWRIAAINDAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLQ  310

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VKSELPS+FKA+R+QQHRWSCGPANLF+KM  EI  NKKVT++KK Y+IY+FF V K+VA
Sbjct  311   VKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIAMNKKVTLYKKFYVIYSFFIVRKLVA  370

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H+ TF +YC+VLP  +L+PE+++P WG++Y+P +   L  +  PRS ++  +W+LFENVM
Sbjct  371   HMFTFFFYCVVLPLAILVPEVEVPKWGSIYLPCIITALNSVGTPRSFYLLFYWVLFENVM  430

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFR------LGERLHLWE  422
             + HRT  TFIGLLE  R++EWVVTEK G+  T + KS  KVP  +      LG+R+ + E
Sbjct  431   SFHRTKATFIGLLEAKRVNEWVVTEKLGD--TLKNKSDNKVPAKKRSISKLLGDRIQVHE  488

Query  421   IIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             +    ++  C  Y+ ++G N Y++YLFLQ V+F + G GY+G  V +S
Sbjct  489   LGFAAFLFICACYDFLYGKNKYFIYLFLQVVTFTITGLGYVGTIVPSS  536



>gb|KHG21024.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
 gb|KHG23680.1| Glucomannan 4-beta-mannosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=537

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/521 (59%), Positives = 415/521 (80%), Gaps = 10/521 (2%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             D +   LG++W   KA ++VP+L++ VY+CL M +M+ ME+VY+G V   +KLF + P +
Sbjct  19    DDVTSQLGLMWELIKAPLLVPMLKLSVYICLGMALMLFMERVYMGIVIVLVKLFWKKPEE  78

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +YK+ PI  EDD E G+S +P VLVQIPM NEK VY++SIGAAC LSWP++R++IQVLDD
Sbjct  79    RYKFVPI--EDDEEHGSSNFPVVLVQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDD  136

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STD  +K +V+QEC+RWA KG+NI Y+ R+NR G+KAG+LK+G+K SYVK CEYVAI DA
Sbjct  137   STDSAIKLMVEQECQRWASKGINITYQIRENRTGYKAGALKEGLKRSYVKHCEYVAIIDA  196

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
             DF PDPDFL ++IPFL HNPDI LVQARW++VNA+EC+LTR+QEMS+D HF+VEQEVGSA
Sbjct  197   DFRPDPDFLRKSIPFLDHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFTVEQEVGSA  256

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              HAFFGFNGTAGIWRI A+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++VKSELP
Sbjct  257   THAFFGFNGTAGIWRIGAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKSELP  316

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKA+R+QQHRWSCGPANLF+KM  EI+ NKKV  WKK+Y+IY+FFFV KI+AH++TF 
Sbjct  317   STFKAFRFQQHRWSCGPANLFRKMVCEIITNKKVRFWKKVYVIYSFFFVRKIIAHMVTFF  376

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+VLP T+L+PE+K+P+WG++Y+P++  +L  +  PRS+H+  +W+LFENVM+LHRT 
Sbjct  377   FYCVVLPLTILVPEVKVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTK  436

Query  565   GTFIGLLEVGRIHEWVVTEKQGNT--KTAQPK----SAKKVPRFR--LGERLHLWEIIVG  410
              T IGL E GR +EWVVTEK G+   K A+      ++K + R+R    +RL+  E+   
Sbjct  437   ATLIGLFETGRANEWVVTEKLGDVAKKVAEANKNKTNSKAIKRYRSKFIDRLNTLELGFS  496

Query  409   FYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              ++  CG ++ ++G N Y++YL+LQ ++F + G GY+G  +
Sbjct  497   AFLFLCGCFDFMYGKNNYFIYLWLQTITFFITGIGYVGTII  537



>ref|XP_009115523.1| PREDICTED: probable mannan synthase 3 [Brassica rapa]
 ref|XP_009115524.1| PREDICTED: probable mannan synthase 3 [Brassica rapa]
Length=555

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/505 (62%), Positives = 395/505 (78%), Gaps = 2/505 (0%)
 Frame = -1

Query  1798  LWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKK  1619
             +W + +  V +P+L+ +V +CLVM  ++ +E+VY+  V   +KL RRTP K +KWE I  
Sbjct  49    IWKETRIFVFIPILKFLVTMCLVMSFLLFIERVYMSVVVVIVKLLRRTPEKVHKWEAIN-  107

Query  1618  EDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKAL  1439
             +DD E+ ++ YP VL+QIPM NEK V QLSIGAAC LSWP +R+I+QVLDDSTDP  K L
Sbjct  108   DDDLELAHTNYPMVLIQIPMYNEKEVCQLSIGAACRLSWPLDRMIVQVLDDSTDPASKEL  167

Query  1438  VQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFL  1259
             V  EC +WA KG+NI  E RDNR G+KAG+LK GM H+YVK CE+VAIFDADF+PDPDFL
Sbjct  168   VNAECDKWARKGINIMSEIRDNRIGYKAGALKAGMMHNYVKQCEFVAIFDADFQPDPDFL  227

Query  1258  YRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNG  1079
              RTIPFL+HN +I LVQ RWK+VNANEC++TR+QEMS++ HF  EQE GS+IHAFFGFNG
Sbjct  228   ARTIPFLIHNREISLVQCRWKFVNANECLMTRMQEMSLNYHFLAEQESGSSIHAFFGFNG  287

Query  1078  TAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQ  899
             TAG+WRIAAL++AGGWKDRTTVEDMDL  RA L GWKFV++ +V VK+ELPS+FKAYR+Q
Sbjct  288   TAGVWRIAALNEAGGWKDRTTVEDMDLAVRACLHGWKFVYVHNVEVKNELPSTFKAYRFQ  347

Query  898   QHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPAT  719
             QHRWSCGPANL++KMT EI++NKKV+ WKKLYLIY FFF+ KIV H+ TF++YCL+LPAT
Sbjct  348   QHRWSCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPAT  407

Query  718   VLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEV  539
             VL PEL++P W  +YVP+   LL  L  PRSLH+  FW+LFENVM++HRT  TFIGLLE 
Sbjct  408   VLFPELQVPKWATVYVPSTITLLNALATPRSLHLLVFWILFENVMSMHRTKATFIGLLEA  467

Query  538   GRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDN  362
             GR++EWVVTEK G+T K+     A      R G+R++  E++VG Y+  CG Y+  +G +
Sbjct  468   GRVNEWVVTEKLGDTLKSKLITKATTKLYTRFGQRINWRELVVGLYIFICGCYDFAYGGS  527

Query  361   YYYVYLFLQGVSFLVIGFGYIGAFV  287
             Y+YVYLFLQ  +F V G GYIG  V
Sbjct  528   YFYVYLFLQACAFFVAGVGYIGTIV  552



>ref|XP_002981551.1| family 2 glycosyltransferase [Selaginella moellendorffii]
 gb|EFJ17366.1| family 2 glycosyltransferase [Selaginella moellendorffii]
Length=529

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/518 (60%), Positives = 409/518 (79%), Gaps = 10/518 (2%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             +  +W+Q +A  I P L+V V +CLVML+M+ +E++Y+  V   +KL  + P  +YKWEP
Sbjct  14    INAMWLQIRAPYIAPALQVGVNICLVMLLMLFVERLYMALVMVLVKLSGKRPENKYKWEP  73

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             IK  DD E GNS YP VLVQ+PM NE+ VYQLSIGAAC LSWP++RII+Q+LDDSTD  +
Sbjct  74    IK--DDLESGNSAYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIVQILDDSTDLTI  131

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K LV+ EC+RWA KGVNIKYE RDNR G+KAG+LK+GMK SYVK C+YVAIFDADF+P+P
Sbjct  132   KNLVELECQRWASKGVNIKYEIRDNRNGYKAGALKEGMKRSYVKDCDYVAIFDADFQPEP  191

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFL+RTIP+LVHN DIGLVQARWK+VNA+ECM+TR+QEMS+  HF+VEQ VGSA +AFFG
Sbjct  192   DFLWRTIPYLVHNADIGLVQARWKFVNADECMMTRMQEMSLSYHFTVEQSVGSATYAFFG  251

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRIAA+ +AGGW  RTTVEDMDL  RAGL+GWKFV+L D+ VK+ELPS+FKAY
Sbjct  252   FNGTAGVWRIAAISEAGGWNSRTTVEDMDLAVRAGLRGWKFVYLDDLSVKNELPSTFKAY  311

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             RYQQHRWSCGPANLF+KM   ++  KKV++ KK  ++Y+FF V KIVAH++TFI++C+V+
Sbjct  312   RYQQHRWSCGPANLFRKMIPGVLAAKKVSMLKKFSILYSFFLVRKIVAHLVTFIFFCVVV  371

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             P  VL+PE+ +P WG++Y+P++  LL  +  P+SL    FW+LFENVM++HRT  TF GL
Sbjct  372   PTCVLVPEVNLPKWGSIYLPSMITLLNCMATPKSLPFLVFWVLFENVMSMHRTKATFTGL  431

Query  547   LEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGE-------RLHLW-EIIVGFYMLFC  392
             L++GR++EW+VTEK G+    +    K+ P+ ++GE       R H++ E+IVG Y+ FC
Sbjct  432   LDIGRVNEWIVTEKLGDALKIKFAKLKQKPKQKIGERQAYISQRFHVFHELIVGLYIFFC  491

Query  391   GWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
               Y+L FG + YY+YL+LQ V+F ++GFGYIG +V  +
Sbjct  492   ASYDLAFGRDRYYIYLYLQAVAFFIMGFGYIGTYVPNT  529



>emb|CDY44151.1| BnaA09g31010D [Brassica napus]
Length=555

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/505 (62%), Positives = 395/505 (78%), Gaps = 2/505 (0%)
 Frame = -1

Query  1798  LWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKK  1619
             +W + +  V +P+L+ +V +CLVM  ++ +E+VY+  V   +KL RRTP K +KWE I  
Sbjct  49    IWKETRIFVFIPILKFLVTMCLVMSFLLFIERVYMSVVVVIVKLLRRTPEKVHKWEAIN-  107

Query  1618  EDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKAL  1439
             +DD E+ ++ YP VL+QIPM NEK V QLSIGAAC LSWP +R+I+QVLDDSTDP  K L
Sbjct  108   DDDLELAHTNYPMVLIQIPMYNEKEVCQLSIGAACRLSWPLDRMIVQVLDDSTDPASKEL  167

Query  1438  VQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFL  1259
             V  EC +WA KG+NI  E RDNR G+KAG+LK GM H+YVK CE+VAIFDADF+PDPDFL
Sbjct  168   VNAECDKWARKGINIMSEIRDNRIGYKAGALKAGMMHNYVKQCEFVAIFDADFQPDPDFL  227

Query  1258  YRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNG  1079
              RTIPFL+HN +I LVQ RWK+VNANEC++TR+QEMS++ HF  EQE GS+IHAFFGFNG
Sbjct  228   ARTIPFLIHNREISLVQCRWKFVNANECLMTRMQEMSLNYHFLAEQESGSSIHAFFGFNG  287

Query  1078  TAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQ  899
             TAG+WRIAAL++AGGWKDRTTVEDMDL  RA L GWKFV++ +V VK+ELPS+FKAYR+Q
Sbjct  288   TAGVWRIAALNEAGGWKDRTTVEDMDLAVRACLHGWKFVYVHNVEVKNELPSTFKAYRFQ  347

Query  898   QHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPAT  719
             QHRWSCGPANL++KMT EI++NKKV+ WKKLYLIY FFF+ KIV H+ TF++YCL+LPAT
Sbjct  348   QHRWSCGPANLWRKMTMEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPAT  407

Query  718   VLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEV  539
             VL PEL++P W  +YVP+   LL  L  PRSLH+  FW+LFENVM++HRT  TFIGLLE 
Sbjct  408   VLFPELQVPKWATVYVPSTITLLNALATPRSLHLLVFWILFENVMSMHRTKATFIGLLEA  467

Query  538   GRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDN  362
             GR++EWVVTEK G+T K+     A      R G+R++  E++VG Y+  CG Y+  +G +
Sbjct  468   GRVNEWVVTEKLGDTLKSKLIAKATTKLYTRFGQRINWRELVVGLYIFICGCYDFAYGGS  527

Query  361   YYYVYLFLQGVSFLVIGFGYIGAFV  287
             Y+YVYLFLQ  +F V G GYIG  V
Sbjct  528   YFYVYLFLQACAFFVAGVGYIGTIV  552



>emb|CDY04707.1| BnaC05g18820D [Brassica napus]
Length=555

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/505 (62%), Positives = 395/505 (78%), Gaps = 2/505 (0%)
 Frame = -1

Query  1798  LWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKK  1619
             +W + +  V +P+L+ +V +CLVM  ++ +E+VY+  V   +KL RRTP K +KWE I  
Sbjct  49    IWKETRIFVFIPILKFLVTMCLVMSFLLFIERVYMSVVVVIVKLLRRTPEKVHKWEVIN-  107

Query  1618  EDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKAL  1439
             +DD E+ ++ YP VL+QIPM NEK V QLSIGAAC LSWP +R+I+QVLDDSTDP  K L
Sbjct  108   DDDLELAHTNYPMVLIQIPMYNEKEVCQLSIGAACRLSWPLDRMIVQVLDDSTDPASKEL  167

Query  1438  VQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFL  1259
             V  EC +WA KG+NI  E RDNR G+KAG+LK GM H+YVK CE+VAIFDADF+PDPDFL
Sbjct  168   VNAECDKWARKGINIMSEIRDNRIGYKAGALKAGMMHNYVKQCEFVAIFDADFQPDPDFL  227

Query  1258  YRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNG  1079
              RTIPFL+HN +I LVQ RWK+VNANEC++TR+QEMS++ HF  EQE GS+IHAFFGFNG
Sbjct  228   ARTIPFLIHNREISLVQCRWKFVNANECLMTRMQEMSLNYHFLAEQESGSSIHAFFGFNG  287

Query  1078  TAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQ  899
             TAG+WRIAAL++AGGWKDRTTVEDMDL  RA L GWKFV++ +V VK+ELPS+FKAYR+Q
Sbjct  288   TAGVWRIAALNEAGGWKDRTTVEDMDLAVRACLHGWKFVYVHNVEVKNELPSTFKAYRFQ  347

Query  898   QHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPAT  719
             QHRWSCGPANL++KMT EI++NKKV+ WKKLYLIY FFF+ KIV H+ TF++YCL+LPAT
Sbjct  348   QHRWSCGPANLWRKMTIEILQNKKVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPAT  407

Query  718   VLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEV  539
             V+ PEL++P W  +YVP+   LL  L  PRSLH+  FW+LFENVM++HRT  TFIGLLE 
Sbjct  408   VMFPELQVPKWATVYVPSTITLLNALATPRSLHLLVFWILFENVMSMHRTKATFIGLLEA  467

Query  538   GRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDN  362
             GR++EWVVTEK G+T K+     A      R G+R++  E++VG Y+  CG Y+  +G +
Sbjct  468   GRVNEWVVTEKLGDTLKSKLIAKATTKLYTRFGQRINWRELVVGLYIFICGCYDFAYGGS  527

Query  361   YYYVYLFLQGVSFLVIGFGYIGAFV  287
             Y+YVYLFLQ  +F V G GYIG  V
Sbjct  528   YFYVYLFLQACAFFVAGVGYIGTIV  552



>ref|XP_010509580.1| PREDICTED: probable mannan synthase 7 [Camelina sativa]
Length=555

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/536 (57%), Positives = 412/536 (77%), Gaps = 5/536 (1%)
 Frame = -1

Query  1885  GNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILME  1706
             G+S ++  + ++  +    GD IA  +G+ W Q +A+V+VPV + +V +CL+M +M+ +E
Sbjct  23    GSSKASVALLNAVKSFPTFGDIIA-RIGLWWEQIRAVVVVPVFKFLVAICLIMSVMLFVE  81

Query  1705  KVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSI  1526
              +Y+G V  Y+KLF+R P K YKWE +  EDD E G+  YP VLVQ+PM NEK V + SI
Sbjct  82    VMYMGIVVLYVKLFKRKPEKVYKWEAM--EDDVECGSDSYPMVLVQMPMYNEKEVCEQSI  139

Query  1525  GAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSL  1346
              AAC +SWP+NR+IIQVLDDSTDP  K LV++EC RW+ +GVNI +E RDNR G+KAG+L
Sbjct  140   AAACKISWPSNRMIIQVLDDSTDPASKELVKKECERWSKEGVNITFEIRDNRNGYKAGAL  199

Query  1345  KQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLT  1166
             ++GMKHSYVK C+YVAIFDADF+PDPDFL RT+PFL+HNP + LVQ RW++VNA++CM+T
Sbjct  200   REGMKHSYVKQCDYVAIFDADFQPDPDFLLRTVPFLIHNPKLALVQGRWEFVNADQCMMT  259

Query  1165  RLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRA  986
             RLQEMS+  HF+VEQ+VGS+  AFFGFNGTAG+WRI+AL ++GGW D+TTVEDMDL  RA
Sbjct  260   RLQEMSLSYHFTVEQQVGSSTFAFFGFNGTAGVWRISALIESGGWNDQTTVEDMDLAVRA  319

Query  985   GLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKL  806
              L+GWK +++ D++VKSELP SF A R QQHRW+CGPANLF+KM  +I+RN+ V++WKKL
Sbjct  320   TLRGWKLLYIDDLKVKSELPCSFNALRSQQHRWTCGPANLFRKMAGQILRNENVSVWKKL  379

Query  805   YLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRS  626
             Y++Y+FFF+ KIVAHVLTF +YC++LPATVL PE+ +P W A Y+P+L  L   +   RS
Sbjct  380   YMLYSFFFIRKIVAHVLTFCFYCVILPATVLFPEVTVPKWAAFYLPSLITLFIAIGRLRS  439

Query  625   LHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRL  446
             +H+ AFW+LFEN M+L RT    +GLLE GR+ EWVVTEK G+    + K   +VP  R 
Sbjct  440   IHLLAFWVLFENSMSLVRTKALVMGLLETGRVQEWVVTEKSGD--ALKTKLIPQVPNVRF  497

Query  445   GERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              ER+HL E++VG Y+L CG Y++I+G N  YVYL  Q ++F V+GFGY+G +V  S
Sbjct  498   RERVHLLELLVGAYLLSCGIYDIIYGKNTLYVYLLFQSLAFFVVGFGYVGKYVPAS  553



>ref|XP_009769755.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like isoform 
X1 [Nicotiana sylvestris]
Length=533

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/521 (60%), Positives = 417/521 (80%), Gaps = 4/521 (1%)
 Frame = -1

Query  1837  RGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRR  1658
             +G    IA  +G++W   KA +IVP+LRV +Y+CL M +M+ +E++Y+G V   +KLF +
Sbjct  15    QGTAADIAGQIGLMWELIKAPLIVPLLRVAIYICLPMELMLFIERLYMGIVIILVKLFLK  74

Query  1657  TPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQ  1478
              P K+YKWEP++  +D EIGNSG+P VLVQIPM NEK VY++SIGAACNLSWP++R++IQ
Sbjct  75    KPDKRYKWEPMR--EDLEIGNSGFPMVLVQIPMFNEKEVYKVSIGAACNLSWPSDRLVIQ  132

Query  1477  VLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVA  1298
             VLDDSTD  +K LV++EC RWAGKG++I+Y+ R++R G+KAG+LK+G+K  YVK CEYV 
Sbjct  133   VLDDSTDLLIKDLVEKECLRWAGKGIDIRYQIRESRGGYKAGALKEGLKRDYVKDCEYVV  192

Query  1297  IFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQE  1118
             IFDADF P+PDFL R IPFLVHN +I LVQ RW++VN+NEC+LTR+QEMS+D HF+VEQE
Sbjct  193   IFDADFRPEPDFLRRAIPFLVHNSEIALVQGRWRFVNSNECLLTRMQEMSLDYHFTVEQE  252

Query  1117  VGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVK  938
             VGS+ HAFFGFNGT G+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKF++LGD++VK
Sbjct  253   VGSSTHAFFGFNGTGGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGDLQVK  312

Query  937   SELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHV  758
             SELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNK+V IWKK Y+IY+FFFV KI+AH+
Sbjct  313   SELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKRVNIWKKFYVIYSFFFVRKIIAHM  372

Query  757   LTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMAL  578
             +TF ++C+VLP ++L+PE++IP+W A+Y+P +  +L  +  PRS+H+  +W+LFENVMA 
Sbjct  373   VTFFFFCVVLPLSLLVPEVEIPVWAAIYIPCIITILNSVGTPRSIHLLFYWILFENVMAF  432

Query  577   HRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRL-GERLHLWEIIVGFY  404
             HRT  TFIGLLE  R +EWVVTEK G+  K        K PR  L G+R+   E+    +
Sbjct  433   HRTKATFIGLLEAKRANEWVVTEKLGDALKNKDKTKPTKKPRGSLFGDRILPQELGFAAF  492

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             + FCG Y++++G + Y++Y+FLQ ++F + GFGYIG  + +
Sbjct  493   LFFCGCYDVLYGKSQYFLYIFLQVITFTIAGFGYIGTIIPS  533



>ref|XP_004951606.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1-like [Setaria 
italica]
Length=521

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/509 (61%), Positives = 410/509 (81%), Gaps = 5/509 (1%)
 Frame = -1

Query  1795  WVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKE  1616
             W Q +A VIVP+LR+ V +CL M +++ +E++Y+  V A ++L R  P ++Y+ EP+  E
Sbjct  15    WSQVRAPVIVPLLRLAVAVCLTMSVLLFLERMYMAVVIAVVRLLRLRPERRYRCEPLP-E  73

Query  1615  DDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALV  1436
             DD E+G+S +P+VLVQIPM NE+ VYQLSIGA C LSWP++R+++QVLDDSTD  +K +V
Sbjct  74    DDPELGSSAFPSVLVQIPMFNEREVYQLSIGAVCGLSWPSDRLVVQVLDDSTDEVIKEMV  133

Query  1435  QQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLY  1256
             + EC RWA KG+NI Y+ RD+R+G+KAG+LK GMKH+YV+ CEYVAIFDADF+PDPDFL 
Sbjct  134   RMECERWARKGINITYQIRDDRRGYKAGALKAGMKHAYVRECEYVAIFDADFQPDPDFLK  193

Query  1255  RTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGT  1076
             RTIP+LVHNP+I LVQARW++VNA+EC++TR+QEMS+D HF+VEQEV S++ AFFGFNGT
Sbjct  194   RTIPYLVHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFFGFNGT  253

Query  1075  AGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQ  896
             AG+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKFV+LGDV+VKSELPS+FKA+R+QQ
Sbjct  254   AGVWRIAAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAFRFQQ  313

Query  895   HRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATV  716
             HRWSCGPANLF+KM  EI+ NKKVTIWKK+++IY FF + KI+AH++TF +YCL++PAT+
Sbjct  314   HRWSCGPANLFRKMLMEIVTNKKVTIWKKIHVIYNFFLIRKIIAHIITFSFYCLIIPATI  373

Query  715   LIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVG  536
              +PE++IP WG +Y+P+   LL  +  PRS H+  FW+ FENVM+LHRT  T IGLLE G
Sbjct  374   FVPEVRIPKWGCVYIPSAITLLNSVGTPRSFHLLFFWVAFENVMSLHRTKATLIGLLEAG  433

Query  535   RIHEWVVTEKQGNT---KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGD  365
             R +EWVVT K G+    K+A     KK    R+ ERLH+ E+ VG ++  CGWY+L +G 
Sbjct  434   RANEWVVTAKLGSAMKMKSANKGGLKK-QFMRIWERLHITELGVGTFLFSCGWYDLAYGR  492

Query  364   NYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             +++Y+YLF Q ++F +IGFGY+G  V  S
Sbjct  493   DHFYIYLFFQSIAFFIIGFGYVGTIVPQS  521



>ref|XP_008360269.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Malus 
domestica]
Length=549

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/541 (59%), Positives = 421/541 (78%), Gaps = 20/541 (4%)
 Frame = -1

Query  1849  EAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLK  1670
             E   RG  D  A  +G++W   KA +IVP+L V VY+   M +M+  E+VY+G V   +K
Sbjct  12    ETFQRGTYD-FAGQIGLIWELIKAPLIVPLLTVGVYVSXAMSLMLFFERVYMGVVIVLVK  70

Query  1669  LFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNR  1490
             LF + P ++YK+EPI  +DD E+G+S +P VL+QIPM NE+ VY++SIGAAC LSWP++R
Sbjct  71    LFWKKPEQRYKYEPI--QDDLELGSSNFPVVLIQIPMFNEREVYKVSIGAACGLSWPSDR  128

Query  1489  IIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSC  1310
             ++IQVLDDSTDP +K +V+ EC+RWA KG+NI+Y+ R+ R G+KAG+LK+G+K SYVK C
Sbjct  129   LVIQVLDDSTDPTIKQMVELECQRWASKGINIRYQIRETRGGYKAGALKEGLKRSYVKHC  188

Query  1309  EYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFS  1130
             EYVAIFDADF P+PD+L R IPFLVHNPDI LVQARW++VNA+EC+LTR+QEMS+D HF+
Sbjct  189   EYVAIFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNADECLLTRMQEMSLDYHFT  248

Query  1129  VEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGD  950
             VEQEVGSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD
Sbjct  249   VEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGD  308

Query  949   VRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKI  770
             ++VKSELPS+F A+R+QQHRWSCGPANLF+KM  EI++ KKVT+WKK Y IY+FFFV KI
Sbjct  309   LQVKSELPSTFNAFRFQQHRWSCGPANLFRKMAMEIIKTKKVTVWKKFYTIYSFFFVRKI  368

Query  769   VAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFEN  590
             +AH++TF +YC+VLP T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFEN
Sbjct  369   IAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFEN  428

Query  589   VMALHRTIGTFIGLLEVGRIHEWVVTEKQGN-TKTAQPKSAK----------------KV  461
             VM+LHRT  T IGLLE  R +EWVVTEK G+  K    ++AK                K 
Sbjct  429   VMSLHRTKATLIGLLETARSNEWVVTEKLGDIVKNKAAEAAKNKVADANKTKPASKLFKR  488

Query  460   PRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             PRF+ G RLHL E+  G ++  CG Y+ + G N Y+VYLFLQ ++FL+ GFGY+G  + +
Sbjct  489   PRFKFGNRLHLLELGFGVFLFMCGCYDFVHGKNNYFVYLFLQTITFLICGFGYVGTIIPS  548

Query  280   S  278
             S
Sbjct  549   S  549



>ref|XP_004506130.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Cicer 
arietinum]
Length=538

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/521 (59%), Positives = 407/521 (78%), Gaps = 12/521 (2%)
 Frame = -1

Query  1819  IAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQY  1640
             I   + ++W   KA +IVP L   VY+ L M +M+ ME+VY+G V   +KLF + P ++Y
Sbjct  20    IVTQMKMIWDVMKAPLIVPFLNACVYISLAMALMLFMERVYMGIVIVLIKLFWKKPEQRY  79

Query  1639  KWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDST  1460
              +EP++  +D E+GNS +P VL+QIPM NEK VY++SIGAAC LSWP++R++IQVLDDST
Sbjct  80    NYEPLR--EDEELGNSNFPVVLIQIPMFNEKEVYKVSIGAACGLSWPSDRLVIQVLDDST  137

Query  1459  DPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADF  1280
             DP VK LV+ EC+RWA KG+NI Y+ R++R G+KAG+LK+G+K +YVK CEYVAIFDADF
Sbjct  138   DPVVKQLVEMECQRWASKGLNITYQIRESRGGYKAGALKEGLKRNYVKHCEYVAIFDADF  197

Query  1279  EPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIH  1100
              P+PDFL R IPFLV NP++ LVQARW++VN+NEC+LTR+QEMS+D HF+VEQEVGSA H
Sbjct  198   RPEPDFLRRAIPFLVGNPELALVQARWRFVNSNECLLTRMQEMSLDYHFTVEQEVGSATH  257

Query  1099  AFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSS  920
             AFFGFNGTAG+WRIAA+D+AGGWKDRTTVEDMDL  RA L+GWKF++LGD+  KSELPS+
Sbjct  258   AFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLEAKSELPST  317

Query  919   FKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYY  740
              +A+R+QQHRWSCGPANLF+KM  +I+RNKKV  WKK+Y+IY+FF V KIVAH++TF +Y
Sbjct  318   LRAFRFQQHRWSCGPANLFRKMAMDIIRNKKVKFWKKVYVIYSFFLVRKIVAHMVTFFFY  377

Query  739   CLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGT  560
             CLV+P T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+LHRT  T
Sbjct  378   CLVIPLTILVPEVYVPIWGAVYIPSVITILNSVGTPRSIHLLFYWILFENVMSLHRTKAT  437

Query  559   FIGLLEVGRIHEWVVTEKQG---NTKTAQPKSAKKV-------PRFRLGERLHLWEIIVG  410
              IGLLE GR +EWVVTEK G   N KT    +AKK         R +  ERL+  E+   
Sbjct  438   LIGLLEYGRANEWVVTEKLGDSVNNKTKSGDAAKKTNAKVQKKTRSKFVERLNFLELGFA  497

Query  409   FYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              ++ FCG Y+   G + Y++YLFLQ +SF ++GFGY+G  V
Sbjct  498   AFLFFCGCYDFQHGKHNYFIYLFLQSLSFSIVGFGYVGTIV  538



>ref|XP_010516764.1| PREDICTED: probable mannan synthase 7 isoform X1 [Camelina sativa]
Length=555

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/536 (57%), Positives = 414/536 (77%), Gaps = 5/536 (1%)
 Frame = -1

Query  1885  GNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILME  1706
             G+S ++  +F++  +    GD IA  +G+ W Q +A+V+VPV + +V +CL+M +M+ +E
Sbjct  23    GSSKASVALFNAVKSFPTFGDIIA-RIGLWWEQIRAVVVVPVFKFLVAICLIMSVMLFVE  81

Query  1705  KVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSI  1526
              +Y+G V  Y+KLF+R PAK YKWE +  EDD E G++ YP VLVQ+PM NEK V + SI
Sbjct  82    VMYMGIVVLYVKLFKRKPAKIYKWEAM--EDDVECGSATYPMVLVQMPMYNEKEVCEQSI  139

Query  1525  GAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSL  1346
              AAC +SWP+NR+IIQVLDDSTDP  K LV++EC RW+ +GVNI +E RDNR G+KAG+L
Sbjct  140   AAACKISWPSNRMIIQVLDDSTDPASKELVKKECERWSKEGVNITFEIRDNRNGYKAGAL  199

Query  1345  KQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLT  1166
             ++GMKHSYVK C+YVAIFDADF+PDPDFL RT+PFL+HN  + LVQ RW++VNA++CM+T
Sbjct  200   REGMKHSYVKQCDYVAIFDADFQPDPDFLLRTVPFLIHNAKLALVQGRWEFVNADQCMMT  259

Query  1165  RLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRA  986
             RLQEMS+  HF+VEQ+VGS+  AFFGFNGTAG+WRI+AL ++GGW D+TTVEDMDL  RA
Sbjct  260   RLQEMSLSYHFTVEQQVGSSTFAFFGFNGTAGVWRISALIESGGWNDQTTVEDMDLAVRA  319

Query  985   GLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKL  806
              L+GWK +++ D++VKSELP SF A R QQHRW+CGPANLF+KM  +I+R++ V++WKKL
Sbjct  320   TLRGWKLLYIDDLKVKSELPCSFNALRSQQHRWTCGPANLFRKMAGKILRSENVSLWKKL  379

Query  805   YLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRS  626
             Y++Y+FFF+ KIVAHVLTF +YC++LPATVL PE+ +P W A Y+P+L  L   +   RS
Sbjct  380   YMLYSFFFIRKIVAHVLTFCFYCVILPATVLFPEVTVPKWAAFYLPSLITLFIAIGRLRS  439

Query  625   LHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRL  446
             +H+ AFW+LFEN M+L RT    +GLLE GR+ EWVVTEK G+    + K   +VP  R 
Sbjct  440   IHLLAFWVLFENSMSLVRTKALVMGLLETGRVQEWVVTEKSGD--ALKTKLIPQVPNVRF  497

Query  445   GERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              ER+HL E++VG Y+L CG Y++I+G N  YVYL  Q ++F V+GFGY+G +V  S
Sbjct  498   RERVHLLELLVGAYLLSCGIYDIIYGKNTLYVYLLFQSLAFFVVGFGYVGKYVPAS  553



>ref|XP_010554514.1| PREDICTED: probable mannan synthase 7 isoform X1 [Tarenaya hassleriana]
Length=565

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/540 (58%), Positives = 411/540 (76%), Gaps = 9/540 (2%)
 Frame = -1

Query  1876  SSAAIMFSSEAAVRGAGDAIAPY------LGVLWVQAKALVIVPVLRVMVYLCLVMLIMI  1715
             SS     SS A    A  AI  +       G  W QA+A+V+VP+ + +V LCLVM +M+
Sbjct  27    SSKINPLSSTATFPDAFKAIPTWKDVSGEFGYGWEQARAVVVVPLFKFLVTLCLVMSVML  86

Query  1714  LMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQ  1535
              +E +Y+G V AY+KLF+R P K YKWE +   DD E G+S YP VLVQIPM NEK V Q
Sbjct  87    FIEIMYMGIVIAYVKLFKRKPEKVYKWEAMN--DDIEYGSSLYPMVLVQIPMYNEKEVCQ  144

Query  1534  LSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKA  1355
             LSI AAC LSWP++RIIIQVLDDSTDP  K LV+QEC RWA +GVNI +E RDNR G+KA
Sbjct  145   LSIAAACKLSWPSDRIIIQVLDDSTDPASKELVEQECERWAREGVNITFEIRDNRNGYKA  204

Query  1354  GSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANEC  1175
             G+L++GM+HSYVK C+YVAIFDADF+PDPDFL RTIPFL+HNP I LVQARW++VNA++C
Sbjct  205   GALREGMRHSYVKQCDYVAIFDADFQPDPDFLSRTIPFLIHNPKIALVQARWEFVNADQC  264

Query  1174  MLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLG  995
             ++TRLQEMS+  HF VEQEVGS+  AFFGFNGTAG+WRI+AL+++GGW D+TTVEDMDL 
Sbjct  265   IMTRLQEMSLSYHFKVEQEVGSSAFAFFGFNGTAGVWRISALNESGGWNDQTTVEDMDLA  324

Query  994   CRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIW  815
              RA L+GWKFV++ D+RVKSELPS+  A+R QQHRW+CGP+NLF+KM  +I+R++ V++ 
Sbjct  325   VRATLRGWKFVYVDDLRVKSELPSTLNAFRNQQHRWTCGPSNLFRKMAGKIIRSENVSLG  384

Query  814   KKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPC  635
             KK Y+IY+FF V KI++H++TF +YC+VLP TV+IPE+++P W A Y+P+   L      
Sbjct  385   KKFYMIYSFFLVRKILSHIITFFFYCIVLPTTVMIPEVEVPKWAAFYLPSTITLFIATGR  444

Query  634   PRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKSAKKVP  458
             PRS H+ AFW+LFEN M+L RT    +GLLE GR++EWVVTEK G+  KT     A K P
Sbjct  445   PRSFHLLAFWVLFENTMSLLRTKALVMGLLETGRVNEWVVTEKLGDPLKTKLIAEAPKEP  504

Query  457   RFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             + R  +R+HL E+ VG Y+LFCG Y++ +G+N+ +VYL LQ ++F ++GFG++G  V  S
Sbjct  505   QARFRDRVHLLEVCVGAYLLFCGCYDVAYGNNFLFVYLLLQSMAFFLVGFGFVGTLVPPS  564



>gb|ADW77641.1| putative mannan synthase [Amorphophallus konjac]
Length=519

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/510 (60%), Positives = 392/510 (77%), Gaps = 5/510 (1%)
 Frame = -1

Query  1798  LWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKK  1619
             +W Q + +V++P +R+ V LCL+M +M+LMEK+ +G VS Y+K+FRR P K Y+WEP+  
Sbjct  11    IWGQVRTMVLIPAMRIAVLLCLIMSVMLLMEKLLMGGVSLYVKVFRRRPKKVYRWEPVG-  69

Query  1618  EDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKAL  1439
               D E+G + YP VLVQIPM NE+ VY LSI AAC L WP++R+I+QVLDDSTDP +K L
Sbjct  70    -GDEELGTAAYPMVLVQIPMYNEREVYHLSIKAACCLQWPSDRLIVQVLDDSTDPMIKDL  128

Query  1438  VQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFL  1259
             V +EC++WA  GVNIKYETR NR G+KAG+LK+GMK+SYV+ C+YVAIFDADF+ DPD+L
Sbjct  129   VYKECQKWALDGVNIKYETRANRNGYKAGALKEGMKYSYVEECDYVAIFDADFQADPDYL  188

Query  1258  YRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNG  1079
              + +PFL+HNP+IGL QARW +VNA EC++TRLQEMSMD HF VEQE GS+IHAFFGFNG
Sbjct  189   VQMVPFLIHNPEIGLAQARWNFVNAEECLMTRLQEMSMDYHFKVEQESGSSIHAFFGFNG  248

Query  1078  TAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQ  899
             TAG+WRI AL++AGGWKDRTTVEDMDL  RA L+GWKFV++GDV+VKSELPS+FKA+RYQ
Sbjct  249   TAGVWRIRALNEAGGWKDRTTVEDMDLAIRATLEGWKFVYVGDVKVKSELPSTFKAFRYQ  308

Query  898   QHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPAT  719
             QHRWSCGPANL +KM  EI+  KKV +WKK YL+Y FF   KIVAH +TF +YC+V P  
Sbjct  309   QHRWSCGPANLVRKMAIEILMTKKVPLWKKFYLLYNFFLTRKIVAHFVTFFFYCVVFPTA  368

Query  718   VLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEV  539
             V  PE+ IPLW  +++PT   +L     PRS+H+  FW LFENVMALHR  G  IGLLE+
Sbjct  369   VFFPEISIPLWAVVHLPTTITILNACGTPRSIHLIVFWTLFENVMALHRCKGVIIGLLEI  428

Query  538   GRIHEWVVTEKQGNTKTAQPKSAK---KVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFG  368
             GR++EWVVTEK G+    +P   +   +  R +  +R H  EI +  Y++ C  YN +  
Sbjct  429   GRVNEWVVTEKLGDALKLKPNGNQNFARKARTKYFQRFHFLEIGLALYLIICASYNYMHA  488

Query  367   DNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             +NY Y+Y++LQ ++FLV+G GY+G FV + 
Sbjct  489   NNYCYIYIYLQSLAFLVMGLGYVGTFVPSE  518



>ref|NP_001031084.1| putative mannan synthase 3 [Arabidopsis thaliana]
 gb|AEE30393.1| putative mannan synthase 3 [Arabidopsis thaliana]
Length=484

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/484 (64%), Positives = 383/484 (79%), Gaps = 2/484 (0%)
 Frame = -1

Query  1729  MLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNE  1550
             M +++ +E+VY+  V  ++KL RRTP K +KWEPI  +DD E+ N+ YP VL+QIPM NE
Sbjct  1     MSLLLFIERVYMSIVVVFVKLLRRTPEKVHKWEPIN-DDDLELANTNYPMVLIQIPMYNE  59

Query  1549  KRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNR  1370
             K V QLSIGAAC LSWP +R+I+QVLDDSTDP  K LV  EC +WA KG+NI  E RDNR
Sbjct  60    KEVCQLSIGAACRLSWPLDRMIVQVLDDSTDPASKELVNAECDKWARKGINIMSEIRDNR  119

Query  1369  KGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYV  1190
              G+KAG+LK GM H+YVK CE+VAIFDADF+PDPDFL RTIPFL+HN +I LVQ RWK+V
Sbjct  120   IGYKAGALKAGMMHNYVKQCEFVAIFDADFQPDPDFLERTIPFLIHNHEISLVQCRWKFV  179

Query  1189  NANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVE  1010
             NANEC++TR+QEMS++ HF  EQE GS+IHAFFGFNGTAG+WRIAAL++AGGWKDRTTVE
Sbjct  180   NANECLMTRMQEMSLNYHFVAEQESGSSIHAFFGFNGTAGVWRIAALNEAGGWKDRTTVE  239

Query  1009  DMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNK  830
             DMDL  RA L GWKFV++ DV VK+ELPS+FKAYR+QQHRWSCGPANL++KMT EI++NK
Sbjct  240   DMDLAVRACLHGWKFVYVHDVEVKNELPSTFKAYRFQQHRWSCGPANLWRKMTMEILQNK  299

Query  829   KVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltall  650
             KV+ WKKLYLIY FFF+ KIV H+ TF++YCL+LP TVL PEL++P W  +Y PT   +L
Sbjct  300   KVSAWKKLYLIYNFFFIRKIVVHIFTFVFYCLILPTTVLFPELQVPKWATVYFPTTITIL  359

Query  649   tlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNT-KTAQPKS  473
               +  PRSLH+  FW+LFENVM++HRT  TFIGLLE GR++EWVVTEK G+T K+     
Sbjct  360   NAIATPRSLHLLVFWILFENVMSMHRTKATFIGLLEAGRVNEWVVTEKLGDTLKSKLIGK  419

Query  472   AKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGA  293
             A      R G+RL+  E++VG Y+ FCG Y+  +G +Y+YVYLFLQ  +F V G GYIG 
Sbjct  420   ATTKLYTRFGQRLNWRELVVGLYIFFCGCYDFAYGGSYFYVYLFLQSCAFFVAGVGYIGT  479

Query  292   FVTT  281
             FV T
Sbjct  480   FVPT  483



>ref|XP_010554517.1| PREDICTED: probable mannan synthase 11 [Tarenaya hassleriana]
Length=546

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/505 (59%), Positives = 395/505 (78%), Gaps = 3/505 (1%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             +G +W Q ++ VI+P+   +V LCLV+ + + ME +Y+  V  ++KLF R P K YKWE 
Sbjct  43    IGFIWNQTRSFVILPLFEFLVTLCLVLSLAVFMESIYMSIVVIFVKLFNRKPEKVYKWEA  102

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             +K  +DAE+G+S +P VLVQIPM NEK V+QLSIGAAC L WP++R+I+QVLDDSTDP +
Sbjct  103   LK--EDAELGHSNHPMVLVQIPMYNEKEVFQLSIGAACMLKWPSDRLIVQVLDDSTDPTI  160

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K +V  EC +WA KG+NIK E RD+R G+KAG+L+QGM+H+YVK C+YVAIFDADF+P+P
Sbjct  161   KEMVNVECGKWASKGINIKCEIRDSRSGYKAGALRQGMRHNYVKQCDYVAIFDADFQPEP  220

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFL R+IPFLVHN D+ LVQARWK+VNANEC++TR+QEMS++ HF  EQE GS  HAFFG
Sbjct  221   DFLERSIPFLVHNSDVALVQARWKFVNANECLMTRMQEMSLNYHFMAEQESGSTRHAFFG  280

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRIAA++DAGGWKDRTTVEDMDL  RAGL+GWKFVF+ D+ VKSELP  FKA+
Sbjct  281   FNGTAGVWRIAAMNDAGGWKDRTTVEDMDLAVRAGLRGWKFVFVNDLTVKSELPCKFKAF  340

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             R+QQHRWSCGPANLF+KMT EI+ NK+VT WKK Y+IY+FFFV K+V H+ TF +YC++L
Sbjct  341   RFQQHRWSCGPANLFRKMTMEIVHNKRVTWWKKCYVIYSFFFVRKVVVHIFTFFFYCIIL  400

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             P +V  P++ IP W  +Y P++ ++   +  PRS ++  FW+LFENV A+HR+ G+FIG+
Sbjct  401   PTSVFFPQVHIPTWATVYAPSVISISNAIATPRSFYLVVFWILFENVNAMHRSKGSFIGM  460

Query  547   LEVGRIHEWVVTEKQGNT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIF  371
             LE GR++EWVVTEK G+  KT         PRF + ER+++ E IVG Y++ C  Y+ IF
Sbjct  461   LEGGRVNEWVVTEKLGDALKTKLLPQVVTRPRFEMWERVNMKEFIVGIYIMGCACYDFIF  520

Query  370   GDNYYYVYLFLQGVSFLVIGFGYIG  296
             G  +  +YLF+Q ++FLV G GY+G
Sbjct  521   GKTWLSLYLFMQSIAFLVCGIGYVG  545



>ref|XP_010505088.1| PREDICTED: probable mannan synthase 7 [Camelina sativa]
Length=554

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/536 (57%), Positives = 412/536 (77%), Gaps = 5/536 (1%)
 Frame = -1

Query  1885  GNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILME  1706
             G+S ++  + ++  +    GD IA  +G+ W Q +A+V+VPV + +V +CL+M +M+ +E
Sbjct  22    GSSKASVALLNAVKSFPTFGDIIA-RIGLWWEQIRAVVVVPVFKFLVAVCLIMSVMLFVE  80

Query  1705  KVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSI  1526
              +Y+G V  Y+KLF+R P K YKWE +  EDD E G++ YP VLVQ+PM NEK V + SI
Sbjct  81    VMYMGIVVLYVKLFKRKPEKIYKWEAM--EDDVECGSATYPMVLVQMPMYNEKEVCEQSI  138

Query  1525  GAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSL  1346
              AAC +SWP+NR+IIQVLDDSTDP  K LV++EC RW+ +GVNI +E RDNR G+KAG+L
Sbjct  139   AAACKISWPSNRLIIQVLDDSTDPASKELVKKECERWSKEGVNITFEIRDNRNGYKAGAL  198

Query  1345  KQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLT  1166
             ++GMKHSYVK C+YVAIFDADF+PDPDFL RT+PFL+HNP + LVQ RW++VNA++CM+T
Sbjct  199   REGMKHSYVKQCDYVAIFDADFQPDPDFLLRTVPFLIHNPKLALVQGRWEFVNADQCMMT  258

Query  1165  RLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRA  986
             RLQEMS+  HF+VEQ+VGS+  AFFGFNGTAG+WRI+AL ++GGW D+TTVEDMDL  RA
Sbjct  259   RLQEMSLSYHFTVEQQVGSSTFAFFGFNGTAGVWRISALIESGGWNDQTTVEDMDLAVRA  318

Query  985   GLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKL  806
              L+GWK +++ D++VKSELP SF A R QQHRW+CGPANLF+KM  +I+R++ V++WKKL
Sbjct  319   TLRGWKLLYIDDLKVKSELPCSFNALRSQQHRWTCGPANLFRKMAGQILRSENVSLWKKL  378

Query  805   YLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRS  626
             Y++Y+FFF+ KIVAH LTF +YC++LPATVL PE+ +P W A Y+P+L  L   +   RS
Sbjct  379   YMLYSFFFIRKIVAHALTFCFYCVILPATVLFPEVTVPKWAAFYLPSLITLFIAIGRLRS  438

Query  625   LHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRL  446
             +H+ AFW+LFEN M+L RT    +GLLE GR+ EWVVTEK G+    + K   +VP  R 
Sbjct  439   IHLLAFWVLFENSMSLVRTKALVMGLLETGRVQEWVVTEKSGD--ALKTKLIPQVPNVRF  496

Query  445   GERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              ER+HL E++VG Y+L CG Y++I+G N  YVYL  Q ++F V+GFGY+G +V  S
Sbjct  497   RERVHLLELLVGAYLLSCGIYDIIYGKNTLYVYLLFQSLAFFVVGFGYVGKYVPAS  552



>ref|XP_002453460.1| hypothetical protein SORBIDRAFT_04g006260 [Sorghum bicolor]
 gb|EES06436.1| hypothetical protein SORBIDRAFT_04g006260 [Sorghum bicolor]
Length=521

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/508 (58%), Positives = 402/508 (79%), Gaps = 3/508 (1%)
 Frame = -1

Query  1795  WVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKE  1616
             W Q +A VIVP+LR+ V +CL M +++ +E++Y+  V   ++L R  P ++Y+ +P+  +
Sbjct  15    WSQVRAPVIVPLLRLAVAVCLTMSVLLFLERMYMAIVITGVRLLRFRPDRRYRCDPLP-D  73

Query  1615  DDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALV  1436
             DD E+G+S +P VLVQIPM NE+ VYQLSIGA C LSWP +R+++QVLDDSTD  +K +V
Sbjct  74    DDPELGSSAFPVVLVQIPMFNEREVYQLSIGAVCGLSWPADRLVVQVLDDSTDEMIKEMV  133

Query  1435  QQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLY  1256
             + EC RWA KG+NI Y+ RD+RKG+KAG+L+ GMKH+YV+ CEYV IFDADF+PDPDFL 
Sbjct  134   RLECERWARKGINITYQIRDDRKGYKAGALRAGMKHAYVRECEYVVIFDADFQPDPDFLK  193

Query  1255  RTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGT  1076
             RT+P+LVHNP+I LVQARW++VNA+EC++TR+QEMS+D HF+VEQEV S++ AFFGFNGT
Sbjct  194   RTVPYLVHNPEIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEVSSSVCAFFGFNGT  253

Query  1075  AGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQ  896
             AG+WRI+A+++AGGWKDRTTVEDMDL  RA LKGWKFV+LGDV+VKSELPS+FKA+R+QQ
Sbjct  254   AGVWRISAINEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKSELPSTFKAFRFQQ  313

Query  895   HRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATV  716
             HRWSCGPANLF+KM  EI+ NKKVTIWKK+++IY FF + KI+AH++TF +YCLV+PAT+
Sbjct  314   HRWSCGPANLFRKMLMEIVTNKKVTIWKKIHVIYNFFLIRKIIAHIITFSFYCLVIPATI  373

Query  715   LIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVG  536
              +PE++IP WG +Y+P+   L+  +  PRS H+  FW+ FENVM+LHRT  T IGLLE G
Sbjct  374   FVPEVRIPKWGCVYIPSAITLMNSVGTPRSFHLLFFWVAFENVMSLHRTKATLIGLLEAG  433

Query  535   RIHEWVVTEKQGNT--KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDN  362
             R +EWVVT K G+     A  K+  +    R+ ERLH+ E+ V  ++  CGWY+  +G +
Sbjct  434   RANEWVVTAKLGSAMKMKAANKAGLRKQFMRIWERLHVTELGVAAFLFSCGWYDFAYGRD  493

Query  361   YYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             ++++YLF Q V+F ++G GY+G  V  S
Sbjct  494   HFFIYLFFQSVAFFIVGIGYVGTIVPQS  521



>gb|KDO45609.1| hypothetical protein CISIN_1g040333mg [Citrus sinensis]
Length=513

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/521 (59%), Positives = 406/521 (78%), Gaps = 34/521 (7%)
 Frame = -1

Query  1825  DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAK  1646
             + IA  +G++W   KA +IVP+L++ VY+CL M +M+ ME+VY+G              K
Sbjct  19    EDIAGQIGLIWELLKAPLIVPLLKLGVYICLAMSLMLFMERVYMGI-------------K  65

Query  1645  QYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDD  1466
             +Y W+PI  EDD E+G+S +P VL+QIPM NEK VY++SIGAAC LSWP++R++IQVLDD
Sbjct  66    RYNWQPI--EDDVELGSSNFPVVLIQIPMFNEKEVYKISIGAACGLSWPSDRLVIQVLDD  123

Query  1465  STDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDA  1286
             STDP +K +V+QEC+RWA KG+NI+Y+ R+NR G+KAG+LK+G+K SYVK CEY      
Sbjct  124   STDPAIKQMVEQECQRWAAKGINIRYQIRENRTGYKAGALKEGLKRSYVKHCEY------  177

Query  1285  DFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSA  1106
                  PD+L R IP+LV N DI LVQARW++VNANEC+LTR+QEMS+D HF VEQEVGSA
Sbjct  178   -----PDYLRRAIPYLVQNSDIALVQARWRFVNANECLLTRMQEMSLDYHFKVEQEVGSA  232

Query  1105  IHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELP  926
              HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  RA LKGWKFV+LGD++VKSELP
Sbjct  233   THAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFVYLGDLQVKSELP  292

Query  925   SSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFI  746
             S+FKA+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV KI+AH++TF 
Sbjct  293   STFKAFRFQQHRWSCGPANLFRKMVMEIIRNKKVKFWKKVYVIYSFFFVRKIIAHMVTFS  352

Query  745   YYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTI  566
             +YC+VLP T+L+PE+++P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+LHRT 
Sbjct  353   FYCVVLPLTILVPEVQVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTK  412

Query  565   GTFIGLLEVGRIHEWVVTEKQGN---TKTAQPKS-----AKKVPRFRLGERLHLWEIIVG  410
              TFIGLLE GR +EWVVTEK G+    K A  K+     A K P+ +  ER+H  E+  G
Sbjct  413   ATFIGLLEAGRANEWVVTEKLGDALKNKAADAKNKTNTKAPKKPKIKFAERMHTLELGFG  472

Query  409   FYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              ++ FCG Y+ + G N Y++YLFLQ ++FL+ GFGYIG  V
Sbjct  473   VFLFFCGCYDFVHGKNNYFIYLFLQTITFLIAGFGYIGTIV  513



>ref|NP_001046164.1| Os02g0192500 [Oryza sativa Japonica Group]
 sp|Q7PC76.1|CSLA1_ORYSJ RecName: Full=Glucomannan 4-beta-mannosyltransferase 1; AltName: 
Full=Cellulose synthase-like protein A1; AltName: Full=Glucomannan-synthase 
1; Short=Mannan synthase 1; AltName: Full=OsCslA1; 
AltName: Full=OsCslA9 [Oryza sativa Japonica Group]
 tpg|DAA01743.1| TPA_exp: cellulose synthase-like A1 [Oryza sativa (japonica cultivar-group)]
 dbj|BAD15390.1| putative cellulose synthase-like protein OsCslA9 [Oryza sativa 
Japonica Group]
 dbj|BAD34025.1| putative cellulose synthase-like protein OsCslA9 [Oryza sativa 
Japonica Group]
 dbj|BAF08078.1| Os02g0192500 [Oryza sativa Japonica Group]
 dbj|BAG95675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=521

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/523 (60%), Positives = 414/523 (79%), Gaps = 6/523 (1%)
 Frame = -1

Query  1840  VRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFR  1661
             V G G A  P     W Q +A VIVP+LR+ V +CL M +++ +E++Y+  V + +K+ R
Sbjct  3     VNGGGAAGLPEA---WSQVRAPVIVPLLRLAVAVCLTMSVLLFLERMYMAVVISGVKILR  59

Query  1660  RTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIII  1481
             R P ++Y+ +PI  +DD E+G S +P VL+QIPM NE+ VYQLSIGA C LSWP++R+++
Sbjct  60    RRPDRRYRCDPIP-DDDPELGTSAFPVVLIQIPMFNEREVYQLSIGAVCGLSWPSDRLVV  118

Query  1480  QVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYV  1301
             QVLDDSTDP +K +V+ EC RWA KGVNI Y+ R+NRKG+KAG+LK+GMKH YV+ CEYV
Sbjct  119   QVLDDSTDPVIKEMVRIECERWAHKGVNITYQIRENRKGYKAGALKEGMKHGYVRECEYV  178

Query  1300  AIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQ  1121
             AIFDADF+PDPDFL RTIPFLVHN DI LVQARW++VNA+EC++TR+QEMS+D HF+VEQ
Sbjct  179   AIFDADFQPDPDFLRRTIPFLVHNSDIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQ  238

Query  1120  EVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRV  941
             EV S++ AFFGFNGTAG+WR++A+++AGGWKDRTTVEDMDL  RA LKGWKFV+LGDV+V
Sbjct  239   EVSSSVCAFFGFNGTAGVWRVSAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQV  298

Query  940   KSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAH  761
             KSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNKKVTIWKK+++IY FF + KI+AH
Sbjct  299   KSELPSTFKAFRFQQHRWSCGPANLFRKMLMEIVRNKKVTIWKKIHVIYNFFLIRKIIAH  358

Query  760   VLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMA  581
             ++TF +YCL++PAT+ +PE++IP WG +Y+PT+  LL  +  PRS H+  FW+LFENVM+
Sbjct  359   IVTFAFYCLIIPATIFVPEVRIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMS  418

Query  580   LHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPR--FRLGERLHLWEIIVGF  407
             LHRT  T IGLLE GR +EWVVTEK GN    +  S     +   R+ +RL++ E+ V  
Sbjct  419   LHRTKATLIGLLEAGRANEWVVTEKLGNALKMKSSSKSSAKKSFMRVWDRLNVTELGVAA  478

Query  406   YMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             ++  CGWY+L FG +++++YLF QG +F ++G GY+G  V  S
Sbjct  479   FLFSCGWYDLAFGKDHFFIYLFFQGAAFFIVGIGYVGTIVPQS  521



>ref|XP_010521855.1| PREDICTED: probable mannan synthase 3 [Tarenaya hassleriana]
Length=564

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/508 (60%), Positives = 392/508 (77%), Gaps = 4/508 (1%)
 Frame = -1

Query  1798  LWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKK  1619
             +W Q + +V++P+L+ +  LC VM +M+ +E+VY+  V   +KL  R P K ++WE +  
Sbjct  59    IWKQTRIIVLIPILKCLATLCFVMSLMLFIERVYMSVVVVIVKLLGRNPEKVHRWEALN-  117

Query  1618  EDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKAL  1439
              DD E+G+S YP VL+QIPM NEK V QLSIGAAC LSWP++R+IIQVLDDSTD   K L
Sbjct  118   -DDIELGHSTYPMVLIQIPMYNEKEVCQLSIGAACRLSWPSDRMIIQVLDDSTDQASKDL  176

Query  1438  VQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFL  1259
             V  E  +WA KG++I+ E RDNR G+KAG+LK GMKHSYVK CEYV IFDADF+P+ DFL
Sbjct  177   VNLEVGKWANKGISIRSEIRDNRNGYKAGALKAGMKHSYVKQCEYVVIFDADFQPETDFL  236

Query  1258  YRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNG  1079
              RT+PFLVHNP+I LVQARWK+VNANEC++TR+QEMS++ HF  EQE GS+IHAFFGFNG
Sbjct  237   ARTVPFLVHNPEIALVQARWKFVNANECLMTRMQEMSLNYHFLAEQESGSSIHAFFGFNG  296

Query  1078  TAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQ  899
             TAG+WRI+AL++AGGWKDRTTVEDMDL  RA L GWKFV++ D+ VK+ELPS+FKAYR+Q
Sbjct  297   TAGVWRISALNEAGGWKDRTTVEDMDLAVRACLHGWKFVYVHDIEVKNELPSTFKAYRFQ  356

Query  898   QHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPAT  719
             QHRWSCGPANLFKKMT EI+ NK+V++WKKLYLIY+FFFV KI+ H  TF +YC++LP +
Sbjct  357   QHRWSCGPANLFKKMTVEIIENKRVSLWKKLYLIYSFFFVRKIIVHTFTFFFYCVILPTS  416

Query  718   VLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEV  539
             VL PE+++P W  +YVP    LL     PRSLH+   W+LFENVMA+HRT  TFIGL + 
Sbjct  417   VLFPEIEVPKWATVYVPATITLLNAAATPRSLHLLVCWILFENVMAMHRTKATFIGLFDA  476

Query  538   GRIHEWVVTEKQGNTKTAQ--PKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGD  365
             GR++EWVVTEK G+T  A+    ++    R R GER++  E++ G Y+  CG Y++ FG 
Sbjct  477   GRVNEWVVTEKLGDTLKAKLICDASPTKRRSRFGERMNWRELVAGLYIFLCGCYDVAFGK  536

Query  364   NYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
              Y+YVYLFLQ ++F V G GY+G  V +
Sbjct  537   TYFYVYLFLQSIAFFVAGVGYVGTIVPS  564



>ref|XP_009364844.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Pyrus 
x bretschneideri]
Length=549

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/555 (58%), Positives = 424/555 (76%), Gaps = 23/555 (4%)
 Frame = -1

Query  1891  MDGNSSSAAIMFSSEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMIL  1712
             M  N++   I    E   RG  +  A  +G+ W   KA +IVP+L V VY+ L M +M+ 
Sbjct  1     MADNTTQILI---PETFQRGTYE-FAGQIGLTWELIKAPLIVPLLTVGVYVSLAMSLMLF  56

Query  1711  MEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQL  1532
              E+VY+G V   +KLF + P ++YK+EPI  +DD E+G+S +P VL+QIPM NE+ VY++
Sbjct  57    FERVYMGVVIVLVKLFWKKPEQRYKYEPI--QDDLELGSSNFPPVLIQIPMFNEREVYKV  114

Query  1531  SIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAG  1352
             SIGAAC LSWP++R++IQVLDDSTDP +K +V+ EC+RWA KG+NI+Y+ R+ R G+KAG
Sbjct  115   SIGAACGLSWPSDRLVIQVLDDSTDPTIKQMVELECQRWASKGINIRYQIRETRGGYKAG  174

Query  1351  SLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECM  1172
             +LK+G+K SYVK CEYVAIFDADF P+PD+L R IPFLVHNPDI LVQARW++VNA+EC+
Sbjct  175   ALKEGLKRSYVKHCEYVAIFDADFRPEPDYLRRAIPFLVHNPDIALVQARWRFVNADECL  234

Query  1171  LTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGC  992
             LTR+QEMS+D HF+VEQEVGSA HAFFGFNGTAG+WRIAA+++AGGWKDRTTVEDMDL  
Sbjct  235   LTRMQEMSLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAV  294

Query  991   RAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWK  812
             RA L+GWKF++LGD++VKSELPS+F A+R+QQHRWSCGPANLF+KM  EI++ KKVT+WK
Sbjct  295   RASLRGWKFLYLGDLQVKSELPSTFNAFRFQQHRWSCGPANLFRKMAMEIIKTKKVTVWK  354

Query  811   KLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCP  632
             K Y IY+FFFV KI+AH++TF +YC+VLP T+L+PE+ +P+WGA+Y+P++  +L  +  P
Sbjct  355   KFYTIYSFFFVRKIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTP  414

Query  631   RSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGN---------------  497
             RS+H+  +W+LFENVM+LHRT  T IGLLE  R +EWVVTEK G+               
Sbjct  415   RSIHLLFYWILFENVMSLHRTKATLIGLLETARSNEWVVTEKLGDIVKNKAAEAAKNKAA  474

Query  496   -TKTAQPKSAK-KVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSF  323
                  +P S   K PRF+ G RLHL E+  G ++  CG Y+ + G N Y+VYLFLQ ++F
Sbjct  475   DANKTKPASKLFKRPRFKFGNRLHLLELGFGVFLFICGCYDFVHGKNNYFVYLFLQTITF  534

Query  322   LVIGFGYIGAFVTTS  278
             L+ GFGY+G  + +S
Sbjct  535   LICGFGYVGTIIPSS  549



>ref|XP_010540228.1| PREDICTED: probable mannan synthase 11 isoform X2 [Tarenaya hassleriana]
Length=534

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/510 (62%), Positives = 394/510 (77%), Gaps = 4/510 (1%)
 Frame = -1

Query  1804  GVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPI  1625
             G +W  +   V+V V+  ++   LVM +M+ +E VY+  V   +KL RRTP K +KWE +
Sbjct  28    GYMWEGSMRKVVVAVMGCLIASGLVMSMMVFVEAVYMTTVVIIVKLLRRTPEKVHKWEAM  87

Query  1624  KKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVK  1445
             K  DD E+ +S YP VL+QIPM NEK V +LSIGAAC +SWP +R+IIQVLDDSTD   K
Sbjct  88    K--DDVELAHSNYPMVLIQIPMFNEKEVCELSIGAACRMSWPWDRMIIQVLDDSTDLTCK  145

Query  1444  ALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPD  1265
              LV++EC +WA KGVNIK E RDNR G+KAG+LK GMKH YVK C+YVAIFDADF+PDPD
Sbjct  146   ELVKEECGKWARKGVNIKSEVRDNRNGYKAGALKAGMKHVYVKHCDYVAIFDADFQPDPD  205

Query  1264  FLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGF  1085
             FL RTIPFL+HNPD+ LVQARWK+VNANEC++TR+QEMS++ HF  EQE GS++HAFFGF
Sbjct  206   FLARTIPFLLHNPDLALVQARWKFVNANECLMTRIQEMSLNYHFMAEQECGSSLHAFFGF  265

Query  1084  NGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYR  905
             NGTAG+WRI+AL +AGGWKDRTTVEDMDL  RA L+GWKFVF+GD++VKSELPSSF+ YR
Sbjct  266   NGTAGVWRISALKEAGGWKDRTTVEDMDLAVRACLQGWKFVFVGDIQVKSELPSSFETYR  325

Query  904   YQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLP  725
             +QQHRWSCGPANLF+KMT EIM +K+V++WKK YLIY FF V KIV H+ TF++YCL+LP
Sbjct  326   FQQHRWSCGPANLFRKMTMEIMESKRVSLWKKAYLIYNFFIVRKIVVHMFTFVFYCLILP  385

Query  724   ATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLL  545
             A+VL PE++IP W  +YVPT   +L ++  PRS H+  FW+LFENVMA+HRT    IGL+
Sbjct  386   ASVLFPEVEIPQWATIYVPTAITILNVMATPRSFHLLVFWVLFENVMAMHRTKAALIGLV  445

Query  544   EVGRIHEWVVTEKQG-NTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFG  368
             E GR+ EWVVTEK G NT  AQ   AK   R R G  +H  E+ VG YML CG Y++ FG
Sbjct  446   EAGRVDEWVVTEKTGHNTLKAQLVPAKPWERRRSGG-VHWEEVAVGLYMLVCGCYDMAFG  504

Query  367   DNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
               Y +VYLFLQ ++F V G G++G  ++ S
Sbjct  505   RTYLFVYLFLQSIAFFVAGVGFLGTPISCS  534



>ref|XP_004497599.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Cicer 
arietinum]
Length=524

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/518 (60%), Positives = 414/518 (80%), Gaps = 8/518 (2%)
 Frame = -1

Query  1840  VRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFR  1661
             ++ A D +   L ++W   +  +IVP+LRV V++CL M +M+L+EKVY   V +++KLF 
Sbjct  12    LQEATDGVGLQLELIWKYIRQPLIVPMLRVAVFICLTMSLMMLVEKVYAAIVISWVKLFG  71

Query  1660  RTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIII  1481
             R P K YKWE    EDD E+G+S YP VLVQ+PM NEK VYQLSIGAAC L+WP +RIII
Sbjct  72    RKPEKVYKWESF--EDDVEMGSSNYPMVLVQVPMYNEKEVYQLSIGAACGLTWPCDRIII  129

Query  1480  QVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYV  1301
             Q+LDDSTDP +K LV+ EC +W  KGVNIKYE RDNR G+KAG+LK+GMKHSYVK C+YV
Sbjct  130   QILDDSTDPSIKELVELECHKWRSKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDYV  189

Query  1300  AIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQ  1121
             AIFDADF+P+ DFL RTIPFLV+NP+IGLVQARW +VNA+EC +TR+Q+MS+D HF VEQ
Sbjct  190   AIFDADFQPESDFLLRTIPFLVNNPEIGLVQARWNFVNADECWMTRMQQMSLDYHFKVEQ  249

Query  1120  EVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRV  941
             EVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKF+FL +++V
Sbjct  250   EVGSSTYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLFLSNIQV  309

Query  940   KSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAH  761
             K+ELPS+ KAYRYQQHRWSCGPANLF+KM  EIM N +V++WKK+Y++Y+FFFV KI AH
Sbjct  310   KNELPSTLKAYRYQQHRWSCGPANLFRKMVMEIMTNNRVSLWKKIYVVYSFFFVRKITAH  369

Query  760   VLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMA  581
             + TF++YCLVLP +VL+PE+ IP WG +Y+P++  LL  +  PRS ++  FW+LFEN +A
Sbjct  370   INTFVFYCLVLPTSVLVPEVFIPTWGIVYIPSIVTLLNAVGTPRSFYLVVFWVLFENTVA  429

Query  580   LHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYM  401
             LHRT GT IGLL   R++EW+VTEK G+    +    K +      +++++ E++VG Y+
Sbjct  430   LHRTKGTIIGLLGTRRVNEWIVTEKLGDALKVKGGDGKGL------KKIYMLELLVGLYL  483

Query  400   LFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             LFCG Y+L++G N+++++++LQ ++FL++ FGYIG FV
Sbjct  484   LFCGTYDLMYGKNHFFLFIYLQSIAFLIMAFGYIGTFV  521



>ref|XP_001764061.1| cellulose synthase-like A1, glycosyltransferase family 2 protein; 
mannan synthase [Physcomitrella patens]
 gb|ABD79099.1| cellulose synthase-like A1 [Physcomitrella patens]
 gb|EDQ71200.1| cellulose synthase-like A1, glycosyltransferase family 2 protein; 
mannan synthase [Physcomitrella patens]
Length=538

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/535 (57%), Positives = 415/535 (78%), Gaps = 15/535 (3%)
 Frame = -1

Query  1852  SEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYL  1673
             +E+   G    +   L  +W++ +  V+ PVL+  + +CLVM+ M+ +E++++  V  ++
Sbjct  2     AESGSTGGLPMLVDQLVKIWLEVRGPVVAPVLQFAINVCLVMVTMLFVERIFMCGVMVFV  61

Query  1672  KLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTN  1493
             KL RRTP  Q+K+E I  +DD E GNS YP VLVQIPM NE+ VYQLSI AAC LSWP +
Sbjct  62    KLLRRTPETQFKFEAI--QDDLEFGNSSYPMVLVQIPMFNEREVYQLSIQAACGLSWPQD  119

Query  1492  RIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKS  1313
             R+IIQVLDDSTD   + LVQ E +RWA KG+NIKYETR NRKG+KAG+L+QGM+H YV++
Sbjct  120   RMIIQVLDDSTDQTTRELVQVEVQRWASKGINIKYETRPNRKGYKAGALRQGMRHPYVQT  179

Query  1312  CEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHF  1133
             C+YVAIFDADF+P+P+FL RT+PFLVHN ++ LVQARWK+VNANEC++T++QE+S++ HF
Sbjct  180   CDYVAIFDADFQPEPEFLQRTVPFLVHNSNLALVQARWKFVNANECLMTKMQEVSLNYHF  239

Query  1132  SVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLG  953
             SVEQ VGSA + FFGFNGTAG+WRI A+++AGGW DRTTVEDMDL  RA L GWKFV++ 
Sbjct  240   SVEQRVGSATYGFFGFNGTAGVWRIRAMEEAGGWNDRTTVEDMDLAVRASLCGWKFVYIH  299

Query  952   DVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNK  773
             D+ VK+ELPS+FKA+R+QQHRWSCGPANLF+K+ F I++N+ + +WK+L++IYAFFFV K
Sbjct  300   DLEVKNELPSTFKAFRFQQHRWSCGPANLFRKVLFTILKNQNLRLWKRLHMIYAFFFVRK  359

Query  772   IVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFE  593
             IVAH++TF +YC+V+PA+VL+PE+ +P WGA+YVP++  LL  +  P+SLH+  FW+LFE
Sbjct  360   IVAHIVTFTFYCVVIPASVLVPEVDLPFWGAVYVPSIITLLNAITTPKSLHLLVFWILFE  419

Query  592   NVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTK-----------TAQPKSAKKVPR-FR  449
             NVM+LHRT  T IGL ++G ++EWVVTEK GN             T Q  ++  + R ++
Sbjct  420   NVMSLHRTKATIIGLFDIGNVNEWVVTEKLGNLMKYRSAKYGKKYTLQRMASNMLARGWK  479

Query  448   LGERLHLWEIIVGFYMLFCGWYNLIF-GDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             + ERLH+ E+  G +++FC  Y+  F G N++YVYLFLQ  +FL++GFGY+G FV
Sbjct  480   MSERLHILELWTGGFLMFCAVYDFYFQGKNHFYVYLFLQSCAFLIMGFGYVGTFV  534



>ref|XP_003590384.1| Glucomannan 4-beta-mannosyltransferase, partial [Medicago truncatula]
Length=461

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/450 (67%), Positives = 381/450 (85%), Gaps = 2/450 (0%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             A +GA + +      LW Q +  +IVP+LRV V++CL M +M+L+E+VY+G V +Y+KLF
Sbjct  3     AFQGARNGLGLQHEFLWRQIREPLIVPLLRVAVFVCLGMSLMMLVERVYMGIVISYVKLF  62

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              R P K+YKWE IK  DD E+GNS YP VLVQ+PM NE+ VYQLSIGAAC LSWP++RII
Sbjct  63    GRKPEKRYKWETIK--DDVELGNSNYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRII  120

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQ+LDDSTDP +K LVQ ECRRW  KGVNIKYE RDNR G+KAG+LK+GMKHSYVK C+Y
Sbjct  121   IQILDDSTDPTIKELVQVECRRWRSKGVNIKYEVRDNRNGYKAGALKEGMKHSYVKQCDY  180

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+PDFL+RTIPFLV+NPDIGLVQARWK+VNA+EC++TR+QEMS++ HF+VE
Sbjct  181   VAIFDADFQPEPDFLWRTIPFLVNNPDIGLVQARWKFVNADECLMTRMQEMSLNYHFTVE  240

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS+ +AFFGFNGTAG+WRI+AL++AGGWKDRTTVEDMDL  RA LKGWKF++L D++
Sbjct  241   QEVGSSSYAFFGFNGTAGVWRISALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSDLQ  300

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+ KA+RYQQHRWSCGPANLF+KM  EI+ NKKV++WKK+Y++Y+FFFV KIVA
Sbjct  301   VKNELPSTLKAFRYQQHRWSCGPANLFRKMVMEIVTNKKVSLWKKIYVVYSFFFVRKIVA  360

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H+ TF++YC+VLPATV++PE+ +P WGA+Y+P++  LL  +  PRS H+  FW+LFEN M
Sbjct  361   HINTFVFYCIVLPATVMVPEVVVPKWGAVYIPSIITLLNAVGTPRSFHLLVFWILFENTM  420

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNT  494
             +LHRT  T IGLLE  R++EW+VTEK G+ 
Sbjct  421   SLHRTKATIIGLLEASRVNEWIVTEKLGDA  450



>ref|XP_009131529.1| PREDICTED: probable mannan synthase 11 [Brassica rapa]
 emb|CDX78675.1| BnaA03g05870D [Brassica napus]
Length=504

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/506 (59%), Positives = 393/506 (78%), Gaps = 3/506 (1%)
 Frame = -1

Query  1807  LGVLWV-QAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWE  1631
             +  +W+ QA++L++VP+ + +V +CLV+ +++ +E VY+  V  Y+KLF+R P K YKWE
Sbjct  1     METMWLRQARSLLLVPLFKCLVAICLVISLLVFVESVYMNIVVIYVKLFKRKPEKIYKWE  60

Query  1630  PIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPE  1451
              +  ++D E+GN  YP VLVQIPM NE+ V+QLSIGAAC L WP +R+IIQVLDDSTDP 
Sbjct  61    AM--QEDIEVGNQNYPMVLVQIPMYNEREVFQLSIGAACRLIWPLDRVIIQVLDDSTDPT  118

Query  1450  VKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPD  1271
             +  +V  EC +WA KG+NIK E RDNR G+KAG+LKQGM+HSYVK C Y+AIFDADF+P+
Sbjct  119   IMEMVSMECAKWASKGINIKCERRDNRNGYKAGALKQGMRHSYVKQCNYIAIFDADFQPE  178

Query  1270  PDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFF  1091
             PD+L+RT+PFL+HNP++ LVQARWK+VNAN+C++TR+QEMS++ HF  EQE GS  HAFF
Sbjct  179   PDYLHRTVPFLIHNPELALVQARWKFVNANKCLMTRMQEMSLNYHFMAEQESGSTRHAFF  238

Query  1090  GFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKA  911
             GFNGTAG+WR+A +++AGGWKDRTTVEDMDL  R GL GWKFVF+ D+ VKSELPS FKA
Sbjct  239   GFNGTAGVWRLAGMEEAGGWKDRTTVEDMDLAVRVGLHGWKFVFVNDIEVKSELPSQFKA  298

Query  910   YRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLV  731
             +R+QQHRWSCGPANLF+KMT EI+ NK+V IWKKLY+IY+FFF+ KI+ H  TF +YC+V
Sbjct  299   FRFQQHRWSCGPANLFRKMTMEIIHNKRVVIWKKLYVIYSFFFLRKILVHFFTFFFYCIV  358

Query  730   LPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIG  551
             LP +V   E+ IP W  +YVP +    T +  PRS ++  FW+LFENVMA+HRT GTFIG
Sbjct  359   LPTSVFFYEVNIPTWSTIYVPFVITFFTAIATPRSFYLVFFWVLFENVMAMHRTKGTFIG  418

Query  550   LLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIF  371
             LLE GR++EWVVTEK G+    +     K PR  + +RL+L E++VG Y+L C  Y+  F
Sbjct  419   LLEGGRVNEWVVTEKLGDALETKLLPQVKKPRNGILQRLNLKEMMVGIYILCCACYDFAF  478

Query  370   GDNYYYVYLFLQGVSFLVIGFGYIGA  293
             G    Y+YLF+Q ++F++ G G++G 
Sbjct  479   GSTLLYIYLFMQALAFIICGVGFVGT  504



>ref|XP_009120642.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Brassica 
rapa]
Length=534

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/521 (60%), Positives = 420/521 (81%), Gaps = 5/521 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G    I   LG++W   KA VIVP+L++ V +CL+M +M+L E+VY+G V   +KLF + 
Sbjct  16    GVKMEITGQLGMIWELVKAPVIVPLLQLAVDICLLMSLMLLCERVYMGIVIVLVKLFWKK  75

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P K+YK+EPI  +DD E+G+S +P VLVQIPM NE+ VY+LSIGAA  LSWP++R++IQV
Sbjct  76    PHKRYKFEPI--QDDEELGSSNFPVVLVQIPMFNEREVYKLSIGAASGLSWPSDRLVIQV  133

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP VK +V+ EC+RWA KG+NI+Y+ R+NR G+KAG+LK+G+K SYVK CEYV I
Sbjct  134   LDDSTDPTVKQMVEMECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHCEYVVI  193

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+P+PDFL R+IPFLVHNP+I LVQARW++VN++EC+LTR+QEMS+D HF+VEQEV
Sbjct  194   FDADFQPEPDFLRRSIPFLVHNPNIALVQARWRFVNSDECLLTRMQEMSLDYHFTVEQEV  253

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
             GS+ HAFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++VKS
Sbjct  254   GSSTHAFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQVKS  313

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+F+A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FFFV K++AH +
Sbjct  314   ELPSTFRAFRFQQHRWSCGPANLFRKMVMEIIRNKKVRFWKKVYVIYSFFFVRKVIAHWV  373

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF +YC+VLP T+L+PE+K+P+WG++Y+P++  +L  +  PRS+H+  +W+LFENVM+LH
Sbjct  374   TFCFYCVVLPLTILVPEVKVPIWGSVYIPSIITVLNSVGTPRSIHLLFYWILFENVMSLH  433

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSA--KKVPR-FRLGERLHLWEIIVGFY  404
             RT  T IGL E  R +EWVVT K G+ ++A+  +   KK PR F+L +RL+  E+    +
Sbjct  434   RTKATLIGLFEADRANEWVVTAKLGSGQSAKGNTEGLKKFPRIFKLPDRLNTLELGFAAF  493

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             +  CG Y+   G N Y++YLFLQ +SF + G G+IG +V +
Sbjct  494   LFVCGCYDYAHGKNNYFIYLFLQTMSFFISGLGWIGTYVPS  534



>gb|ABD79100.1| cellulose synthase-like A2 [Physcomitrella patens]
Length=538

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/535 (57%), Positives = 416/535 (78%), Gaps = 15/535 (3%)
 Frame = -1

Query  1852  SEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYL  1673
             +E+A  G    +   L  LW+  ++ ++ P+L+  + +CLVM+ M+ +E++++  V  ++
Sbjct  2     AESARGGTFSVLVDQLLQLWLDVRSPIVAPLLQFAINVCLVMVTMLFVERIFMCGVMVFV  61

Query  1672  KLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTN  1493
             KL RRTP  Q+K+EP++  DD E GNS +P VLVQIPM NE+ VYQLSI AAC LSWP +
Sbjct  62    KLLRRTPETQFKFEPLR--DDLEFGNSSFPMVLVQIPMFNEREVYQLSIQAACGLSWPGD  119

Query  1492  RIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKS  1313
             R+IIQVLDDSTD   + LVQ EC+RWA KG+NI+YETR NRKG+KAG+L+QGMK  YV++
Sbjct  120   RMIIQVLDDSTDQTTRDLVQMECQRWASKGINIRYETRPNRKGYKAGALRQGMKWPYVQT  179

Query  1312  CEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHF  1133
             C+YVAIFDADF+P+P+FL RT+PFLVHN D+ LVQARWK+VNANEC++T++QE+S++ HF
Sbjct  180   CDYVAIFDADFQPEPEFLQRTVPFLVHNSDLALVQARWKFVNANECLMTKMQEVSLNYHF  239

Query  1132  SVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLG  953
             SVEQ VGSA + FFGFNGTAG+WRI A+++AGGW DRTTVEDMDL  RA L GWKFV++ 
Sbjct  240   SVEQRVGSATYGFFGFNGTAGVWRIRAMEEAGGWNDRTTVEDMDLAVRASLCGWKFVYIH  299

Query  952   DVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNK  773
             D+ VK+ELPS+FKA+R+QQHRWSCGPANLF+K+   I++N+ + +WK+L++IYAFFFV K
Sbjct  300   DLEVKNELPSTFKAFRFQQHRWSCGPANLFRKVLPSILKNQNLKLWKRLHMIYAFFFVRK  359

Query  772   IVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFE  593
             +VAH++TF +YC+V+PA+VL+PE+ +P WGA+YVP++  LL  +  P+SLH+  FW+LFE
Sbjct  360   VVAHIVTFTFYCVVIPASVLVPEVDLPFWGAVYVPSIITLLNAITTPKSLHLLVFWILFE  419

Query  592   NVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTK-----------TAQPKSAKKVPR-FR  449
             NVM+LHRT  T IGL ++G ++EWVVTEK GN             T Q  ++  + R ++
Sbjct  420   NVMSLHRTKATIIGLFDIGNVNEWVVTEKLGNLMKYRSSKYGKKYTLQRMASNMLARGWK  479

Query  448   LGERLHLWEIIVGFYMLFCGWYNLIF-GDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             + ER+HL E+  G +++FC  Y+  F G N++YVYLFLQ  +FLV+GFGY+G FV
Sbjct  480   MSERMHLLEVWTGGFLMFCAVYDFYFQGKNHFYVYLFLQSCAFLVMGFGYVGTFV  534



>gb|AAQ62570.1| glycosyltransferase 1 [Ipomoea trifida]
 gb|AAS79578.1| putative glycosyltransferase [Ipomoea trifida]
Length=537

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/526 (57%), Positives = 410/526 (78%), Gaps = 10/526 (2%)
 Frame = -1

Query  1840  VRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFR  1661
             +RG G  +A  + +++   KA +IVPVLR+ VY+CL M +M+ +E++Y+G V   +K+F 
Sbjct  16    LRGPGGDMAAQMRLMYDLVKAPLIVPVLRLAVYVCLTMSMMLFVERLYMGIVIILVKIFC  75

Query  1660  RTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIII  1481
               P K+YKWEP++  +D EIG S +P+VL+QIPM NEK VY++SIGA CN +WP++R+++
Sbjct  76    GKPEKRYKWEPMR--EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVV  133

Query  1480  QVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYV  1301
             QVLDDSTD  +K +V++EC RWA KG+NI Y+TR  R G+KAG+LK+G+ H YV+ CEYV
Sbjct  134   QVLDDSTDHNIKEMVEKECLRWASKGINITYQTRVTRGGYKAGALKEGLTHDYVQDCEYV  193

Query  1300  AIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQ  1121
             AIFDADF P+PDFL R+IPFL+HNP+I L+QARW++VNA+EC+LTR+QEMS+D HF VEQ
Sbjct  194   AIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQ  253

Query  1120  EVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRV  941
             EVGS+ HAFFGFNGT GIWRIAA+++AGGWKDRTTVEDMDL  RAGLKGWKF++LGD+ V
Sbjct  254   EVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHV  313

Query  940   KSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAH  761
             KSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNK+V +WKK+Y+IY+FF V KI AH
Sbjct  314   KSELPSTFKAFRFQQHRWSCGPANLFRKMFIEIVRNKRVNVWKKVYVIYSFFLVRKITAH  373

Query  760   VLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMA  581
             ++TF +YC+VLP T+L+PE+++P WGA+Y+P +  +L  +  PRS+H+  +W+LFENVM+
Sbjct  374   MVTFFFYCVVLPLTILVPEVEVPKWGAIYIPCIITILNSVGTPRSIHLLFYWILFENVMS  433

Query  580   LHRTIGTFIGLLEVGRIHEWVVTEKQGNT------KTAQPKSAKKVPRFRLGERLHLWEI  419
              HRT  T IGLLE  R +EWVVTEK G+         ++P   K    FR  +R+ L E+
Sbjct  434   FHRTKATLIGLLEFKRANEWVVTEKLGDAINNNNKSNSKPAPKKSKSMFR--DRILLHEL  491

Query  418   IVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
                 ++  CG Y+ + G N+YY+YLFLQ ++F + G G++G  V +
Sbjct  492   GFAVFLFVCGVYDFLHGKNHYYIYLFLQVITFTIAGVGWVGTIVPS  537



>ref|XP_002528577.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33785.1| conserved hypothetical protein [Ricinus communis]
Length=498

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/522 (60%), Positives = 409/522 (78%), Gaps = 36/522 (7%)
 Frame = -1

Query  1843  AVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLF  1664
             A +GA D I+    ++W Q +A +IVP+LR+ V +CL+M +M+ +E+VY+G V   +K+F
Sbjct  13    AFQGARDDISMQFLIIWDQIRAPLIVPLLRLAVAVCLLMSLMLFIERVYMGIVITLVKIF  72

Query  1663  RRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRII  1484
              R P K+YKWEP+K  DD E+GNS YP V            YQLSIGAAC LSWP++RII
Sbjct  73    GRKPEKRYKWEPLK--DDVEMGNSAYPMV------------YQLSIGAACGLSWPSDRII  118

Query  1483  IQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEY  1304
             IQVLDDSTDP +K LV+ EC+RWA KG+NIKYE RDNR G+KAG+LK+GMK SYVK C+Y
Sbjct  119   IQVLDDSTDPTIKDLVELECQRWASKGINIKYEIRDNRNGYKAGALKEGMKRSYVKHCDY  178

Query  1303  VAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVE  1124
             VAIFDADF+P+PDFL+RTIPFLVHNP++GLVQARWK+VN++EC++TR+QEMS+D HF+VE
Sbjct  179   VAIFDADFQPEPDFLWRTIPFLVHNPELGLVQARWKFVNSDECLMTRMQEMSLDYHFTVE  238

Query  1123  QEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVR  944
             QEVGS+ +AFFGFNGTAG+WRIAAL++AGGWKDRTTVEDMDL  RA LKGWKF++LG ++
Sbjct  239   QEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLGSLK  298

Query  943   VKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVA  764
             VK+ELPS+F+AYRYQQH                      +T+WKK ++IY+FF V KIVA
Sbjct  299   VKNELPSTFRAYRYQQH----------------------LTLWKKAHVIYSFFLVRKIVA  336

Query  763   HVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVM  584
             H++TF++YC+VLPATVL+PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+LFENVM
Sbjct  337   HIVTFVFYCVVLPATVLVPEVAVPKWGAVYIPSIVTLLNAVGTPRSLHLMVFWILFENVM  396

Query  583   ALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFY  404
             +LHRT  TFIGLLE GR++EW+VTEK G+   A+P  A K PRF+ G+RLHL E+  G Y
Sbjct  397   SLHRTKATFIGLLEAGRVNEWIVTEKLGDALKAKPAKAPKKPRFKFGDRLHLLELGTGAY  456

Query  403   MLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             + FCG Y++ FG N+Y++YLF+Q ++F ++GFGYIG FV  S
Sbjct  457   LFFCGCYDVAFGKNHYFLYLFVQAIAFFIMGFGYIGTFVPNS  498



>gb|AAQ62572.1| glycosyltransferase 10 [Ipomoea trifida]
 dbj|BAF36343.1| hypothetical protein [Ipomoea trifida]
Length=537

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/528 (57%), Positives = 408/528 (77%), Gaps = 14/528 (3%)
 Frame = -1

Query  1840  VRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFR  1661
             +RG G  +A  + +++   KA +IVPVLR+ VY+CL M +M+ +E++Y+G V   +K+F 
Sbjct  16    LRGPGGDMAAQMRLMYDLVKAPLIVPVLRLAVYVCLTMSMMLFVERLYMGIVIILVKIFC  75

Query  1660  RTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIII  1481
               P K+YKWEP++  +D EIG S +P+VL+QIPM NEK VY++SIGA CN +WP++R+++
Sbjct  76    GKPEKRYKWEPMR--EDYEIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVV  133

Query  1480  QVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYV  1301
             QVLDDSTD  +K +V++EC RWA KG+NI Y+TR  R G+KAG+LK+G+ H YV+ CEYV
Sbjct  134   QVLDDSTDHNIKEMVEKECLRWASKGINITYQTRVTRGGYKAGALKEGLTHDYVQDCEYV  193

Query  1300  AIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQ  1121
             AIFDADF P+PDFL R+IPFL+HNP+I L+QARW++VNA+EC+LTR+QEMS+D HF VEQ
Sbjct  194   AIFDADFRPEPDFLLRSIPFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQ  253

Query  1120  EVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRV  941
             EVGS+ HAFFGFNGT GIWRIAA+++AGGWKDRTTVEDMDL  RAGLKGWKF++LGD+ V
Sbjct  254   EVGSSTHAFFGFNGTGGIWRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHV  313

Query  940   KSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAH  761
             KSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNK+V +WKK+Y+IY+FF V KI AH
Sbjct  314   KSELPSTFKAFRFQQHRWSCGPANLFRKMFMEIVRNKRVNVWKKVYVIYSFFLVRKITAH  373

Query  760   VLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMA  581
             ++TF +YC+VLP T+L+PE+++P WGA+Y+P +  +L  +  PRS+H+  +W+LFENVM+
Sbjct  374   MVTFFFYCVVLPLTILVPEVEVPKWGAIYIPCIITILNSVGTPRSIHLLFYWILFENVMS  433

Query  580   LHRTIGTFIGLLEVGRIHEWVVTEKQGNT--------KTAQPKSAKKVPRFRLGERLHLW  425
              HRT  T IGLLE  R +EWVVTEK G+             PK  K +      +R+ L 
Sbjct  434   FHRTKATLIGLLEFKRANEWVVTEKLGDAINNNNKSNSKPAPKKTKSI----FKDRILLH  489

Query  424   EIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTT  281
             E+    ++  CG Y+ + G N+YY+YLFLQ ++F + G G++G  V +
Sbjct  490   ELGFAVFLFVCGVYDYLHGKNHYYIYLFLQVITFTIAGVGWVGTIVPS  537



>ref|XP_003606273.1| Glucomannan 4-beta-mannosyltransferase [Medicago truncatula]
 gb|AES88470.1| cellulose synthase-like protein A1 [Medicago truncatula]
Length=542

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/526 (58%), Positives = 403/526 (77%), Gaps = 18/526 (3%)
 Frame = -1

Query  1819  IAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQY  1640
             ++  + ++W   KA +IVP L   VY+ L M +M+ ME+VY+G V   +KLF + P ++Y
Sbjct  20    VSSQIKMIWDVMKAPLIVPFLNACVYISLAMALMLFMERVYMGFVIILVKLFWKKPEQRY  79

Query  1639  KWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDST  1460
             K+EP+  +DD E+G   +P VLVQIPM NE+ VY++SIGAAC LSWPT+R++IQVLDDST
Sbjct  80    KYEPL--QDDEELGGENFPVVLVQIPMFNEREVYKVSIGAACGLSWPTDRLVIQVLDDST  137

Query  1459  DPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADF  1280
             DP VK LV+ EC+RWA KG+NI Y+ R+ R G+KAG+LK+G+K SYVK CEYV IFDADF
Sbjct  138   DPVVKQLVEMECQRWASKGINITYQIRETRGGYKAGALKEGLKRSYVKHCEYVVIFDADF  197

Query  1279  EPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIH  1100
              P PDFL R IPFLV NP+I LVQ RW++VNANEC+LTR+QEMS+D HF+VEQEVGSA H
Sbjct  198   SPPPDFLRRAIPFLVGNPEIALVQGRWRFVNANECLLTRMQEMSLDYHFTVEQEVGSATH  257

Query  1099  AFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSS  920
             AFFGFNGTAGIWRIAA+++AGGWKDRTTVEDMDL  RA L+GWKF++LGD++  SELPS+
Sbjct  258   AFFGFNGTAGIWRIAAINEAGGWKDRTTVEDMDLAVRASLRGWKFLYLGDLQANSELPST  317

Query  919   FKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYY  740
              +A+R+QQHRWSCGPANLF+KM  EI+RNKKV  WKK+Y+IY+FF V KIVAH++TF +Y
Sbjct  318   LRAFRFQQHRWSCGPANLFRKMAMEIIRNKKVKFWKKVYVIYSFFLVRKIVAHMVTFFFY  377

Query  739   CLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGT  560
             CLV+P T+L+PE+ +P+WGA+Y+P++  +L  +  PRS+H+  +W+LFENVM+LHRT  T
Sbjct  378   CLVIPLTILVPEVHVPIWGAVYIPSIITILNSVGTPRSIHLLFYWILFENVMSLHRTKAT  437

Query  559   FIGLLEVGRIHEWVVTEKQGNT---------------KTAQPKSAKKVPRFRLGERLHLW  425
              IGLLE GR +EWVVTEK G++               K    K  KK  R +  ERL+  
Sbjct  438   LIGLLEYGRANEWVVTEKLGDSVNNNNNKKDKSGDAAKKTNVKVQKKT-RSKFMERLNFL  496

Query  424   EIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             E+    ++ FCG Y+ + G + Y++YLFLQ ++F ++GFGY+G  V
Sbjct  497   ELGFAVFLFFCGCYDYVHGKHNYFIYLFLQTLTFTIVGFGYVGTIV  542



>ref|XP_010540227.1| PREDICTED: probable mannan synthase 11 isoform X1 [Tarenaya hassleriana]
Length=535

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/511 (62%), Positives = 394/511 (77%), Gaps = 5/511 (1%)
 Frame = -1

Query  1804  GVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPI  1625
             G +W  +   V+V V+  ++   LVM +M+ +E VY+  V   +KL RRTP K +KWE +
Sbjct  28    GYMWEGSMRKVVVAVMGCLIASGLVMSMMVFVEAVYMTTVVIIVKLLRRTPEKVHKWEAM  87

Query  1624  KKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVK  1445
             K  DD E+ +S YP VL+QIPM NEK V +LSIGAAC +SWP +R+IIQVLDDSTD   K
Sbjct  88    K--DDVELAHSNYPMVLIQIPMFNEKEVCELSIGAACRMSWPWDRMIIQVLDDSTDLTCK  145

Query  1444  -ALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
               LV++EC +WA KGVNIK E RDNR G+KAG+LK GMKH YVK C+YVAIFDADF+PDP
Sbjct  146   QELVKEECGKWARKGVNIKSEVRDNRNGYKAGALKAGMKHVYVKHCDYVAIFDADFQPDP  205

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFL RTIPFL+HNPD+ LVQARWK+VNANEC++TR+QEMS++ HF  EQE GS++HAFFG
Sbjct  206   DFLARTIPFLLHNPDLALVQARWKFVNANECLMTRIQEMSLNYHFMAEQECGSSLHAFFG  265

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             FNGTAG+WRI+AL +AGGWKDRTTVEDMDL  RA L+GWKFVF+GD++VKSELPSSF+ Y
Sbjct  266   FNGTAGVWRISALKEAGGWKDRTTVEDMDLAVRACLQGWKFVFVGDIQVKSELPSSFETY  325

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             R+QQHRWSCGPANLF+KMT EIM +K+V++WKK YLIY FF V KIV H+ TF++YCL+L
Sbjct  326   RFQQHRWSCGPANLFRKMTMEIMESKRVSLWKKAYLIYNFFIVRKIVVHMFTFVFYCLIL  385

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             PA+VL PE++IP W  +YVPT   +L ++  PRS H+  FW+LFENVMA+HRT    IGL
Sbjct  386   PASVLFPEVEIPQWATIYVPTAITILNVMATPRSFHLLVFWVLFENVMAMHRTKAALIGL  445

Query  547   LEVGRIHEWVVTEKQG-NTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIF  371
             +E GR+ EWVVTEK G NT  AQ   AK   R R G  +H  E+ VG YML CG Y++ F
Sbjct  446   VEAGRVDEWVVTEKTGHNTLKAQLVPAKPWERRRSGG-VHWEEVAVGLYMLVCGCYDMAF  504

Query  370   GDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             G  Y +VYLFLQ ++F V G G++G  ++ S
Sbjct  505   GRTYLFVYLFLQSIAFFVAGVGFLGTPISCS  535



>ref|XP_010420302.1| PREDICTED: probable mannan synthase 11 [Camelina sativa]
Length=506

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/501 (58%), Positives = 391/501 (78%), Gaps = 2/501 (0%)
 Frame = -1

Query  1795  WVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKE  1616
             W +  +L++VP+ + +V +CLV+ +++ +E +Y+  V  Y+KLF+R P K YKWE +  +
Sbjct  7     WRKMSSLLLVPIFKCLVAMCLVISLLVFVESLYMNIVVFYVKLFKRKPEKIYKWEAM--Q  64

Query  1615  DDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALV  1436
             +D E+G+  YP VLVQIPM NE+ V+QLSIGAAC L WP +R+IIQVLDDSTDP +  +V
Sbjct  65    EDMELGDQNYPMVLVQIPMYNEREVFQLSIGAACGLIWPLDRLIIQVLDDSTDPTIMEMV  124

Query  1435  QQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLY  1256
               EC +WA KG+NIK E RDNR G+KAG+LKQGM+HSYVK C Y+AIFDADF+P+PD+L+
Sbjct  125   NIECGKWARKGINIKCERRDNRNGYKAGALKQGMRHSYVKQCAYIAIFDADFQPEPDYLH  184

Query  1255  RTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGT  1076
             R+IPFL+HNP++ LVQARWK+VNA +C++TR+QEMS++ HF+ EQE GS  HAFFGFNGT
Sbjct  185   RSIPFLIHNPELALVQARWKFVNAKKCLMTRMQEMSLNYHFTAEQESGSTRHAFFGFNGT  244

Query  1075  AGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQ  896
             AG+WR+AA+++AGGWKDRTTVEDMDL  R GL GW+FVF+ DV VKSELPS FKA+R+QQ
Sbjct  245   AGVWRMAAMEEAGGWKDRTTVEDMDLAVRVGLHGWRFVFVNDVAVKSELPSQFKAFRFQQ  304

Query  895   HRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATV  716
             HRWSCGPANLF+KM  EI+ NK+VTIWKKLY+IY+FFFV KI+ H  TF +YCL+LP +V
Sbjct  305   HRWSCGPANLFRKMAMEIISNKRVTIWKKLYVIYSFFFVRKIIVHFFTFFFYCLILPTSV  364

Query  715   LIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVG  536
               PE+ IP W  +Y P +  L   +  PRS ++  FW+LFENVMA+HRT GTFIGLLE G
Sbjct  365   FFPEVNIPTWSTMYFPFMITLFNAIATPRSFYLVIFWVLFENVMAMHRTKGTFIGLLEGG  424

Query  535   RIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYY  356
             R++EWVVTEK G+    +     + PR  + +R++  E++VG Y+L C  YNL+FG    
Sbjct  425   RVNEWVVTEKLGDALETKLLPQIRKPRNGVLDRINSKEMMVGIYILCCASYNLVFGKTLL  484

Query  355   YVYLFLQGVSFLVIGFGYIGA  293
             Y+YL++Q ++F++ GFG++G 
Sbjct  485   YIYLYMQALAFIISGFGFVGT  505



>gb|AAQ62571.1| glycosyltransferase 5, partial [Ipomoea trifida]
Length=508

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/505 (59%), Positives = 399/505 (79%), Gaps = 5/505 (1%)
 Frame = -1

Query  1786  AKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKEDDA  1607
              KA +IVPVLR+ VY+CL M +M+ +E++Y+G V   +K+F   P K+YKWEP++  +D 
Sbjct  6     VKAPLIVPVLRLAVYVCLTMSMMLFVERLYMGIVIILVKIFCGKPEKRYKWEPMR--EDY  63

Query  1606  EIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQE  1427
             EIG S +P+VL+QIPM NEK VY++SIGA CN +WP++R+++QVLDDSTD  +K +V++E
Sbjct  64    EIGTSVFPSVLIQIPMFNEKEVYKISIGAVCNFAWPSDRLVVQVLDDSTDHNIKEMVEKE  123

Query  1426  CRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTI  1247
             C RWA KG+NI Y+TR  R G+KAG+LK+G+ H YV+ CEYVAIFDADF P+PDFL R+I
Sbjct  124   CLRWASKGINITYQTRVTRGGYKAGALKEGLTHDYVQDCEYVAIFDADFRPEPDFLLRSI  183

Query  1246  PFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGI  1067
             PFL+HNP+I L+QARW++VNA+EC+LTR+QEMS+D HF VEQEVGS+ HAFFGFNGT GI
Sbjct  184   PFLIHNPEIALIQARWRFVNADECLLTRMQEMSLDYHFKVEQEVGSSTHAFFGFNGTGGI  243

Query  1066  WRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRW  887
             WRIAA+++AGGWKDRTTVEDMDL  RAGLKGWKF++LGD+ VKSELPS+FKA+R+QQHRW
Sbjct  244   WRIAAINEAGGWKDRTTVEDMDLAVRAGLKGWKFLYLGDLHVKSELPSTFKAFRFQQHRW  303

Query  886   SCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIP  707
             SCGPANLF+KM  EI+RNK+V +WKK+Y+IY+FF V KI AH++TF +YC+VLP T+L+P
Sbjct  304   SCGPANLFRKMFMEIVRNKRVNVWKKVYVIYSFFLVRKITAHMVTFFFYCVVLPLTILVP  363

Query  706   ELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIH  527
             E+++P WGA+Y+P +  +L  +  PRS+H+  +W+LFENVM+ HRT  T IGLLE  R +
Sbjct  364   EVEVPKWGAIYIPCIITILNSVGTPRSIHLLFYWILFENVMSFHRTKATLIGLLEFKRAN  423

Query  526   EWVVTEKQG---NTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYY  356
             EWVVTEK G   N   +  K A K  +    +R+ L E+    ++  CG Y+ + G N+Y
Sbjct  424   EWVVTEKLGDAINNNKSNSKPAPKKTKSIFRDRILLHELGFAVFLFVCGVYDYLHGKNHY  483

Query  355   YVYLFLQGVSFLVIGFGYIGAFVTT  281
             Y+YLFLQ ++F + G G++G  V +
Sbjct  484   YIYLFLQVITFTIAGVGWVGTIVPS  508



>ref|XP_006606290.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X3 [Glycine max]
 ref|XP_006606291.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X4 [Glycine max]
Length=436

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/435 (68%), Positives = 372/435 (86%), Gaps = 1/435 (0%)
 Frame = -1

Query  1579  VLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGV  1400
             VLVQIPM NEK VYQLSIGAAC LSWP++R+IIQVLDDSTDP +K +V+ EC+RWA KGV
Sbjct  2     VLVQIPMYNEKEVYQLSIGAACGLSWPSDRVIIQVLDDSTDPIIKNMVEVECQRWASKGV  61

Query  1399  NIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDI  1220
             NIKYE R+NR G+KAG+LK+GMKHSYV  C+YVAIFDADF+P+P+FL+RTIPFL +NP++
Sbjct  62    NIKYEIRENRNGYKAGALKEGMKHSYVNLCDYVAIFDADFQPEPNFLWRTIPFLAYNPEV  121

Query  1219  GLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDA  1040
              LVQARWK+VNA+EC++TR+QEMS+D HF VEQEVGS+ +AFFGFNGTAG+WRI+AL++A
Sbjct  122   ALVQARWKFVNADECLMTRMQEMSLDYHFLVEQEVGSSTYAFFGFNGTAGVWRISALNEA  181

Query  1039  GGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFK  860
             GGWKDRTTVEDMDL  RAGLKG KFV+L D++VKSELPS+FKAYRYQQHRWSCGPANLFK
Sbjct  182   GGWKDRTTVEDMDLAVRAGLKGGKFVYLSDLKVKSELPSTFKAYRYQQHRWSCGPANLFK  241

Query  859   KMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGA  680
             KM  EIMRNKKV++WKKLY+IY+FFFV KIVAHV+TF++YC+++PATVL+PE+++P WGA
Sbjct  242   KMAMEIMRNKKVSMWKKLYVIYSFFFVRKIVAHVVTFVFYCVIMPATVLVPEVEVPKWGA  301

Query  679   LYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQG  500
             +Y+P++  LL  +  PRS+H+  FW+LFENVM++HRT  T  GLLE GR++EWVVTEK G
Sbjct  302   VYIPSIITLLNAVGTPRSIHLLVFWILFENVMSMHRTKATLTGLLEAGRVNEWVVTEKLG  361

Query  499   NT-KTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSF  323
             +  KT     A + PR R+GERLH  E++VG Y+ FC  Y+L +G N+Y++YLFLQ ++F
Sbjct  362   DALKTKSGGKAARKPRIRIGERLHFLELLVGAYLFFCACYDLKYGKNHYFIYLFLQSMAF  421

Query  322   LVIGFGYIGAFVTTS  278
              V G GY+G FV  S
Sbjct  422   FVAGVGYVGTFVPNS  436



>ref|XP_006646997.1| PREDICTED: LOW QUALITY PROTEIN: glucomannan 4-beta-mannosyltransferase 
1-like [Oryza brachyantha]
Length=520

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/521 (59%), Positives = 409/521 (79%), Gaps = 6/521 (1%)
 Frame = -1

Query  1834  GAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRT  1655
             G   A+ P     W Q +A VI P+LR+ V +CL M +++ + ++Y+  V A +KL RR 
Sbjct  4     GGAAAVVPEA---WSQGRAPVIGPLLRLAVAVCLTMPVLLFLXRMYMAVVIAGVKLLRRR  60

Query  1654  PAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQV  1475
             P ++Y+ +P+  +DD E+G S +P VL+QIPM NE+ VYQLSIGA C LSWP++R+++QV
Sbjct  61    PERRYRCDPLP-DDDPELGTSAFPVVLIQIPMFNEREVYQLSIGAVCGLSWPSDRLVVQV  119

Query  1474  LDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAI  1295
             LDDSTDP +K +V+ EC RWA KGVNI Y+ R +RKG+KAG+LK+GMKH YV+ CEYVAI
Sbjct  120   LDDSTDPVIKEMVRMECERWAHKGVNITYQIRQDRKGYKAGALKEGMKHGYVRECEYVAI  179

Query  1294  FDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEV  1115
             FDADF+PDPDFL RTIPFLVHN DI LVQARW++VNA+EC++TR+QEMS+D HF+VEQEV
Sbjct  180   FDADFQPDPDFLRRTIPFLVHNSDIALVQARWRFVNADECLMTRMQEMSLDYHFTVEQEV  239

Query  1114  GSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKS  935
              S++ AFFGFNGTAGIWRI+A+++AGGWKDRTTVEDMDL  RA LKGWKFV+LGDV+VKS
Sbjct  240   SSSVCAFFGFNGTAGIWRISAVNEAGGWKDRTTVEDMDLAIRASLKGWKFVYLGDVQVKS  299

Query  934   ELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVL  755
             ELPS+FKA+R+QQHRWSCGPANLF+KM  EI++NKKVTIWKK+++IY FF + KIVAH++
Sbjct  300   ELPSTFKAFRFQQHRWSCGPANLFRKMLMEIVKNKKVTIWKKIHVIYNFFLIRKIVAHIV  359

Query  754   TFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALH  575
             TF +YCL++PAT+ +PE++IP WG +Y+PT+  LL  +  PRS H+  FW+LFENVM+LH
Sbjct  360   TFTFYCLIIPATIFVPEVRIPKWGCVYIPTIITLLNSVGTPRSFHLLFFWILFENVMSLH  419

Query  574   RTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQPKSAKKVPR--FRLGERLHLWEIIVGFYM  401
             RT  T IGLLE GR +EWVVT K GN    +  +     +   R+ +RL++ E+ V  ++
Sbjct  420   RTKATLIGLLEAGRANEWVVTAKLGNALKMKSSNKSSFKKSFMRIWDRLNVTELGVAAFL  479

Query  400   LFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
               CGWY+L FG +++++YLF QG +F ++G GY+G  V  S
Sbjct  480   FSCGWYDLAFGKDHFFIYLFFQGAAFFIVGIGYVGTIVPQS  520



>ref|XP_010690012.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Beta 
vulgaris subsp. vulgaris]
Length=537

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/529 (57%), Positives = 416/529 (79%), Gaps = 12/529 (2%)
 Frame = -1

Query  1840  VRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFR  1661
             ++  GD ++  L ++W   KA +IVP+L++ V +CL M +M+ ME++Y+G V + +K+F 
Sbjct  10    LQARGD-VSYQLELMWDMIKAPLIVPLLKLGVIVCLTMSLMLFMERLYMGIVISLVKMFW  68

Query  1660  RTPAKQYKWEPIKKE-DDAEIGNSG-YPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRI  1487
             + P K+Y WE +    DD E G S  +P VL+QIPM NE+ VY++SIGAACNLSWP +R+
Sbjct  69    KKPDKRYNWEALPDSIDDIETGGSNKFPHVLIQIPMFNEREVYKVSIGAACNLSWPADRM  128

Query  1486  IIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCE  1307
             +IQVLDDSTDP VK +V+ EC+RWA KG+NI Y+ R+NR G+KAG+LK+G+K  YVK CE
Sbjct  129   VIQVLDDSTDPIVKDMVELECQRWASKGLNIVYQIRENRVGYKAGALKEGLKRDYVKHCE  188

Query  1306  YVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSV  1127
             YVAIFDADF P+PD+L R IPFL++NP++ LVQ RW++VNA+EC++TR+QEMS+D HF V
Sbjct  189   YVAIFDADFRPEPDYLRRAIPFLMYNPELALVQGRWRFVNADECLMTRMQEMSLDYHFKV  248

Query  1126  EQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDV  947
             EQEVGS+ HAFFGFNGTAG+WRIAA+D+AGGWKDRTTVEDMDL  RA L+GWKFV+LGD+
Sbjct  249   EQEVGSSTHAFFGFNGTAGVWRIAAIDEAGGWKDRTTVEDMDLAVRASLRGWKFVYLGDL  308

Query  946   RVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIV  767
             +VKSELPS+FKA+R+QQHRWSCGPANLF+KM  EI+RNK V  WKK+Y+IY+FF V KI 
Sbjct  309   QVKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKNVRFWKKVYVIYSFFLVRKIT  368

Query  766   AHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENV  587
             AH++TF +YC++LP T+L+PE+++P+WG++Y+P++  +L  +  PRS+H+  +W+LFENV
Sbjct  369   AHMVTFFFYCVILPLTILVPEVEVPIWGSVYIPSIITILNSVGTPRSIHLLFYWILFENV  428

Query  586   MALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQP---------KSAKKVPRFRLGERL  434
             M+LHRT  T IGL E GR +EWVVTEK G+++ A+          K+A +  R ++ +R+
Sbjct  429   MSLHRTKATLIGLFEAGRANEWVVTEKLGDSQKAKAHAKEKPGSFKTAVRKLRSKILDRM  488

Query  433   HLWEIIVGFYMLFCGWYNLIFGDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
             +L E++VG ++   G Y+ ++G   YYVY FLQ ++F ++GFGY+G  +
Sbjct  489   NLLELVVGVFLFCIGCYDFMYGKWSYYVYFFLQSITFFIVGFGYVGTII  537



>ref|XP_010492500.1| PREDICTED: probable mannan synthase 11 [Camelina sativa]
Length=506

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/501 (59%), Positives = 390/501 (78%), Gaps = 2/501 (0%)
 Frame = -1

Query  1795  WVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKE  1616
             W + ++L++VP+ + +V +CL + +++ +E  Y+  V  Y+KLF+R P K YKWE +  +
Sbjct  7     WREMRSLLLVPMFKCLVAMCLFISLLVFVESFYMNIVVFYVKLFKRKPEKIYKWEAM--Q  64

Query  1615  DDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALV  1436
             +D E+G+  YP VLVQIPM NE+ V+QLSIGAAC L WP +R+I+QVLDDSTDP +  +V
Sbjct  65    EDMELGDQNYPMVLVQIPMYNEREVFQLSIGAACGLIWPLDRLIVQVLDDSTDPTIMDMV  124

Query  1435  QQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLY  1256
               EC +WA KG+NIK E RDNR G+KAG+LKQGM+HSYVK C Y+AIFDADF+P+PD+L 
Sbjct  125   NIECGKWARKGINIKCERRDNRNGYKAGALKQGMRHSYVKQCTYIAIFDADFQPEPDYLQ  184

Query  1255  RTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGT  1076
             RTIPFL+HNP++ LVQARWK+VNA +C++TR+QEMS++ HF+ EQE GS  HAFFGFNGT
Sbjct  185   RTIPFLIHNPELALVQARWKFVNAKKCLMTRMQEMSLNYHFTAEQESGSTRHAFFGFNGT  244

Query  1075  AGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQ  896
             AG+WR+AA+++AGGWKDRTTVEDMDL  R GL GWKFVF+ DV VKSELPS FKA+R+QQ
Sbjct  245   AGVWRMAAMEEAGGWKDRTTVEDMDLAVRVGLHGWKFVFVNDVAVKSELPSQFKAFRFQQ  304

Query  895   HRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATV  716
             HRWSCGPANLF+KMT EI+ NK+VTIWKKLY+IY+FFFV KI+ H  TF +YCL+LP +V
Sbjct  305   HRWSCGPANLFRKMTMEIISNKRVTIWKKLYVIYSFFFVRKIIVHFFTFFFYCLILPTSV  364

Query  715   LIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVG  536
               PE+ IP W  +Y P +  L   +  PRS ++  FW+LFENVMA+HRT GTFIGLLE G
Sbjct  365   FFPEVNIPTWSTVYFPFMITLFNAIATPRSFYLVVFWVLFENVMAMHRTKGTFIGLLEGG  424

Query  535   RIHEWVVTEKQGNTKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNYY  356
             R++EWVVTEK G+    +     + PR  + +R++  E++VG Y+L C  YNL+FG    
Sbjct  425   RVNEWVVTEKLGDALETKLLPQIRKPRNGVLDRINSKEMMVGIYILCCASYNLVFGKTLL  484

Query  355   YVYLFLQGVSFLVIGFGYIGA  293
             Y+YL++Q ++F++ GFG++G 
Sbjct  485   YIYLYMQALAFIISGFGFVGT  505



>ref|XP_010937167.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like [Elaeis 
guineensis]
Length=581

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/507 (59%), Positives = 396/507 (78%), Gaps = 3/507 (1%)
 Frame = -1

Query  1795  WVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKE  1616
             W  A+ + + P+LR  V LCL M +M+L+E V +   S  +KL RR P K+YKWEPIK  
Sbjct  77    WRVARKMAVAPLLRAAVVLCLAMSVMLLVEVVSMAVCSLAVKLLRRRPEKRYKWEPIK--  134

Query  1615  DDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALV  1436
              D E GN  YP VLVQIPM NEK VY+LSIGAAC LSWP++RIIIQVLDDSTDP +K LV
Sbjct  135   GDLESGNLAYPMVLVQIPMYNEKEVYKLSIGAACGLSWPSDRIIIQVLDDSTDPTIKDLV  194

Query  1435  QQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLY  1256
             + EC+ WA KG+NI YE R NRKG+KAG+LK+GM+HSYV+ C++VAIFD+DF+P+ DFL 
Sbjct  195   ELECKFWASKGMNIYYEVRGNRKGYKAGALKEGMEHSYVQQCDFVAIFDSDFQPESDFLM  254

Query  1255  RTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGT  1076
             R IPFLV+NP I LVQARW +VN+ EC++TR+Q+M++D HF VEQE GS+  AFFGFNGT
Sbjct  255   RAIPFLVYNPKIALVQARWDFVNSTECLMTRIQKMTLDYHFKVEQEAGSSTFAFFGFNGT  314

Query  1075  AGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQ  896
             AG+WR +A+D+AGGWKDRTTVEDMDL  RA LKGWKFV++GD++V+SELPSSFKAYR+QQ
Sbjct  315   AGVWRKSAIDEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDIKVRSELPSSFKAYRHQQ  374

Query  895   HRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATV  716
             HRW+CG ANLF+K+  E +  K+V++WKK +++Y+FFFV KIVAH++TF+ YC+V+PA+V
Sbjct  375   HRWTCGAANLFRKVAIETVMTKEVSLWKKFHVLYSFFFVRKIVAHIVTFVLYCVVIPASV  434

Query  715   LIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVG  536
             L+PE+ IP WG +Y+PT   +L  +  PRS+H+  FW+LFENVM++HR   T +GL E G
Sbjct  435   LVPEVSIPTWGVVYIPTTITVLNAIRNPRSIHLMPFWILFENVMSMHRMKATMVGLFEAG  494

Query  535   RIHEWVVTEKQGNTKTAQPKSA-KKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNY  359
              ++EWVVTEK G+    +P++   + P  RL +R+   EI    ++ FC   ++ FG+NY
Sbjct  495   GVNEWVVTEKLGDALKGKPETQILEKPPIRLKDRITFSEIGFAVFLFFCACCDVAFGENY  554

Query  358   YYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             YYVY++LQ ++FLV+GFGY+G+F+  S
Sbjct  555   YYVYIYLQALAFLVVGFGYVGSFIPNS  581



>emb|CDX79614.1| BnaC03g19500D [Brassica napus]
Length=551

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/507 (59%), Positives = 397/507 (78%), Gaps = 2/507 (0%)
 Frame = -1

Query  1795  WVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIKKE  1616
             W QA+A+V+VPV + +V LCL+M +M+ +E +Y+G V AY+KLF+R P K YKW  ++ E
Sbjct  44    WEQARAVVVVPVFKFLVALCLIMSVMLFVEMMYMGVVVAYIKLFKRKPEKVYKWVAME-E  102

Query  1615  DDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKALV  1436
             DD E G+  +P VLVQIPM NEK V + SI AAC +SWP+NRIIIQVLDDSTDP  K LV
Sbjct  103   DDVECGSESFPMVLVQIPMYNEKEVCEQSIAAACKISWPSNRIIIQVLDDSTDPASKELV  162

Query  1435  QQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDFLY  1256
             ++EC RW+ +GVNI +E RDNRKG+KAG+L++GMKHSYVK C+YVAIFDADF+P+PDFL+
Sbjct  163   KKECERWSKEGVNITFEIRDNRKGYKAGALREGMKHSYVKQCDYVAIFDADFQPEPDFLF  222

Query  1255  RTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFNGT  1076
             RT+PFL+HNP + LVQ RW++VNA +CM+TRLQEMS+  HF VEQ+VGS+  AFFGFNGT
Sbjct  223   RTVPFLIHNPKLALVQGRWEFVNAGQCMMTRLQEMSLSYHFMVEQQVGSSTFAFFGFNGT  282

Query  1075  AGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRYQQ  896
             AG+WRI+AL+++GGW D+TTVEDMDL  RA L+GWK ++L D++VKSELP SF A R QQ
Sbjct  283   AGVWRISALNESGGWNDQTTVEDMDLAVRATLRGWKLLYLDDLKVKSELPCSFNALRSQQ  342

Query  895   HRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPATV  716
             HRW+CGPANLF+KM  +I+R++ V++WKKLY++Y+FFF+ K+VAHVL+F +YC++LPATV
Sbjct  343   HRWTCGPANLFRKMAGKIIRSENVSLWKKLYMLYSFFFMRKLVAHVLSFCFYCVILPATV  402

Query  715   LIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLEVG  536
             L PE+ +P W A Y+P+L  LL  L   RS+H+ AFW+LFEN M+L RT    +GL E G
Sbjct  403   LFPEVTVPKWAAFYLPSLITLLIALGRLRSIHLLAFWVLFENAMSLVRTKALVMGLFETG  462

Query  535   RIHEWVVTEKQGN-TKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFGDNY  359
             R+ EWVVTEK G+  KT     A +    R  +R+HL E++VG Y+LFCG Y++I+G   
Sbjct  463   RVQEWVVTEKLGDGLKTKLIAQAPEEHHVRFRDRVHLMELLVGVYLLFCGCYDIIYGKQT  522

Query  358   YYVYLFLQGVSFLVIGFGYIGAFVTTS  278
              ++YL  Q + F V+GFGY+G +V  S
Sbjct  523   LFLYLLFQSMGFFVVGFGYVGKYVAAS  549



>ref|XP_011010406.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 9-like isoform 
X1 [Populus euphratica]
Length=546

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/479 (66%), Positives = 401/479 (84%), Gaps = 4/479 (1%)
 Frame = -1

Query  1858  FSSEAAVRGAG-DAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVS  1682
              SS + +  AG D +   +G++W      + VPVL+++V +CL M IMI +E+VY+G V 
Sbjct  4     LSSASNIFPAGRDGVTGQIGLIWQVIMEPLTVPVLKLLVVVCLGMSIMIFIERVYMGVVI  63

Query  1681  AYLKLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSW  1502
              ++KLF + P K+YKWEPIK  DD E+GNS YP VLVQ+PM NEK VYQLSIGAAC LSW
Sbjct  64    VFVKLFGKKPNKRYKWEPIK--DDIELGNSAYPMVLVQVPMYNEKEVYQLSIGAACGLSW  121

Query  1501  PTNRIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSY  1322
             P++RIIIQVLDDSTDP +K+LV+ EC+RWA KG+ IKYE RDNR G+KAG+LK+GMKHSY
Sbjct  122   PSDRIIIQVLDDSTDPAIKSLVEVECQRWASKGITIKYEMRDNRNGYKAGALKEGMKHSY  181

Query  1321  VKSCEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMD  1142
             VK C ++AIFDADF+P+PDFL+RTIPFL HNP+I LVQARWK+VN++EC++TR+QEMS+D
Sbjct  182   VKQCFFLAIFDADFQPEPDFLWRTIPFLAHNPEIALVQARWKFVNSDECLMTRMQEMSLD  241

Query  1141  RHFSVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFV  962
              HF+VEQEVGSA +AFFGFNGTAG+WRI+A+++AGGWKDRTTVEDMDL  RA LKGWKFV
Sbjct  242   YHFTVEQEVGSATYAFFGFNGTAGVWRISAVNEAGGWKDRTTVEDMDLAVRASLKGWKFV  301

Query  961   FLGDVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFF  782
             ++GD++VK+ELPS+FKAYRYQQHRWSCGPANLF+KM  EI++NKKV++WKK Y+IY+FFF
Sbjct  302   YVGDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAIEIVKNKKVSVWKKCYVIYSFFF  361

Query  781   VNKIVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWM  602
             V KIVAH++TF++YC+VLPATVL+PE+ +P WGA+Y+P++  LL  +  PRSLH+  FW+
Sbjct  362   VRKIVAHIVTFLFYCVVLPATVLVPEVTVPKWGAVYIPSVVTLLNAVGTPRSLHLMVFWI  421

Query  601   LFENVMALHRTIGTFIGLLEVGRIHEWVVTEKQGNTKTAQ-PKSAKKVPRFRLGERLHL  428
             LFENVM+LHRT  TFIGLLE GR++EWVVTEK G+   A+ P  A K PR R+GER+ L
Sbjct  422   LFENVMSLHRTKATFIGLLEGGRVNEWVVTEKIGDALKAKLPAKATKKPRIRIGERIWL  480



>ref|XP_010937165.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 1-like [Elaeis 
guineensis]
Length=541

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/511 (59%), Positives = 394/511 (77%), Gaps = 3/511 (1%)
 Frame = -1

Query  1807  LGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEP  1628
             +G++W Q +A+V++PV++  V  CL+M +M+L+EKV +G +S Y KLF R P + YK +P
Sbjct  32    IGLIWRQVRAMVVIPVMKAAVVACLIMSVMVLVEKVSMGLISLYAKLFHRRPERIYKCDP  91

Query  1627  IKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEV  1448
             I   +D E+G   YP VLVQIPM NEK VYQLSIGAACNLSWP +RIIIQ+LDDSTD  +
Sbjct  92    I--AEDEELGTLAYPMVLVQIPMYNEKEVYQLSIGAACNLSWPKDRIIIQILDDSTDLII  149

Query  1447  KALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDP  1268
             K LV++EC +W G G NIKYETRDNRKG+KAG+LK+GMKHSYV++CEY+A+FDADF+P P
Sbjct  150   KDLVKKECEKWFGMGNNIKYETRDNRKGYKAGALKEGMKHSYVETCEYIAMFDADFQPAP  209

Query  1267  DFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFG  1088
             DFL RT+PFLVHNP I LVQARWK+VNANEC++TR+QEMSMD HF VEQE GS   AFFG
Sbjct  210   DFLTRTVPFLVHNPSIALVQARWKFVNANECLMTRMQEMSMDYHFKVEQESGSTSCAFFG  269

Query  1087  FNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAY  908
             +NGTAG+WRI A+++AGGWKDRTTVEDMDL  RAGL GWK +++G ++VKSELPS+FKAY
Sbjct  270   YNGTAGVWRIQAINEAGGWKDRTTVEDMDLAVRAGLGGWKMIYVGSIKVKSELPSTFKAY  329

Query  907   RYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVL  728
             R+QQHRWSCGPANLF+KM  +I++ KKV+IWKK Y+IY+FF   +++++ +TF +YC+V+
Sbjct  330   RFQQHRWSCGPANLFRKMLCDIVKAKKVSIWKKFYVIYSFFLARRVLSNFVTFFFYCVVI  389

Query  727   PATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGL  548
             P +V  PE+KIP WG +Y+P+   +L  +  P S H+  FW+LFENVM+LHR     IGL
Sbjct  390   PLSVFFPEVKIPRWGMVYIPSTITILNAVGTPSSFHLIIFWILFENVMSLHRCKAVIIGL  449

Query  547   LEVGRIHEWVVTEKQGN-TKTAQPKSAKKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIF  371
             LE GR +EWVVTEK G+  KT       K  R +  ERLH  E+ +  Y++ C  Y+  F
Sbjct  450   LEAGRANEWVVTEKLGDLLKTKSNIKVAKKYRSKFWERLHFLELGLAVYLMICACYDYYF  509

Query  370   GDNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
               +YY+V LF Q ++F+++G GYIG  + + 
Sbjct  510   RKDYYFVILFPQAMAFVIMGVGYIGTIIPSD  540



>ref|XP_008783921.1| PREDICTED: probable mannan synthase 3 isoform X1 [Phoenix dactylifera]
Length=577

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/510 (59%), Positives = 395/510 (77%), Gaps = 5/510 (1%)
 Frame = -1

Query  1801  VLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYLKLFRRTPAKQYKWEPIK  1622
             V W  A+ + + P+LR  V LCL M +M+L+E V + A S  +KL RR P K+YKWEPIK
Sbjct  71    VAWRVARKMAVAPLLRAAVVLCLAMSVMLLVEVVSMAAFSLSVKLLRRRPEKRYKWEPIK  130

Query  1621  KEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTNRIIIQVLDDSTDPEVKA  1442
                D E GN GYP VLVQIPM NE  VY+LSIGAAC LSWP++RIIIQVLDDSTDP +K 
Sbjct  131   --GDLESGNLGYPMVLVQIPMYNEIEVYKLSIGAACGLSWPSDRIIIQVLDDSTDPTIKD  188

Query  1441  LVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKSCEYVAIFDADFEPDPDF  1262
             LV+ EC+ WA KG+NI YE R NRKG+KAG+LK+GM+HSYV+ CE+VAIFD+DF+P+ DF
Sbjct  189   LVELECKFWASKGMNIYYEVRGNRKGYKAGALKEGMEHSYVQQCEFVAIFDSDFQPESDF  248

Query  1261  LYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHFSVEQEVGSAIHAFFGFN  1082
             L R IPFLV+NP+I LVQARW +VN+ EC++TR+Q+M++D HF VEQE GS+   FFGFN
Sbjct  249   LMRAIPFLVYNPNIALVQARWDFVNSTECLMTRIQKMTLDYHFKVEQEAGSSTFGFFGFN  308

Query  1081  GTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLGDVRVKSELPSSFKAYRY  902
             GTAG+WR +A+D+AGGWKDRTTVEDMDL  RA LKGWKFV++GD++V+SELPS+FKAYR+
Sbjct  309   GTAGVWRKSAIDEAGGWKDRTTVEDMDLAVRASLKGWKFVYVGDIKVRSELPSTFKAYRH  368

Query  901   QQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNKIVAHVLTFIYYCLVLPA  722
             QQHRW+CG ANLF+K+  E +  K+V+ WKK +++Y+FFFV K+VAH++TFI YC+V+P 
Sbjct  369   QQHRWTCGAANLFRKVAIETVMTKEVSFWKKFHVLYSFFFVRKVVAHIVTFILYCIVIPV  428

Query  721   TVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFENVMALHRTIGTFIGLLE  542
             +VL+PE+ IP WG +Y+PT   +L  +  PRS+H+  FW+LFENVM++HR   T +GL E
Sbjct  429   SVLVPEVSIPTWGVVYIPTTITVLNAIRNPRSIHLMPFWILFENVMSMHRMKATMVGLFE  488

Query  541   VGRIHEWVVTEKQGNTKTAQPKSA--KKVPRFRLGERLHLWEIIVGFYMLFCGWYNLIFG  368
              G ++EWVVTEK G+T   +P++   +K P  RL +R    EI    ++ FC  YN+ FG
Sbjct  489   AGGVNEWVVTEKLGDTLKGKPETQILEKHP-IRLRDRFTFSEIGFAVFLFFCACYNVAFG  547

Query  367   DNYYYVYLFLQGVSFLVIGFGYIGAFVTTS  278
             +NYYY+Y+ LQ ++FLV+GFGY+G F   S
Sbjct  548   ENYYYIYICLQALAFLVVGFGYVGTFTPNS  577



>ref|XP_001759264.1| cellulose synthase-like A2, glycosyltransferase family 2 protein; 
mannan synthase [Physcomitrella patens]
 gb|EDQ75948.1| cellulose synthase-like A2, glycosyltransferase family 2 protein; 
mannan synthase [Physcomitrella patens]
Length=535

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/532 (57%), Positives = 411/532 (77%), Gaps = 12/532 (2%)
 Frame = -1

Query  1852  SEAAVRGAGDAIAPYLGVLWVQAKALVIVPVLRVMVYLCLVMLIMILMEKVYLGAVSAYL  1673
             +E+A  G    +   L  LW+  ++ ++ P+L+  + +CLVM+ M+ +E++++  V  ++
Sbjct  2     AESARGGTFSVLVDQLLQLWLDVRSPIVAPLLQFAINVCLVMVTMLFVERIFMCGVMVFV  61

Query  1672  KLFRRTPAKQYKWEPIKKEDDAEIGNSGYPTVLVQIPMCNEKRVYQLSIGAACNLSWPTN  1493
             KL RRTP  Q+K+EP++  DD E GNS +P VLVQIPM NE+ VYQLSI AAC LSWP +
Sbjct  62    KLLRRTPETQFKFEPLR--DDLEFGNSSFPMVLVQIPMFNEREVYQLSIQAACGLSWPGD  119

Query  1492  RIIIQVLDDSTDPEVKALVQQECRRWAGKGVNIKYETRDNRKGFKAGSLKQGMKHSYVKS  1313
             R+IIQVLDDSTD   + LVQ EC+RWA KG+NI+YETR NRKG+KAG+L+QGMK  YV++
Sbjct  120   RMIIQVLDDSTDQTTRDLVQMECQRWASKGINIRYETRPNRKGYKAGALRQGMKWPYVQT  179

Query  1312  CEYVAIFDADFEPDPDFLYRTIPFLVHNPDIGLVQARWKYVNANECMLTRLQEMSMDRHF  1133
             C+YVAIFDADF+P+P+FL RT+PFLVHN ++ LVQARWK+VNANEC++T++QE+S++ HF
Sbjct  180   CDYVAIFDADFQPEPEFLQRTVPFLVHNSNLALVQARWKFVNANECLMTKMQEVSLNYHF  239

Query  1132  SVEQEVGSAIHAFFGFNGTAGIWRIAALDDAGGWKDRTTVEDMDLGCRAGLKGWKFVFLG  953
             SVEQ VGSA + FFGFNGTAG+WRI A+++AGGW DRTTVEDMDL  RA L GWKFV++ 
Sbjct  240   SVEQRVGSATYGFFGFNGTAGVWRIRAMEEAGGWNDRTTVEDMDLAVRASLCGWKFVYIH  299

Query  952   DVRVKSELPSSFKAYRYQQHRWSCGPANLFKKMTFEIMRNKKVTIWKKLYLIYAFFFVNK  773
             D+ VK+ELPS+FKA+R+QQHRWSCGPANLF+K+   I++N+ + +WK+L++IYAFFFV K
Sbjct  300   DLEVKNELPSTFKAFRFQQHRWSCGPANLFRKVLPSILKNQNLKLWKRLHMIYAFFFVRK  359

Query  772   IVAHVLTFIYYCLVLPATVLIPELKIPLWGALYVPtltalltlLPCPRSLHMTAFWMLFE  593
             +VAH++TF +YC+V+PA+VL+PE+ +P WGA+YVP++  LL  +  P+SLH+  FW+LFE
Sbjct  360   VVAHIVTFTFYCVVIPASVLVPEVDLPFWGAVYVPSIITLLNAITTPKSLHLLVFWILFE  419

Query  592   NVMALHRTIGTFIGLLEVGRIHEWVVTEKQGN-TKTAQPKSAKKVPRFRLGER-------  437
             NVM+LHRT  T IGL ++G ++EWVVTEK GN  K    K  KK    R+          
Sbjct  420   NVMSLHRTKATIIGLFDIGNVNEWVVTEKLGNLMKYRSSKYGKKYTLQRMASNMLARGWK  479

Query  436   -LHLWEIIVGFYMLFCGWYNLIF-GDNYYYVYLFLQGVSFLVIGFGYIGAFV  287
              +HL E+  G +++FC  Y+  F G N++YVYLFLQ  +FLV+GFGY+G FV
Sbjct  480   MMHLLEVWTGGFLMFCAVYDFYFQGKNHFYVYLFLQSCAFLVMGFGYVGTFV  531



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5611601724636