BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23961_g1_i3 len=2147 path=[9580:0-6 6613:7-608 753:609-670
8674:671-898 7931:899-962 1107:963-988 1133:989-1076 1221:1077-1123
1268:1124-1610 8421:1611-1732 1755:1733-1739 1762:1740-2146]

Length=2147
                                                                      Score     E

ref|XP_009593045.1|  PREDICTED: probable magnesium transporter NI...    651   0.0      
ref|XP_006338750.1|  PREDICTED: uncharacterized protein LOC102593285    652   0.0      
ref|XP_009781329.1|  PREDICTED: probable magnesium transporter NI...    651   0.0      
ref|XP_009593044.1|  PREDICTED: probable magnesium transporter NI...    652   0.0      
ref|XP_009781328.1|  PREDICTED: probable magnesium transporter NI...    651   0.0      
emb|CDP16754.1|  unnamed protein product                                634   0.0      
ref|XP_008231217.1|  PREDICTED: uncharacterized protein LOC103330418    633   0.0      
ref|XP_007217235.1|  hypothetical protein PRUPE_ppa005773mg             631   0.0      
ref|XP_009345158.1|  PREDICTED: uncharacterized protein LOC103936992    628   0.0      
ref|XP_011098988.1|  PREDICTED: probable magnesium transporter NIPA8    625   0.0      
gb|EYU31888.1|  hypothetical protein MIMGU_mgv1a006503mg                622   0.0      
ref|XP_008379030.1|  PREDICTED: uncharacterized protein LOC103442068    620   0.0      
ref|XP_010249353.1|  PREDICTED: probable magnesium transporter NIPA8    609   0.0      
ref|XP_007032075.1|  Uncharacterized protein isoform 1                  609   0.0      
ref|XP_007032077.1|  Uncharacterized protein isoform 3                  604   0.0      
ref|XP_003518156.1|  PREDICTED: magnesium transporter NIPA3-like ...    604   0.0      
gb|KDP41887.1|  hypothetical protein JCGZ_26905                         603   0.0      
ref|XP_009378082.1|  PREDICTED: uncharacterized protein LOC103966622    615   0.0      
ref|XP_007151693.1|  hypothetical protein PHAVU_004G068100g             602   0.0      
ref|XP_006599420.1|  PREDICTED: magnesium transporter NIPA3 isofo...    602   0.0      
ref|XP_004304576.1|  PREDICTED: NIPA-like protein 2-like                599   0.0      
ref|XP_006574742.1|  PREDICTED: magnesium transporter NIPA3-like ...    599   0.0      
ref|XP_010090937.1|  hypothetical protein L484_007572                   599   0.0      
ref|XP_010250449.1|  PREDICTED: probable magnesium transporter NI...    597   0.0      
ref|XP_003548044.1|  PREDICTED: magnesium transporter NIPA3 isofo...    597   0.0      
gb|KEH25623.1|  magnesium transporter NIPA protein                      595   0.0      
ref|XP_010554142.1|  PREDICTED: probable magnesium transporter NIPA8    593   0.0      
gb|KHG04148.1|  NIPA-like protein 3                                     593   0.0      
ref|XP_006446877.1|  hypothetical protein CICLE_v10015243mg             592   0.0      
ref|XP_011033700.1|  PREDICTED: probable magnesium transporter NIPA8    591   0.0      
emb|CBI21245.3|  unnamed protein product                                590   0.0      
ref|XP_010682217.1|  PREDICTED: probable magnesium transporter NIPA8    590   0.0      
ref|XP_010028908.1|  PREDICTED: probable magnesium transporter NI...    588   0.0      
gb|AFK45775.1|  unknown                                                 585   0.0      
ref|XP_004167028.1|  PREDICTED: uncharacterized LOC101223129            578   0.0      
ref|XP_002512799.1|  pentatricopeptide repeat-containing protein,...    603   0.0      Ricinus communis
ref|XP_004489736.1|  PREDICTED: NIPA-like protein 2-like                577   0.0      
ref|XP_006290458.1|  hypothetical protein CARUB_v10019534mg             576   0.0      
ref|XP_004145621.1|  PREDICTED: uncharacterized protein LOC101223129    574   0.0      
ref|XP_002876986.1|  hypothetical protein ARALYDRAFT_484434             574   0.0      
ref|XP_008449977.1|  PREDICTED: uncharacterized protein LOC103491699    574   0.0      
ref|XP_010425383.1|  PREDICTED: probable magnesium transporter NI...    573   0.0      
ref|XP_009593046.1|  PREDICTED: probable magnesium transporter NI...    572   0.0      
ref|XP_009781330.1|  PREDICTED: probable magnesium transporter NI...    571   0.0      
ref|XP_010502603.1|  PREDICTED: probable magnesium transporter NI...    572   0.0      
emb|CDX83636.1|  BnaC07g23760D                                          569   0.0      
ref|XP_006395536.1|  hypothetical protein EUTSA_v10004224mg             569   0.0      
emb|CDY48980.1|  BnaA02g28160D                                          569   0.0      
ref|XP_009129492.1|  PREDICTED: NIPA-like protein 2                     568   0.0      
ref|XP_009152036.1|  PREDICTED: NIPA-like protein 2                     568   0.0      
emb|CDY13650.1|  BnaA06g32730D                                          568   0.0      
ref|NP_189301.1|  uncharacterized protein                               565   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929508.1|  PREDICTED: probable magnesium transporter NIPA8    565   0.0      
ref|XP_010514324.1|  PREDICTED: probable magnesium transporter NI...    565   0.0      
ref|XP_010660769.1|  PREDICTED: uncharacterized protein LOC100244618    588   0.0      
emb|CDY28535.1|  BnaC02g36250D                                          561   0.0      
ref|XP_008798362.1|  PREDICTED: uncharacterized protein LOC103713272    560   0.0      
ref|XP_010528114.1|  PREDICTED: probable magnesium transporter NI...    558   0.0      
ref|XP_010528116.1|  PREDICTED: probable magnesium transporter NI...    552   0.0      
ref|XP_006469116.1|  PREDICTED: uncharacterized protein LOC102612526    585   0.0      
gb|ACU23269.1|  unknown                                                 548   0.0      Glycine max [soybeans]
gb|KHN00641.1|  NIPA-like protein 3                                     541   0.0      
ref|XP_009403806.1|  PREDICTED: magnesium transporter NIPA3-like        538   0.0      
ref|XP_002320397.2|  hypothetical protein POPTR_0014s13580g             533   2e-180   Populus trichocarpa [western balsam poplar]
ref|XP_010028910.1|  PREDICTED: probable magnesium transporter NI...    529   6e-179   
ref|XP_004952598.1|  PREDICTED: uncharacterized protein LOC101761...    526   2e-177   
ref|NP_001158915.1|  hypothetical protein                               523   2e-176   Zea mays [maize]
ref|XP_009421007.1|  PREDICTED: NIPA-like protein 3                     523   3e-176   
gb|AFW71602.1|  hypothetical protein ZEAMMB73_269507                    522   3e-176   
ref|XP_010235476.1|  PREDICTED: probable magnesium transporter NI...    522   5e-176   
ref|XP_004952599.1|  PREDICTED: uncharacterized protein LOC101761...    521   1e-175   
gb|EEC73279.1|  hypothetical protein OsI_07422                          520   2e-175   Oryza sativa Indica Group [Indian rice]
ref|XP_010235478.1|  PREDICTED: probable magnesium transporter NI...    517   4e-174   
ref|XP_006647255.1|  PREDICTED: magnesium transporter NIPA3-like        516   5e-174   
ref|NP_001046964.1|  Os02g0518100                                       514   3e-173   Oryza sativa Japonica Group [Japonica rice]
emb|CAN71073.1|  hypothetical protein VITISV_020459                     514   4e-172   Vitis vinifera
ref|XP_008677537.1|  PREDICTED: uncharacterized protein LOC100381...    511   6e-172   
gb|KDO63498.1|  hypothetical protein CISIN_1g013305mg                   499   3e-168   
ref|XP_008341659.1|  PREDICTED: uncharacterized protein LOC103404508    471   2e-158   
ref|XP_009623388.1|  PREDICTED: probable magnesium transporter NIPA8    456   2e-151   
gb|KDO63499.1|  hypothetical protein CISIN_1g013305mg                   448   2e-148   
ref|XP_009795431.1|  PREDICTED: probable magnesium transporter NIPA8    435   2e-143   
ref|XP_008677538.1|  PREDICTED: uncharacterized protein LOC100381...    432   1e-141   
ref|XP_004229598.1|  PREDICTED: probable magnesium transporter NIPA8    431   1e-141   
ref|XP_006366500.1|  PREDICTED: uncharacterized protein LOC102580280    429   3e-141   
ref|XP_006844682.1|  hypothetical protein AMTR_s00016p00244190          431   4e-141   
ref|XP_010425385.1|  PREDICTED: probable magnesium transporter NI...    431   4e-141   
ref|XP_010502604.1|  PREDICTED: probable magnesium transporter NI...    429   2e-140   
ref|XP_010514326.1|  PREDICTED: probable magnesium transporter NI...    423   5e-138   
ref|XP_009593048.1|  PREDICTED: probable magnesium transporter NI...    411   6e-133   
ref|XP_009781332.1|  PREDICTED: probable magnesium transporter NI...    410   7e-133   
gb|KGN57684.1|  hypothetical protein Csa_3G251940                       387   1e-124   
gb|KDO63500.1|  hypothetical protein CISIN_1g013305mg                   371   6e-120   
ref|XP_002452179.1|  hypothetical protein SORBIDRAFT_04g021230          360   8e-115   Sorghum bicolor [broomcorn]
ref|XP_001759023.1|  predicted protein                                  362   7e-114   
ref|XP_001767665.1|  predicted protein                                  360   5e-113   
gb|AFW62415.1|  hypothetical protein ZEAMMB73_017317                    355   2e-112   
ref|XP_010250448.1|  PREDICTED: probable magnesium transporter NI...    345   2e-108   
ref|XP_010250446.1|  PREDICTED: probable magnesium transporter NI...    345   8e-108   
gb|AFW62414.1|  hypothetical protein ZEAMMB73_017317                    309   3e-95    
gb|AFW62413.1|  hypothetical protein ZEAMMB73_017317                    297   1e-91    
gb|AFW62411.1|  hypothetical protein ZEAMMB73_017317                    296   2e-91    
dbj|BAJ86371.1|  predicted protein                                      269   2e-80    
ref|XP_002985516.1|  hypothetical protein SELMODRAFT_424601             249   9e-72    
ref|XP_002948114.1|  hypothetical protein VOLCADRAFT_57599              247   3e-71    
ref|XP_001696908.1|  hypothetical protein CHLREDRAFT_105319             244   1e-70    Chlamydomonas reinhardtii
ref|XP_002994097.1|  hypothetical protein SELMODRAFT_432033             238   9e-69    
gb|EEE57089.1|  hypothetical protein OsJ_06921                          208   3e-57    Oryza sativa Japonica Group [Japonica rice]
gb|EMS63964.1|  hypothetical protein TRIUR3_32291                       199   5e-54    
gb|EMT12935.1|  hypothetical protein F775_29752                         187   2e-51    
ref|XP_008665574.1|  PREDICTED: uncharacterized protein LOC103644160    177   6e-48    
gb|AFW64415.1|  hypothetical protein ZEAMMB73_848936                    177   4e-47    
ref|XP_001702244.1|  hypothetical protein CHLREDRAFT_154239             175   4e-44    Chlamydomonas reinhardtii
ref|XP_006386824.1|  hypothetical protein POPTR_0002s22570g             152   7e-40    
ref|NP_001168192.1|  uncharacterized protein LOC100381948               150   1e-38    Zea mays [maize]
ref|XP_008660086.1|  PREDICTED: uncharacterized protein LOC103639071    143   6e-36    
ref|XP_005713339.1|  unnamed protein product                            149   2e-35    
emb|CBJ28314.1|  conserved unknown protein                              150   2e-34    
gb|KFM26614.1|  NIPA-like protein 3                                     141   8e-33    
gb|EJK75739.1|  hypothetical protein THAOC_02531                        141   7e-32    
ref|XP_008341202.1|  PREDICTED: uncharacterized protein LOC103404123    129   5e-31    
gb|ACG24207.1|  hypothetical protein                                    124   5e-30    Zea mays [maize]
gb|KDO26176.1|  hypothetical protein SPRG_08537                         129   3e-29    
ref|XP_008610337.1|  hypothetical protein SDRG_06338                    129   5e-29    
dbj|BAB01731.1|  unnamed protein product                                123   7e-29    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008605809.1|  hypothetical protein SDRG_02028                    127   3e-28    
ref|XP_002903171.1|  conserved hypothetical protein                     127   3e-28    
gb|ETL91611.1|  hypothetical protein L917_09847                         126   1e-27    
gb|ETI45111.1|  hypothetical protein F443_10241                         126   1e-27    
ref|XP_008893321.1|  hypothetical protein PPTG_01689                    124   7e-27    
ref|XP_002863735.1|  hypothetical protein ARALYDRAFT_917443             117   8e-27    
ref|XP_009829195.1|  hypothetical protein H257_05884                    124   1e-26    
ref|XP_009822771.1|  hypothetical protein H257_01318                    125   2e-26    
gb|KDO16746.1|  hypothetical protein SPRG_17766                         121   2e-26    
ref|XP_008875746.1|  hypothetical protein H310_10995                    122   3e-26    
ref|XP_005703095.1|  hypothetical protein Gasu_58080                    121   5e-26    
gb|KDO27804.1|  hypothetical protein SPRG_07403                         123   8e-26    
ref|XP_009531108.1|  hypothetical protein PHYSODRAFT_511769             121   9e-26    
ref|XP_009532339.1|  hypothetical protein PHYSODRAFT_516367             122   1e-25    
ref|XP_008605808.1|  hypothetical protein SDRG_02027                    119   3e-25    
ref|XP_008870043.1|  hypothetical protein H310_06676                    120   8e-25    
ref|XP_008612411.1|  hypothetical protein SDRG_08308                    119   2e-24    
ref|XP_008875745.1|  hypothetical protein, variant                      115   3e-24    
emb|CCA16969.1|  conserved hypothetical protein                         118   4e-24    
ref|XP_009829196.1|  hypothetical protein H257_05885                    114   4e-24    
ref|XP_008875744.1|  hypothetical protein H310_10994                    115   6e-24    
emb|CCI47841.1|  unnamed protein product                                117   6e-24    
ref|XP_008875742.1|  hypothetical protein H310_10993                    114   8e-24    
ref|XP_002900355.1|  conserved hypothetical protein                     116   1e-23    
gb|ETI33557.1|  hypothetical protein F443_19763                         113   1e-22    
gb|ETK73921.1|  hypothetical protein L915_19195                         113   1e-22    
gb|ETP31597.1|  hypothetical protein F442_19543                         113   1e-22    
ref|XP_008913758.1|  hypothetical protein PPTG_17308                    113   1e-22    
ref|XP_008913759.1|  hypothetical protein, variant                      112   1e-22    
gb|ETI33558.1|  hypothetical protein, variant                           112   2e-22    
gb|ETK73922.1|  hypothetical protein, variant                           112   2e-22    
gb|KHN70024.1|  hypothetical protein M896_030090                        108   9e-22    
emb|CCI47840.1|  unnamed protein product                                109   2e-21    
gb|KDO33115.1|  hypothetical protein SPRG_01927                         109   2e-21    
ref|XP_009264123.1|  hypothetical protein EROM_030070                   105   1e-20    
ref|XP_008872364.1|  hypothetical protein H310_08423                    103   2e-20    
ref|XP_008870535.1|  hypothetical protein H310_07038                    103   7e-20    
ref|XP_002783331.1|  conserved hypothetical protein                     103   1e-19    Perkinsus marinus ATCC 50983
ref|WP_028830909.1|  hypothetical protein                               104   1e-19    
gb|KDO21227.1|  hypothetical protein SPRG_13727                         102   3e-19    
ref|XP_002782851.1|  conserved hypothetical protein                     102   4e-19    Perkinsus marinus ATCC 50983
ref|XP_008604095.1|  hypothetical protein SDRG_00400                    101   4e-19    
gb|ETO63681.1|  hypothetical protein, variant 1                         100   6e-19    
gb|ETL28639.1|  hypothetical protein, variant 1                         100   6e-19    
ref|XP_008913389.1|  hypothetical protein, variant 1                  99.8    7e-19    
ref|XP_009518923.1|  hypothetical protein PHYSODRAFT_487294             100   7e-19    
gb|ETK75214.1|  hypothetical protein, variant 1                       99.8    7e-19    
ref|XP_009842058.1|  hypothetical protein H257_15596                    100   7e-19    
ref|XP_008614573.1|  hypothetical protein SDRG_10365                  98.6    2e-18    
ref|XP_002999246.1|  conserved hypothetical protein                   99.8    2e-18    
gb|ETP47186.1|  hypothetical protein F442_06736                       99.4    2e-18    
ref|XP_008892304.1|  hypothetical protein PPTG_02790                  99.0    3e-18    
ref|XP_002767514.1|  conserved hypothetical protein                   97.1    3e-18    Perkinsus marinus ATCC 50983
gb|KFG26894.1|  hypothetical protein NESG_01050                       97.8    4e-18    
ref|XP_009837075.1|  hypothetical protein H257_11752                  97.1    5e-18    
emb|CAD26163.2|  hypothetical protein                                 97.1    8e-18    Encephalitozoon cuniculi
ref|NP_597528.1|  hypothetical protein ECU03_0170                     96.7    1e-17    Encephalitozoon cuniculi GB-M1
ref|XP_002898925.1|  conserved hypothetical protein                   95.9    1e-17    
gb|AGE96559.1|  hypothetical protein ECU03_0170                       96.3    1e-17    
gb|AHW68400.1|  putative nucleotide-sugar transporter                 96.3    1e-17    
ref|XP_008871405.1|  hypothetical protein H310_07436                  95.5    2e-17    
ref|XP_008290388.1|  PREDICTED: NIPA-like protein 2                   94.4    2e-17    
ref|XP_009518122.1|  hypothetical protein PHYSODRAFT_486419           95.1    3e-17    
emb|CCI39701.1|  unnamed protein product                              95.5    4e-17    
ref|XP_010744902.1|  PREDICTED: NIPA-like protein 2 isoform X2        93.2    4e-17    
ref|XP_005930224.1|  PREDICTED: NIPA-like protein 2-like              93.2    5e-17    
ref|XP_010744901.1|  PREDICTED: NIPA-like protein 2 isoform X1        93.2    5e-17    
ref|XP_008605810.1|  hypothetical protein, variant                    92.0    5e-17    
emb|CCA15657.1|  conserved hypothetical protein                       95.1    6e-17    
gb|EIJ89780.1|  hypothetical protein NEQG_00550                       94.4    6e-17    
ref|XP_006796034.1|  PREDICTED: NIPA-like protein 2-like              92.4    9e-17    
ref|XP_004560082.1|  PREDICTED: NIPA-like protein 2-like isoform X1   92.4    1e-16    
ref|XP_005742974.1|  PREDICTED: NIPA-like protein 2-like              92.0    1e-16    
ref|XP_003965886.1|  PREDICTED: NIPA-like protein 2-like              92.0    1e-16    
gb|EJW03703.1|  hypothetical protein EDEG_00191                       92.8    2e-16    
ref|XP_008074381.1|  hypothetical protein VCUG_01363                  92.0    3e-16    
ref|XP_008864473.1|  hypothetical protein, variant 1                  90.9    5e-16    
ref|XP_005803537.1|  PREDICTED: NIPA-like protein 2-like              90.1    5e-16    
gb|KDO23222.1|  hypothetical protein SPRG_11154                       90.5    6e-16    
emb|CCI50505.1|  unnamed protein product                              90.9    7e-16    
emb|CCG84103.1|  protein of unknown function                          90.1    7e-16    
gb|ETL28638.1|  hypothetical protein L916_18041                       90.5    8e-16    
ref|XP_007550545.1|  PREDICTED: NIPA-like protein 2 isoform X2        89.4    8e-16    
ref|XP_008913388.1|  hypothetical protein PPTG_17410                  90.5    9e-16    
gb|ETO63680.1|  hypothetical protein F444_18651                       90.5    9e-16    
gb|ETL81892.1|  hypothetical protein L917_17858                       90.1    9e-16    
ref|XP_008431105.1|  PREDICTED: NIPA-like protein 2 isoform X2        89.0    1e-15    
gb|ETK75213.1|  hypothetical protein L915_18138                       90.1    1e-15    
gb|KDO28741.1|  hypothetical protein SPRG_19958                       89.4    1e-15    
ref|XP_002286051.1|  predicted protein                                91.3    2e-15    Thalassiosira pseudonana CCMP1335
ref|XP_008321951.1|  PREDICTED: NIPA-like protein 2                   88.2    2e-15    
ref|XP_005464985.1|  PREDICTED: NIPA-like protein 2-like              88.2    2e-15    
ref|XP_007550544.1|  PREDICTED: NIPA-like protein 2 isoform X1        87.8    3e-15    
gb|EQB61629.1|  nucleotide-sugar transporter                          88.2    4e-15    
ref|XP_008431104.1|  PREDICTED: NIPA-like protein 2 isoform X1        87.4    5e-15    
ref|XP_005836246.1|  hypothetical protein GUITHDRAFT_135966           89.4    7e-15    
ref|XP_003886885.1|  hypothetical protein EHEL_030050                 87.8    8e-15    
dbj|BAD94846.1|  hypothetical protein                                 82.0    1e-14    Arabidopsis thaliana [mouse-ear cress]
gb|EKC35858.1|  NIPA-like protein 2                                   85.9    1e-14    
emb|CCI50504.1|  unnamed protein product                              86.7    2e-14    
gb|ETP04801.1|  hypothetical protein, variant 3                       84.7    2e-14    
ref|XP_008913391.1|  hypothetical protein, variant 3                  84.7    2e-14    
gb|AFW62416.1|  hypothetical protein ZEAMMB73_017317                  82.0    2e-14    
gb|ELQ76324.1|  Drug/Metabolite Transporter (DMT) Superfamily         86.3    3e-14    
gb|ETK75216.1|  hypothetical protein, variant 3                       84.3    3e-14    
gb|ETO63686.1|  hypothetical protein, variant 6                       84.0    3e-14    
ref|XP_009829197.1|  hypothetical protein, variant                    83.6    3e-14    
ref|XP_008864472.1|  hypothetical protein H310_02670                  84.3    6e-14    
ref|XP_003072512.1|  hypothetical protein Eint_030060                 84.7    7e-14    
ref|XP_005842413.1|  hypothetical protein GUITHDRAFT_160462           84.3    2e-13    
ref|XP_004077670.1|  PREDICTED: NIPA-like protein 2-like              82.4    2e-13    
emb|CCF51775.1|  uncharacterized protein UHOR_03790                   83.6    3e-13    
ref|XP_009839898.1|  hypothetical protein H257_13908                  82.8    3e-13    
ref|XP_005851241.1|  hypothetical protein CHLNCDRAFT_137963           79.0    3e-13    
ref|XP_008620005.1|  hypothetical protein SDRG_15605                  82.0    3e-13    
ref|XP_009835023.1|  hypothetical protein H257_10240                  82.0    4e-13    
ref|XP_009839899.1|  hypothetical protein, variant                    82.0    4e-13    
gb|KDO28115.1|  hypothetical protein SPRG_20272                       81.6    4e-13    
ref|XP_008864475.1|  hypothetical protein, variant 3                  80.9    4e-13    
emb|CCA27702.1|  conserved hypothetical protein                       83.2    5e-13    
gb|EPR80014.1|  hypothetical protein SLOPH_2238                       82.0    5e-13    
gb|ESA20040.1|  hypothetical protein GLOINDRAFT_18955                 81.6    5e-13    
emb|CDI56421.1|  duf803-domain-containing protein                     82.4    7e-13    
ref|XP_005107839.1|  PREDICTED: NIPA-like protein 2-like              81.3    7e-13    
gb|KGB78790.1|  hypothetical protein CNBG_4628                        81.3    8e-13    
gb|KDO16152.1|  hypothetical protein SPRG_18313                       78.2    1e-12    
ref|XP_008875743.1|  hypothetical protein, variant                    78.6    1e-12    
ref|XP_007424860.1|  PREDICTED: NIPA-like protein 2 isoform X1        79.3    2e-12    
gb|KDO22600.1|  hypothetical protein SPRG_12580                       78.2    2e-12    
ref|XP_008610945.1|  hypothetical protein SDRG_06912                  77.8    3e-12    
ref|XP_008616806.1|  hypothetical protein SDRG_12512                  78.6    5e-12    
gb|EPB85435.1|  hypothetical protein HMPREF1544_07806                 78.6    6e-12    
ref|XP_009078069.1|  PREDICTED: NIPA-like protein 2                   77.0    8e-12    
dbj|GAA93742.1|  hypothetical protein E5Q_00388                       78.6    8e-12    
gb|ELT93209.1|  hypothetical protein CAPTEDRAFT_228824                78.2    8e-12    
gb|KFM23155.1|  Magnesium transporter NIPA3                           78.2    8e-12    
ref|XP_773505.1|  hypothetical protein CNBI1190                       79.0    9e-12    Cryptococcus neoformans var. neoformans B-3501A
gb|KFP85541.1|  NIPA-like 2                                           77.0    9e-12    
ref|XP_002373268.1|  DUF803 domain membrane protein                   77.4    9e-12    Aspergillus flavus NRRL3357
ref|XP_001818083.2|  hypothetical protein AOR_1_1936174               77.4    1e-11    Aspergillus oryzae RIB40
ref|XP_002146046.1|  DUF803 domain membrane protein                   77.4    1e-11    Talaromyces marneffei ATCC 18224
ref|XP_758463.1|  hypothetical protein UM02316.1                      78.2    1e-11    Ustilago maydis 521
ref|XP_001264161.1|  hypothetical protein NFIA_009440                 77.0    1e-11    Aspergillus fischeri NRRL 181
ref|XP_002123647.3|  PREDICTED: NIPA-like protein 2                   76.3    2e-11    Ciona intestinalis [sea vase]
ref|XP_008864476.1|  hypothetical protein, variant 4                  75.1    2e-11    
dbj|GAC98740.1|  hypothetical protein PHSY_006334                     77.4    2e-11    
ref|XP_007604618.1|  hypothetical protein VICG_01172                  76.6    2e-11    
gb|ETP04800.1|  hypothetical protein, variant 2                       75.5    2e-11    
ref|XP_008913390.1|  hypothetical protein, variant 2                  75.5    2e-11    
gb|ETL81894.1|  hypothetical protein, variant 2                       75.5    2e-11    
ref|XP_006678335.1|  hypothetical protein BATDEDRAFT_11038            74.7    3e-11    
gb|ETO63684.1|  hypothetical protein, variant 4                       74.7    3e-11    
ref|XP_002158262.2|  PREDICTED: NIPA-like protein 2-like              75.5    3e-11    
gb|ETK75215.1|  hypothetical protein, variant 2                       75.1    3e-11    
gb|KCZ82009.1|  hypothetical protein H312_00491                       76.3    4e-11    
gb|KFX43951.1|  Magnesium transporter NIPA2                           75.1    4e-11    
ref|XP_008864474.1|  hypothetical protein, variant 2                  75.1    4e-11    
ref|XP_007424861.1|  PREDICTED: NIPA-like protein 2 isoform X2        75.1    4e-11    
dbj|GAK64072.1|  DUF803 domain membrane protein                       76.6    5e-11    
emb|CCU99941.1|  unnamed protein product                              75.9    5e-11    
gb|EYE98915.1|  DUF803-domain-containing protein                      75.5    5e-11    
gb|ETS60825.1|  hypothetical protein PaG_04738                        76.3    5e-11    
ref|XP_007411308.1|  hypothetical protein MELLADRAFT_88080            75.9    5e-11    
dbj|GAC72430.1|  uncharacterized conserved protein                    76.3    6e-11    
ref|XP_752954.1|  DUF803 domain membrane protein                      75.1    6e-11    
gb|KDN47981.1|  DUF803-domain-containing protein                      76.3    7e-11    
ref|XP_002124786.2|  PREDICTED: NIPA-like protein 2                   72.4    1e-10    
ref|XP_005841638.1|  hypothetical protein GUITHDRAFT_160735           74.7    1e-10    
ref|XP_008861690.1|  hypothetical protein H310_00622                  72.4    2e-10    
ref|XP_008166596.1|  PREDICTED: NIPA-like protein 2                   73.6    2e-10    
ref|XP_002478336.1|  DUF803 domain membrane protein                   73.2    3e-10    
ref|XP_001827918.1|  nucleotide-sugar transporter                     73.6    3e-10    
ref|XP_009890220.1|  PREDICTED: NIPA-like protein 2                   72.8    3e-10    
ref|XP_006676660.1|  hypothetical protein BATDEDRAFT_22897            73.9    3e-10    
emb|CDM38385.1|  Magnesium transporter NIPA3                          72.8    4e-10    
gb|KFX85703.1|  hypothetical protein V490_09469                       72.8    4e-10    
ref|XP_007302804.1|  DUF803-domain-containing protein                 73.6    4e-10    
gb|KFY03906.1|  hypothetical protein O988_01132                       72.8    4e-10    
gb|KGL98717.1|  NIPA-like 2                                           71.6    5e-10    
dbj|BAE56081.1|  unnamed protein product                              71.6    5e-10    
ref|XP_001623753.1|  predicted protein                                72.0    6e-10    
ref|XP_001389822.2|  hypothetical protein ANI_1_1932014               71.6    7e-10    
dbj|GAA86826.1|  DUF803 domain membrane protein                       71.6    8e-10    
ref|XP_007767949.1|  DUF803-domain-containing protein                 72.4    8e-10    
ref|XP_007746917.1|  hypothetical protein A1O5_08143                  71.6    9e-10    
gb|EOB14769.1|  Non-imprinted in Prader-Willi/Angelman syndrome r...  69.3    9e-10    
ref|XP_008892240.1|  hypothetical protein PPTG_02752                  70.5    1e-09    
gb|EQL34697.1|  hypothetical protein BDFG_03412                       70.9    1e-09    
ref|XP_009827485.1|  hypothetical protein H257_04594                  70.1    1e-09    
ref|XP_007839734.1|  hypothetical protein PFICI_12962                 70.9    1e-09    
gb|EEH09687.1|  DUF803 domain-containing protein                      70.9    1e-09    
ref|XP_002838770.1|  hypothetical protein                             71.6    1e-09    
ref|XP_001268669.1|  DUF803 domain membrane protein                   70.9    1e-09    
gb|EGC44163.1|  DUF803 domain-containing protein                      70.9    1e-09    
ref|XP_008222822.1|  PREDICTED: magnesium transporter NIPA2 isofo...  70.1    1e-09    
gb|KGO38750.1|  Magnesium transporter NIPA                            70.5    2e-09    
gb|EKV09178.1|  hypothetical protein PDIP_65620                       70.5    2e-09    
ref|XP_007222648.1|  hypothetical protein PRUPE_ppa008557mg           69.7    2e-09    
gb|EXX69512.1|  hypothetical protein RirG_095430                      69.7    2e-09    
ref|XP_008728353.1|  hypothetical protein G647_05805                  70.5    2e-09    
ref|XP_005819751.1|  hypothetical protein GUITHDRAFT_148371           70.5    3e-09    
ref|XP_006028060.1|  PREDICTED: NIPA-like protein 2                   69.7    3e-09    
ref|XP_010762044.1|  hypothetical protein PADG_06653                  69.7    3e-09    
dbj|GAD95720.1|  hypothetical protein AOR_1_1936174                   70.1    3e-09    
gb|KFY87728.1|  hypothetical protein V500_06801                       70.1    3e-09    
ref|XP_009806803.1|  PREDICTED: NIPA-like protein 2                   69.7    3e-09    
ref|XP_003193321.1|  hypothetical protein CGB_D1390W                  70.1    3e-09    
ref|XP_007754796.1|  hypothetical protein A1O7_02575                  70.1    3e-09    
gb|EEH34261.2|  DUF803 domain membrane protein                        69.7    3e-09    
gb|EPS25583.1|  hypothetical protein PDE_00517                        69.3    3e-09    
ref|XP_010878706.1|  PREDICTED: NIPA-like protein 2                   69.7    4e-09    
emb|CDS08090.1|  hypothetical protein LRAMOSA02039                    69.3    4e-09    
ref|XP_001637190.1|  predicted protein                                68.2    4e-09    
gb|KDB27958.1|  hypothetical protein H109_00254                       69.3    5e-09    
ref|XP_007893273.1|  PREDICTED: NIPA-like protein 2                   68.9    5e-09    
ref|XP_007802214.1|  hypothetical protein EPUS_02936                  69.3    5e-09    
gb|KFV51004.1|  NIPA-like 2                                           68.6    5e-09    
gb|EZF32573.1|  hypothetical protein H101_03842                       68.9    5e-09    
gb|EGD95748.1|  hypothetical protein TESG_03216                       68.9    6e-09    
gb|KGO74086.1|  Magnesium transporter NIPA                            68.9    6e-09    
ref|XP_001792556.1|  hypothetical protein SNOG_01934                  68.9    6e-09    
ref|XP_006631429.1|  PREDICTED: NIPA-like protein 3-like              68.9    6e-09    
gb|KFY10719.1|  hypothetical protein V491_07505                       68.9    6e-09    
gb|EKG12236.1|  hypothetical protein MPH_10643                        68.9    6e-09    
gb|KFH72032.1|  hypothetical protein MVEG_02325                       69.7    7e-09    
ref|XP_004889122.1|  PREDICTED: NIPA-like protein 2                   68.6    7e-09    
gb|KFY61375.1|  hypothetical protein V496_05044                       68.6    7e-09    
ref|XP_003231298.1|  hypothetical protein TERG_08085                  68.6    7e-09    
ref|XP_003171146.1|  ichthyin                                         68.6    7e-09    
gb|ELR09258.1|  hypothetical protein GMDG_03828                       68.6    8e-09    
ref|XP_001243628.1|  hypothetical protein CIMG_03069                  68.6    8e-09    
gb|AFW62410.1|  hypothetical protein ZEAMMB73_017317                  64.3    8e-09    
gb|KFY18557.1|  hypothetical protein V493_08517                       68.6    8e-09    
gb|EHK48537.1|  hypothetical protein TRIATDRAFT_158342                69.3    9e-09    
gb|KDO16151.1|  hypothetical protein SPRG_18312                       65.5    9e-09    
ref|XP_003069033.1|  hypothetical protein CPC735_010670               68.6    9e-09    
ref|XP_011111446.1|  hypothetical protein H072_5587                   68.2    9e-09    
emb|CDS03979.1|  hypothetical protein LRAMOSA06934                    68.6    1e-08    
ref|XP_001622241.1|  hypothetical protein NEMVEDRAFT_v1g1805          66.6    1e-08    
gb|KDR68406.1|  hypothetical protein GALMADRAFT_257099                68.6    1e-08    
gb|KFZ11580.1|  hypothetical protein V501_04683                       68.2    1e-08    
emb|CDS06642.1|  hypothetical protein LRAMOSA09169                    67.8    1e-08    
gb|KFY70196.1|  hypothetical protein V499_09375                       68.2    1e-08    
ref|XP_007732585.1|  hypothetical protein A1O3_04265                  67.8    1e-08    
ref|XP_009156871.1|  hypothetical protein HMPREF1120_04492            67.8    1e-08    
ref|XP_009531237.1|  hypothetical protein PHYSODRAFT_316811           67.8    1e-08    
ref|XP_007329417.1|  hypothetical protein AGABI1DRAFT_120229          68.2    2e-08    
ref|XP_003655139.1|  hypothetical protein THITE_2118469               67.4    2e-08    
gb|EWC47809.1|  hypothetical protein DRE_03009                        68.2    2e-08    
ref|XP_003219553.1|  PREDICTED: NIPA-like protein 2 isoform X1        67.4    2e-08    
gb|KFY36781.1|  hypothetical protein V494_04977                       67.4    2e-08    
ref|XP_001229666.1|  hypothetical protein CHGG_03150                  67.4    2e-08    
gb|KFY06690.1|  hypothetical protein V492_07834                       67.0    2e-08    
gb|EPE06011.1|  hypothetical protein F503_02840                       67.8    2e-08    
gb|KDE04167.1|  hypothetical protein MVLG_05391                       67.4    2e-08    
emb|CDH59198.1|  duf803 domain-containing protein                     67.0    3e-08    
ref|XP_002849959.1|  DUF803 domain membrane protein                   67.0    3e-08    
ref|XP_008106600.1|  PREDICTED: NIPA-like protein 2 isoform X3        66.2    3e-08    
ref|XP_007726154.1|  hypothetical protein A1O1_07091                  66.6    3e-08    
gb|AFR94320.1|  hypothetical protein CNAG_05056                       67.4    3e-08    
ref|XP_006460188.1|  hypothetical protein AGABI2DRAFT_184681          67.0    3e-08    
gb|EIE90938.1|  hypothetical protein RO3G_15649                       66.2    3e-08    
ref|XP_003663181.1|  hypothetical protein MYCTH_2304750               66.6    4e-08    
emb|CEJ87696.1|  hypothetical protein VHEMI04486                      67.0    4e-08    
gb|KFY11034.1|  hypothetical protein V492_04714                       67.0    4e-08    
gb|KEQ97606.1|  hypothetical protein AUEXF2481DRAFT_46450             66.2    4e-08    
gb|KHJ36437.1|  putative duf803 domain membrane protein               66.2    4e-08    
gb|KFX87370.1|  hypothetical protein V490_08304                       67.0    4e-08    
ref|XP_002622126.1|  DUF803 domain membrane protein                   65.9    4e-08    
ref|XP_011122496.1|  hypothetical protein AOL_s00079g319              67.0    5e-08    
gb|KFY04185.1|  hypothetical protein O988_00949                       66.6    5e-08    
ref|XP_460648.1|  DEHA2F06644p                                        65.9    5e-08    
ref|XP_659822.1|  hypothetical protein AN2218.2                       66.6    5e-08    
gb|EWC47113.1|  hypothetical protein DRE_03482                        65.9    6e-08    
gb|EIT80760.1|  hypothetical protein Ao3042_02893                     65.5    6e-08    
ref|XP_007917085.1|  putative duf803 domain membrane protein          65.5    7e-08    
ref|XP_008719728.1|  hypothetical protein HMPREF1541_07181            65.5    7e-08    
gb|EPB87009.1|  hypothetical protein HMPREF1544_06227                 65.5    7e-08    
ref|XP_007666137.1|  PREDICTED: NIPA-like protein 3 isoform X2        65.5    7e-08    
ref|XP_008380486.1|  PREDICTED: magnesium transporter NIPA2           64.7    7e-08    
emb|CDH49407.1|  hypothetical protein RO3G_04718                      65.9    8e-08    
ref|XP_008027734.1|  hypothetical protein SETTUDRAFT_154879           65.5    8e-08    
gb|ETR97274.1|  DUF803-domain-containing protein                      66.2    8e-08    
ref|XP_006273300.1|  PREDICTED: NIPA-like protein 2                   65.1    8e-08    
ref|XP_008080481.1|  Multidrug resistance efflux transporter EmrE     65.5    9e-08    
emb|CEJ03196.1|  hypothetical protein RMCBS344292_17184               65.1    9e-08    
emb|CEJ00609.1|  Putative Duf803 domain membrane protein              65.5    9e-08    
ref|XP_002995848.1|  hypothetical protein NCER_101156                 62.4    1e-07    
gb|KFA63468.1|  hypothetical protein S40285_00365                     64.7    1e-07    
emb|CAK37427.1|  unnamed protein product                              65.1    1e-07    
ref|XP_009518951.1|  hypothetical protein PHYSODRAFT_482232           64.3    1e-07    
gb|KEY69433.1|  hypothetical protein S7711_05747                      64.7    1e-07    
ref|WP_028831544.1|  hypothetical protein                             65.5    1e-07    
ref|XP_003479929.1|  PREDICTED: NIPA-like domain containing 2         64.7    1e-07    
ref|XP_002378491.1|  conserved hypothetical protein                   64.3    1e-07    
ref|XP_001823156.2|  hypothetical protein AOR_1_534114                63.9    2e-07    
ref|XP_009347006.1|  PREDICTED: magnesium transporter NIPA2-like      63.9    2e-07    
gb|KFY64694.1|  hypothetical protein V496_03089                       65.1    2e-07    
ref|XP_001877199.1|  predicted protein                                64.7    2e-07    
ref|XP_008542797.1|  PREDICTED: NIPA-like protein 3                   64.3    2e-07    
ref|XP_010617872.1|  PREDICTED: NIPA-like protein 2                   63.9    2e-07    
emb|CBQ71043.1|  conserved hypothetical protein                       64.7    2e-07    
ref|XP_007868003.1|  DUF803-domain-containing protein                 63.9    2e-07    
gb|KFY29715.1|  hypothetical protein V494_08523                       64.7    2e-07    
emb|CEG73648.1|  Putative DUF803-domain-containing protein            64.3    2e-07    
ref|XP_007424146.1|  PREDICTED: NIPA-like protein 3 isoform X4        63.9    2e-07    
gb|KFY22234.1|  hypothetical protein V493_06738                       64.3    3e-07    
ref|XP_006693093.1|  hypothetical protein CTHT_0026350                63.9    3e-07    
ref|XP_006965251.1|  predicted protein                                62.0    3e-07    
emb|CCU82672.1|  DUF803 domain membrane protein                       63.5    3e-07    
gb|ETO08033.1|  DUF803 domain protein                                 62.8    3e-07    
gb|EST05831.1|  hypothetical protein PSEUBRA_SCAF4g04975              62.0    3e-07    
ref|XP_003045281.1|  hypothetical protein NECHADRAFT_104817           64.3    3e-07    
gb|EMD34727.1|  hypothetical protein CERSUDRAFT_116922                63.5    3e-07    
gb|KFZ07151.1|  hypothetical protein V501_06722                       63.9    3e-07    
ref|XP_009657050.1|  ichthyin                                         63.2    3e-07    
ref|XP_008525902.1|  PREDICTED: NIPA-like protein 2                   63.2    4e-07    
ref|XP_010521546.1|  PREDICTED: probable magnesium transporter NIPA4  63.2    4e-07    
gb|EIE86544.1|  hypothetical protein RO3G_11255                       63.2    4e-07    
ref|XP_004012055.1|  PREDICTED: NIPA-like protein 2                   63.5    4e-07    
ref|XP_002783259.1|  hypothetical protein Pmar_PMAR023381             62.8    4e-07    
ref|XP_002999216.1|  conserved hypothetical protein                   62.8    4e-07    
ref|XP_007056072.1|  PREDICTED: NIPA-like protein 2                   63.2    4e-07    
gb|EPQ67393.1|  hypothetical protein BGT96224_3011                    63.2    4e-07    
ref|XP_007686821.1|  hypothetical protein COCMIDRAFT_25369            63.2    4e-07    
ref|XP_005976762.1|  PREDICTED: NIPA-like protein 2                   62.8    4e-07    
gb|KFY46214.1|  hypothetical protein V495_02606                       63.9    4e-07    
ref|XP_658528.1|  hypothetical protein AN0924.2                       63.2    4e-07    
ref|XP_007706493.1|  hypothetical protein COCCADRAFT_313              63.2    4e-07    
gb|KFY74780.1|  hypothetical protein V499_05219                       63.5    5e-07    
ref|XP_006956246.1|  DUF803-domain-containing protein                 63.2    5e-07    
ref|XP_007382116.1|  DUF803-domain-containing protein                 63.2    6e-07    
ref|XP_008106599.1|  PREDICTED: NIPA-like protein 2 isoform X2        62.4    6e-07    
ref|XP_007877339.1|  hypothetical protein PFL1_01638                  63.2    6e-07    
gb|KDR83559.1|  hypothetical protein GALMADRAFT_235781                63.2    6e-07    
gb|KHJ86724.1|  magnesium transporter NIPA2 family protein            62.4    6e-07    
gb|ELR50063.1|  NIPA-like protein 2                                   62.0    6e-07    
ref|XP_010861862.1|  PREDICTED: NIPA-like protein 2                   62.4    6e-07    
ref|XP_008222823.1|  PREDICTED: magnesium transporter NIPA2 isofo...  61.6    7e-07    
ref|XP_568229.1|  hypothetical protein                                62.4    7e-07    
gb|ELR09483.1|  hypothetical protein GMDG_00665                       62.8    8e-07    
ref|XP_001542063.1|  predicted protein                                62.4    8e-07    
gb|KDQ64695.1|  hypothetical protein JAAARDRAFT_52643                 62.8    8e-07    
ref|XP_004431256.1|  PREDICTED: NIPA-like protein 2                   62.0    8e-07    
ref|XP_007697435.1|  hypothetical protein COCSADRAFT_24362            63.2    8e-07    
ref|XP_001525761.1|  hypothetical protein LELG_02319                  62.0    8e-07    
ref|XP_007374222.1|  hypothetical protein SPAPADRAFT_60063            62.0    8e-07    
ref|XP_002561753.1|  Pc16g14560                                       62.0    8e-07    
gb|ETN76570.1|  hypothetical protein NECAME_11604                     62.0    9e-07    
gb|KIH60562.1|  hypothetical protein ANCDUO_09187                     62.0    9e-07    
gb|ELU14921.1|  hypothetical protein CAPTEDRAFT_138820                61.6    9e-07    
ref|XP_505382.1|  YALI0F13651p                                        62.0    9e-07    
ref|XP_001542704.1|  predicted protein                                62.8    9e-07    
gb|KFZ03316.1|  hypothetical protein V502_11045                       62.8    9e-07    
emb|CEG65738.1|  hypothetical protein RMATCC62417_02457               62.0    1e-06    
gb|KFY81747.1|  hypothetical protein V500_11128                       62.4    1e-06    
emb|CEI96621.1|  hypothetical protein RMCBS344292_10778               61.6    1e-06    
gb|EMD94968.1|  hypothetical protein COCHEDRAFT_1210973               62.0    1e-06    
ref|XP_002547739.1|  hypothetical protein CTRG_02046                  61.6    1e-06    
gb|KDQ22519.1|  hypothetical protein PLEOSDRAFT_1050308               61.6    1e-06    
gb|ETO24833.1|  hypothetical protein RFI_12320                        59.7    1e-06    
ref|XP_006048835.1|  PREDICTED: NIPA-like protein 2                   61.2    1e-06    
gb|EER39148.1|  DUF803 domain-containing protein                      62.4    1e-06    
ref|XP_003348900.1|  hypothetical protein SMAC_01922                  61.6    1e-06    
ref|XP_500578.1|  YALI0B06732p                                        61.2    1e-06    
ref|XP_625368.1|  hypothetical protein                                62.0    2e-06    
ref|XP_001501319.1|  PREDICTED: NIPA-like domain containing 3 iso...  61.2    2e-06    
ref|XP_005316430.1|  PREDICTED: NIPA-like protein 2                   60.8    2e-06    
ref|XP_956175.2|  hypothetical protein NCU00490                       61.2    2e-06    
ref|XP_004947958.1|  PREDICTED: NIPA-like domain containing 3 iso...  61.2    2e-06    
ref|XP_008601439.1|  DUF803 domain membrane protein                   61.2    2e-06    
gb|KGQ04578.1|  Magnesium transporter NIPA2                           60.8    2e-06    
ref|XP_002543372.1|  hypothetical protein UREG_02888                  60.8    2e-06    
emb|CDK25784.1|  unnamed protein product                              60.8    2e-06    
gb|ESA43398.1|  DUF803 domain membrane protein                        61.2    2e-06    



>ref|XP_009593045.1| PREDICTED: probable magnesium transporter NIPA8 isoform X2 [Nicotiana 
tomentosiformis]
Length=445

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/439 (79%), Positives = 384/439 (87%), Gaps = 5/439 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGA INL GS+ INFGTNLLKLGHDER KHS LGNEGT+ KA MKPII+FQTWR+
Sbjct  1     MGEWVIGAVINLFGSVAINFGTNLLKLGHDEREKHSVLGNEGTDVKATMKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA+GN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NKTVTIKV+VAT FIVL
Sbjct  61    GIVFFAIGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKTVTIKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY L LVLVVA HHS+Y+RGELLL VP N
Sbjct  121   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYSLTLVLVVALHHSIYKRGELLLAVPMN  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             + KP W+MLLPFSYA+VSG +GS SVLFAKSLSN+LRLS+S+ Y LHSWFTYSMLLLFLS
Sbjct  181   ENKPCWRMLLPFSYAVVSGAVGSCSVLFAKSLSNMLRLSMSSGYSLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMF+LG++
Sbjct  241   TAGFWMARLNEGLSFFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFILGMI  300

Query  1165  CVFIGISLLAPDDSKGTQTKD-sslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMK  1341
              VF+GISLLAPD+SKG + KD S + + S+LS D ERL M  ED Q+KD++SF  V+LMK
Sbjct  301   SVFVGISLLAPDESKGGEVKDGSLVSTTSNLSQDEERLFMQSEDSQIKDIRSFGRVMLMK  360

Query  1342  AVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWR  1521
               N+IVKAKAACS+SLG G DSL ASSVLVMPMVSSKITGFRG G+D+AKL   R  GW 
Sbjct  361   TANMIVKAKAACSVSLGFGGDSLHASSVLVMPMVSSKITGFRGGGLDRAKLLSARGPGWS  420

Query  1522  RISVDED----CETSAMLP  1566
             + +VDED     ET+AMLP
Sbjct  421   KFAVDEDGETILETTAMLP  439



>ref|XP_006338750.1| PREDICTED: uncharacterized protein LOC102593285 [Solanum tuberosum]
Length=457

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/439 (78%), Positives = 386/439 (88%), Gaps = 5/439 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGA INL GSI INFGTNLLKLGHDER KHS LGNE TN K+ MKPII+FQTWR+
Sbjct  1     MGEWVIGAVINLFGSIAINFGTNLLKLGHDEREKHSVLGNEVTNVKSTMKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA+GN LNF+SFG+AAQSLLAALGSIQFVSNIAFAYFV NKTVTI V+VAT FIVL
Sbjct  61    GILFFAIGNCLNFVSFGYAAQSLLAALGSIQFVSNIAFAYFVLNKTVTINVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCL LVLVVA HHS+Y+RGEL+L VP N
Sbjct  121   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLTLVLVVALHHSIYKRGELMLAVPMN  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             + KP+W MLLPFSYA+VSG +GS SVLFAKSLSN+LRLS+S+ Y LHSWFTYSMLLLFLS
Sbjct  181   ESKPYWHMLLPFSYAVVSGAVGSCSVLFAKSLSNMLRLSMSSGYSLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQI WTFFSICTGFVYFQEYQVFDALRTTMF+LG++
Sbjct  241   TAGFWMARLNEGLSFFDAILIVPMFQITWTFFSICTGFVYFQEYQVFDALRTTMFILGMI  300

Query  1165  CVFIGISLLAPDDSKGTQTKD-sslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMK  1341
              VF+GISLLAPD+SKG + KD S + + S+LS D ERL+MP ED Q+KD++SF  V+LMK
Sbjct  301   SVFVGISLLAPDESKGGEVKDGSLVSTTSNLSQDEERLLMPSEDSQIKDIRSFGRVMLMK  360

Query  1342  AVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWR  1521
             A N+IVKAKAACS+SLG G+DSL ASSVLVMPMVSSKITGFRG G+D+AK+   R  GW 
Sbjct  361   AANMIVKAKAACSVSLGFGEDSLHASSVLVMPMVSSKITGFRGGGLDRAKILSVRGPGWN  420

Query  1522  RISVDEDC----ETSAMLP  1566
             + +VD+D     ET+AMLP
Sbjct  421   KFAVDKDSETILETTAMLP  439



>ref|XP_009781329.1| PREDICTED: probable magnesium transporter NIPA8 isoform X2 [Nicotiana 
sylvestris]
Length=445

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/439 (79%), Positives = 383/439 (87%), Gaps = 5/439 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGA INL GS+ INFGTNLLKLGHDER KHS LGNEGT+ KA MKPII+FQTWR+
Sbjct  1     MGEWVIGAVINLFGSVAINFGTNLLKLGHDEREKHSVLGNEGTDVKATMKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA+GN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NKTVTIKV+VAT FIVL
Sbjct  61    GIVFFAIGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKTVTIKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY L LVLVVA HHS+Y+RGELLL VP N
Sbjct  121   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYSLTLVLVVALHHSIYKRGELLLAVPMN  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             + KP W+MLLPFSYA+VSG +GS SVLFAKSLSN+LRLS+S+ Y LHSWFTYSMLLLFLS
Sbjct  181   ENKPCWRMLLPFSYAVVSGAVGSCSVLFAKSLSNMLRLSMSSGYSLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMF+LG++
Sbjct  241   TAGFWMARLNEGLSFFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFILGMI  300

Query  1165  CVFIGISLLAPDDSKGTQTKD-sslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMK  1341
              VF+GISLLAPD+SKG + KD S +   S+ S D ERL M  ED Q+KD++SF  V+LMK
Sbjct  301   SVFVGISLLAPDESKGGELKDGSLVSKTSNSSQDEERLFMQSEDSQIKDIRSFGRVMLMK  360

Query  1342  AVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWR  1521
               N+IVKAKAACS+SLG G+DSL ASSVLVMPMVSSKITGFRG G+D+AKL   R  GW 
Sbjct  361   TANMIVKAKAACSVSLGFGEDSLHASSVLVMPMVSSKITGFRGGGLDRAKLLSARGPGWS  420

Query  1522  RISVDED----CETSAMLP  1566
             + +VDED     ET+AMLP
Sbjct  421   KFAVDEDGETILETTAMLP  439



>ref|XP_009593044.1| PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Nicotiana 
tomentosiformis]
Length=462

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/439 (79%), Positives = 384/439 (87%), Gaps = 5/439 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGA INL GS+ INFGTNLLKLGHDER KHS LGNEGT+ KA MKPII+FQTWR+
Sbjct  1     MGEWVIGAVINLFGSVAINFGTNLLKLGHDEREKHSVLGNEGTDVKATMKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA+GN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NKTVTIKV+VAT FIVL
Sbjct  61    GIVFFAIGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKTVTIKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY L LVLVVA HHS+Y+RGELLL VP N
Sbjct  121   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYSLTLVLVVALHHSIYKRGELLLAVPMN  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             + KP W+MLLPFSYA+VSG +GS SVLFAKSLSN+LRLS+S+ Y LHSWFTYSMLLLFLS
Sbjct  181   ENKPCWRMLLPFSYAVVSGAVGSCSVLFAKSLSNMLRLSMSSGYSLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMF+LG++
Sbjct  241   TAGFWMARLNEGLSFFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFILGMI  300

Query  1165  CVFIGISLLAPDDSKGTQTKD-sslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMK  1341
              VF+GISLLAPD+SKG + KD S + + S+LS D ERL M  ED Q+KD++SF  V+LMK
Sbjct  301   SVFVGISLLAPDESKGGEVKDGSLVSTTSNLSQDEERLFMQSEDSQIKDIRSFGRVMLMK  360

Query  1342  AVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWR  1521
               N+IVKAKAACS+SLG G DSL ASSVLVMPMVSSKITGFRG G+D+AKL   R  GW 
Sbjct  361   TANMIVKAKAACSVSLGFGGDSLHASSVLVMPMVSSKITGFRGGGLDRAKLLSARGPGWS  420

Query  1522  RISVDED----CETSAMLP  1566
             + +VDED     ET+AMLP
Sbjct  421   KFAVDEDGETILETTAMLP  439



>ref|XP_009781328.1| PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Nicotiana 
sylvestris]
Length=462

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/439 (79%), Positives = 383/439 (87%), Gaps = 5/439 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGA INL GS+ INFGTNLLKLGHDER KHS LGNEGT+ KA MKPII+FQTWR+
Sbjct  1     MGEWVIGAVINLFGSVAINFGTNLLKLGHDEREKHSVLGNEGTDVKATMKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA+GN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NKTVTIKV+VAT FIVL
Sbjct  61    GIVFFAIGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKTVTIKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY L LVLVVA HHS+Y+RGELLL VP N
Sbjct  121   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYSLTLVLVVALHHSIYKRGELLLAVPMN  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             + KP W+MLLPFSYA+VSG +GS SVLFAKSLSN+LRLS+S+ Y LHSWFTYSMLLLFLS
Sbjct  181   ENKPCWRMLLPFSYAVVSGAVGSCSVLFAKSLSNMLRLSMSSGYSLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMF+LG++
Sbjct  241   TAGFWMARLNEGLSFFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFILGMI  300

Query  1165  CVFIGISLLAPDDSKGTQTKD-sslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMK  1341
              VF+GISLLAPD+SKG + KD S +   S+ S D ERL M  ED Q+KD++SF  V+LMK
Sbjct  301   SVFVGISLLAPDESKGGELKDGSLVSKTSNSSQDEERLFMQSEDSQIKDIRSFGRVMLMK  360

Query  1342  AVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWR  1521
               N+IVKAKAACS+SLG G+DSL ASSVLVMPMVSSKITGFRG G+D+AKL   R  GW 
Sbjct  361   TANMIVKAKAACSVSLGFGEDSLHASSVLVMPMVSSKITGFRGGGLDRAKLLSARGPGWS  420

Query  1522  RISVDED----CETSAMLP  1566
             + +VDED     ET+AMLP
Sbjct  421   KFAVDEDGETILETTAMLP  439



>emb|CDP16754.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/440 (78%), Positives = 384/440 (87%), Gaps = 10/440 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEW+IGAFINL GSI INFGTNLLKLGHDER + SA G +GTNGK     II+FQ+WR+
Sbjct  1     MGEWIIGAFINLFGSIAINFGTNLLKLGHDERERQSAQGIDGTNGK----HIIYFQSWRV  56

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA GN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NKTVT+KV++AT FIVL
Sbjct  57    GILFFAFGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKTVTVKVLIATAFIVL  116

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPV+TPEQLA+KYSN+TFLLYCLILVLVVA HHS+YRRGELLL VPG 
Sbjct  117   GNIFLVAFGNHQSPVFTPEQLADKYSNVTFLLYCLILVLVVALHHSIYRRGELLLAVPGQ  176

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DLKP+WQMLLPFSYAIVSG +GS SVLFAKSLSNLLRLS+S+ Y LHSWFTYSMLLLFLS
Sbjct  177   DLKPYWQMLLPFSYAIVSGAVGSCSVLFAKSLSNLLRLSLSSGYQLHSWFTYSMLLLFLS  236

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQV DALRTTMFVLGV+
Sbjct  237   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVLDALRTTMFVLGVI  296

Query  1165  CVFIGISLLAPDDSKGTQTKD-sslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMK  1341
              VFIGISLLAPDD KG + KD S +   SSLS DV+RL++P ED Q+KD+ SF+  + +K
Sbjct  297   SVFIGISLLAPDDLKGGEAKDTSLVSVTSSLSTDVDRLVIPYEDSQIKDISSFARAMKVK  356

Query  1342  AVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWR  1521
             A NL+VKAKAACSLSLGLG+DSL ASSVLVMPMVSSK+TGFRG+G  + KLF  R  GW 
Sbjct  357   AANLVVKAKAACSLSLGLGEDSLHASSVLVMPMVSSKMTGFRGSGFGRTKLFSPRGSGWS  416

Query  1522  RISVDED-----CETSAMLP  1566
             +ISVDE+      ET++MLP
Sbjct  417   KISVDEEDRESMLETTSMLP  436



>ref|XP_008231217.1| PREDICTED: uncharacterized protein LOC103330418 [Prunus mume]
Length=444

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/441 (76%), Positives = 377/441 (85%), Gaps = 7/441 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWV+GAFINL GSI INFGTNLLKLGH+ER +HS L +EG +GK  +KPIIHFQTWR+
Sbjct  1     MGEWVVGAFINLFGSIAINFGTNLLKLGHNERERHSILESEGASGKLPLKPIIHFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G +FF LGN LNFISFG+AAQSLLAALGSIQF+SNIAFAYFV NK VT+KVMVAT FIVL
Sbjct  61    GFLFFVLGNCLNFISFGYAAQSLLAALGSIQFISNIAFAYFVLNKMVTVKVMVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTPEQLAEKYSNI FLLYCLILVLVVA  HS+YRRGELL  V G 
Sbjct  121   GNIFLVAFGNHQSPVYTPEQLAEKYSNIAFLLYCLILVLVVALQHSIYRRGELLHAVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYAIVSG +GSFSVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  181   DLRPYWHMLLPFSYAIVSGAVGSFSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQV +ALRTTMF+LG+M
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVLNALRTTMFILGMM  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsassls---NDVERLIMPLEDPQLKDVKSFSHVVL  1335
              VF+GISLLAPDDSKG + KD+S + +   S    D  RL +P ED Q++D +SF   +L
Sbjct  301   SVFVGISLLAPDDSKGAEVKDNSSLVSVMSSTIPKDEGRLAVPSEDVQIRDTRSFVQGIL  360

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             MK  + IVKAK AC+LSLG G+DS+ AS+VLVMPMVSSKITGFRGNG D+AK+F  ++ G
Sbjct  361   MKISDTIVKAKTACALSLGFGEDSINASAVLVMPMVSSKITGFRGNGFDRAKIFSMKNSG  420

Query  1516  WRRISVDEDC----ETSAMLP  1566
             W +IS+DED     ETS +LP
Sbjct  421   WTKISMDEDATKMLETSPVLP  441



>ref|XP_007217235.1| hypothetical protein PRUPE_ppa005773mg [Prunus persica]
 ref|XP_007217236.1| hypothetical protein PRUPE_ppa005773mg [Prunus persica]
 gb|EMJ18434.1| hypothetical protein PRUPE_ppa005773mg [Prunus persica]
 gb|EMJ18435.1| hypothetical protein PRUPE_ppa005773mg [Prunus persica]
Length=444

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/441 (76%), Positives = 377/441 (85%), Gaps = 7/441 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWV+GAFINL GSI INFGTNLLKLGH+ER +HS L +EG +GK  +KPIIHFQTWR+
Sbjct  1     MGEWVVGAFINLFGSIAINFGTNLLKLGHNERERHSILESEGASGKLPLKPIIHFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G +FF LGN LNFISFG+AAQSLLAALGSIQF+SNIAFAYFV NK VT+KVMVAT FIVL
Sbjct  61    GFLFFVLGNCLNFISFGYAAQSLLAALGSIQFISNIAFAYFVLNKMVTVKVMVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTPEQLAEKYSNI FLLYCLILVLVVA  HS+YRRGELL  V G 
Sbjct  121   GNIFLVAFGNHQSPVYTPEQLAEKYSNIAFLLYCLILVLVVALQHSIYRRGELLHAVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYAIVSG +GSFSVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  181   DLRPYWHMLLPFSYAIVSGAVGSFSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQV +ALRTTMF+LG+M
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVLNALRTTMFILGMM  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsassls---NDVERLIMPLEDPQLKDVKSFSHVVL  1335
              VF+GISLLAPDDSKG + KD+S + +   S    D  RL +P ED Q++D +SF   +L
Sbjct  301   SVFVGISLLAPDDSKGAEVKDNSSLVSVMSSTIPKDAGRLAVPSEDIQIRDTRSFVQGIL  360

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             +K  + IVKAK AC+LSLG G+DS+ AS+VLVMPMVSSKITGFRGNG D+AK+F  ++ G
Sbjct  361   VKISDTIVKAKTACALSLGFGEDSINASAVLVMPMVSSKITGFRGNGFDRAKIFSMKNSG  420

Query  1516  WRRISVDEDC----ETSAMLP  1566
             W +IS+DED     ETS +LP
Sbjct  421   WTKISMDEDATKMLETSPVLP  441



>ref|XP_009345158.1| PREDICTED: uncharacterized protein LOC103936992 [Pyrus x bretschneideri]
 ref|XP_009345159.1| PREDICTED: uncharacterized protein LOC103936992 [Pyrus x bretschneideri]
 ref|XP_009345160.1| PREDICTED: uncharacterized protein LOC103936992 [Pyrus x bretschneideri]
Length=444

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/441 (76%), Positives = 378/441 (86%), Gaps = 7/441 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWV+GAFINL GSI INFGTNLLKLGH+ER +HS L ++G NGK  +KPII +QTWRI
Sbjct  1     MGEWVVGAFINLFGSIAINFGTNLLKLGHNERERHSILESDGGNGKLPLKPIIQYQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G +FFALGN LNF+SFG+AAQSLLAALGS+QFVSNIAFAYFV NK VT+KVMVAT FIVL
Sbjct  61    GFLFFALGNCLNFVSFGYAAQSLLAALGSVQFVSNIAFAYFVLNKMVTVKVMVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTP+QLAEKYSNI FLLYC+ILVLVVA HHS+YRRGELL  V G 
Sbjct  121   GNIFLVAFGNHQSPVYTPQQLAEKYSNIAFLLYCMILVLVVALHHSIYRRGELLHAVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYAIVSG +GSFSVLFAKSLSNLLRL++S+SY +HSWFTYSMLLLFLS
Sbjct  181   DLRPYWHMLLPFSYAIVSGAVGSFSVLFAKSLSNLLRLALSSSYQIHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQV DALRTTMF+LG+M
Sbjct  241   TAGFWMARLNEGLSFFDAILIVPMFQIAWTFFSICTGFVYFQEYQVLDALRTTMFILGMM  300

Query  1165  CVFIGISLLAPDDSKGTQTKD---sslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVL  1335
              VF+GI+LLAPDDSKG + KD      V +SS+S DV RL +  ED Q +D KSF   +L
Sbjct  301   SVFVGITLLAPDDSKGAEVKDNPSLVSVVSSSISKDVGRLAISSEDVQTRDAKSFVQGIL  360

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             +K  + IVKAK AC+L+LG G+DS+ AS+VLVMPMVSSKITGFRGNG D+AK+F  R+ G
Sbjct  361   VKISDAIVKAKTACALALGFGEDSINASAVLVMPMVSSKITGFRGNGFDRAKIFSMRNSG  420

Query  1516  WRRISVDEDC----ETSAMLP  1566
             W +IS+DED     ETS +LP
Sbjct  421   WTKISMDEDATKMLETSPVLP  441



>ref|XP_011098988.1| PREDICTED: probable magnesium transporter NIPA8 [Sesamum indicum]
 ref|XP_011098989.1| PREDICTED: probable magnesium transporter NIPA8 [Sesamum indicum]
 ref|XP_011098990.1| PREDICTED: probable magnesium transporter NIPA8 [Sesamum indicum]
Length=436

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/429 (79%), Positives = 374/429 (87%), Gaps = 3/429 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFINL GSI INFGTNLLKLGHDER +HS +GN+G NGKA MKPII+FQTWRI
Sbjct  1     MGEWVIGAFINLFGSIAINFGTNLLKLGHDERERHSVVGNDGANGKALMKPIIYFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GIIFF LGN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV NKTVT+KV+VAT FIVL
Sbjct  61    GIIFFILGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLNKTVTVKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTPEQLAEKY N TFL+YCLILV+VV  +HS+YRRGELLL VPGN
Sbjct  121   GNIFLVAFGNHQSPVYTPEQLAEKYGNATFLIYCLILVIVVCLNHSIYRRGELLLAVPGN  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D+KP+W MLLP SYAIVSG +GS SVLFAKSLSNLLRLSIS+ Y LHSWF YS+LLLF +
Sbjct  181   DIKPYWHMLLPLSYAIVSGAVGSCSVLFAKSLSNLLRLSISSGYQLHSWFMYSILLLFFT  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQI WTFFSICTGFVYFQEYQVFDALRTTMF+LG++
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIVWTFFSICTGFVYFQEYQVFDALRTTMFILGMI  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsassls-NDVERLIMPLEDPQLKDVKSFSHVVLMK  1341
              VFIGISLLAPD+SKG + KD++LVS +S   N+ +RLIMP  D Q+KD+KS   +V MK
Sbjct  301   SVFIGISLLAPDESKGGEIKDTALVSVTSNHPNNADRLIMPAGDSQIKDMKSLLRMVQMK  360

Query  1342  AVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWR  1521
             A +LIVK KAACSLSLGLG++S+ ASSVLVMPMV SKI GFRGN +D  KLF  R+ GW 
Sbjct  361   AASLIVKTKAACSLSLGLGEESIHASSVLVMPMVPSKINGFRGNVLDGTKLFSFRAPGWS  420

Query  1522  RISVDEDCE  1548
             RI  DED E
Sbjct  421   RI--DEDGE  427



>gb|EYU31888.1| hypothetical protein MIMGU_mgv1a006503mg [Erythranthe guttata]
Length=441

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/439 (75%), Positives = 378/439 (86%), Gaps = 7/439 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFINL GSI INFGTNLLKLGHDER +HS +GN+GTNGKA MKPI++FQTWRI
Sbjct  1     MGEWVIGAFINLFGSIAINFGTNLLKLGHDERERHSVVGNDGTNGKALMKPIVYFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGS+QFVSNIAFA+FV NKTVT+KV+VAT FIVL
Sbjct  61    GILFFILGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAFFVLNKTVTVKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTPE+LAEKY N TFL+YCLILV+VV   H++YRRGE+LL +PGN
Sbjct  121   GNIFLVAFGNHQSPVYTPEELAEKYGNTTFLIYCLILVIVVCSSHAIYRRGEVLLAIPGN  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D+KP+WQMLLP SYAIVSG  GS SVLFAKSLSNLLRLS+S+ Y LHSWFTYSMLLLF S
Sbjct  181   DIKPYWQMLLPLSYAIVSGAAGSCSVLFAKSLSNLLRLSMSSGYQLHSWFTYSMLLLFFS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS +DAILIVPMFQI WTFFSICTGFVYFQEYQVFDALRTTMF+LG++
Sbjct  241   TAGFWMARLNEGLSLYDAILIVPMFQIVWTFFSICTGFVYFQEYQVFDALRTTMFILGMI  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsassls-NDVERLIMPLEDPQLKDVKSFSHVVLMK  1341
              VFIGISLLAPD+SKG + KD++L+S ++   ND++R + P ED Q+KDV+S   +V  K
Sbjct  301   SVFIGISLLAPDESKGGEIKDTALISVAASHPNDMDRFVTPYEDSQIKDVRSLVRMVRTK  360

Query  1342  AVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWR  1521
             A N +VK KAA SLS G G++S+ ASSVLVMPMVSSKITGFRGN VD+ KLF  R +GW 
Sbjct  361   AANYMVKIKAAYSLSWGFGEESIHASSVLVMPMVSSKITGFRGNIVDKNKLFSFRGRGWS  420

Query  1522  RISVDEDCE----TSAMLP  1566
             +I  DE+ E    T+ +LP
Sbjct  421   KI--DEEGENLLQTTTILP  437



>ref|XP_008379030.1| PREDICTED: uncharacterized protein LOC103442068 [Malus domestica]
 ref|XP_008379031.1| PREDICTED: uncharacterized protein LOC103442068 [Malus domestica]
 ref|XP_008379032.1| PREDICTED: uncharacterized protein LOC103442068 [Malus domestica]
 ref|XP_008379034.1| PREDICTED: uncharacterized protein LOC103442068 [Malus domestica]
Length=444

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/441 (75%), Positives = 375/441 (85%), Gaps = 7/441 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWV+GAFINL GSI INFGTN LKLGH+ER +HS L ++G NGK  +KPII +QTWRI
Sbjct  1     MGEWVVGAFINLFGSIAINFGTNXLKLGHNERERHSILESDGGNGKLPLKPIIQYQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G +FFALGN LNF+SFG+AAQSLLAALGS+QFVSNIAFAYFV NK VT+KVMVAT FIVL
Sbjct  61    GFLFFALGNCLNFVSFGYAAQSLLAALGSVQFVSNIAFAYFVLNKMVTVKVMVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTPEQLAEKYSNI FL YC+ILVLVVA HHS+YRRGELL  V G 
Sbjct  121   GNIFLVAFGNHQSPVYTPEQLAEKYSNIAFLFYCMILVLVVALHHSIYRRGELLHAVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
              L+P+W MLLPFSYAIVSG +GSFSVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  181   XLRPYWHMLLPFSYAIVSGAVGSFSVLFAKSLSNLLRLALSSSYQLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQV DALRTTMF+LG++
Sbjct  241   TAGFWMARLNEGLSFFDAILIVPMFQIAWTFFSICTGFVYFQEYQVLDALRTTMFILGMI  300

Query  1165  CVFIGISLLAPDDSKGTQTKD---sslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVL  1335
              VF+GI+LLAPDDSKG + KD      V +SS+S DV RL +  ED Q +D KSF   +L
Sbjct  301   SVFVGITLLAPDDSKGAEVKDNPSLVSVVSSSISKDVGRLAVSSEDVQTRDAKSFVQGIL  360

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             +K  + IVKAK AC+L+LG G+DS+ AS+VLVMPMVSSKITGFRGNG D+AK+F  R+ G
Sbjct  361   VKISDAIVKAKTACALALGFGEDSINASAVLVMPMVSSKITGFRGNGFDRAKIFSMRNXG  420

Query  1516  WRRISVDEDC----ETSAMLP  1566
             W +IS+DED     ETS +LP
Sbjct  421   WTKISMDEDATKMLETSPVLP  441



>ref|XP_010249353.1| PREDICTED: probable magnesium transporter NIPA8 [Nelumbo nucifera]
 ref|XP_010249354.1| PREDICTED: probable magnesium transporter NIPA8 [Nelumbo nucifera]
 ref|XP_010249356.1| PREDICTED: probable magnesium transporter NIPA8 [Nelumbo nucifera]
 ref|XP_010249357.1| PREDICTED: probable magnesium transporter NIPA8 [Nelumbo nucifera]
Length=443

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/438 (74%), Positives = 385/438 (88%), Gaps = 5/438 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG WVIGAFIN++GSI INFGTNLLKLGHD+R + S L N+GTNG   +KPII+FQTWR+
Sbjct  1     MGGWVIGAFINVIGSIAINFGTNLLKLGHDQRERLSMLENDGTNGNIVLKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA+GN LNFISFG+AAQSLLAALGSIQFVSNIAF+YFV NK VT+KV+VATTFIV+
Sbjct  61    GILFFAVGNCLNFISFGYAAQSLLAALGSIQFVSNIAFSYFVLNKMVTVKVLVATTFIVI  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTP+QL EKY NI FLLYCLILVLVVA HHS+YRRGE +L V G+
Sbjct  121   GNIFLVAFGNHQSPVYTPDQLVEKYRNIIFLLYCLILVLVVAVHHSIYRRGEFVLAVSGH  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL P W MLLPFSYA+VSG +GS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  181   DLNPCWHMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLTMSSSYKLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLG+M
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGMM  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsass--lsNDVERLI-MPLEDPQLKDVKSFSHVVL  1335
              VFIGISLLAPD++KG + + SSL+S++S  +++D++RL+ +P E+ +++D++SF  ++L
Sbjct  301   SVFIGISLLAPDETKGVEVRGSSLLSSTSPVIADDMDRLLNLPSEETEIRDLRSFGQLLL  360

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             +KA +++ KAK AC+LSLGLG+DS+ ASSVLVMPMVSS++ GFRG+G D+ KLF  R  G
Sbjct  361   VKATSILSKAKTACTLSLGLGEDSINASSVLVMPMVSSRMNGFRGSGFDRTKLFSLRRPG  420

Query  1516  WRRISVDEDC--ETSAML  1563
             W RIS+DED   E S+ML
Sbjct  421   WSRISMDEDAEMERSSML  438



>ref|XP_007032075.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007032076.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007032078.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY03001.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY03002.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY03004.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=439

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/426 (74%), Positives = 368/426 (86%), Gaps = 3/426 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFINL GSI INFGTNLLKLGH+ER +HS +      GK  +KPII+FQTWR+
Sbjct  1     MGEWVIGAFINLFGSIAINFGTNLLKLGHNERERHSTMDG---GGKTPLKPIIYFQTWRV  57

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGS+QFVSNIAFA+FV NK VT+KV+VAT FIVL
Sbjct  58    GILFFVLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAFFVLNKMVTVKVLVATAFIVL  117

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLIL+LVVA HHS+YRRGE LL V G 
Sbjct  118   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILILVVALHHSIYRRGEHLLAVSGQ  177

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYA+VSG +GS SVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLFLS
Sbjct  178   DLRPYWNMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFLS  237

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGF+YFQEYQVFDALRTTMF+LG+M
Sbjct  238   TAGFWMTRLNEGLSLFDAILIVPMFQIAWTFFSICTGFIYFQEYQVFDALRTTMFILGMM  297

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKA  1344
              VFIGISLLAPD+S+G + KD   V +SS S + +RLI+P ED Q K++KSF+  ++MK 
Sbjct  298   SVFIGISLLAPDESRGGEVKDIDSVMSSSNSTETDRLILPSEDVQNKEIKSFTQGMMMKI  357

Query  1345  VNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWRR  1524
              +++ KAK  CSLSLG G+DS+ AS+VLVMPM+SSKITGFRG G D++++F  ++  W R
Sbjct  358   TDMLAKAKMTCSLSLGFGEDSINASAVLVMPMMSSKITGFRGGGFDRSRIFSMKNSSWSR  417

Query  1525  ISVDED  1542
             +++DED
Sbjct  418   VAMDED  423



>ref|XP_007032077.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY03003.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=440

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/427 (74%), Positives = 368/427 (86%), Gaps = 4/427 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFINL GSI INFGTNLLKLGH+ER +HS +      GK  +KPII+FQTWR+
Sbjct  1     MGEWVIGAFINLFGSIAINFGTNLLKLGHNERERHSTMDG---GGKTPLKPIIYFQTWRV  57

Query  445   GIIFFALGNSLNFISFGFAAQ-SLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIV  621
             GI+FF LGN LNFISFG+AAQ SLLAALGS+QFVSNIAFA+FV NK VT+KV+VAT FIV
Sbjct  58    GILFFVLGNCLNFISFGYAAQQSLLAALGSVQFVSNIAFAFFVLNKMVTVKVLVATAFIV  117

Query  622   LGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPG  801
             LGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLIL+LVVA HHS+YRRGE LL V G
Sbjct  118   LGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILILVVALHHSIYRRGEHLLAVSG  177

Query  802   NDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFL  981
              DL+P+W MLLPFSYA+VSG +GS SVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLFL
Sbjct  178   QDLRPYWNMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFL  237

Query  982   STAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGV  1161
             STAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGF+YFQEYQVFDALRTTMF+LG+
Sbjct  238   STAGFWMTRLNEGLSLFDAILIVPMFQIAWTFFSICTGFIYFQEYQVFDALRTTMFILGM  297

Query  1162  MCVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMK  1341
             M VFIGISLLAPD+S+G + KD   V +SS S + +RLI+P ED Q K++KSF+  ++MK
Sbjct  298   MSVFIGISLLAPDESRGGEVKDIDSVMSSSNSTETDRLILPSEDVQNKEIKSFTQGMMMK  357

Query  1342  AVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWR  1521
               +++ KAK  CSLSLG G+DS+ AS+VLVMPM+SSKITGFRG G D++++F  ++  W 
Sbjct  358   ITDMLAKAKMTCSLSLGFGEDSINASAVLVMPMMSSKITGFRGGGFDRSRIFSMKNSSWS  417

Query  1522  RISVDED  1542
             R+++DED
Sbjct  418   RVAMDED  424



>ref|XP_003518156.1| PREDICTED: magnesium transporter NIPA3-like isoform X1 [Glycine 
max]
Length=441

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/442 (71%), Positives = 380/442 (86%), Gaps = 8/442 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEW++GAFINL GSI INFGTNLLKLGH+ER +H  LG++G NGK  +KPII+FQ+WRI
Sbjct  1     MGEWIVGAFINLFGSIAINFGTNLLKLGHNERERH-LLGSDGVNGKMNLKPIIYFQSWRI  59

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV NK VT+KV+VAT FIVL
Sbjct  60    GIVFFFLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLNKMVTVKVLVATAFIVL  119

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQL EKY+NI+FLLY L L+ +VA HHS+Y+RGELLL V G+
Sbjct  120   GNVFLVAFGNHQSPVYTPEQLTEKYTNISFLLYLLALISIVALHHSIYKRGELLLGVSGH  179

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYA+VSG +GS SVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLFLS
Sbjct  180   DLRPYWSMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLALSNGYQLHSWFTYSMLLLFLS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQIAWT FSICTGF+YFQEYQVFDALRTTMF+LG+M
Sbjct  240   TAGFWMTRLNEGLSLFDAILIVPMFQIAWTLFSICTGFIYFQEYQVFDALRTTMFMLGMM  299

Query  1165  CVFIGISLLAPDDSKGTQTKDss--lvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLM  1338
             CVFIGISLLAPD+SKG +TKDSS   + +S++S +  RL++  E+ Q KD +S    +L+
Sbjct  300   CVFIGISLLAPDESKGPETKDSSLDSMVSSAISTEANRLVVSPEEAQNKDTRSLVKAILI  359

Query  1339  KAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGW  1518
             K  +L+VKAK  C+LSLG G+D++ ASSVLVMPM+SS++TGFRGNG+++A++   R+ GW
Sbjct  360   KITDLLVKAKTTCALSLGFGEDTINASSVLVMPMMSSRMTGFRGNGLERARILSMRN-GW  418

Query  1519  RRISVDEDC----ETSAMLPPQ  1572
             R+I +DED     ETS+++PP 
Sbjct  419   RKIPMDEDAGKLLETSSVVPPS  440



>gb|KDP41887.1| hypothetical protein JCGZ_26905 [Jatropha curcas]
Length=441

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/426 (73%), Positives = 365/426 (86%), Gaps = 0/426 (0%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEW+IGAFINL GSI INFGTNLLKLGH+ER +HS L  EG +GK+ +KPII+FQTWR+
Sbjct  1     MGEWIIGAFINLFGSIAINFGTNLLKLGHNERERHSMLDIEGASGKSHLKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF  GN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV NK VT+KV+VAT FIVL
Sbjct  61    GIVFFFFGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLNKMVTVKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN FLVAFGNHQSPVYTPEQLAEKYSN+TFLLYC+ILV+VVA HH +YRRG LL+ V G 
Sbjct  121   GNTFLVAFGNHQSPVYTPEQLAEKYSNMTFLLYCMILVVVVAMHHYIYRRGALLIAVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+WQMLLPFSYA+VSG +GS SVLFAKSLSNLLRL++SN Y LHSWFTYSM+LLF S
Sbjct  181   DLRPYWQMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLAMSNGYPLHSWFTYSMVLLFFS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQI WTFFSICTGFVYFQEYQVFDALRTTMF+LG+ 
Sbjct  241   TAGFWMTRLNEGLSLFDAILIVPMFQIVWTFFSICTGFVYFQEYQVFDALRTTMFILGMT  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKA  1344
             CVFIGISLLAPD+ +G + KD++ + +   S++ +RL+ P+ED    D ++F   V  KA
Sbjct  301   CVFIGISLLAPDEPRGGEVKDNASLVSVMSSSESDRLVNPVEDAHNNDPRTFVQGVTAKA  360

Query  1345  VNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWRR  1524
             + ++ KAKAACSLSLG G+DS+ AS+VLVMPMVSSKITGFRG+  D+ K+F  R+ GW +
Sbjct  361   MEVLAKAKAACSLSLGFGEDSINASAVLVMPMVSSKITGFRGSVFDRPKIFSLRNSGWSK  420

Query  1525  ISVDED  1542
             IS+DED
Sbjct  421   ISMDED  426



>ref|XP_009378082.1| PREDICTED: uncharacterized protein LOC103966622 [Pyrus x bretschneideri]
Length=799

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/438 (74%), Positives = 373/438 (85%), Gaps = 3/438 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWV+GAFINL GSI INFGTNLLKLGH+ER +HS L ++G NGK  +KPIIH+QTWR+
Sbjct  1     MGEWVVGAFINLFGSIAINFGTNLLKLGHNERERHSILESDGGNGKLPLKPIIHYQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G +FFALGN LNF+SFG+AAQSLLAALGS+QFVSNIAFAYFV NK VT+KVMVAT FIV+
Sbjct  61    GFLFFALGNCLNFVSFGYAAQSLLAALGSVQFVSNIAFAYFVLNKMVTVKVMVATAFIVI  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTPEQLAEKYSNI FL YC+ILVLVVA HHS+YRRGELL  V G 
Sbjct  121   GNIFLVAFGNHQSPVYTPEQLAEKYSNIAFLFYCMILVLVVALHHSIYRRGELLHAVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYAIVSG +GSFSVLFAKSLSNLLRL+IS+SY LHSWFTYSMLLLFLS
Sbjct  181   DLRPYWHMLLPFSYAIVSGAVGSFSVLFAKSLSNLLRLAISSSYQLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQV DALRTTMF+LG+M
Sbjct  241   TAGFWMARLNEGLSFFDAILIVPMFQIAWTFFSICTGFVYFQEYQVLDALRTTMFILGMM  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsassls---NDVERLIMPLEDPQLKDVKSFSHVVL  1335
              VF+GI+LLAPDDS+G + K++  + +   S    D+ R  +  ED Q++D +SF   +L
Sbjct  301   SVFVGITLLAPDDSRGAEVKENPSLVSVVSSSIPKDMGRFAVSSEDVQIRDTRSFVQGIL  360

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             +K  + IVKAK AC+LSLG GDDS+ AS+VLVMPMVSSKITGFRGNG D+AK+F  R+ G
Sbjct  361   VKISDAIVKAKTACALSLGFGDDSINASAVLVMPMVSSKITGFRGNGFDRAKIFSMRNSG  420

Query  1516  WRRISVDEDCETSAMLPP  1569
             W ++S+DED   +  + P
Sbjct  421   WTKMSMDEDATKTLEINP  438



>ref|XP_007151693.1| hypothetical protein PHAVU_004G068100g [Phaseolus vulgaris]
 gb|ESW23687.1| hypothetical protein PHAVU_004G068100g [Phaseolus vulgaris]
Length=442

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/442 (71%), Positives = 376/442 (85%), Gaps = 7/442 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEW +GA INL GSI INFGTNLLKLGH+ER +H   G++G NGK  +KPII+FQ+WRI
Sbjct  1     MGEWTVGALINLFGSIAINFGTNLLKLGHNERERHLH-GSDGVNGKMTLKPIIYFQSWRI  59

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV NK VT+KV+VAT FIVL
Sbjct  60    GIVFFFLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLNKMVTVKVLVATAFIVL  119

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQL EKY+NI FLLY L L+ +VA HHS+Y+RGELLL V G+
Sbjct  120   GNVFLVAFGNHQSPVYTPEQLTEKYTNIAFLLYLLALISIVALHHSIYKRGELLLAVSGH  179

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYAIVSG +GS SVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLFLS
Sbjct  180   DLRPYWSMLLPFSYAIVSGAVGSCSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFLS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGF+YFQEYQVFDALRTTMF+LG+M
Sbjct  240   TAGFWMTRLNEGLSLFDAILIVPMFQIAWTFFSICTGFIYFQEYQVFDALRTTMFILGMM  299

Query  1165  CVFIGISLLAPDDSKGTQTKDss--lvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLM  1338
             CVFIGISLLAPD+SKG + KD S   + +S+ S +V RL++  E+ Q KD +SF   VL+
Sbjct  300   CVFIGISLLAPDESKGPEPKDGSLDSMVSSATSTEVNRLVVSPEEAQNKDPRSFVKAVLI  359

Query  1339  KAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGW  1518
             K  +L+VKAK +C+LSLG G+D++ ASSVLVMPM+SS++TGFRGNG+++A++   R+ GW
Sbjct  360   KIADLLVKAKTSCALSLGFGEDTINASSVLVMPMMSSRMTGFRGNGLERARILSMRNSGW  419

Query  1519  RRISVDEDC----ETSAMLPPQ  1572
              +I +DED     +TS+++PP 
Sbjct  420   SKIPMDEDAGKLLDTSSVVPPS  441



>ref|XP_006599420.1| PREDICTED: magnesium transporter NIPA3 isoform X2 [Glycine max]
 gb|KHN13404.1| NIPA-like protein 3 [Glycine soja]
Length=441

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/442 (71%), Positives = 377/442 (85%), Gaps = 8/442 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEW++GAFINL GSI INFGTNLLKLGH+ER +H  LG++G NGK  +KPII+FQ+WRI
Sbjct  1     MGEWIVGAFINLFGSIAINFGTNLLKLGHNERERH-LLGSDGVNGKMNLKPIIYFQSWRI  59

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV NK VT+KV+VAT FIVL
Sbjct  60    GIVFFFLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLNKMVTVKVLVATAFIVL  119

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQL EKY+NI FLLY L L+ +VA HHS+Y+RGELL  V G+
Sbjct  120   GNVFLVAFGNHQSPVYTPEQLTEKYTNIAFLLYLLALISIVALHHSIYKRGELLFAVSGH  179

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYA+VSG +GS SVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLFLS
Sbjct  180   DLRPYWSMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFLS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQI WTFFSICTGF+YFQEYQVFDALRTTMF+LG+M
Sbjct  240   TAGFWMTRLNEGLSLFDAILIVPMFQITWTFFSICTGFIYFQEYQVFDALRTTMFILGMM  299

Query  1165  CVFIGISLLAPDDSKGTQTKDss--lvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLM  1338
             CVFIGISLLAPD+SKG +TKDSS   + +S++S +  RL++  E+ Q KD +SF   +L+
Sbjct  300   CVFIGISLLAPDESKGPETKDSSLDSMVSSAMSTETSRLVVSPEEAQNKDSRSFVKAILI  359

Query  1339  KAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGW  1518
             K  +L+VKAK +C+LSLG G+D++  SSVLVMPM+SS++TGFRGNG+++A++   R  GW
Sbjct  360   KVTDLLVKAKTSCALSLGFGEDTINTSSVLVMPMMSSRMTGFRGNGLERARILSMR-NGW  418

Query  1519  RRISVDEDC----ETSAMLPPQ  1572
              +I +DED     ETS+++PP 
Sbjct  419   SKIPMDEDAGKLLETSSVVPPS  440



>ref|XP_004304576.1| PREDICTED: NIPA-like protein 2-like [Fragaria vesca subsp. vesca]
Length=443

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/440 (74%), Positives = 375/440 (85%), Gaps = 6/440 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWV+GAFINL GSI INFGTNLLKLGH+ER +HS L  +GTNGK  +KPII+F TWR+
Sbjct  1     MGEWVVGAFINLFGSIAINFGTNLLKLGHNERERHSMLEGDGTNGKLPLKPIIYFHTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G +FF LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NK VT+KVMVAT FIVL
Sbjct  61    GFVFFVLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKMVTVKVMVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPV+TPEQLAEK+SNITFLLYCLIL+L+VA HHS+YRRG LL  V G+
Sbjct  121   GNIFLVAFGNHQSPVFTPEQLAEKFSNITFLLYCLILILIVALHHSIYRRGVLLHAVSGH  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+ +W MLLPFSYAIVSG +GSFSVLFAKSLSNLLRL +S+SY LHSWFTYSMLLLFLS
Sbjct  181   DLRSYWHMLLPFSYAIVSGAVGSFSVLFAKSLSNLLRLVMSSSYQLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQV + LRTTMF+LG+M
Sbjct  241   TAGFWMTRLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVLNTLRTTMFILGMM  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKA  1344
              VF GISLLAPDDSKG   KD+S + + ++  +V+R+++P ED Q++D +SF   +LMK 
Sbjct  301   SVFTGISLLAPDDSKGGDIKDNSSLVSVNIPKEVDRIVVPSEDIQIRDTRSFVQGILMKI  360

Query  1345  VNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGR--SQGW  1518
                +VKAK AC+LSLG G+DS+ AS+VLVMPMVSSKITGFRGNG D+AK+F  R  + GW
Sbjct  361   SEALVKAKTACALSLGFGEDSINASAVLVMPMVSSKITGFRGNGFDRAKIFSMRNSNSGW  420

Query  1519  RRISVDEDC----ETSAMLP  1566
              +IS+DED     ETS MLP
Sbjct  421   GKISMDEDATKMLETSPMLP  440



>ref|XP_006574742.1| PREDICTED: magnesium transporter NIPA3-like isoform X2 [Glycine 
max]
Length=443

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/444 (71%), Positives = 380/444 (86%), Gaps = 10/444 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEW++GAFINL GSI INFGTNLLKLGH+ER +H  LG++G NGK  +KPII+FQ+WRI
Sbjct  1     MGEWIVGAFINLFGSIAINFGTNLLKLGHNERERH-LLGSDGVNGKMNLKPIIYFQSWRI  59

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV NK VT+KV+VAT FIVL
Sbjct  60    GIVFFFLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLNKMVTVKVLVATAFIVL  119

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQL EKY+NI+FLLY L L+ +VA HHS+Y+RGELLL V G+
Sbjct  120   GNVFLVAFGNHQSPVYTPEQLTEKYTNISFLLYLLALISIVALHHSIYKRGELLLGVSGH  179

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYA+VSG +GS SVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLFLS
Sbjct  180   DLRPYWSMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLALSNGYQLHSWFTYSMLLLFLS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQIAWT FSICTGF+YFQEYQVFDALRTTMF+LG+M
Sbjct  240   TAGFWMTRLNEGLSLFDAILIVPMFQIAWTLFSICTGFIYFQEYQVFDALRTTMFMLGMM  299

Query  1165  CVFIGISLLAPDDSK--GTQTKDss--lvsasslsNDVERLIMPLEDPQLKDVKSFSHVV  1332
             CVFIGISLLAPD+SK  G +TKDSS   + +S++S +  RL++  E+ Q KD +S    +
Sbjct  300   CVFIGISLLAPDESKVSGPETKDSSLDSMVSSAISTEANRLVVSPEEAQNKDTRSLVKAI  359

Query  1333  LMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQ  1512
             L+K  +L+VKAK  C+LSLG G+D++ ASSVLVMPM+SS++TGFRGNG+++A++   R+ 
Sbjct  360   LIKITDLLVKAKTTCALSLGFGEDTINASSVLVMPMMSSRMTGFRGNGLERARILSMRN-  418

Query  1513  GWRRISVDEDC----ETSAMLPPQ  1572
             GWR+I +DED     ETS+++PP 
Sbjct  419   GWRKIPMDEDAGKLLETSSVVPPS  442



>ref|XP_010090937.1| hypothetical protein L484_007572 [Morus notabilis]
 gb|EXB41422.1| hypothetical protein L484_007572 [Morus notabilis]
Length=453

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/449 (72%), Positives = 382/449 (85%), Gaps = 11/449 (2%)
 Frame = +1

Query  262   LMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGT-NGKAAMKPIIHFQTW  438
             +MGEWV+GAFINL GSI INFGTNLLKLGH+ER +H++L ++GT NGK  +KPII+FQTW
Sbjct  4     MMGEWVVGAFINLFGSIAINFGTNLLKLGHNERERHASLESDGTSNGKHTLKPIIYFQTW  63

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
             R+GI+FF LGN LNFISFG+AAQSLLAALGSIQFVSN+AFAYFV NK VT+ VMVAT FI
Sbjct  64    RVGIVFFILGNCLNFISFGYAAQSLLAALGSIQFVSNMAFAYFVLNKRVTVNVMVATAFI  123

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVP  798
             VLGN+FLVAFGNHQSPVYTPEQLAEKYSN+TFL YC+IL+LVVA HHS+YRRGELLL V 
Sbjct  124   VLGNVFLVAFGNHQSPVYTPEQLAEKYSNVTFLFYCVILILVVAVHHSIYRRGELLLAVS  183

Query  799   GNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLF  978
             G+DL+P+W MLLPFSYAIVSG +GS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLF
Sbjct  184   GHDLRPYWHMLLPFSYAIVSGAVGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLF  243

Query  979   LSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLG  1158
             LSTAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGF+YFQEYQVFDALRTTMF+LG
Sbjct  244   LSTAGFWMTRLNEGLSLFDAILIVPMFQIAWTFFSICTGFIYFQEYQVFDALRTTMFILG  303

Query  1159  VMCVFIGISLLAPDDSKGTQTKDsslvsasslsN---DVERLIMPLEDPQLKDVKSFSHV  1329
             +M VFIGISLLAPD+SKG++ KD++ + +   S+   +V+RL++  ED   +D  SF   
Sbjct  304   MMSVFIGISLLAPDESKGSEVKDNTSLVSVMSSSIPKEVDRLVVGSEDAISRDSGSFMQG  363

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFR-GNGVDQAKLFPGR  1506
             ++MK  +++VKAK AC+LSLG G+DS+ AS+VLVMPMVSSKITGFR G+G ++AKLF  R
Sbjct  364   LVMKMSDIVVKAKNACALSLGFGEDSINASAVLVMPMVSSKITGFRGGSGFERAKLFNMR  423

Query  1507  -SQGWRRI----SVDEDCETSAM-LPPQS  1575
              S GW +I    ++D+D     +   PQS
Sbjct  424   NSGGWTKIPTTTTMDQDAAVEMLDHSPQS  452



>ref|XP_010250449.1| PREDICTED: probable magnesium transporter NIPA8 isoform X3 [Nelumbo 
nucifera]
Length=441

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/440 (72%), Positives = 370/440 (84%), Gaps = 7/440 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWV+GAFINL GS+ INFGTNLLKLGH++R + S L N+G NGK A+KPII+FQTWR+
Sbjct  1     MGEWVVGAFINLFGSVAINFGTNLLKLGHNQRERLSMLDNDGVNGKIALKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF+LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NK VT+KV+VAT FIVL
Sbjct  61    GILFFSLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKMVTVKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGN QSPVYTPEQL EKYSNI FLLYCLIL L+VA HHS+YRRGEL+L V  N
Sbjct  121   GNIFLVAFGNLQSPVYTPEQLVEKYSNIIFLLYCLILALIVAIHHSIYRRGELMLAVSVN  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL  +W MLLPFSYA+VSG +GS SVLFAKSLSNLLRL++S+ Y LHSWFTYSMLLLFLS
Sbjct  181   DLSSYWHMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLTVSSGYQLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSI TGFVYFQEYQVFDA+RTTMF+LG++
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSIFTGFVYFQEYQVFDAIRTTMFILGMI  300

Query  1165  CVFIGISLLAPDDSKGTQTKD--sslvsasslsNDVERLI-MPLEDPQLKDVKSFSHVVL  1335
              VFIGISLLAPD+ KG + KD        SS+  D++R++ +P E+ +++D +SF   ++
Sbjct  301   SVFIGISLLAPDEPKGGEVKDSSLVSSMDSSIVTDMDRMVKLPCEETEIRDTRSFGKAMM  360

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
              KA ++I KAKAAC LSLGLG+DS+ ASSVL MPMVSS++TGFRG G D+ K    RS G
Sbjct  361   TKATSIITKAKAACMLSLGLGEDSISASSVLAMPMVSSRMTGFRGAGFDRTKFLSLRSPG  420

Query  1516  WRRISVDED----CETSAML  1563
             W +IS++ED     ETS++L
Sbjct  421   WSKISMNEDDAEMMETSSIL  440



>ref|XP_003548044.1| PREDICTED: magnesium transporter NIPA3 isoform X1 [Glycine max]
Length=443

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/444 (71%), Positives = 377/444 (85%), Gaps = 10/444 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEW++GAFINL GSI INFGTNLLKLGH+ER +H  LG++G NGK  +KPII+FQ+WRI
Sbjct  1     MGEWIVGAFINLFGSIAINFGTNLLKLGHNERERH-LLGSDGVNGKMNLKPIIYFQSWRI  59

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV NK VT+KV+VAT FIVL
Sbjct  60    GIVFFFLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLNKMVTVKVLVATAFIVL  119

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQL EKY+NI FLLY L L+ +VA HHS+Y+RGELL  V G+
Sbjct  120   GNVFLVAFGNHQSPVYTPEQLTEKYTNIAFLLYLLALISIVALHHSIYKRGELLFAVSGH  179

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYA+VSG +GS SVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLFLS
Sbjct  180   DLRPYWSMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFLS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQI WTFFSICTGF+YFQEYQVFDALRTTMF+LG+M
Sbjct  240   TAGFWMTRLNEGLSLFDAILIVPMFQITWTFFSICTGFIYFQEYQVFDALRTTMFILGMM  299

Query  1165  CVFIGISLLAPDDSK--GTQTKDss--lvsasslsNDVERLIMPLEDPQLKDVKSFSHVV  1332
             CVFIGISLLAPD+SK  G +TKDSS   + +S++S +  RL++  E+ Q KD +SF   +
Sbjct  300   CVFIGISLLAPDESKVSGPETKDSSLDSMVSSAMSTETSRLVVSPEEAQNKDSRSFVKAI  359

Query  1333  LMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQ  1512
             L+K  +L+VKAK +C+LSLG G+D++  SSVLVMPM+SS++TGFRGNG+++A++   R  
Sbjct  360   LIKVTDLLVKAKTSCALSLGFGEDTINTSSVLVMPMMSSRMTGFRGNGLERARILSMR-N  418

Query  1513  GWRRISVDEDC----ETSAMLPPQ  1572
             GW +I +DED     ETS+++PP 
Sbjct  419   GWSKIPMDEDAGKLLETSSVVPPS  442



>gb|KEH25623.1| magnesium transporter NIPA protein [Medicago truncatula]
Length=442

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/442 (70%), Positives = 376/442 (85%), Gaps = 7/442 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWV+GAFINL GSI INFGTNLLKLGH+ER +H  LG++G +GK  +KPII+FQ+WRI
Sbjct  1     MGEWVVGAFINLFGSIAINFGTNLLKLGHNERERH-LLGSDGVHGKVTLKPIIYFQSWRI  59

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGS+QFVSN+AFAYFV NK VT+KV+VAT FIVL
Sbjct  60    GILFFFLGNCLNFISFGYAAQSLLAALGSVQFVSNLAFAYFVLNKMVTVKVLVATAFIVL  119

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQL EKY+N+ FLLY L L+++V  HHS+Y+RGELLL + G+
Sbjct  120   GNVFLVAFGNHQSPVYTPEQLTEKYTNVAFLLYLLALIVIVVLHHSIYKRGELLLAISGH  179

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DLKP W MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLFLS
Sbjct  180   DLKPIWGMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFLS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGF+YFQEYQVFD LRTTMF+LG+M
Sbjct  240   TAGFWMTRLNEGLSLFDAILIVPMFQIAWTFFSICTGFIYFQEYQVFDTLRTTMFILGMM  299

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsas--slsNDVERLIMPLEDPQLKDVKSFSHVVLM  1338
             CVFIGISLLAPD+SK ++TKDSSL S    ++S + +RL+   E+   KD++SF   VL+
Sbjct  300   CVFIGISLLAPDESKVSETKDSSLDSVVSPAISTETKRLVASSEEAHSKDMRSFVKGVLI  359

Query  1339  KAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGW  1518
             K  +++VKAK +C+LSLG G+D++ ASSVLVMPM+SS++ GFRGNG++++++   R+ GW
Sbjct  360   KIADILVKAKTSCALSLGFGEDTINASSVLVMPMMSSRMNGFRGNGLERSRILSMRNSGW  419

Query  1519  RRISVDEDC----ETSAMLPPQ  1572
              RI +DED     ET++ +PP 
Sbjct  420   SRIPMDEDATKLLETNSNVPPS  441



>ref|XP_010554142.1| PREDICTED: probable magnesium transporter NIPA8 [Tarenaya hassleriana]
 ref|XP_010554143.1| PREDICTED: probable magnesium transporter NIPA8 [Tarenaya hassleriana]
 ref|XP_010554144.1| PREDICTED: probable magnesium transporter NIPA8 [Tarenaya hassleriana]
Length=434

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/435 (71%), Positives = 368/435 (85%), Gaps = 4/435 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER +     N G  GK  +KPII+FQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNERERLVIQENGG--GKTPLKPIIYFQTWRV  58

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF +GN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NK VT+K++VAT FIVL
Sbjct  59    GILFFLIGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKMVTVKILVATAFIVL  118

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPV+TPEQLAEKYSN+TFL+YC+IL+L+VAF+H VYR+GELL++ PG 
Sbjct  119   GNIFLVAFGNHQSPVFTPEQLAEKYSNMTFLIYCVILILIVAFNHFVYRKGELLISAPGQ  178

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             +L+P+W MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  179   ELRPYWHMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYELHSWFTYSMLLLFLS  238

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGF+YFQE+QVFD LRTTMF+LG+M
Sbjct  239   TAGFWMTRLNEGLSLFDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDTLRTTMFILGMM  298

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKA  1344
             CVFIGISLLAPDD++G + KD+S + +   S + + LI P ED   KD +     V MK 
Sbjct  299   CVFIGISLLAPDDTRGNEMKDNSTLVSVIPSTEEDSLIPPSEDGHSKDTRQVVQGVYMKI  358

Query  1345  VNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGR-SQGWR  1521
              +L+ K KAAC  SLG G+DS+ AS+VLVMPMVSSKITGFRGNG+++AK+   R + GW 
Sbjct  359   SDLVAKTKAACLASLGFGEDSINASAVLVMPMVSSKITGFRGNGLERAKILSMRGASGWS  418

Query  1522  RISVDEDCETSAMLP  1566
             ++S+DED ETS + P
Sbjct  419   KVSMDED-ETSVLSP  432



>gb|KHG04148.1| NIPA-like protein 3 [Gossypium arboreum]
Length=444

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/445 (70%), Positives = 375/445 (84%), Gaps = 10/445 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG+WVIGAFINL GSI INFGTNLLKLGH+ER +HS +  EG  GK  +KPII+FQTWR+
Sbjct  1     MGDWVIGAFINLFGSIAINFGTNLLKLGHNERERHSMMDGEGMAGKVPLKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF +GN LNFISFG+AAQSLLAALGS+QF+SNIAFAYFV NK VT+KV+ AT FIVL
Sbjct  61    GILFFIIGNCLNFISFGYAAQSLLAALGSVQFISNIAFAYFVLNKMVTVKVLAATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN FLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLIL+LVVA HH +YRRGE++L+V G 
Sbjct  121   GNFFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILILVVALHHYIYRRGEIVLSVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYA+VSG +GS SVLFAKSLSNLLRL++SN Y LHSWFTYSM+LLFLS
Sbjct  181   DLRPYWNMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMILLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGF+YFQEYQVFDALRTTMF+LG++
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFIYFQEYQVFDALRTTMFILGMV  300

Query  1165  CVFIGISLLAPDDSKGTQTKDs---slvsasslsNDVERLIMPLEDPQLKDVKSFSHVVL  1335
              VF GISLLAPD+ +G + KD+   + V +SS S + +R I   ED + K++KSF+  ++
Sbjct  301   SVFAGISLLAPDEPRGGEVKDASHPTSVLSSSNSTETDRFIFESEDAENKEMKSFTQRMV  360

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             +K  +++ KAK  CSLSLG GDDS+ AS+VLVMPM+SSKITGFRG+G D++++F  R+  
Sbjct  361   VKVTDILAKAKTTCSLSLGFGDDSINASAVLVMPMMSSKITGFRGSGFDRSRIFSLRNSS  420

Query  1516  WRRISVDEDCETSAMLP-----PQS  1575
             W R+++DE  E++ ML      PQS
Sbjct  421   WSRVAMDE--ESAKMLNGDGVLPQS  443



>ref|XP_006446877.1| hypothetical protein CICLE_v10015243mg [Citrus clementina]
 gb|ESR60117.1| hypothetical protein CICLE_v10015243mg [Citrus clementina]
 gb|KDO63497.1| hypothetical protein CISIN_1g013305mg [Citrus sinensis]
Length=445

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/445 (73%), Positives = 373/445 (84%), Gaps = 10/445 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFINL+GSI INFGTNLLKLGH ER KHS L ++GTNGK ++KPI+H+ +WR+
Sbjct  1     MGEWVIGAFINLVGSIAINFGTNLLKLGHIEREKHSTLDSDGTNGKHSLKPIVHYHSWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGS+QFVSNIAF+YFVFNK VT+KV+VAT FIVL
Sbjct  61    GILVFLLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFSYFVFNKMVTVKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQLAEKYSNITFL+YCLIL+ +VA +H +YR+GE LL V G 
Sbjct  121   GNIFLVSFGNHQSPVYTPEQLAEKYSNITFLVYCLILIFIVAIYHYIYRKGENLLAVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D + +W+MLLPFSYAIVSG +GSFSVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLF S
Sbjct  181   DNR-YWRMLLPFSYAIVSGAVGSFSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFFS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWT FSICTGFVYFQEYQVFDALR TMF+LG  
Sbjct  240   TAGFWMARLNEGLSLFDAILIVPMFQIAWTSFSICTGFVYFQEYQVFDALRATMFILGTA  299

Query  1165  CVFIGISLLAPDDSKGTQTKD---sslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVL  1335
              VFIGISLLAPD+SKG + KD      V +SS+S +V+RLI+P ED Q K+ K F   + 
Sbjct  300   SVFIGISLLAPDESKGGEVKDDSSLVSVMSSSISTEVDRLILPSEDAQSKEPKPFVQGMS  359

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             MK  +++ KAK ACS+SLGLG+DS+ AS+VLVMPMVSSKI GFRGN  D+AKLF  ++ G
Sbjct  360   MKISDMMAKAKTACSMSLGLGEDSINASAVLVMPMVSSKINGFRGNRFDRAKLFNVKNSG  419

Query  1516  --WRRISVDED----CETSAMLPPQ  1572
               W  IS+DED     ETSA LPP 
Sbjct  420   SDWSGISIDEDGAKLLETSAGLPPS  444



>ref|XP_011033700.1| PREDICTED: probable magnesium transporter NIPA8 [Populus euphratica]
Length=444

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/441 (71%), Positives = 372/441 (84%), Gaps = 7/441 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFINL GSI INFGTNLLKLGH+ER +HS   N GT+GK  +KPII+FQTWR+
Sbjct  1     MGEWVIGAFINLFGSIAINFGTNLLKLGHNERERHSMQDNVGTSGKVPVKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NK VT+KV+VAT FIVL
Sbjct  61    GILFFFLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKMVTVKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTPEQLAEKYSN+TFL YCL+L+L+VA HH +YRRGE++L + G 
Sbjct  121   GNIFLVAFGNHQSPVYTPEQLAEKYSNMTFLFYCLVLILLVALHHYIYRRGEIILAISGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+WQMLLPFSYA+VSG +GS SVLFAKSLSNLLRL++S+ Y LHSWFTYS+LLLFLS
Sbjct  181   DLRPYWQMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLAMSSDYQLHSWFTYSILLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGL+ FDAILIVPMFQI WTFFSICTGFVYFQEYQVFDALRTTMF+LG+ 
Sbjct  241   TAGFWMTRLNEGLALFDAILIVPMFQIVWTFFSICTGFVYFQEYQVFDALRTTMFILGMT  300

Query  1165  CVFIGISLLAPDDSKGTQTKDss---lvsasslsNDVERLIMPLEDPQLKDVKSFSHVVL  1335
              VF+GISLLAPD+SK  + KD++    V +SS+S + +RL++  ED Q KD +S++  ++
Sbjct  301   SVFVGISLLAPDESKAGEVKDNASSVPVVSSSISIETDRLVISSEDAQNKDPRSYAQAMV  360

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             +K   ++ KAK ACSLSLG G+DS+ AS+VLVMPMVSSKITGFRG   D+ K F  R+  
Sbjct  361   IKIKEVLAKAKTACSLSLGFGEDSINASAVLVMPMVSSKITGFRGTVFDRPKFFSLRNSS  420

Query  1516  WRRISVDED----CETSAMLP  1566
             W +IS+++D     ET+ +LP
Sbjct  421   WSKISMNDDGVNVLETNPVLP  441



>emb|CBI21245.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/429 (73%), Positives = 362/429 (84%), Gaps = 3/429 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWV+GA IN+ GSI INFGTNLLKLGH+ER +   L N G NGK   KPII+FQTWR+
Sbjct  1     MGEWVVGAIINVFGSIAINFGTNLLKLGHNERGRSLLLDNNGANGKLVPKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G++FF+LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NK V++KV+VAT FIVL
Sbjct  61    GLLFFSLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKMVSVKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPV+TPEQLAEK+SN TFL+YCLIL+LVVA +H +YRRGE+   + G 
Sbjct  121   GNIFLVAFGNHQSPVFTPEQLAEKFSNATFLVYCLILILVVALNHYIYRRGEMQFAISGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYA VSG +GS SVLFAKSLSNLLRL++S+ Y LHSWFTYSMLL FLS
Sbjct  181   DLEPYWHMLLPFSYATVSGAVGSCSVLFAKSLSNLLRLAMSSGYQLHSWFTYSMLLCFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LRTTMF+LG+M
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRTTMFILGMM  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsN---DVERLIMPLEDPQLKDVKSFSHVVL  1335
              VFIGISLLAPD+ KG +TKD+S +++ + S+   D +RLI P ED Q +D +S    +L
Sbjct  301   SVFIGISLLAPDEPKGGETKDNSTLASITSSSTPTDTDRLITPSEDAQTQDPRSRMQAML  360

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             MKA   IVKAKAACSLSLG G+DS+ AS+ LVMPMVSSKITGFRG+  D  +LF  ++ G
Sbjct  361   MKATEAIVKAKAACSLSLGFGEDSINASAGLVMPMVSSKITGFRGSSPDGGRLFSLKNPG  420

Query  1516  WRRISVDED  1542
             W +IS+DED
Sbjct  421   WTKISMDED  429



>ref|XP_010682217.1| PREDICTED: probable magnesium transporter NIPA8 [Beta vulgaris 
subsp. vulgaris]
Length=443

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/443 (71%), Positives = 377/443 (85%), Gaps = 8/443 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFINL GSI INFGTNLLKLGH ER +   L N+ TNGK  +KPI HFQTWR+
Sbjct  1     MGEWVIGAFINLFGSIAINFGTNLLKLGHTER-ERFVLENKETNGKIVLKPITHFQTWRV  59

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA GN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV +K +++KV+VATTFIVL
Sbjct  60    GILFFAFGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLSKKISVKVLVATTFIVL  119

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQLAEKYSNITFLLYCL LV VVA HH +YRRGE+L    G+
Sbjct  120   GNVFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLTLVFVVAIHHYIYRRGEILAT-SGH  178

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             +LK +WQM++PFSYA+VSG +GS SVLFAKSLSNLLRL++S++Y LH+WFTYSMLLLFLS
Sbjct  179   ELKSYWQMMIPFSYAVVSGAVGSCSVLFAKSLSNLLRLAMSSNYHLHTWFTYSMLLLFLS  238

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGL+ FDAI+IVPMFQIAWTFFSICTGFVYFQEYQVF+ LRT+MF+LG+M
Sbjct  239   TAGFWMARLNEGLAFFDAIVIVPMFQIAWTFFSICTGFVYFQEYQVFNTLRTSMFILGMM  298

Query  1165  CVFIGISLLAPDDSKGTQTKDss--lvsasslsNDVERLIM-PLEDPQLKDVKSFSHVVL  1335
              VFIGI+LLAPD++KG + KDSS   +++SS++ND ERL++   ED Q K+VK F H +L
Sbjct  299   SVFIGITLLAPDEAKGGEVKDSSLDALTSSSVANDGERLVLTSYEDTQSKEVKPFIHKML  358

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNG-VDQAKLFPGRSQ  1512
              KA  +++KAK  C L+LG+G++++ ASSVLVMPM+SSKITGFRG   VD+AK FP RS 
Sbjct  359   TKATEVMLKAKTTCLLALGMGENTMNASSVLVMPMLSSKITGFRGGSTVDRAKFFPMRST  418

Query  1513  GWRRISVDEDCETSAMLPPQSMV  1581
             GW +I +DED  ++ +L   S+V
Sbjct  419   GWDKIPMDED--STKLLETSSLV  439



>ref|XP_010028908.1| PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028909.1| PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Eucalyptus 
grandis]
 gb|KCW55739.1| hypothetical protein EUGRSUZ_I01571 [Eucalyptus grandis]
 gb|KCW55740.1| hypothetical protein EUGRSUZ_I01571 [Eucalyptus grandis]
Length=443

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/443 (71%), Positives = 372/443 (84%), Gaps = 9/443 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFINL GSI INFGTNLLKLGH+ER + S    +G NGK  +KPIIHF TWR+
Sbjct  1     MGEWVIGAFINLFGSIAINFGTNLLKLGHNERERQSMQDTDGANGKHPLKPIIHFHTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV NK VT+KV+ AT FIVL
Sbjct  61    GILFFFLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLNKLVTVKVLAATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQLAEKYSNITFL YCLIL+L+VAFHH+VYRRGELL+ V G 
Sbjct  121   GNVFLVAFGNHQSPVYTPEQLAEKYSNITFLFYCLILMLIVAFHHAVYRRGELLIAVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             +L+P+W MLLPFSYAIVSG +GS SVLFAKSLSNLLRL++S++Y LHSWFTYSMLLLFLS
Sbjct  181   ELRPYWHMLLPFSYAIVSGAVGSCSVLFAKSLSNLLRLAMSSNYQLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMF+LG+ 
Sbjct  241   TAGFWMTRLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFILGMT  300

Query  1165  CVFIGISLLAPDDSKGTQTKD---sslvsasslsNDVERLIMPLEDPQLKDVK--SFSHV  1329
              VF+GI LLAPD+S+G + KD    + V++S +S++ +RLI+   D   K+++  SF   
Sbjct  301   SVFVGICLLAPDESRGGEVKDNPSLASVTSSGISSESDRLIVSTGDGHGKEMRSSSFMQE  360

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRS  1509
             V  + ++++V+AK ACS+SLG  DDS+ AS+VLVMPMVSSKITGFR  G D++K+F  ++
Sbjct  361   VTFRIMDILVRAKNACSVSLGFTDDSINASAVLVMPMVSSKITGFRSTGFDRSKVFSMKN  420

Query  1510  QGWRRISVDED----CETSAMLP  1566
              GW RIS+DE+     +T+ +LP
Sbjct  421   FGWNRISLDEEGAKMLDTAVVLP  443



>gb|AFK45775.1| unknown [Lotus japonicus]
Length=442

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/442 (70%), Positives = 372/442 (84%), Gaps = 7/442 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEW++GAFINL GSI INFGTNLLKLGH+ER +H  LG++G NGK  +KPII FQ+WRI
Sbjct  1     MGEWIVGAFINLFGSIAINFGTNLLKLGHNERERH-VLGSDGLNGKMTLKPIISFQSWRI  59

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV NK VT+KV+VAT FIVL
Sbjct  60    GILFFFLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLNKMVTVKVLVATAFIVL  119

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPV+TPEQL EKY+N+ FLLY L L+++VA HHS Y+RGELLL V G+
Sbjct  120   GNIFLVAFGNHQSPVFTPEQLTEKYTNVAFLLYLLALIVIVALHHSGYKRGELLLAVSGH  179

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYA+VSG +GS SVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLFLS
Sbjct  180   DLRPYWNMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFLS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGL+ FDAILIVPMFQIAWT FSICTGF+YFQEY VFDALRTTMF+LG+M
Sbjct  240   TAGFWMTRLNEGLALFDAILIVPMFQIAWTLFSICTGFIYFQEYLVFDALRTTMFILGMM  299

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVE--RLIMPLEDPQLKDVKSFSHVVLM  1338
             CVF+GISLLAPD+SKG +TKDSSL S  S +  +E  RL++  E+ Q ++ +SF   + +
Sbjct  300   CVFLGISLLAPDESKGAETKDSSLDSMVSPAISIEAKRLVVSSEEAQNRETRSFVKGMRI  359

Query  1339  KAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGW  1518
             K  +++ +AKA+ +LS G G+DS+ ASSVLVMPM+SS+ITGFRG G+D++++   R+ GW
Sbjct  360   KITDMLAQAKASFALSFGFGEDSINASSVLVMPMMSSRITGFRGTGIDRSRMLSMRNYGW  419

Query  1519  RRISVDEDC----ETSAMLPPQ  1572
              +I +DED     ETS ++PP 
Sbjct  420   SKIPMDEDAGKLLETSQIVPPS  441



>ref|XP_004167028.1| PREDICTED: uncharacterized LOC101223129 [Cucumis sativus]
Length=444

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/429 (72%), Positives = 367/429 (86%), Gaps = 3/429 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGA INL GS+ INFGTNLLKLGH+ER KHS L N G+ GK  MKPII+FQTWR+
Sbjct  1     MGEWVIGAVINLFGSLAINFGTNLLKLGHNEREKHSMLENNGSIGKTPMKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI FF +GN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV +K VT+KVMVAT FIVL
Sbjct  61    GITFFIIGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLHKMVTVKVMVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQL EKY NITFLLYC+IL+LVVA HHS+YRRGELLL+V G 
Sbjct  121   GNVFLVAFGNHQSPVYTPEQLVEKYGNITFLLYCVILILVVALHHSIYRRGELLLSVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYAIVSG IGS SVLFAKSLS LLRL++S+ Y LHSWFTYS+LLLFLS
Sbjct  181   DLRPYWHMLLPFSYAIVSGAIGSCSVLFAKSLSILLRLAMSSDYQLHSWFTYSLLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGF+YF+E+QV DALRTTMF+LG+M
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFIYFKEFQVLDALRTTMFILGMM  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslv---sasslsNDVERLIMPLEDPQLKDVKSFSHVVL  1335
              VFIGISLLAPD+ +  + KD+S +   +++S +++ ERLI+  ++ + +D KSFS  VL
Sbjct  301   SVFIGISLLAPDEPRDGEFKDNSSLVSGTSTSFTSEEERLIVSSKELETRDAKSFSQGVL  360

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             +K  +++ KAKAA +LSLG G+DSL AS++LVMPMVSS++TGFRG G +++K F  R   
Sbjct  361   LKITDVVAKAKAALALSLGFGEDSLNASAILVMPMVSSRMTGFRGTGFERSKFFSMRKPD  420

Query  1516  WRRISVDED  1542
             W RIS+DE+
Sbjct  421   WSRISLDEE  429



>ref|XP_002512799.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF49302.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=1198

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/429 (74%), Positives = 371/429 (86%), Gaps = 3/429 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFINL GSI INFGTNLLKLGH ER +HS L N+G +GK+ +KPIIHFQTWRI
Sbjct  1     MGEWVIGAFINLFGSIAINFGTNLLKLGHTERERHSTLDNDGASGKSHLKPIIHFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GIIFF LGN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV +K VT+KV+VAT FIVL
Sbjct  61    GIIFFFLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLHKMVTVKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQLAEKYSN+TFLLYC+IL+LVVA HH +YRRGE+L  + G 
Sbjct  121   GNVFLVAFGNHQSPVYTPEQLAEKYSNMTFLLYCMILILVVALHHYLYRRGEILAAISGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+WQMLLPFSYA+VSG +GS SVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLFLS
Sbjct  181   DLRPYWQMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAI+IVPMFQI WTFFSICTGFVYFQEYQVFDALRTTMF+LG+M
Sbjct  241   TAGFWMTRLNEGLSLFDAIVIVPMFQIVWTFFSICTGFVYFQEYQVFDALRTTMFILGMM  300

Query  1165  CVFIGISLLAPDDSKGTQTKDss---lvsasslsNDVERLIMPLEDPQLKDVKSFSHVVL  1335
             CVFIGISLLAPD+ +G + KD++    V +SS+S++ +RLI P ED Q KD ++     +
Sbjct  301   CVFIGISLLAPDEPRGGEGKDNASLVSVVSSSVSSESDRLIKPAEDAQNKDPRTLVQGTM  360

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
              K + LI KAKAACS+SLG G+DS+ AS+VLVMPMVSSK+TGFRG+  D+ K+F  ++ G
Sbjct  361   AKVMELIAKAKAACSISLGFGEDSINASAVLVMPMVSSKMTGFRGSVFDRPKIFSLKNSG  420

Query  1516  WRRISVDED  1542
             W +IS+DED
Sbjct  421   WSKISMDED  429



>ref|XP_004489736.1| PREDICTED: NIPA-like protein 2-like [Cicer arietinum]
Length=441

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/442 (71%), Positives = 375/442 (85%), Gaps = 8/442 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWV+GAFINL GSI INFGTNLLKLGH+ER +H  LGN+G +GK  +KPII+FQ+WRI
Sbjct  1     MGEWVVGAFINLFGSIAINFGTNLLKLGHNERERH-LLGNDGVHGKVTLKPIIYFQSWRI  59

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGS+QFVSN+AFAYFV NK VT+KV+VAT FIVL
Sbjct  60    GILFFFLGNCLNFISFGYAAQSLLAALGSVQFVSNLAFAYFVLNKLVTVKVLVATAFIVL  119

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQL EKY+N  FLLY L L+++VA HHSVY+RGEL L V G+
Sbjct  120   GNVFLVAFGNHQSPVYTPEQLTEKYTNAAFLLYLLALIVIVALHHSVYKRGELQLAVSGH  179

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DLKPFW MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLFLS
Sbjct  180   DLKPFWSMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFLS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGF+YFQEYQVFD LRTTMF+LG+M
Sbjct  240   TAGFWMTRLNEGLSLFDAILIVPMFQIAWTFFSICTGFIYFQEYQVFDTLRTTMFILGMM  299

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsas--slsNDVERLIMPLEDPQLKDVKSFSHVVLM  1338
             CVFIGISLLAPD+SKG +TKDSSL S    ++S ++ RLI+  E+   KD +SF + VL+
Sbjct  300   CVFIGISLLAPDESKG-ETKDSSLDSGVSPAISTEMNRLIVSSEEAHNKDPRSFVNGVLV  358

Query  1339  KAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGW  1518
             K  N+ VKAK +C+LSLG G+D++ ASSV VMPM+SS++ GFRGNG+++A++   R+ GW
Sbjct  359   KITNMWVKAKTSCALSLGFGEDTINASSVFVMPMMSSRMNGFRGNGLERARILSMRNSGW  418

Query  1519  RRISVDEDC----ETSAMLPPQ  1572
              ++ +DED     +T+ ++PP 
Sbjct  419   SKVPMDEDAVKLLDTNPIVPPS  440



>ref|XP_006290458.1| hypothetical protein CARUB_v10019534mg [Capsella rubella]
 gb|EOA23356.1| hypothetical protein CARUB_v10019534mg [Capsella rubella]
Length=442

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/431 (70%), Positives = 362/431 (84%), Gaps = 7/431 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER +  AL   G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNER-ERLALQEHG-GGKMPLKPIIHFQTWRV  58

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAY V NK VT+KV+VAT FIVL
Sbjct  59    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYVVLNKMVTVKVLVATAFIVL  118

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPV+TPEQLAEKYSN+TFL+YC IL+L+VA HH +Y++GE+L++ PG 
Sbjct  119   GNVFLVAFGNHQSPVFTPEQLAEKYSNVTFLVYCGILILIVAVHHFLYKKGEVLISTPGQ  178

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             ++  +W+MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  179   EINSYWKMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  238

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+LG+M
Sbjct  239   TAGFWMTRLNEGLSLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFILGMM  298

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDV---ERLIMPL--EDPQLKDVKSFSHV  1329
             CVFIGISLLAPDD++G +TKD+S    S +++ V   E  +MP   ED   KD +     
Sbjct  299   CVFIGISLLAPDDTRGNETKDNSSSLDSIVTSSVPTEEDRLMPQSSEDGHSKDTRVVVQG  358

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRS  1509
             + MKA +LI K K AC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+F  R 
Sbjct  359   MYMKAADLITKTKTACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKIFSMRG  418

Query  1510  QGWRRISVDED  1542
              GW +++++E+
Sbjct  419   SGWSKLAMEEE  429



>ref|XP_004145621.1| PREDICTED: uncharacterized protein LOC101223129 [Cucumis sativus]
Length=443

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/429 (72%), Positives = 367/429 (86%), Gaps = 4/429 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGA INL GS+ INFGTNLLKLGH+ER KHS L N G+ GK  MKPII+FQTWR+
Sbjct  1     MGEWVIGAVINLFGSLAINFGTNLLKLGHNEREKHSMLENNGSIGKTPMKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GIIF  +GN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV +K VT+KVMVAT FIVL
Sbjct  61    GIIFI-IGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLHKMVTVKVMVATAFIVL  119

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQL EKY NITFLLYC+IL+LVVA HHS+YRRGELLL+V G 
Sbjct  120   GNVFLVAFGNHQSPVYTPEQLVEKYGNITFLLYCVILILVVALHHSIYRRGELLLSVSGQ  179

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYAIVSG IGS SVLFAKSLS LLRL++S+ Y LHSWFTYS+LLLFLS
Sbjct  180   DLRPYWHMLLPFSYAIVSGAIGSCSVLFAKSLSILLRLAMSSDYQLHSWFTYSLLLLFLS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGF+YF+E+QV DALRTTMF+LG+M
Sbjct  240   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFIYFKEFQVLDALRTTMFILGMM  299

Query  1165  CVFIGISLLAPDDSKGTQTKDsslv---sasslsNDVERLIMPLEDPQLKDVKSFSHVVL  1335
              VFIGISLLAPD+ +  + KD+S +   +++S +++ ERLI+  ++ + +D KSFS  VL
Sbjct  300   SVFIGISLLAPDEPRDGEFKDNSSLVSGTSTSFTSEEERLIVSSKELETRDAKSFSQGVL  359

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             +K  +++ KAKAA +LSLG G+DSL AS++LVMPMVSS++TGFRG G +++K F  R   
Sbjct  360   LKITDVVAKAKAALALSLGFGEDSLNASAILVMPMVSSRMTGFRGTGFERSKFFSMRKPD  419

Query  1516  WRRISVDED  1542
             W RIS+DE+
Sbjct  420   WSRISLDEE  428



>ref|XP_002876986.1| hypothetical protein ARALYDRAFT_484434 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53245.1| hypothetical protein ARALYDRAFT_484434 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/431 (70%), Positives = 364/431 (84%), Gaps = 8/431 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER +  AL + G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNER-ERLALQDGG--GKMPLKPIIHFQTWRV  57

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAY V NK VT+KV+VAT FIVL
Sbjct  58    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYVVLNKMVTVKVLVATAFIVL  117

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPV+TPEQLAEKYSN+TFL+YC IL+L+VA HH +YR+GE+L+++PG 
Sbjct  118   GNVFLVAFGNHQSPVFTPEQLAEKYSNVTFLVYCGILILIVAVHHFLYRKGEVLISIPGQ  177

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             ++  +W+MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  178   EISSYWKMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  237

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+LG+M
Sbjct  238   TAGFWMTRLNEGLSLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFILGMM  297

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDV---ERLIMPL--EDPQLKDVKSFSHV  1329
             CVFIGISLLAPDD++G +T+D+S    S +S+ V   E  +MP   ED   KD +     
Sbjct  298   CVFIGISLLAPDDTRGNETRDNSSSLDSIVSSSVPTEEDRLMPQSSEDGHSKDTRVVVQG  357

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRS  1509
             + MKA +LI K KAAC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R 
Sbjct  358   MYMKAADLIAKTKAACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRG  417

Query  1510  QGWRRISVDED  1542
              GW +++++E+
Sbjct  418   SGWSKLAMEEE  428



>ref|XP_008449977.1| PREDICTED: uncharacterized protein LOC103491699 [Cucumis melo]
 ref|XP_008449978.1| PREDICTED: uncharacterized protein LOC103491699 [Cucumis melo]
Length=444

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/429 (72%), Positives = 365/429 (85%), Gaps = 3/429 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGA INL GS+ INFGTNLLKLGH+ER KHS L N G+ GK  MKPII+FQTWR+
Sbjct  1     MGEWVIGAVINLFGSLAINFGTNLLKLGHNEREKHSMLENNGSIGKTPMKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI FF +GN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV +K VT+KVMVAT FIVL
Sbjct  61    GITFFIIGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLHKMVTVKVMVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQL EKY NITFLLYC+IL++VVA HHS+YRRGELLL+V G 
Sbjct  121   GNVFLVAFGNHQSPVYTPEQLVEKYGNITFLLYCVILIVVVALHHSIYRRGELLLSVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+ +W MLLPFSYAIVSG IGS SVLFAKSLS LLRL++S+ Y LHSWFTYS+LLLFLS
Sbjct  181   DLRSYWHMLLPFSYAIVSGAIGSCSVLFAKSLSILLRLAMSSDYQLHSWFTYSLLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGF+YF+E+QV DALRTTMF+LG+M
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFIYFKEFQVLDALRTTMFILGMM  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslv---sasslsNDVERLIMPLEDPQLKDVKSFSHVVL  1335
              VFIGISLLAPD+ +  + KD+S +   +++S +++ ERLI+  ++ + +D KSFS   L
Sbjct  301   SVFIGISLLAPDEPRDGEFKDNSSLVSGTSTSFTSEEERLIVSSKESETRDAKSFSQGFL  360

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             +K  +++ KAKAA +LSLG G+DSL AS+VLVMPMVSS++TGFRG G +++K F  R   
Sbjct  361   LKITDVVAKAKAALALSLGFGEDSLNASAVLVMPMVSSRMTGFRGTGFERSKFFSMRKPD  420

Query  1516  WRRISVDED  1542
             W RIS+DE+
Sbjct  421   WSRISLDEE  429



>ref|XP_010425383.1| PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Camelina 
sativa]
 ref|XP_010425384.1| PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Camelina 
sativa]
Length=442

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/431 (69%), Positives = 361/431 (84%), Gaps = 7/431 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER + +   N G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNERERLALQDNGG--GKMPLKPIIHFQTWRV  58

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAY V NK VT+KV+VAT FIVL
Sbjct  59    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYVVLNKMVTVKVLVATAFIVL  118

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPV+TPEQLAEKYSN+TFL+YC IL+++V  HH +YR+GE+LL++PG 
Sbjct  119   GNVFLVAFGNHQSPVFTPEQLAEKYSNVTFLVYCGILIIIVVVHHFLYRKGEVLLSMPGQ  178

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             ++  +W+MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  179   EISSYWKMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  238

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+LG+M
Sbjct  239   TAGFWMTRLNEGLSLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFILGMM  298

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsassls----NDVERLI-MPLEDPQLKDVKSFSHV  1329
             CVF+GISLLAPDD++G +TKD+S    S +S     + +RLI    ED   KD +   H 
Sbjct  299   CVFLGISLLAPDDTRGNETKDTSSSLDSIVSSSLPTEEDRLIPQSSEDGHSKDTRVVVHG  358

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRS  1509
             + MKA +LI K K AC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R 
Sbjct  359   MYMKAADLIAKTKTACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRG  418

Query  1510  QGWRRISVDED  1542
              GW +++++E+
Sbjct  419   SGWSKLAMEEE  429



>ref|XP_009593046.1| PREDICTED: probable magnesium transporter NIPA8 isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009593047.1| PREDICTED: probable magnesium transporter NIPA8 isoform X3 [Nicotiana 
tomentosiformis]
Length=414

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/391 (79%), Positives = 343/391 (88%), Gaps = 5/391 (1%)
 Frame = +1

Query  409   MKPIIHFQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVT  588
             MKPII+FQTWR+GI+FFA+GN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NKTVT
Sbjct  1     MKPIIYFQTWRVGIVFFAIGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKTVT  60

Query  589   IKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVY  768
             IKV+VAT FIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY L LVLVVA HHS+Y
Sbjct  61    IKVLVATAFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYSLTLVLVVALHHSIY  120

Query  769   RRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHS  948
             +RGELLL VP N+ KP W+MLLPFSYA+VSG +GS SVLFAKSLSN+LRLS+S+ Y LHS
Sbjct  121   KRGELLLAVPMNENKPCWRMLLPFSYAVVSGAVGSCSVLFAKSLSNMLRLSMSSGYSLHS  180

Query  949   WFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD  1128
             WFTYSMLLLFLSTAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD
Sbjct  181   WFTYSMLLLFLSTAGFWMARLNEGLSFFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD  240

Query  1129  ALRTTMFVLGVMCVFIGISLLAPDDSKGTQTKD-sslvsasslsNDVERLIMPLEDPQLK  1305
             ALRTTMF+LG++ VF+GISLLAPD+SKG + KD S + + S+LS D ERL M  ED Q+K
Sbjct  241   ALRTTMFILGMISVFVGISLLAPDESKGGEVKDGSLVSTTSNLSQDEERLFMQSEDSQIK  300

Query  1306  DVKSFSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQ  1485
             D++SF  V+LMK  N+IVKAKAACS+SLG G DSL ASSVLVMPMVSSKITGFRG G+D+
Sbjct  301   DIRSFGRVMLMKTANMIVKAKAACSVSLGFGGDSLHASSVLVMPMVSSKITGFRGGGLDR  360

Query  1486  AKLFPGRSQGWRRISVDED----CETSAMLP  1566
             AKL   R  GW + +VDED     ET+AMLP
Sbjct  361   AKLLSARGPGWSKFAVDEDGETILETTAMLP  391



>ref|XP_009781330.1| PREDICTED: probable magnesium transporter NIPA8 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009781331.1| PREDICTED: probable magnesium transporter NIPA8 isoform X3 [Nicotiana 
sylvestris]
Length=414

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/391 (79%), Positives = 342/391 (87%), Gaps = 5/391 (1%)
 Frame = +1

Query  409   MKPIIHFQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVT  588
             MKPII+FQTWR+GI+FFA+GN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NKTVT
Sbjct  1     MKPIIYFQTWRVGIVFFAIGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKTVT  60

Query  589   IKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVY  768
             IKV+VAT FIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY L LVLVVA HHS+Y
Sbjct  61    IKVLVATAFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYSLTLVLVVALHHSIY  120

Query  769   RRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHS  948
             +RGELLL VP N+ KP W+MLLPFSYA+VSG +GS SVLFAKSLSN+LRLS+S+ Y LHS
Sbjct  121   KRGELLLAVPMNENKPCWRMLLPFSYAVVSGAVGSCSVLFAKSLSNMLRLSMSSGYSLHS  180

Query  949   WFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD  1128
             WFTYSMLLLFLSTAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD
Sbjct  181   WFTYSMLLLFLSTAGFWMARLNEGLSFFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD  240

Query  1129  ALRTTMFVLGVMCVFIGISLLAPDDSKGTQTKD-sslvsasslsNDVERLIMPLEDPQLK  1305
             ALRTTMF+LG++ VF+GISLLAPD+SKG + KD S +   S+ S D ERL M  ED Q+K
Sbjct  241   ALRTTMFILGMISVFVGISLLAPDESKGGELKDGSLVSKTSNSSQDEERLFMQSEDSQIK  300

Query  1306  DVKSFSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQ  1485
             D++SF  V+LMK  N+IVKAKAACS+SLG G+DSL ASSVLVMPMVSSKITGFRG G+D+
Sbjct  301   DIRSFGRVMLMKTANMIVKAKAACSVSLGFGEDSLHASSVLVMPMVSSKITGFRGGGLDR  360

Query  1486  AKLFPGRSQGWRRISVDED----CETSAMLP  1566
             AKL   R  GW + +VDED     ET+AMLP
Sbjct  361   AKLLSARGPGWSKFAVDEDGETILETTAMLP  391



>ref|XP_010502603.1| PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Camelina 
sativa]
Length=443

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/431 (70%), Positives = 363/431 (84%), Gaps = 6/431 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER +  AL + G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNER-ERLALQDNGGGGKMPLKPIIHFQTWRV  59

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAY V NK VT+KV+VAT FIVL
Sbjct  60    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYVVLNKMVTVKVLVATAFIVL  119

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPV+TPEQLAEKYSN+TFL+YC IL+++V  HH +YR+GE+L+++PG 
Sbjct  120   GNVFLVAFGNHQSPVFTPEQLAEKYSNVTFLVYCGILIIIVVVHHFLYRKGEVLISMPGQ  179

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             ++  +W+MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  180   EISSYWKMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+LG+M
Sbjct  240   TAGFWMTRLNEGLSLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFILGMM  299

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDV---ERLIMPL--EDPQLKDVKSFSHV  1329
             CVF+GISLLAPDD++G +TKDSS    S +S+ +   E  +MP   ED   KD +   H 
Sbjct  300   CVFLGISLLAPDDTRGNETKDSSSSLDSIVSSSLPTEEDRLMPQSSEDGHSKDTRVVVHG  359

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRS  1509
             + MKA +LI K K AC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R 
Sbjct  360   LYMKAADLIAKTKTACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRG  419

Query  1510  QGWRRISVDED  1542
              GW +++++E+
Sbjct  420   SGWSKLAMEEE  430



>emb|CDX83636.1| BnaC07g23760D [Brassica napus]
Length=446

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/442 (68%), Positives = 364/442 (82%), Gaps = 9/442 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER + +    +G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNERERLAL--QDGGGGKTPLKPIIHFQTWRV  58

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAY V NK VT+KV+VAT FIVL
Sbjct  59    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYVVLNKMVTVKVLVATAFIVL  118

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPV+TPEQLAEKYSN+TFL+YC IL+L+VA +H +YR+GE+LL+ PG 
Sbjct  119   GNVFLVAFGNHQSPVFTPEQLAEKYSNVTFLVYCGILILIVAVNHFLYRKGEVLLSTPGQ  178

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             ++  +W+MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  179   EISSYWKMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  238

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+ G++
Sbjct  239   TAGFWMTRLNEGLSLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFISGML  298

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDV----ERLI-MPLEDPQLKDVKSFSHV  1329
             CVFIGISLLAPDD++G ++KD++    S +S+DV    +RLI    ED   KD +     
Sbjct  299   CVFIGISLLAPDDTRGNESKDNTSSLDSIVSSDVPSEEDRLISQSSEDGHSKDTRVVVQG  358

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRS  1509
             + MKA +L  K K AC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R 
Sbjct  359   MYMKATDLFAKTKTACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRG  418

Query  1510  QGWRRISVDEDCETSAMLPPQS  1575
              GW +++++E  E + ML   S
Sbjct  419   SGWSKLAMEE--EGTRMLEKTS  438



>ref|XP_006395536.1| hypothetical protein EUTSA_v10004224mg [Eutrema salsugineum]
 gb|ESQ32822.1| hypothetical protein EUTSA_v10004224mg [Eutrema salsugineum]
Length=444

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/442 (68%), Positives = 366/442 (83%), Gaps = 9/442 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER + +    +G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNERERLAL--QDGGGGKTPLKPIIHFQTWRV  58

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAY V NK VT+KV+VAT FIVL
Sbjct  59    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYVVLNKMVTVKVLVATAFIVL  118

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPV+TP+QLAEKYSN+TFL+YC IL+L+VA +H +YR+GE+L++VPG 
Sbjct  119   GNVFLVAFGNHQSPVFTPDQLAEKYSNVTFLIYCGILILIVAVNHFLYRKGEVLISVPGQ  178

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             ++  +W+MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  179   EISSYWKMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  238

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+LG+M
Sbjct  239   TAGFWMTRLNEGLSLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFILGMM  298

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDV----ERLI-MPLEDPQLKDVKSFSHV  1329
             CVFIGISLLAPDD++G +TK++S    S +S+ V    +RLI    ED   KD +     
Sbjct  299   CVFIGISLLAPDDTRGNETKENSSSLDSIVSSSVPTEEDRLISQSSEDGHSKDTRVVVQG  358

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRS  1509
             + MKA +LI K K AC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R 
Sbjct  359   MYMKAADLIAKTKIACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRG  418

Query  1510  QGWRRISVDEDCETSAMLPPQS  1575
              GW +++++E  E + ML   S
Sbjct  419   SGWSKLAMEE--EGTRMLEKTS  438



>emb|CDY48980.1| BnaA02g28160D [Brassica napus]
Length=444

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/440 (69%), Positives = 366/440 (83%), Gaps = 6/440 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER +  AL + G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNER-ERLALQDNGGGGKTPLKPIIHFQTWRV  59

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAY V NK VT+KV+VAT FIVL
Sbjct  60    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYVVLNKMVTVKVLVATAFIVL  119

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGE-LLLNVPG  801
             GN+FLVAFGNHQSPV+TPEQLAEKYSN+TFL+YC IL+++VA +H +YR+GE LL++VPG
Sbjct  120   GNVFLVAFGNHQSPVFTPEQLAEKYSNVTFLVYCGILIIIVAVNHFLYRKGEVLLISVPG  179

Query  802   NDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFL  981
              ++  +W++LLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFL
Sbjct  180   QEISSYWKLLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFL  239

Query  982   STAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGV  1161
             STAGFWM RLNEGL  +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+LG+
Sbjct  240   STAGFWMTRLNEGLFLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFILGM  299

Query  1162  MCVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLI-MPLEDPQLKDVKSFSHVVLM  1338
             MCVFIGISLLAPDD++G +TKD++    S +S++ +RLI    ED   KD +     + M
Sbjct  300   MCVFIGISLLAPDDTRGNETKDNTSSLDSIVSSEEDRLIPQSFEDGHSKDTRVAVQGMYM  359

Query  1339  KAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGR-SQG  1515
             KA +LI K KAAC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R   G
Sbjct  360   KAADLIAKTKAACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRGGSG  419

Query  1516  WRRISVDEDCETSAMLPPQS  1575
             W ++++ E  E + ML   S
Sbjct  420   WSKLAMQE--EGTRMLEKTS  437



>ref|XP_009129492.1| PREDICTED: NIPA-like protein 2 [Brassica rapa]
Length=443

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/440 (69%), Positives = 366/440 (83%), Gaps = 7/440 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER +  AL + G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNER-ERLALQDSG-GGKTTLKPIIHFQTWRV  58

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAY V NK VT+KV+VAT FIVL
Sbjct  59    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYVVLNKMVTVKVLVATAFIVL  118

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGE-LLLNVPG  801
             GN+FLVAFGNHQSPV+TPEQLAEKYSN+TFL+YC IL+++VA +H +YR+GE LL++VPG
Sbjct  119   GNVFLVAFGNHQSPVFTPEQLAEKYSNVTFLVYCGILIIIVAVNHFLYRKGEVLLISVPG  178

Query  802   NDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFL  981
              D+  +W++LLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFL
Sbjct  179   QDISSYWKLLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFL  238

Query  982   STAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGV  1161
             STAGFWM RLNEGL  +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+LG+
Sbjct  239   STAGFWMTRLNEGLFLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFILGM  298

Query  1162  MCVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLI-MPLEDPQLKDVKSFSHVVLM  1338
             MCVFIGISLLAPDD++G +TKD++    S +S++ +RLI    ED   KD +     + M
Sbjct  299   MCVFIGISLLAPDDTRGNETKDNTSSLDSIVSSEEDRLIPQSFEDGHSKDTRVAVQGMYM  358

Query  1339  KAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGR-SQG  1515
             KA +LI K KAAC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R   G
Sbjct  359   KAADLIAKTKAACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRGGSG  418

Query  1516  WRRISVDEDCETSAMLPPQS  1575
             W ++++ E  E + ML   S
Sbjct  419   WSKLAMQE--EGTRMLEKTS  436



>ref|XP_009152036.1| PREDICTED: NIPA-like protein 2 [Brassica rapa]
 ref|XP_009152037.1| PREDICTED: NIPA-like protein 2 [Brassica rapa]
Length=446

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/442 (68%), Positives = 364/442 (82%), Gaps = 9/442 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER + +    +G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNERERLAL--QDGGGGKTPLKPIIHFQTWRV  58

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAY V NK VT+KV+VAT FIVL
Sbjct  59    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYVVLNKMVTVKVLVATAFIVL  118

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPV+TPEQLAEKYSN TFL+YC IL+L+VA +H +YR+GE+LL+ PG 
Sbjct  119   GNVFLVAFGNHQSPVFTPEQLAEKYSNATFLVYCGILILIVAVNHFLYRKGEVLLSTPGQ  178

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             ++  +W+MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  179   EISSYWKMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  238

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+ G++
Sbjct  239   TAGFWMTRLNEGLSLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFISGML  298

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDV----ERLI-MPLEDPQLKDVKSFSHV  1329
             CVFIGISLLAPDD++G ++KD++    S +S+DV    +RLI    ED   KD +     
Sbjct  299   CVFIGISLLAPDDTRGNESKDNTSSLDSIVSSDVPSEEDRLISQSSEDGHSKDTRVVVQG  358

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRS  1509
             + MKA +L  K K+AC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R 
Sbjct  359   MYMKATDLFAKTKSACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRG  418

Query  1510  QGWRRISVDEDCETSAMLPPQS  1575
              GW +++++E  E + ML   S
Sbjct  419   SGWSKLAMEE--EGTRMLEKTS  438



>emb|CDY13650.1| BnaA06g32730D [Brassica napus]
Length=445

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/442 (68%), Positives = 363/442 (82%), Gaps = 9/442 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER + +    +G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNERERLAL--QDGGGGKTPLKPIIHFQTWRV  58

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAY V NK VT+KV+VAT FIVL
Sbjct  59    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYVVLNKMVTVKVLVATAFIVL  118

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPV+TPEQLAEKYSN TFL+YC IL+L+VA +H +YR+GE+LL+ PG 
Sbjct  119   GNVFLVAFGNHQSPVFTPEQLAEKYSNATFLVYCGILILIVAVNHFLYRKGEVLLSTPGQ  178

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             ++  +W+MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  179   EISSYWKMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  238

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+ G++
Sbjct  239   TAGFWMTRLNEGLSLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFISGML  298

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDV----ERLI-MPLEDPQLKDVKSFSHV  1329
             CVFIGISLLAPDD++G ++KD++    S +S+DV    +RLI    ED   KD +     
Sbjct  299   CVFIGISLLAPDDTRGNESKDNTSSLDSIVSSDVPSEEDRLISQSSEDGHSKDTRVVVQG  358

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRS  1509
             + MKA +L  K K AC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R 
Sbjct  359   MYMKATDLFAKTKTACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRG  418

Query  1510  QGWRRISVDEDCETSAMLPPQS  1575
              GW +++++E  E + ML   S
Sbjct  419   SGWSKLAMEE--EGTRMLEKTS  438



>ref|NP_189301.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_850634.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974367.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8RWF4.1|NIPA8_ARATH RecName: Full=Probable magnesium transporter NIPA8 [Arabidopsis 
thaliana]
 gb|AAM13128.1| unknown protein [Arabidopsis thaliana]
 gb|AAP31931.1| At3g26670 [Arabidopsis thaliana]
 dbj|BAE98977.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77193.1| uncharacterized protein AT3G26670 [Arabidopsis thaliana]
 gb|AEE77194.1| uncharacterized protein AT3G26670 [Arabidopsis thaliana]
 gb|AEE77195.1| uncharacterized protein AT3G26670 [Arabidopsis thaliana]
Length=441

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/431 (70%), Positives = 360/431 (84%), Gaps = 8/431 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER +  AL + G  GK  +KPIIH QTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNER-ERLALQDGG--GKMPLKPIIHNQTWRV  57

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAY V NK VT+KV+VAT FIVL
Sbjct  58    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYVVLNKMVTVKVLVATAFIVL  117

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPV+TPEQLAEKYSN+TFL+YC IL+L+VA HH +YR+GE+L++ PG 
Sbjct  118   GNVFLVAFGNHQSPVFTPEQLAEKYSNVTFLVYCGILILIVAVHHFLYRKGEVLISTPGQ  177

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             ++  +W+MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  178   EISSYWKMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  237

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS +DAILIVPMFQIAWTFFSICTG +YFQE+QVFDALRTTMF+LG+M
Sbjct  238   TAGFWMTRLNEGLSLYDAILIVPMFQIAWTFFSICTGCIYFQEFQVFDALRTTMFILGMM  297

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDV----ERLI-MPLEDPQLKDVKSFSHV  1329
             CVFIGISLLAPDD++G +TKD+S    S +S+ V    +RLI    ED   KD +     
Sbjct  298   CVFIGISLLAPDDTRGNETKDNSSSLDSIVSSSVPTEEDRLIPQSSEDGHSKDTRVVVQG  357

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRS  1509
             + MKA +LI K K AC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R 
Sbjct  358   MYMKAADLIAKTKTACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRG  417

Query  1510  QGWRRISVDED  1542
              GW +++++E+
Sbjct  418   SGWSKLAMEEE  428



>ref|XP_010929508.1| PREDICTED: probable magnesium transporter NIPA8 [Elaeis guineensis]
Length=444

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/425 (72%), Positives = 352/425 (83%), Gaps = 2/425 (0%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGA IN++GSI INFGTNLLKLGHD+R K S LG +G NGK  +KPII+FQTWR+
Sbjct  1     MGEWVIGALINIVGSIAINFGTNLLKLGHDQREKLSTLGGDGANGKFILKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFALGN LNFISF +AAQSLLAALGSIQF+SNIAFAYFV +KTV++KVMVAT FIV 
Sbjct  61    GILFFALGNCLNFISFAYAAQSLLAALGSIQFISNIAFAYFVLSKTVSVKVMVATAFIVF  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQL  KYSN+ FLLYCL+LVLVVA +H +YRRGE  L + G 
Sbjct  121   GNIFLVSFGNHQSPVYTPEQLIAKYSNLVFLLYCLMLVLVVAGNHYIYRRGEAYLALSGK  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D  P+W+ LLPFSYA VSG +GS SVLFAKSLSN+LRL+I ++Y LHSWFTYSMLLLF S
Sbjct  181   DFSPYWRTLLPFSYATVSGAVGSCSVLFAKSLSNMLRLTIGSNYQLHSWFTYSMLLLFFS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPM QIAWTFFSICTGFVYFQEYQVFD LR TMF+LG+ 
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMLQIAWTFFSICTGFVYFQEYQVFDTLRITMFLLGMT  300

Query  1165  CVFIGISLLAPDDSKGTQTKDssl-vsasslsNDVERLI-MPLEDPQLKDVKSFSHVVLM  1338
              VF+GISLLAPDD KG+  KDSSL  S +    D+ R + +P E+ ++ DV SF +V+  
Sbjct  301   FVFVGISLLAPDDVKGSDAKDSSLPSSTAQGVADINRFVKLPSEEAEINDVTSFMNVMRT  360

Query  1339  KAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGW  1518
             KA ++IVKAKAACSLSLGLG++S+ ASSVLVMPMVSS+ TGFRG   ++AK  P RS  W
Sbjct  361   KANSIIVKAKAACSLSLGLGEESISASSVLVMPMVSSRTTGFRGTVFERAKFIPVRSSSW  420

Query  1519  RRISV  1533
                S+
Sbjct  421   SYPSI  425



>ref|XP_010514324.1| PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Camelina 
sativa]
 ref|XP_010514325.1| PREDICTED: probable magnesium transporter NIPA8 isoform X2 [Camelina 
sativa]
Length=440

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/431 (69%), Positives = 361/431 (84%), Gaps = 9/431 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER + +   N G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNERERLALQDNGG--GKMPLKPIIHFQTWRV  58

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAY V NK VT+KV+VAT FIVL
Sbjct  59    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYVVLNKMVTVKVLVATAFIVL  118

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPV+TPEQLAEKYSN+TFL+YC IL+++V  HH +YR+GE+L+++PG 
Sbjct  119   GNVFLVAFGNHQSPVFTPEQLAEKYSNVTFLVYCGILIIIVVVHHFLYRKGEVLISMPGQ  178

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             ++  +W+MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  179   EISSYWKMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  238

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+LG+M
Sbjct  239   TAGFWMTRLNEGLSLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFILGMM  298

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsassls----NDVERLI-MPLEDPQLKDVKSFSHV  1329
             CVF+GISLLAPDD++G +TKDSS    S +S     + +RLI    ED   KD +   H 
Sbjct  299   CVFLGISLLAPDDTRGNETKDSSSSLDSIVSSSLPTEEDRLIPQSSEDGHSKDTR--VHG  356

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRS  1509
             + MKA +LI K K AC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R 
Sbjct  357   MYMKAADLIAKTKTACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRG  416

Query  1510  QGWRRISVDED  1542
              GW +++++E+
Sbjct  417   SGWSKLAMEEE  427



>ref|XP_010660769.1| PREDICTED: uncharacterized protein LOC100244618 [Vitis vinifera]
Length=1141

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/429 (73%), Positives = 362/429 (84%), Gaps = 3/429 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWV+GA IN+ GSI INFGTNLLKLGH+ER +   L N G NGK   KPII+FQTWR+
Sbjct  1     MGEWVVGAIINVFGSIAINFGTNLLKLGHNERGRSLLLDNNGANGKLVPKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G++FF+LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NK V++KV+VAT FIVL
Sbjct  61    GLLFFSLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKMVSVKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPV+TPEQLAEK+SN TFL+YCLIL+LVVA +H +YRRGE+   + G 
Sbjct  121   GNIFLVAFGNHQSPVFTPEQLAEKFSNATFLVYCLILILVVALNHYIYRRGEMQFAISGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYA VSG +GS SVLFAKSLSNLLRL++S+ Y LHSWFTYSMLL FLS
Sbjct  181   DLEPYWHMLLPFSYATVSGAVGSCSVLFAKSLSNLLRLAMSSGYQLHSWFTYSMLLCFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LRTTMF+LG+M
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRTTMFILGMM  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsN---DVERLIMPLEDPQLKDVKSFSHVVL  1335
              VFIGISLLAPD+ KG +TKD+S +++ + S+   D +RLI P ED Q +D +S    +L
Sbjct  301   SVFIGISLLAPDEPKGGETKDNSTLASITSSSTPTDTDRLITPSEDAQTQDPRSRMQAML  360

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             MKA   IVKAKAACSLSLG G+DS+ AS+ LVMPMVSSKITGFRG+  D  +LF  ++ G
Sbjct  361   MKATEAIVKAKAACSLSLGFGEDSINASAGLVMPMVSSKITGFRGSSPDGGRLFSLKNPG  420

Query  1516  WRRISVDED  1542
             W +IS+DED
Sbjct  421   WTKISMDED  429



>emb|CDY28535.1| BnaC02g36250D [Brassica napus]
Length=444

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/440 (69%), Positives = 364/440 (83%), Gaps = 6/440 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGA IN+ GS+ INFGTNLLKLGH+ER + +   N G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGALINIFGSVAINFGTNLLKLGHNERERLALQDNSG-GGKTPLKPIIHFQTWRV  59

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAY V NK VT+KV+VAT FIVL
Sbjct  60    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYVVLNKMVTVKVLVATAFIVL  119

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGE-LLLNVPG  801
             GN+FLVAFGNHQSPV+TPEQLAEKYSN+TFL+YC IL+++VA +H + R+GE LL++VPG
Sbjct  120   GNVFLVAFGNHQSPVFTPEQLAEKYSNLTFLVYCGILIIIVAVNHFLCRKGEVLLISVPG  179

Query  802   NDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFL  981
              ++  +W++LLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFL
Sbjct  180   QEISSYWKLLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFL  239

Query  982   STAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGV  1161
             STAGFWM RLNEGL  +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+LG+
Sbjct  240   STAGFWMTRLNEGLFLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFILGM  299

Query  1162  MCVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLI-MPLEDPQLKDVKSFSHVVLM  1338
             MCVFIGISLLAPDD++G +TKDS+L   S +S++ +RLI    ED   KD +     + M
Sbjct  300   MCVFIGISLLAPDDTRGNETKDSTLSLDSIVSSEEDRLIPQSFEDGHSKDTRVAVQGMYM  359

Query  1339  KAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGR-SQG  1515
             KA +LI K KAAC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R   G
Sbjct  360   KAADLISKTKAACLTALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRGGSG  419

Query  1516  WRRISVDEDCETSAMLPPQS  1575
             W ++++ E  E + ML   S
Sbjct  420   WSKLAMQE--EGTRMLEKTS  437



>ref|XP_008798362.1| PREDICTED: uncharacterized protein LOC103713272 [Phoenix dactylifera]
 ref|XP_008798363.1| PREDICTED: uncharacterized protein LOC103713272 [Phoenix dactylifera]
Length=447

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/425 (71%), Positives = 349/425 (82%), Gaps = 2/425 (0%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGA IN++GSI INFGTNLLKLGHD+R K S LG +G NGK  +KPII+FQTWR+
Sbjct  1     MGEWVIGALINIVGSIAINFGTNLLKLGHDQREKLSTLGGDGPNGKLILKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFALGN LNFISF +AAQSLLAALGSIQF+SNIAFAYFV +KTV++KVMVAT FIV 
Sbjct  61    GILFFALGNCLNFISFAYAAQSLLAALGSIQFISNIAFAYFVLSKTVSVKVMVATAFIVS  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLV+FGNHQSPVYTPEQL  KYSN+ FLLYCL LVLVVA +  +YRRGE  L + G 
Sbjct  121   GNVFLVSFGNHQSPVYTPEQLIAKYSNLVFLLYCLTLVLVVAANQYIYRRGEADLALSGE  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D  P+W+ LLPFSYA VSG +GS SVLFAKSLSN+LRL+I ++Y LHSWFTYSMLLLF S
Sbjct  181   DFSPYWRTLLPFSYATVSGAVGSCSVLFAKSLSNMLRLTIGSNYQLHSWFTYSMLLLFFS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVF  LR TMF+LG+ 
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFGTLRITMFLLGMT  300

Query  1165  CVFIGISLLAPDDSKGTQTKDssl-vsasslsNDVERLI-MPLEDPQLKDVKSFSHVVLM  1338
              VFIGISLLAPDD+KG+  KDS L  S +    D+ R   +P E+ ++ DV SF +V+  
Sbjct  301   FVFIGISLLAPDDAKGSDAKDSLLPSSTAQGVTDINRFAKLPSEETEINDVTSFMNVMRT  360

Query  1339  KAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGW  1518
             KA +++VKAKAACSLSLGLG+ S+ ASSVLVMPMVSS+ TGFRG  +++AK  P RS  W
Sbjct  361   KANSILVKAKAACSLSLGLGEQSMSASSVLVMPMVSSRTTGFRGTILERAKFIPVRSSSW  420

Query  1519  RRISV  1533
                S+
Sbjct  421   SYPSI  425



>ref|XP_010528114.1| PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010528115.1| PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Tarenaya 
hassleriana]
Length=428

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/428 (71%), Positives = 360/428 (84%), Gaps = 5/428 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER K +   N G  GK  +KPII+FQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNEREKQAMQENSG--GKTPLKPIIYFQTWRV  58

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV  K VT+KV+VAT FIV+
Sbjct  59    GILFFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLKKMVTVKVLVATAFIVI  118

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPV+TPEQLAEKYSNI+FL+YCLIL+L+VAF+H +YR+GELLL+VPG 
Sbjct  119   GNVFLVAFGNHQSPVFTPEQLAEKYSNISFLIYCLILILIVAFNHFIYRKGELLLSVPGQ  178

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
              L P+W MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY L+SWFTYSMLLLFLS
Sbjct  179   QLTPYWHMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYELNSWFTYSMLLLFLS  238

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+ G+M
Sbjct  239   TAGFWMTRLNEGLSLFDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFISGMM  298

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKD-VKSFSHVVLMK  1341
             CVFIGISLLAPDD++G + KD+  + +   + + +RLI P ED   KD  +     + MK
Sbjct  299   CVFIGISLLAPDDTRGIEAKDNPTLVSVVSTEE-DRLIPPSEDGHSKDSTRQVVQGMYMK  357

Query  1342  AVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGR-SQGW  1518
                LI KAK AC +SLG G++S+ AS++LVMPMVSSKITGFRGNG+++AK+   R   GW
Sbjct  358   VSGLIAKAKTACLVSLGFGEESINASAILVMPMVSSKITGFRGNGLERAKVLSMRGGSGW  417

Query  1519  RRISVDED  1542
              ++++DE 
Sbjct  418   NKVAMDEQ  425



>ref|XP_010528116.1| PREDICTED: probable magnesium transporter NIPA8 isoform X2 [Tarenaya 
hassleriana]
Length=424

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/428 (70%), Positives = 359/428 (84%), Gaps = 9/428 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+E ++      E + GK  +KPII+FQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNEAMQ------ENSGGKTPLKPIIYFQTWRV  54

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV  K VT+KV+VAT FIV+
Sbjct  55    GILFFLLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLKKMVTVKVLVATAFIVI  114

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPV+TPEQLAEKYSNI+FL+YCLIL+L+VAF+H +YR+GELLL+VPG 
Sbjct  115   GNVFLVAFGNHQSPVFTPEQLAEKYSNISFLIYCLILILIVAFNHFIYRKGELLLSVPGQ  174

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
              L P+W MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY L+SWFTYSMLLLFLS
Sbjct  175   QLTPYWHMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYELNSWFTYSMLLLFLS  234

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+ G+M
Sbjct  235   TAGFWMTRLNEGLSLFDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFISGMM  294

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKD-VKSFSHVVLMK  1341
             CVFIGISLLAPDD++G + KD+  + +   + + +RLI P ED   KD  +     + MK
Sbjct  295   CVFIGISLLAPDDTRGIEAKDNPTLVSVVSTEE-DRLIPPSEDGHSKDSTRQVVQGMYMK  353

Query  1342  AVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGR-SQGW  1518
                LI KAK AC +SLG G++S+ AS++LVMPMVSSKITGFRGNG+++AK+   R   GW
Sbjct  354   VSGLIAKAKTACLVSLGFGEESINASAILVMPMVSSKITGFRGNGLERAKVLSMRGGSGW  413

Query  1519  RRISVDED  1542
              ++++DE 
Sbjct  414   NKVAMDEQ  421



>ref|XP_006469116.1| PREDICTED: uncharacterized protein LOC102612526 [Citrus sinensis]
Length=1508

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/444 (72%), Positives = 373/444 (84%), Gaps = 10/444 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFINL+GSI INFGTNLLKLGH ER KHS L ++GTNGK ++KPI+H+ +WR+
Sbjct  1     MGEWVIGAFINLVGSIAINFGTNLLKLGHIEREKHSTLDSDGTNGKHSLKPIVHYHSWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGS+QFVSNIAF+YFVFNK VT+KV+VAT FIVL
Sbjct  61    GILVFLLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFSYFVFNKMVTVKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQLAEKYSNITFL+YCLIL+ +VA +H +YR+GE LL V G 
Sbjct  121   GNIFLVSFGNHQSPVYTPEQLAEKYSNITFLVYCLILIFIVAIYHYIYRKGENLLAVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D + +W+MLLPFSYAIVSG +GSFSVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLF S
Sbjct  181   DNR-YWRMLLPFSYAIVSGAVGSFSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFFS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWT FSICTGFVYFQEYQVFDALR  MF+LG  
Sbjct  240   TAGFWMARLNEGLSLFDAILIVPMFQIAWTSFSICTGFVYFQEYQVFDALRAMMFILGTA  299

Query  1165  CVFIGISLLAPDDSKGTQTKDs---slvsasslsNDVERLIMPLEDPQLKDVKSFSHVVL  1335
              VFIGISLLAPD+SKG + KD      V +SS+S +V+RLI+P ED Q K+ + F   + 
Sbjct  300   SVFIGISLLAPDESKGGEVKDDSSLVSVMSSSISTEVDRLILPSEDAQSKEPRPFVQGMS  359

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
             MK  +++ KAK ACS+SLGLG+DS+ AS+VLVMPMVSSKI GFRGN +D+AKLF  ++ G
Sbjct  360   MKISDMMAKAKTACSMSLGLGEDSINASAVLVMPMVSSKINGFRGNRLDRAKLFNVKNSG  419

Query  1516  --WRRISVDED----CETSAMLPP  1569
               W  IS+DE+     ETSA LPP
Sbjct  420   SDWSGISIDEEGAKLLETSAGLPP  443



>gb|ACU23269.1| unknown [Glycine max]
Length=394

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/395 (74%), Positives = 339/395 (86%), Gaps = 5/395 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEW++GAFINL GSI INFGTNLLKLGH+ER +H  LG++G NGK  +KPII+FQ+WRI
Sbjct  1     MGEWIVGAFINLFGSIAINFGTNLLKLGHNERERH-LLGSDGVNGKMNLKPIIYFQSWRI  59

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF LGN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV NK VT+KV+VAT FIVL
Sbjct  60    GIVFFFLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLNKMVTVKVLVATAFIVL  119

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQL EKY+NI FLLY L L+ +VA HHS+Y+RGELL  V G+
Sbjct  120   GNVFLVAFGNHQSPVYTPEQLTEKYTNIAFLLYLLALISIVALHHSIYKRGELLFAVSGH  179

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYA+VSG +GS SVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLFLS
Sbjct  180   DLRPYWSMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFLS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQI WTFFSICTGF+YFQEYQVFDALRTTMF+LG+M
Sbjct  240   TAGFWMTRLNEGLSLFDAILIVPMFQITWTFFSICTGFIYFQEYQVFDALRTTMFILGMM  299

Query  1165  CVFIGISLLAPDDSK--GTQTKDsslvsasslsNDVE--RLIMPLEDPQLKDVKSFSHVV  1332
             CVFIGISLLAPD+SK  G +TKDSSL S  S +   E  RL++  E+ Q KD +SF   +
Sbjct  300   CVFIGISLLAPDESKVSGPETKDSSLDSMVSSAMSTETSRLVVSPEEAQNKDSRSFVKAI  359

Query  1333  LMKAVNLIVKAKAACslslglgddslQASSVLVMP  1437
             L+K  +L+VKAK +C+LSLG G+D++  SSVLVMP
Sbjct  360   LIKVTDLLVKAKTSCALSLGFGEDTINTSSVLVMP  394



>gb|KHN00641.1| NIPA-like protein 3 [Glycine soja]
Length=458

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/469 (64%), Positives = 362/469 (77%), Gaps = 45/469 (10%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEW++GAFINL GSI INFGTNLLKLGH+E I    +  +  NG            +  
Sbjct  1     MGEWIVGAFINLFGSIAINFGTNLLKLGHNE-ISADMVNLDFING----------SMYCF  49

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
              I+FF LGN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV NK VT+KV+VAT FIVL
Sbjct  50    CIVFFFLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLNKMVTVKVLVATAFIVL  109

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQL EKY+NI+FLLY L LV +VA HHS+Y+RGELLL V G+
Sbjct  110   GNVFLVAFGNHQSPVYTPEQLTEKYTNISFLLYLLALVSIVALHHSIYKRGELLLGVSGH  169

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYA+VSG +GS SVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLFLS
Sbjct  170   DLRPYWSMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRLALSNGYQLHSWFTYSMLLLFLS  229

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQ---------------  1119
             TAGFWM RLNEGLS FDAILIVPMFQIAWT FSICTGF+YFQEYQ               
Sbjct  230   TAGFWMTRLNEGLSLFDAILIVPMFQIAWTLFSICTGFIYFQEYQDSELPGYFMLQNRLL  289

Query  1120  ------------VFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQTKDss--lvsassls  1257
                         VFDALRTTMF+LG+MCVFIGISLLAPD+SKG +TKDSS   + +S++S
Sbjct  290   VKNLTMDFRCAEVFDALRTTMFMLGMMCVFIGISLLAPDESKGPETKDSSLDSMVSSAIS  349

Query  1258  NDVERLIMPLEDPQLKDVKSFSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMP  1437
              +  RL++  E+ Q KD +S    +L+K  +L+VKAK  C+LSLG G+D++ ASSVLVMP
Sbjct  350   TEANRLVVSPEEAQNKDTRSLVKAILIKITDLLVKAKTTCALSLGFGEDTINASSVLVMP  409

Query  1438  MVSSKITGFRGNGVDQAKLFPGRSQGWRRISVDEDC----ETSAMLPPQ  1572
             M+SS++TGFRGNG+++A++   R+ GWR+I +DED     ETS+++PP 
Sbjct  410   MMSSRMTGFRGNGLERARILSMRN-GWRKIPMDEDAGKLLETSSVVPPS  457



>ref|XP_009403806.1| PREDICTED: magnesium transporter NIPA3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009403807.1| PREDICTED: magnesium transporter NIPA3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009403808.1| PREDICTED: magnesium transporter NIPA3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009403809.1| PREDICTED: magnesium transporter NIPA3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009403810.1| PREDICTED: magnesium transporter NIPA3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009403812.1| PREDICTED: magnesium transporter NIPA3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009403813.1| PREDICTED: magnesium transporter NIPA3-like [Musa acuminata subsp. 
malaccensis]
Length=442

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/430 (68%), Positives = 347/430 (81%), Gaps = 3/430 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN++GSI INFGTNLLKLGHD+R +HS L  +GTN K  +K IIHFQTWRI
Sbjct  1     MGEWVIGAFINIIGSIAINFGTNLLKLGHDQRERHSMLSRDGTNSKLNVKSIIHFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G++ FA GN LNF+SF +AAQSLLAALGSIQFVSNIAFAYFV +KTV++KVMVATTFIV 
Sbjct  61    GLLLFAFGNCLNFVSFAYAAQSLLAALGSIQFVSNIAFAYFVLSKTVSVKVMVATTFIVF  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPE+L  KYS++ FLLYC  L+LVV  +  +YRRGE  L V  +
Sbjct  121   GNIFLVSFGNHQSPVYTPEELIAKYSSLVFLLYCFTLLLVVIINQYIYRRGEAYLAVSNH  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D   +W  LLPFSYA VSG +GSFSVLFAKSLSN+LRL++S+ Y  HSWFTY MLLLF S
Sbjct  181   D-SLYWCTLLPFSYATVSGAVGSFSVLFAKSLSNMLRLTMSSVYQFHSWFTYCMLLLFFS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGF+YFQEYQVF+ LR TMF++G+ 
Sbjct  240   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFIYFQEYQVFNILRITMFIVGMA  299

Query  1165  CVFIGISLLAPDDSKGTQTKD-sslvsasslsNDVERLI-MPLEDPQLKDVKSFSHVVLM  1338
              VFIGISLLAPD+SKG+ TK+ S   +A SL  ++ RL  +P E+P++ DV SF+   L 
Sbjct  300   FVFIGISLLAPDESKGSDTKEPSFPSAAQSLPTNMNRLAKLPTEEPEINDVGSFAQAALS  359

Query  1339  KAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGW  1518
             KA  +++KAKAA SLSLGLG++S+ ASSVLVMPMVSS+ TGFR    D+ K  P R+  W
Sbjct  360   KAKIILLKAKAAGSLSLGLGEESISASSVLVMPMVSSRTTGFRETTFDRTKFIPLRNSRW  419

Query  1519  RRISVDEDCE  1548
                S+D++ +
Sbjct  420   SSPSIDDNSD  429



>ref|XP_002320397.2| hypothetical protein POPTR_0014s13580g [Populus trichocarpa]
 gb|EEE98712.2| hypothetical protein POPTR_0014s13580g [Populus trichocarpa]
Length=410

 Score =   533 bits (1372),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 281/403 (70%), Positives = 337/403 (84%), Gaps = 7/403 (2%)
 Frame = +1

Query  379   GNEGTNGKAAMKPIIHFQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAF  558
             G   T+GK  +KPII+FQTWR+GI+FF LGN LNFISFG+AAQSLLAALGSIQFVSNIAF
Sbjct  5     GIPRTSGKVPVKPIIYFQTWRVGILFFFLGNCLNFISFGYAAQSLLAALGSIQFVSNIAF  64

Query  559   AYFVFNKTVTIKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILV  738
             AYFV NK VT+KV+VAT FIVLGNIFLVAFGNHQSPVYTPEQLAEKYSN+TFL YCL+L+
Sbjct  65    AYFVLNKMVTVKVLVATAFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNMTFLFYCLVLI  124

Query  739   LVVAFHHSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrl  918
             L+VA HH +YRRGE++L + G DL+P+WQMLLPFSYA+VSG +GS SVLFAKSLSNLLRL
Sbjct  125   LLVALHHYIYRRGEIILAISGQDLRPYWQMLLPFSYAVVSGAVGSCSVLFAKSLSNLLRL  184

Query  919   sisnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGF  1098
             ++S+ Y LHSWFTYS+LLLFLSTAGFWM RLNEGL+ FDAILIVPMFQI WTFFSICTGF
Sbjct  185   AMSSDYQLHSWFTYSILLLFLSTAGFWMTRLNEGLALFDAILIVPMFQIVWTFFSICTGF  244

Query  1099  VYFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQTKDsslvsasslsN---DVE  1269
             VYFQEYQVFDALRTTMF+LG+  VF+GISLLAPD+S+G + KD++ +     S+   + +
Sbjct  245   VYFQEYQVFDALRTTMFILGMTSVFVGISLLAPDESRGGEVKDNASLVPVVSSSISIETD  304

Query  1270  RLIMPLEDPQLKDVKSFSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSS  1449
             RL++  ED Q KD +SF+  +++K   ++ KAK ACSLSLG G+DS+ AS+VLVMPMVSS
Sbjct  305   RLVISSEDAQNKDPRSFAQAMVIKIKEVLAKAKTACSLSLGFGEDSINASAVLVMPMVSS  364

Query  1450  KITGFRGNGVDQAKLFPGRSQGWRRISVDED----CETSAMLP  1566
             KITGFRG   D+ K F  R+ GW +IS+D+D     ET+ +LP
Sbjct  365   KITGFRGTVFDRPKFFSLRNSGWSKISMDDDGVNVLETNPVLP  407



>ref|XP_010028910.1| PREDICTED: probable magnesium transporter NIPA8 isoform X2 [Eucalyptus 
grandis]
Length=407

 Score =   529 bits (1362),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 283/404 (70%), Positives = 340/404 (84%), Gaps = 9/404 (2%)
 Frame = +1

Query  382   NEGTNGKAAMKPIIHFQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFA  561
              +G NGK  +KPIIHF TWR+GI+FF LGN LNFISFG+AAQSLLAALGS+QFVSNIAFA
Sbjct  4     TDGANGKHPLKPIIHFHTWRVGILFFFLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFA  63

Query  562   YFVFNKTVTIKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVL  741
             YFV NK VT+KV+ AT FIVLGN+FLVAFGNHQSPVYTPEQLAEKYSNITFL YCLIL+L
Sbjct  64    YFVLNKLVTVKVLAATAFIVLGNVFLVAFGNHQSPVYTPEQLAEKYSNITFLFYCLILML  123

Query  742   VVAFHHSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrls  921
             +VAFHH+VYRRGELL+ V G +L+P+W MLLPFSYAIVSG +GS SVLFAKSLSNLLRL+
Sbjct  124   IVAFHHAVYRRGELLIAVSGQELRPYWHMLLPFSYAIVSGAVGSCSVLFAKSLSNLLRLA  183

Query  922   isnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFV  1101
             +S++Y LHSWFTYSMLLLFLSTAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGFV
Sbjct  184   MSSNYQLHSWFTYSMLLLFLSTAGFWMTRLNEGLSLFDAILIVPMFQIAWTFFSICTGFV  243

Query  1102  YFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQTKD---sslvsasslsNDVER  1272
             YFQEYQVFDALRTTMF+LG+  VF+GI LLAPD+S+G + KD    + V++S +S++ +R
Sbjct  244   YFQEYQVFDALRTTMFILGMTSVFVGICLLAPDESRGGEVKDNPSLASVTSSGISSESDR  303

Query  1273  LIMPLEDPQLKDVK--SFSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVS  1446
             LI+   D   K+++  SF   V  + ++++V+AK ACS+SLG  DDS+ AS+VLVMPMVS
Sbjct  304   LIVSTGDGHGKEMRSSSFMQEVTFRIMDILVRAKNACSVSLGFTDDSINASAVLVMPMVS  363

Query  1447  SKITGFRGNGVDQAKLFPGRSQGWRRISVDED----CETSAMLP  1566
             SKITGFR  G D++K+F  ++ GW RIS+DE+     +T+ +LP
Sbjct  364   SKITGFRSTGFDRSKVFSMKNFGWNRISLDEEGAKMLDTAVVLP  407



>ref|XP_004952598.1| PREDICTED: uncharacterized protein LOC101761262 isoform X1 [Setaria 
italica]
Length=419

 Score =   526 bits (1354),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 280/421 (67%), Positives = 335/421 (80%), Gaps = 2/421 (0%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG+WVIGA IN++GS+ INFGTNLLKLGHD+R K SA+ N   N K   K ++HFQTWRI
Sbjct  1     MGDWVIGALINIVGSVAINFGTNLLKLGHDQREKLSAINNSEGNEKFVPKSVMHFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA GN LNF+SF +AAQSLLAALGSIQFVSNIAFAYFV NKT+++KVMVATTFIV 
Sbjct  61    GILFFAAGNCLNFMSFAYAAQSLLAALGSIQFVSNIAFAYFVLNKTISVKVMVATTFIVF  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV VVAF+H +YR GE +++    
Sbjct  121   GNIFLVSFGNHQSPVYTPEQLIAKYSNLVFVLYCMSLVFVVAFNHYLYRSGETIISNSSK  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D   +W+ +LPFSYA+VSG IGS SVLFAKSLSN+LRL++S+ Y  HS FTYS++LLFL 
Sbjct  181   DAGTYWRTMLPFSYAVVSGAIGSCSVLFAKSLSNMLRLTMSSRYEFHSLFTYSIVLLFLC  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR  MFVLG+ 
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRIIMFVLGMT  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKA  1344
              VF+GISLLAPDDSK   TKD S  +  S+ +      M +E+ +  D  SF   V +KA
Sbjct  301   FVFLGISLLAPDDSKAADTKDGSSATEDSVIDMDRNGKMQMEETEADDSNSFVSSVKVKA  360

Query  1345  VNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWRR  1524
               +++KAK+ACS+SLGLG++S+ ASSVL MPMVSS+ TGFRGN  D++K  P R+  W  
Sbjct  361   KRVLLKAKSACSMSLGLGEESISASSVLAMPMVSSRTTGFRGN--DRSKYVPLRTTDWSN  418

Query  1525  I  1527
             +
Sbjct  419   L  419



>ref|NP_001158915.1| hypothetical protein [Zea mays]
 gb|ACF86669.2| unknown [Zea mays]
 gb|AFW71601.1| hypothetical protein ZEAMMB73_269507 [Zea mays]
Length=420

 Score =   523 bits (1346),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 278/421 (66%), Positives = 332/421 (79%), Gaps = 1/421 (0%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG+W+IGA IN++GS+ INFGTNLLKLGHD+R K S++ N   N K   K ++HFQTWRI
Sbjct  1     MGDWIIGALINIVGSVAINFGTNLLKLGHDQREKLSSINNSEGNEKFVPKSVMHFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA GN LNF+SF +AAQSLLAALGSIQFVSNIAFAYFV NKT+++KVMVATTFIV 
Sbjct  61    GILFFAAGNCLNFMSFAYAAQSLLAALGSIQFVSNIAFAYFVLNKTISVKVMVATTFIVF  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV VVAF+H +YR GE +++    
Sbjct  121   GNIFLVSFGNHQSPVYTPEQLIAKYSNLVFVLYCMSLVFVVAFNHYLYRSGETIISNSSK  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D   +W+ +LPFSYA+VSG IGS SVLFAKSLSN+LRL++S+ Y  HSWFTYS++LLFL 
Sbjct  181   DAGTYWRTMLPFSYAVVSGAIGSCSVLFAKSLSNMLRLTMSSRYEFHSWFTYSIVLLFLC  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR  MFVLG+ 
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRIIMFVLGMT  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKA  1344
              VF+GISLLAPDDSK   TKD S  +  S+ +      MP+E+    D  SF   V + A
Sbjct  301   FVFVGISLLAPDDSKA-DTKDGSSTADDSIIDIDRNGKMPMEETDTDDSISFVTSVKVNA  359

Query  1345  VNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWRR  1524
               ++ KAK+ACS+SLGLG+ ++ ASSVL MPMVSS+ TGFRG G D+ K  P R+  W  
Sbjct  360   KRVLSKAKSACSMSLGLGESTISASSVLAMPMVSSRTTGFRGIGNDRPKYVPLRTTDWSN  419

Query  1525  I  1527
             +
Sbjct  420   L  420



>ref|XP_009421007.1| PREDICTED: NIPA-like protein 3 [Musa acuminata subsp. malaccensis]
 ref|XP_009421008.1| PREDICTED: NIPA-like protein 3 [Musa acuminata subsp. malaccensis]
 ref|XP_009421009.1| PREDICTED: NIPA-like protein 3 [Musa acuminata subsp. malaccensis]
 ref|XP_009421010.1| PREDICTED: NIPA-like protein 3 [Musa acuminata subsp. malaccensis]
Length=440

 Score =   523 bits (1348),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 297/441 (67%), Positives = 355/441 (80%), Gaps = 8/441 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEW+IGAFIN++GSI INFGTNLLKLGHD+R KH     +GTN K  +K IIHFQTWRI
Sbjct  1     MGEWIIGAFINIIGSITINFGTNLLKLGHDQREKHYMPSCDGTNSKVNVKSIIHFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F  GN LNF+SF +AAQSLLAALGSIQF+SNIAFAYFV +KTV++KVMVATTFIV 
Sbjct  61    GILLFVFGNCLNFVSFAYAAQSLLAALGSIQFISNIAFAYFVLSKTVSVKVMVATTFIVF  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPE+L  KYS++ FLLYCL L+L+V  +   YR GE  L+V  +
Sbjct  121   GNIFLVSFGNHQSPVYTPEELIAKYSSMVFLLYCLTLLLIVGVNQYFYRTGEAYLSV-SD  179

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
              +  +W+ LLPFSYA VSG +GS SVLFAKSLSN+LRL++S++Y  HSWFTY MLLLF S
Sbjct  180   PVSSYWRTLLPFSYATVSGAVGSCSVLFAKSLSNMLRLTMSSNYQFHSWFTYCMLLLFFS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSI TGFVYFQEYQVF+ LR TMFV+G+ 
Sbjct  240   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSIFTGFVYFQEYQVFNTLRITMFVVGMT  299

Query  1165  CVFIGISLLAPDDSKGTQTKDssl-vsasslsNDVER--LIMPLEDPQLKDVKSFSHVVL  1335
              VFIGISLLAPDDSKG++TKDSSL  SA  L  D+ R  +++PLEDP++ DV+S +  VL
Sbjct  300   FVFIGISLLAPDDSKGSETKDSSLPSSAQDLPTDMNRGAMLLPLEDPEISDVRSLAQAVL  359

Query  1336  MKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQG  1515
              K   +++KAKAA SLSLGLG++S+ ASSVLVMPMVSS+ TGFRG   D+AK  P R+  
Sbjct  360   TKVKFILLKAKAAGSLSLGLGEESISASSVLVMPMVSSRTTGFRGTNYDRAKFIPLRNTE  419

Query  1516  WRRISVD----EDCETSAMLP  1566
             W ++S+D    E  +T  +LP
Sbjct  420   WGKLSIDDNDPETRDTRTLLP  440



>gb|AFW71602.1| hypothetical protein ZEAMMB73_269507 [Zea mays]
Length=416

 Score =   522 bits (1345),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 279/423 (66%), Positives = 335/423 (79%), Gaps = 9/423 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG+W+IGA IN++GS+ INFGTNLLKLGHD+R K S++ N   N K   K ++HFQTWRI
Sbjct  1     MGDWIIGALINIVGSVAINFGTNLLKLGHDQREKLSSINNSEGNEKFVPKSVMHFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA GN LNF+SF +AAQSLLAALGSIQFVSNIAFAYFV NKT+++KVMVATTFIV 
Sbjct  61    GILFFAAGNCLNFMSFAYAAQSLLAALGSIQFVSNIAFAYFVLNKTISVKVMVATTFIVF  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV VVAF+H +YR GE +++    
Sbjct  121   GNIFLVSFGNHQSPVYTPEQLIAKYSNLVFVLYCMSLVFVVAFNHYLYRSGETIISNSSK  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D   +W+ +LPFSYA+VSG IGS SVLFAKSLSN+LRL++S+ Y  HSWFTYS++LLFL 
Sbjct  181   DAGTYWRTMLPFSYAVVSGAIGSCSVLFAKSLSNMLRLTMSSRYEFHSWFTYSIVLLFLC  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR  MFVLG+ 
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRIIMFVLGMT  300

Query  1165  CVFIGISLLAPDDSK-GTQTKDsslvsasslsNDVERL-IMPLEDPQLKDVKSFSHVVLM  1338
              VF+GISLLAPDDSK G+ T D S++       D++R   MP+E+    D  SF   V +
Sbjct  301   FVFVGISLLAPDDSKDGSSTADDSII-------DIDRNGKMPMEETDTDDSISFVTSVKV  353

Query  1339  KAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGW  1518
              A  ++ KAK+ACS+SLGLG+ ++ ASSVL MPMVSS+ TGFRG G D+ K  P R+  W
Sbjct  354   NAKRVLSKAKSACSMSLGLGESTISASSVLAMPMVSSRTTGFRGIGNDRPKYVPLRTTDW  413

Query  1519  RRI  1527
               +
Sbjct  414   SNL  416



>ref|XP_010235476.1| PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Brachypodium 
distachyon]
Length=430

 Score =   522 bits (1345),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 277/430 (64%), Positives = 336/430 (78%), Gaps = 9/430 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG+WVIGA IN++GS+ INFGTNLLKLGHD+R K SA  +   NGK   K +++FQTWRI
Sbjct  1     MGDWVIGALINIVGSVAINFGTNLLKLGHDQREKLSASNSNQGNGKFVPKSVMYFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA+GN LNF+SF +AAQSLLAALGSIQFVSNIAFAY V NKT+T+KVMVAT FIV 
Sbjct  61    GILFFAVGNCLNFMSFAYAAQSLLAALGSIQFVSNIAFAYVVLNKTITVKVMVATAFIVF  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV +VAF+  +YR GE +L+    
Sbjct  121   GNVFLVSFGNHQSPVYTPEQLIAKYSNLVFVLYCMSLVFIVAFNQYLYRSGETILSDNAK  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D   +W+ LLPFSYAIVSG +GS SVLFAKSLSN+LRL++S+ Y  HSWFTYS+LLLFL 
Sbjct  181   DTGTYWRTLLPFSYAIVSGAVGSCSVLFAKSLSNMLRLTMSSRYQFHSWFTYSILLLFLC  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS +DAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR  MFVLG+ 
Sbjct  241   TAGFWMARLNEGLSLYDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRIMMFVLGMT  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsN---------DVERLIMPLEDPQLKDVKS  1317
              VFIGISLLAPDD+K   TKD S V+   + +         +     + +E+ ++ D  S
Sbjct  301   FVFIGISLLAPDDNKAADTKDGSSVTRGPMIDMNSEAHVSGNCRPRKLQMEETEVDDTDS  360

Query  1318  FSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLF  1497
             FS  V +KA  ++ +AK+ACS+SLGLG++++ ASSVL MPMVSS+ TGFRG G D++K  
Sbjct  361   FSTSVKVKAKRILSRAKSACSMSLGLGEETISASSVLAMPMVSSRTTGFRGTGTDRSKYI  420

Query  1498  PGRSQGWRRI  1527
             P RS  W  +
Sbjct  421   PLRSTEWDNL  430



>ref|XP_004952599.1| PREDICTED: uncharacterized protein LOC101761262 isoform X2 [Setaria 
italica]
Length=418

 Score =   521 bits (1341),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 280/421 (67%), Positives = 335/421 (80%), Gaps = 3/421 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG+WVIGA IN++GS+ INFGTNLLKLGHD+R K SA+ N   N K   K ++HFQTWRI
Sbjct  1     MGDWVIGALINIVGSVAINFGTNLLKLGHDQREKLSAINNSEGNEKFVPKSVMHFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA GN LNF+SF +AAQSLLAALGSIQFVSNIAFAYFV NKT+++KVMVATTFIV 
Sbjct  61    GILFFAAGNCLNFMSFAYAAQSLLAALGSIQFVSNIAFAYFVLNKTISVKVMVATTFIVF  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV VVAF+H +YR GE +++    
Sbjct  121   GNIFLVSFGNHQSPVYTPEQLIAKYSNLVFVLYCMSLVFVVAFNHYLYRSGETIISNSSK  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D   +W+ +LPFSYA+VSG IGS SVLFAKSLSN+LRL++S+ Y  HS FTYS++LLFL 
Sbjct  181   DAGTYWRTMLPFSYAVVSGAIGSCSVLFAKSLSNMLRLTMSSRYEFHSLFTYSIVLLFLC  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR  MFVLG+ 
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRIIMFVLGMT  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKA  1344
              VF+GISLLAPDDSK   TKD S  +  S+ +      M +E+ +  D  SF   V +KA
Sbjct  301   FVFLGISLLAPDDSKA-DTKDGSSATEDSVIDMDRNGKMQMEETEADDSNSFVSSVKVKA  359

Query  1345  VNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWRR  1524
               +++KAK+ACS+SLGLG++S+ ASSVL MPMVSS+ TGFRGN  D++K  P R+  W  
Sbjct  360   KRVLLKAKSACSMSLGLGEESISASSVLAMPMVSSRTTGFRGN--DRSKYVPLRTTDWSN  417

Query  1525  I  1527
             +
Sbjct  418   L  418



>gb|EEC73279.1| hypothetical protein OsI_07422 [Oryza sativa Indica Group]
Length=420

 Score =   520 bits (1340),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 280/421 (67%), Positives = 327/421 (78%), Gaps = 1/421 (0%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG+WVIGA IN++GS+ INFGTNLLKLGHD+R K S   N   N K   K ++HFQTWRI
Sbjct  1     MGDWVIGALINIVGSVAINFGTNLLKLGHDQREKLSTTNNNQGNDKFVPKSVMHFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA GN LNF+SF +AAQSLLAALGSIQFVSNIAFAYFV NKT+++KVMVATTFIV 
Sbjct  61    GILFFAAGNCLNFMSFAYAAQSLLAALGSIQFVSNIAFAYFVLNKTISVKVMVATTFIVF  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV VVAF+  +YR GE +++    
Sbjct  121   GNIFLVSFGNHQSPVYTPEQLVAKYSNLVFVLYCMSLVFVVAFNQYLYRSGETIISDSAK  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
                  W+ LLPFSYAIVSG IGS SVLFAKSLSN+LRL++S+ Y  HSWFTYSMLLLFL 
Sbjct  181   HTGSHWRTLLPFSYAIVSGAIGSCSVLFAKSLSNMLRLTMSSRYQFHSWFTYSMLLLFLF  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR  MFVLG+ 
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRIVMFVLGMT  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKA  1344
              VFIGISLLAPDDSK   TKD S  +     +      M  E+ ++    SF+  V +KA
Sbjct  301   SVFIGISLLAPDDSK-VDTKDGSSATQEPAIDANRPGKMQTEETEVDGTNSFTSSVKVKA  359

Query  1345  VNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWRR  1524
               ++ KAK+ACS+SLGLG++++ ASSVL MPMVSS+ TGFRG   D++K  P RS  W  
Sbjct  360   KRILSKAKSACSMSLGLGEETISASSVLAMPMVSSRTTGFRGIATDRSKYIPLRSTDWDN  419

Query  1525  I  1527
             +
Sbjct  420   L  420



>ref|XP_010235478.1| PREDICTED: probable magnesium transporter NIPA8 isoform X2 [Brachypodium 
distachyon]
Length=429

 Score =   517 bits (1332),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 277/430 (64%), Positives = 336/430 (78%), Gaps = 10/430 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG+WVIGA IN++GS+ INFGTNLLKLGHD+R K SA  +   NGK   K +++FQTWRI
Sbjct  1     MGDWVIGALINIVGSVAINFGTNLLKLGHDQREKLSASNSNQGNGKFVPKSVMYFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA+GN LNF+SF +AAQSLLAALGSIQFVSNIAFAY V NKT+T+KVMVAT FIV 
Sbjct  61    GILFFAVGNCLNFMSFAYAAQSLLAALGSIQFVSNIAFAYVVLNKTITVKVMVATAFIVF  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV +VAF+  +YR GE +L+    
Sbjct  121   GNVFLVSFGNHQSPVYTPEQLIAKYSNLVFVLYCMSLVFIVAFNQYLYRSGETILSDNAK  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D   +W+ LLPFSYAIVSG +GS SVLFAKSLSN+LRL++S+ Y  HSWFTYS+LLLFL 
Sbjct  181   DTGTYWRTLLPFSYAIVSGAVGSCSVLFAKSLSNMLRLTMSSRYQFHSWFTYSILLLFLC  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS +DAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR  MFVLG+ 
Sbjct  241   TAGFWMARLNEGLSLYDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRIMMFVLGMT  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsN---------DVERLIMPLEDPQLKDVKS  1317
              VFIGISLLAPDD+K   TKD S V+   + +         +     + +E+ ++ D  S
Sbjct  301   FVFIGISLLAPDDNKA-DTKDGSSVTRGPMIDMNSEAHVSGNCRPRKLQMEETEVDDTDS  359

Query  1318  FSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLF  1497
             FS  V +KA  ++ +AK+ACS+SLGLG++++ ASSVL MPMVSS+ TGFRG G D++K  
Sbjct  360   FSTSVKVKAKRILSRAKSACSMSLGLGEETISASSVLAMPMVSSRTTGFRGTGTDRSKYI  419

Query  1498  PGRSQGWRRI  1527
             P RS  W  +
Sbjct  420   PLRSTEWDNL  429



>ref|XP_006647255.1| PREDICTED: magnesium transporter NIPA3-like [Oryza brachyantha]
Length=416

 Score =   516 bits (1330),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 278/422 (66%), Positives = 327/422 (77%), Gaps = 7/422 (2%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG+WVIGA IN++GS+ INFGTNLLKLGHD+R K S   +   N K   K ++HFQTWRI
Sbjct  1     MGDWVIGALINIVGSVAINFGTNLLKLGHDQREKLSTTTSNQGNDKFVPKSVMHFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA GN LNF+SF +AAQSLLAALGSIQFVSNIAFAYFV NKT+++KVMVATTFIV 
Sbjct  61    GILFFAAGNCLNFMSFAYAAQSLLAALGSIQFVSNIAFAYFVLNKTISVKVMVATTFIVF  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQL  KYSN+ F+LYC  LV VVAF+  +YR GE +L+    
Sbjct  121   GNIFLVSFGNHQSPVYTPEQLVAKYSNLVFVLYCTSLVFVVAFNQYLYRSGETILSDSAK  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
                  W+ LLPFSYAIVSG IGS SVLFAKSLSN+LRL++S+ Y  HSWFTYSMLLLFL 
Sbjct  181   HTGSHWRTLLPFSYAIVSGAIGSCSVLFAKSLSNMLRLTMSSRYQFHSWFTYSMLLLFLF  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR  MFVLG+ 
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRIVMFVLGMT  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERL-IMPLEDPQLKDVKSFSHVVLMK  1341
              VFIGISLLAPDDSK   + +           D  R   M +E+ ++    SF++ V +K
Sbjct  301   SVFIGISLLAPDDSKDGSSANQEPAI------DASRPGKMQMEETEVDGTSSFTNSVKVK  354

Query  1342  AVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWR  1521
             A  ++ KAK+ACS+SLGLG++++ ASSVL MPMVSS+ TGFRG+  D++K  P RS  W 
Sbjct  355   AKRILSKAKSACSMSLGLGEETISASSVLAMPMVSSRTTGFRGSNTDRSKYIPLRSTDWD  414

Query  1522  RI  1527
              +
Sbjct  415   NL  416



>ref|NP_001046964.1| Os02g0518100 [Oryza sativa Japonica Group]
 dbj|BAD26324.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD38563.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08878.1| Os02g0518100 [Oryza sativa Japonica Group]
Length=416

 Score =   514 bits (1325),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 278/421 (66%), Positives = 325/421 (77%), Gaps = 5/421 (1%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG+WVIGA IN++GS+ INFGTNLLKLGHD+R K S   N   N K   K ++HFQTWRI
Sbjct  1     MGDWVIGALINIVGSVAINFGTNLLKLGHDQREKLSTTNNNQGNDKFVPKSVMHFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA GN LNF+SF +AAQSLLAALGSIQFVSNIAFAYFV NKT+++KVMVATTFIV 
Sbjct  61    GILFFAAGNCLNFMSFAYAAQSLLAALGSIQFVSNIAFAYFVLNKTISVKVMVATTFIVF  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV VVAF+  +YR GE +++    
Sbjct  121   GNIFLVSFGNHQSPVYTPEQLVAKYSNLVFVLYCMSLVFVVAFNQYLYRSGETIISDSAK  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
                  W+ LLPFSYAIVSG IGS SVLFAKSLSN+LRL++S+ Y  HSWFTYSMLLLFL 
Sbjct  181   HTGSHWRTLLPFSYAIVSGAIGSCSVLFAKSLSNMLRLTMSSRYQFHSWFTYSMLLLFLF  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR  MFVLG+ 
Sbjct  241   TAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRIVMFVLGMT  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKA  1344
              VFIGISLLAPDDS     KD S  +     +      M  E+ ++    SF+  V +KA
Sbjct  301   SVFIGISLLAPDDS-----KDGSSATQEPAIDANRPGKMQTEETEVDGTNSFTSSVKVKA  355

Query  1345  VNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWRR  1524
               ++ KAK+ACS+SLGLG++++ ASSVL MPMVSS+ TGFRG   D++K  P RS  W  
Sbjct  356   KRILSKAKSACSMSLGLGEETISASSVLAMPMVSSRTTGFRGIATDRSKYIPLRSTDWDN  415

Query  1525  I  1527
             +
Sbjct  416   L  416



>emb|CAN71073.1| hypothetical protein VITISV_020459 [Vitis vinifera]
Length=492

 Score =   514 bits (1325),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 280/406 (69%), Positives = 327/406 (81%), Gaps = 14/406 (3%)
 Frame = +1

Query  358   RIKHSALGNEGTNGKAAMKPIIHFQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQ  537
             R +   L N G NGK   KPII+FQTWR+G++FF+LGN LNFISFG+AAQSLLAALGSIQ
Sbjct  77    RGRSLLLDNNGANGKLVPKPIIYFQTWRVGLLFFSLGNCLNFISFGYAAQSLLAALGSIQ  136

Query  538   FVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFL  717
             FVSNIAFAYFV NK V++KV+VAT FIVLGNIFLVAFGNHQSPV+TPEQLAEK+SN TFL
Sbjct  137   FVSNIAFAYFVLNKMVSVKVLVATAFIVLGNIFLVAFGNHQSPVFTPEQLAEKFSNATFL  196

Query  718   LYCLILVLVVAFHHSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTI--------GS  873
             +YCLIL+LVVA +H +YRRGE+   + G DL+P+W MLLPFSYA VSG I          
Sbjct  197   VYCLILILVVALNHYIYRRGEMQFAISGQDLEPYWHMLLPFSYATVSGKIVKATFIPNMQ  256

Query  874   FSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVP  1053
             F VL +    NLLRL++S+ Y LHSWFTYSMLL FLSTAGFWMARLNEGLS FDAILIVP
Sbjct  257   FLVLLSS---NLLRLAMSSGYQLHSWFTYSMLLCFLSTAGFWMARLNEGLSLFDAILIVP  313

Query  1054  MFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQTKDss  1233
             MFQIAWTFFSICTGFVYFQEYQVFD LRTTMF+LG+M VFIGISLLAPD+ KG +TKD+S
Sbjct  314   MFQIAWTFFSICTGFVYFQEYQVFDTLRTTMFILGMMSVFIGISLLAPDEPKGGETKDNS  373

Query  1234  lvsasslsN---DVERLIMPLEDPQLKDVKSFSHVVLMKAVNLIVKAKAACslslglgdd  1404
              +++ + S+   D +RLI P ED Q +D +S    +LMKA   IVKAKAACSLSLG G+D
Sbjct  374   TLASITSSSTPTDTDRLITPSEDAQTQDPRSRMQAMLMKATEAIVKAKAACSLSLGFGED  433

Query  1405  slQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWRRISVDED  1542
             S+ AS+ LVMPMVSSKITGFRG+  D  +LF  ++ GW +IS+DED
Sbjct  434   SINASAGLVMPMVSSKITGFRGSSPDGGRLFSLKNPGWTKISMDED  479



>ref|XP_008677537.1| PREDICTED: uncharacterized protein LOC100381948 isoform X1 [Zea 
mays]
 gb|AFW62417.1| hypothetical protein ZEAMMB73_017317 [Zea mays]
Length=420

 Score =   511 bits (1317),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 272/421 (65%), Positives = 330/421 (78%), Gaps = 1/421 (0%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG+W+IGA IN++GS+ INFGTNLLKLGHD+R K S + N   N K   K ++HFQTWRI
Sbjct  1     MGDWIIGALINIVGSVGINFGTNLLKLGHDQREKLSLINNSEGNEKFVPKSVMHFQTWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA GN LNF+SF +AAQSLLAALGSIQFVSNIAFAYFV NKT+++KVMVATTFIV 
Sbjct  61    GILFFAAGNCLNFMSFAYAAQSLLAALGSIQFVSNIAFAYFVLNKTISVKVMVATTFIVF  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV VVAF+H +YR GE +++    
Sbjct  121   GNIFLVSFGNHQSPVYTPEQLIAKYSNLVFVLYCMSLVFVVAFNHYLYRSGETIISNSSK  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             +   +W+ +LPFSYA+VSG IGS SVLFAKSLSN++RL++++ Y  HSWFTYS++LLFL 
Sbjct  181   NAGTYWRTMLPFSYAVVSGAIGSCSVLFAKSLSNMMRLTMNSRYEFHSWFTYSIVLLFLC  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR  M VLG+ 
Sbjct  241   TAGFWMGRLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRIIMVVLGMT  300

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKA  1344
              VF+GISLLAPDD+K   TKD S  +  S+ +      M +E+    D  SF   V  KA
Sbjct  301   FVFVGISLLAPDDTKA-DTKDGSSTAEESIIDMDRNGKMQMEETDTDDSNSFVTSVKAKA  359

Query  1345  VNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWRR  1524
               +++KAK+ACS+SLGLG+D++ ASSVL MPMVSS+ TGFRG   D++K  P R+  W  
Sbjct  360   KRVLLKAKSACSMSLGLGEDTISASSVLAMPMVSSRTTGFRGIEDDRSKYVPLRTTDWSN  419

Query  1525  I  1527
             +
Sbjct  420   L  420



>gb|KDO63498.1| hypothetical protein CISIN_1g013305mg [Citrus sinensis]
Length=348

 Score =   499 bits (1285),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 255/316 (81%), Positives = 284/316 (90%), Gaps = 1/316 (0%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFINL+GSI INFGTNLLKLGH ER KHS L ++GTNGK ++KPI+H+ +WR+
Sbjct  1     MGEWVIGAFINLVGSIAINFGTNLLKLGHIEREKHSTLDSDGTNGKHSLKPIVHYHSWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGS+QFVSNIAF+YFVFNK VT+KV+VAT FIVL
Sbjct  61    GILVFLLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFSYFVFNKMVTVKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQLAEKYSNITFL+YCLIL+ +VA +H +YR+GE LL V G 
Sbjct  121   GNIFLVSFGNHQSPVYTPEQLAEKYSNITFLVYCLILIFIVAIYHYIYRKGENLLAVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D   +W+MLLPFSYAIVSG +GSFSVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLF S
Sbjct  181   D-NRYWRMLLPFSYAIVSGAVGSFSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFFS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWMARLNEGLS FDAILIVPMFQIAWT FSICTGFVYFQEYQVFDALR TMF+LG  
Sbjct  240   TAGFWMARLNEGLSLFDAILIVPMFQIAWTSFSICTGFVYFQEYQVFDALRATMFILGTA  299

Query  1165  CVFIGISLLAPDDSKG  1212
              VFIGISLLAPD+SKG
Sbjct  300   SVFIGISLLAPDESKG  315



>ref|XP_008341659.1| PREDICTED: uncharacterized protein LOC103404508, partial [Malus 
domestica]
Length=287

 Score =   471 bits (1213),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 240/286 (84%), Positives = 262/286 (92%), Gaps = 0/286 (0%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWV+GAFINL GSI INFGTNLLKLGH+ER +HS L ++G NGK  +KPIIH+QTWR+
Sbjct  1     MGEWVVGAFINLFGSIAINFGTNLLKLGHNERERHSILESDGGNGKLPLKPIIHYQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G +FFALGN LNF+SFG+AAQSLLAALGS+QFVSNIAFAYFV NK VT+KVMVAT FIV+
Sbjct  61    GFLFFALGNCLNFVSFGYAAQSLLAALGSVQFVSNIAFAYFVLNKMVTVKVMVATAFIVI  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYTPEQLAEKYSNI FL YC+ILVLVVA HHS+YRRGELL  V G 
Sbjct  121   GNIFLVAFGNHQSPVYTPEQLAEKYSNIAFLFYCMILVLVVALHHSIYRRGELLHAVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYAIVSG +GSFSVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  181   DLRPYWHMLLPFSYAIVSGAVGSFSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQV  1122
             TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQV
Sbjct  241   TAGFWMARLNEGLSFFDAILIVPMFQIAWTFFSICTGFVYFQEYQV  286



>ref|XP_009623388.1| PREDICTED: probable magnesium transporter NIPA8 [Nicotiana tomentosiformis]
Length=339

 Score =   456 bits (1173),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 249/354 (70%), Positives = 283/354 (80%), Gaps = 30/354 (8%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAM-KPIIHFQTWR  441
             MGEWVI A INLLGSIIINFGTNLLKLGHDER +HS       N K  M KPII+FQTWR
Sbjct  1     MGEWVIAAIINLLGSIIINFGTNLLKLGHDERKRHS------MNVKPTMNKPIIYFQTWR  54

Query  442   IGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIV  621
             +GI+FFA+GN LNFISFG+AAQSLLAALGSIQFVSNI FAYF+ NKTVTIK+++AT FIV
Sbjct  55    VGILFFAIGNCLNFISFGYAAQSLLAALGSIQFVSNIVFAYFLSNKTVTIKIVLATAFIV  114

Query  622   LGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPG  801
             +GNIFLVAFGNHQSPVY PEQLAE Y+N TFLLYC  LVLVV  HHS+Y+RGE       
Sbjct  115   VGNIFLVAFGNHQSPVYMPEQLAENYTNTTFLLYCFTLVLVVVLHHSIYKRGE-------  167

Query  802   NDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisns---yllHSWFTYSMLL  972
                    QML+PFSYA+VSG IGS SVLFAKSLSN+LRLS+S S    +L + FTYSMLL
Sbjct  168   ------GQMLVPFSYAVVSGAIGSCSVLFAKSLSNMLRLSMSTSGGYAILQNRFTYSMLL  221

Query  973   LFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFV  1152
             +FLST GFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYF+EY+VFDALRTTMF+
Sbjct  222   MFLSTGGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFEEYKVFDALRTTMFI  281

Query  1153  LGVMCVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVK  1314
             LG++ VF+GI LLAP+D       D S      +  D +RL MP +D Q+KD++
Sbjct  282   LGMISVFVGIYLLAPED-------DESYSKGGEILKDDKRLFMPSQDTQIKDIE  328



>gb|KDO63499.1| hypothetical protein CISIN_1g013305mg [Citrus sinensis]
Length=328

 Score =   448 bits (1152),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 231/286 (81%), Positives = 258/286 (90%), Gaps = 1/286 (0%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFINL+GSI INFGTNLLKLGH ER KHS L ++GTNGK ++KPI+H+ +WR+
Sbjct  1     MGEWVIGAFINLVGSIAINFGTNLLKLGHIEREKHSTLDSDGTNGKHSLKPIVHYHSWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGS+QFVSNIAF+YFVFNK VT+KV+VAT FIVL
Sbjct  61    GILVFLLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFSYFVFNKMVTVKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQLAEKYSNITFL+YCLIL+ +VA +H +YR+GE LL V G 
Sbjct  121   GNIFLVSFGNHQSPVYTPEQLAEKYSNITFLVYCLILIFIVAIYHYIYRKGENLLAVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D   +W+MLLPFSYAIVSG +GSFSVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLF S
Sbjct  181   D-NRYWRMLLPFSYAIVSGAVGSFSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFFS  239

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQV  1122
             TAGFWMARLNEGLS FDAILIVPMFQIAWT FSICTGFVYFQEYQV
Sbjct  240   TAGFWMARLNEGLSLFDAILIVPMFQIAWTSFSICTGFVYFQEYQV  285



>ref|XP_009795431.1| PREDICTED: probable magnesium transporter NIPA8 [Nicotiana sylvestris]
Length=337

 Score =   435 bits (1119),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 244/354 (69%), Positives = 280/354 (79%), Gaps = 32/354 (9%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVI A INLLGSIIINFGTNLLKLGHDER KHS +           KPII+FQTWR 
Sbjct  1     MGEWVIAAIINLLGSIIINFGTNLLKLGHDERKKHSKV--------PIKKPIIYFQTWRA  52

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FFA+GN LNFISFG+AAQSLLAALGSIQFVSNI FAYF+ NKTVTIK+++AT FIV+
Sbjct  53    GILFFAIGNCLNFISFGYAAQSLLAALGSIQFVSNIVFAYFLSNKTVTIKLVLATAFIVV  112

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLI-LVLVVAFHHSVYRRGELLLNVPG  801
             GNIFLVAFGNHQSPVY PEQLAE Y+N TFLLYC   +VLVV  HHSVY+RGE       
Sbjct  113   GNIFLVAFGNHQSPVYMPEQLAENYTNTTFLLYCFTLVVLVVVLHHSVYKRGE-------  165

Query  802   NDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisns---yllHSWFTYSMLL  972
                    QML+PFSYA+VSG IGS SVLFAKSLSN+LRLS+S++    +L+S FTYSMLL
Sbjct  166   ------GQMLVPFSYALVSGAIGSCSVLFAKSLSNMLRLSMSSTGGYAILNSRFTYSMLL  219

Query  973   LFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFV  1152
             +FLST GFWMARLN+GLSRFDAILIVPMFQIAWTFFSICTGFVYF+EY+VFD LRTTMF+
Sbjct  220   MFLSTGGFWMARLNQGLSRFDAILIVPMFQIAWTFFSICTGFVYFEEYKVFDTLRTTMFI  279

Query  1153  LGVMCVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVK  1314
             LG++ VF+G  LLAP+D       D S      +  D +RL MP +D Q+KD++
Sbjct  280   LGMISVFVGCYLLAPED-------DESYSKGGEVLKDEKRLFMPSQDTQIKDIE  326



>ref|XP_008677538.1| PREDICTED: uncharacterized protein LOC100381948 isoform X2 [Zea 
mays]
Length=370

 Score =   432 bits (1110),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 244/421 (58%), Positives = 295/421 (70%), Gaps = 51/421 (12%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG+W+IGA IN++GS+ INFGTNLLKLGHD                              
Sbjct  1     MGDWIIGALINIVGSVGINFGTNLLKLGHD------------------------------  30

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
                                 QSLLAALGSIQFVSNIAFAYFV NKT+++KVMVATTFIV 
Sbjct  31    --------------------QSLLAALGSIQFVSNIAFAYFVLNKTISVKVMVATTFIVF  70

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV VVAF+H +YR GE +++    
Sbjct  71    GNIFLVSFGNHQSPVYTPEQLIAKYSNLVFVLYCMSLVFVVAFNHYLYRSGETIISNSSK  130

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             +   +W+ +LPFSYA+VSG IGS SVLFAKSLSN++RL++++ Y  HSWFTYS++LLFL 
Sbjct  131   NAGTYWRTMLPFSYAVVSGAIGSCSVLFAKSLSNMMRLTMNSRYEFHSWFTYSIVLLFLC  190

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR  M VLG+ 
Sbjct  191   TAGFWMGRLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRIIMVVLGMT  250

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKA  1344
              VF+GISLLAPDD+K   TKD S  +  S+ +      M +E+    D  SF   V  KA
Sbjct  251   FVFVGISLLAPDDTKA-DTKDGSSTAEESIIDMDRNGKMQMEETDTDDSNSFVTSVKAKA  309

Query  1345  VNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWRR  1524
               +++KAK+ACS+SLGLG+D++ ASSVL MPMVSS+ TGFRG   D++K  P R+  W  
Sbjct  310   KRVLLKAKSACSMSLGLGEDTISASSVLAMPMVSSRTTGFRGIEDDRSKYVPLRTTDWSN  369

Query  1525  I  1527
             +
Sbjct  370   L  370



>ref|XP_004229598.1| PREDICTED: probable magnesium transporter NIPA8 [Solanum lycopersicum]
Length=347

 Score =   431 bits (1108),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 235/362 (65%), Positives = 278/362 (77%), Gaps = 38/362 (10%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG+WVIGA INLLGSI INFGTNLLKL HDER           N +A MKPII+FQ WRI
Sbjct  1     MGDWVIGALINLLGSIFINFGTNLLKLAHDER-----------NLRARMKPIIYFQAWRI  49

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF +GN LNFISFG+AAQSLLAALGSIQF+SNI FAY V NKTV IK+++AT F+V 
Sbjct  50    GILFFTIGNCLNFISFGYAAQSLLAALGSIQFISNIGFAYLVLNKTVKIKLLLATAFVVA  109

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYT EQL E Y+NI FL+YC+ LVLVV FHHS+Y+RG+        
Sbjct  110   GNIFLVAFGNHQSPVYTTEQLGENYTNIVFLVYCIGLVLVVVFHHSIYKRGK--------  161

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllH------------S  948
                   QML+PFSYA+VSG IGS SVLFAKSLSN+LRLS+S+++               +
Sbjct  162   -----GQMLVPFSYAVVSGAIGSCSVLFAKSLSNILRLSMSSTHDGDGGGDSGGYSTLLN  216

Query  949   WFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD  1128
              FTYSMLL+F+ST GFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYF+EY+VFD
Sbjct  217   GFTYSMLLMFISTGGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFEEYKVFD  276

Query  1129  ALRTTMFVLGVMCVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKD  1308
             ALRTTMFV G++ VFIGI LLAP+D +  +    +++  S+ S DVERL   +   Q++D
Sbjct  277   ALRTTMFVFGMISVFIGIYLLAPEDDEVLKDNSLAVLKTSNSSQDVERLF--ISSDQIRD  334

Query  1309  VK  1314
             ++
Sbjct  335   IE  336



>ref|XP_006366500.1| PREDICTED: uncharacterized protein LOC102580280 [Solanum tuberosum]
Length=334

 Score =   429 bits (1104),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 236/359 (66%), Positives = 274/359 (76%), Gaps = 45/359 (13%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MG+WVIGA INLLGS+ INFGTNLLKL HDER           N +A MKPII+FQ WRI
Sbjct  1     MGDWVIGALINLLGSVFINFGTNLLKLAHDER-----------NLRARMKPIIYFQAWRI  49

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+FF +GN LNFISFG+AAQSLL+ALGSIQF+SNI FAYFV NKTVTIK+++AT F+V 
Sbjct  50    GILFFTIGNCLNFISFGYAAQSLLSALGSIQFISNIGFAYFVLNKTVTIKLLLATAFVVA  109

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLVAFGNHQSPVYT EQL E Y+N  FL+YC+ LVLVV FHHS+Y+RG+        
Sbjct  110   GNIFLVAFGNHQSPVYTTEQLGENYTNTVFLVYCISLVLVVIFHHSIYKRGK--------  161

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrl---------sisnsyllHSWFT  957
                   +ML+PFSYA+VSG IGS SVLFAKSLSN+LRL         S      LHS FT
Sbjct  162   -----GKMLVPFSYAVVSGAIGSCSVLFAKSLSNMLRLSMSSSVDGGSGGGYSTLHSGFT  216

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             YSMLL+F+ST GFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYF+EY+VFDALR
Sbjct  217   YSMLLMFISTGGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFEEYKVFDALR  276

Query  1138  TTMFVLGVMCVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVK  1314
             TTMFV G++ VF+GI LLAP+D +    KD SL        +V+RL MP    Q++D++
Sbjct  277   TTMFVFGMISVFVGIYLLAPEDDE--VLKDGSL--------EVKRLFMP--SDQIRDIE  323



>ref|XP_006844682.1| hypothetical protein AMTR_s00016p00244190 [Amborella trichopoda]
 gb|ERN06357.1| hypothetical protein AMTR_s00016p00244190 [Amborella trichopoda]
Length=386

 Score =   431 bits (1108),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 238/361 (66%), Positives = 292/361 (81%), Gaps = 7/361 (2%)
 Frame = +1

Query  499   AAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIFLVAFGNHQSPVYTP  678
             A QSLLAALGS+QFVSN+AFAYFV +  VT KVM+AT FIVLGNIFLVAFGNHQSPVYTP
Sbjct  26    ATQSLLAALGSVQFVSNVAFAYFVLDTKVTTKVMLATVFIVLGNIFLVAFGNHQSPVYTP  85

Query  679   EQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVS  858
             EQL EK+SN+ FLLYCL L+LV+ F+H +YRRGELLL+  G+DLKP+W +LLPFSYAIVS
Sbjct  86    EQLVEKFSNLIFLLYCLGLILVIVFNHLIYRRGELLLSSAGHDLKPYWPLLLPFSYAIVS  145

Query  859   GTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDA  1038
             G +GS+SVLFAKSLSNLLRL++S+ Y  HSWFTYSMLL FLSTAGFWM RLNEGL+ FDA
Sbjct  146   GALGSYSVLFAKSLSNLLRLTMSSHYEFHSWFTYSMLLFFLSTAGFWMTRLNEGLALFDA  205

Query  1039  ILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQ  1218
             ILIVPMFQIAWTFFSICTGF+YFQEYQVF++LRTTMF+LG++ VF GISLLAP+DSKG +
Sbjct  206   ILIVPMFQIAWTFFSICTGFIYFQEYQVFNSLRTTMFILGMVSVFTGISLLAPEDSKGHE  265

Query  1219  TKDss--lvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKAVNLIVKAKAACslslg  1392
             TK++       SS + D+ R +  +E   ++D KS  H VL +A    +KA+AAC+LSLG
Sbjct  266   TKNALPITSQPSSFTTDLSRSLNLIEK-DVRDPKSLGHAVLTRARTFTIKARAACTLSLG  324

Query  1393  lgddslQASSVLVMPMVSSKI-TGFRGNGVDQAKLFPGRSQGWRRISVDED---CETSAM  1560
             LG+D + ASSVL MPM+SS++ T FRG+ +DQ K    R+ G  +  ++ED    ET+++
Sbjct  325   LGEDQIGASSVLTMPMLSSRMTTSFRGSDLDQEKFLSLRNTGSAKGLIEEDGKEMETTSL  384

Query  1561  L  1563
             L
Sbjct  385   L  385



>ref|XP_010425385.1| PREDICTED: probable magnesium transporter NIPA8 isoform X2 [Camelina 
sativa]
Length=383

 Score =   431 bits (1108),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 247/431 (57%), Positives = 304/431 (71%), Gaps = 66/431 (15%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER + +   N G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNERERLALQDNGG--GKMPLKPIIHFQTWRV  58

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSN                 +A  ++VL
Sbjct  59    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSN-----------------IAFAYVVL  101

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
               +  V                                          ++GE+LL++PG 
Sbjct  102   NKMVTV------------------------------------------KKGEVLLSMPGQ  119

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             ++  +W+MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  120   EISSYWKMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  179

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+LG+M
Sbjct  180   TAGFWMTRLNEGLSLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFILGMM  239

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsassls----NDVERLI-MPLEDPQLKDVKSFSHV  1329
             CVF+GISLLAPDD++G +TKD+S    S +S     + +RLI    ED   KD +   H 
Sbjct  240   CVFLGISLLAPDDTRGNETKDTSSSLDSIVSSSLPTEEDRLIPQSSEDGHSKDTRVVVHG  299

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRS  1509
             + MKA +LI K K AC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R 
Sbjct  300   MYMKAADLIAKTKTACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRG  359

Query  1510  QGWRRISVDED  1542
              GW +++++E+
Sbjct  360   SGWSKLAMEEE  370



>ref|XP_010502604.1| PREDICTED: probable magnesium transporter NIPA8 isoform X2 [Camelina 
sativa]
Length=384

 Score =   429 bits (1103),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 248/431 (58%), Positives = 306/431 (71%), Gaps = 65/431 (15%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER +  AL + G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNER-ERLALQDNGGGGKMPLKPIIHFQTWRV  59

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSN                 +A  ++VL
Sbjct  60    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSN-----------------IAFAYVVL  102

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
               +  V                                          ++GE+L+++PG 
Sbjct  103   NKMVTV------------------------------------------KKGEVLISMPGQ  120

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             ++  +W+MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  121   EISSYWKMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  180

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+LG+M
Sbjct  181   TAGFWMTRLNEGLSLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFILGMM  240

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsasslsNDV---ERLIMPL--EDPQLKDVKSFSHV  1329
             CVF+GISLLAPDD++G +TKDSS    S +S+ +   E  +MP   ED   KD +   H 
Sbjct  241   CVFLGISLLAPDDTRGNETKDSSSSLDSIVSSSLPTEEDRLMPQSSEDGHSKDTRVVVHG  300

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRS  1509
             + MKA +LI K K AC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R 
Sbjct  301   LYMKAADLIAKTKTACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRG  360

Query  1510  QGWRRISVDED  1542
              GW +++++E+
Sbjct  361   SGWSKLAMEEE  371



>ref|XP_010514326.1| PREDICTED: probable magnesium transporter NIPA8 isoform X3 [Camelina 
sativa]
Length=381

 Score =   423 bits (1087),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 247/431 (57%), Positives = 304/431 (71%), Gaps = 68/431 (16%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER + +   N G  GK  +KPIIHFQTWR+
Sbjct  1     MGEWVIGAFINIFGSVAINFGTNLLKLGHNERERLALQDNGG--GKMPLKPIIHFQTWRV  58

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGSIQFVSN                 +A  ++VL
Sbjct  59    GILVFLLGNCLNFISFGYAAQSLLAALGSIQFVSN-----------------IAFAYVVL  101

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
               +  V                                          ++GE+L+++PG 
Sbjct  102   NKMVTV------------------------------------------KKGEVLISMPGQ  119

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             ++  +W+MLLPFSYA+VSG IGS SVLFAKSLSNLLRL++S+SY LHSWFTYSMLLLFLS
Sbjct  120   EISSYWKMLLPFSYAVVSGAIGSCSVLFAKSLSNLLRLAMSSSYQLHSWFTYSMLLLFLS  179

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TAGFWM RLNEGLS +DAILIVPMFQIAWTFFSICTGF+YFQE+QVFDALRTTMF+LG+M
Sbjct  180   TAGFWMTRLNEGLSLYDAILIVPMFQIAWTFFSICTGFIYFQEFQVFDALRTTMFILGMM  239

Query  1165  CVFIGISLLAPDDSKGTQTKDsslvsassls----NDVERLI-MPLEDPQLKDVKSFSHV  1329
             CVF+GISLLAPDD++G +TKDSS    S +S     + +RLI    ED   KD +   H 
Sbjct  240   CVFLGISLLAPDDTRGNETKDSSSSLDSIVSSSLPTEEDRLIPQSSEDGHSKDTR--VHG  297

Query  1330  VLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRS  1509
             + MKA +LI K K AC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++AK+   R 
Sbjct  298   MYMKAADLIAKTKTACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERAKILSMRG  357

Query  1510  QGWRRISVDED  1542
              GW +++++E+
Sbjct  358   SGWSKLAMEEE  368



>ref|XP_009593048.1| PREDICTED: probable magnesium transporter NIPA8 isoform X4 [Nicotiana 
tomentosiformis]
Length=410

 Score =   411 bits (1056),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 231/305 (76%), Positives = 260/305 (85%), Gaps = 5/305 (2%)
 Frame = +1

Query  667   VYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLKPFWQMLLPFSY  846
             VYTPEQLAEKYSNITFLLY L LVLVVA HHS+Y+RGELLL VP N+ KP W+MLLPFSY
Sbjct  83    VYTPEQLAEKYSNITFLLYSLTLVLVVALHHSIYKRGELLLAVPMNENKPCWRMLLPFSY  142

Query  847   AIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLS  1026
             A+VSG +GS SVLFAKSLSN+LRLS+S+ Y LHSWFTYSMLLLFLSTAGFWMARLNEGLS
Sbjct  143   AVVSGAVGSCSVLFAKSLSNMLRLSMSSGYSLHSWFTYSMLLLFLSTAGFWMARLNEGLS  202

Query  1027  RFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDS  1206
              FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMF+LG++ VF+GISLLAPD+S
Sbjct  203   FFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFILGMISVFVGISLLAPDES  262

Query  1207  KGTQTKD-sslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKAVNLIVKAKAACsl  1383
             KG + KD S + + S+LS D ERL M  ED Q+KD++SF  V+LMK  N+IVKAKAACS+
Sbjct  263   KGGEVKDGSLVSTTSNLSQDEERLFMQSEDSQIKDIRSFGRVMLMKTANMIVKAKAACSV  322

Query  1384  slglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWRRISVDED----CET  1551
             SLG G DSL ASSVLVMPMVSSKITGFRG G+D+AKL   R  GW + +VDED     ET
Sbjct  323   SLGFGGDSLHASSVLVMPMVSSKITGFRGGGLDRAKLLSARGPGWSKFAVDEDGETILET  382

Query  1552  SAMLP  1566
             +AMLP
Sbjct  383   TAMLP  387


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  435  LENWNHFLCSWKLS*FHFIWICCSVAPCSSGFYTVcl*ycicllci*QNSYYQSNGGHNF  614
            +E+W   LC  KLS FHFIWICCSV   S G YT+CL + +CLLC  QNS  QS G +  
Sbjct  1    MESWYCILCYRKLSQFHFIWICCSVTSSSFGIYTICLKHRLCLLCFEQNSDNQSIGSYCL  60

Query  615  YCSWKHLSCCFWQPPVT  665
            YCSWKHLSC  WQPPV 
Sbjct  61   YCSWKHLSCSLWQPPVA  77



>ref|XP_009781332.1| PREDICTED: probable magnesium transporter NIPA8 isoform X4 [Nicotiana 
sylvestris]
Length=410

 Score =   410 bits (1055),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 230/305 (75%), Positives = 259/305 (85%), Gaps = 5/305 (2%)
 Frame = +1

Query  667   VYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLKPFWQMLLPFSY  846
             VYTPEQLAEKYSNITFLLY L LVLVVA HHS+Y+RGELLL VP N+ KP W+MLLPFSY
Sbjct  83    VYTPEQLAEKYSNITFLLYSLTLVLVVALHHSIYKRGELLLAVPMNENKPCWRMLLPFSY  142

Query  847   AIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLS  1026
             A+VSG +GS SVLFAKSLSN+LRLS+S+ Y LHSWFTYSMLLLFLSTAGFWMARLNEGLS
Sbjct  143   AVVSGAVGSCSVLFAKSLSNMLRLSMSSGYSLHSWFTYSMLLLFLSTAGFWMARLNEGLS  202

Query  1027  RFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDS  1206
              FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMF+LG++ VF+GISLLAPD+S
Sbjct  203   FFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFILGMISVFVGISLLAPDES  262

Query  1207  KGTQTKD-sslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKAVNLIVKAKAACsl  1383
             KG + KD S +   S+ S D ERL M  ED Q+KD++SF  V+LMK  N+IVKAKAACS+
Sbjct  263   KGGELKDGSLVSKTSNSSQDEERLFMQSEDSQIKDIRSFGRVMLMKTANMIVKAKAACSV  322

Query  1384  slglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWRRISVDED----CET  1551
             SLG G+DSL ASSVLVMPMVSSKITGFRG G+D+AKL   R  GW + +VDED     ET
Sbjct  323   SLGFGEDSLHASSVLVMPMVSSKITGFRGGGLDRAKLLSARGPGWSKFAVDEDGETILET  382

Query  1552  SAMLP  1566
             +AMLP
Sbjct  383   TAMLP  387


 Score = 78.2 bits (191),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  435  LENWNHFLCSWKLS*FHFIWICCSVAPCSSGFYTVcl*ycicllci*QNSYYQSNGGHNF  614
            +E+W   LC  KLS FHFIWICCSV   S G YT+CL + +CLLC  QNS  QS G +  
Sbjct  1    MESWYCILCYRKLSQFHFIWICCSVTSSSFGIYTICLKHRLCLLCFEQNSDNQSIGSYCL  60

Query  615  YCSWKHLSCCFWQPPVT  665
            YCSWKHLSC  WQPPVT
Sbjct  61   YCSWKHLSCSLWQPPVT  77



>gb|KGN57684.1| hypothetical protein Csa_3G251940 [Cucumis sativus]
Length=333

 Score =   387 bits (993),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 197/246 (80%), Positives = 219/246 (89%), Gaps = 0/246 (0%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGA INL GS+ INFGTNLLKLGH+ER KHS L N G+ GK  MKPII+FQTWR+
Sbjct  1     MGEWVIGAVINLFGSLAINFGTNLLKLGHNEREKHSMLENNGSIGKTPMKPIIYFQTWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI FF +GN LNFISFG+AAQSLLAALGS+QFVSNIAFAYFV +K VT+KVMVAT FIVL
Sbjct  61    GITFFIIGNCLNFISFGYAAQSLLAALGSVQFVSNIAFAYFVLHKMVTVKVMVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN+FLVAFGNHQSPVYTPEQL EKY NITFLLYC+IL+LVVA HHS+YRRGELLL+V G 
Sbjct  121   GNVFLVAFGNHQSPVYTPEQLVEKYGNITFLLYCVILILVVALHHSIYRRGELLLSVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             DL+P+W MLLPFSYAIVSG IGS SVLFAKSLS LLRL++S+ Y LHSWFTYS+LLLFLS
Sbjct  181   DLRPYWHMLLPFSYAIVSGAIGSCSVLFAKSLSILLRLAMSSDYQLHSWFTYSLLLLFLS  240

Query  985   TAGFWM  1002
             TAGFW+
Sbjct  241   TAGFWI  246



>gb|KDO63500.1| hypothetical protein CISIN_1g013305mg [Citrus sinensis]
Length=251

 Score =   371 bits (953),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 193/251 (77%), Positives = 222/251 (88%), Gaps = 1/251 (0%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEWVIGAFINL+GSI INFGTNLLKLGH ER KHS L ++GTNGK ++KPI+H+ +WR+
Sbjct  1     MGEWVIGAFINLVGSIAINFGTNLLKLGHIEREKHSTLDSDGTNGKHSLKPIVHYHSWRV  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             GI+ F LGN LNFISFG+AAQSLLAALGS+QFVSNIAF+YFVFNK VT+KV+VAT FIVL
Sbjct  61    GILVFLLGNCLNFISFGYAAQSLLAALGSVQFVSNIAFSYFVFNKMVTVKVLVATAFIVL  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GNIFLV+FGNHQSPVYTPEQLAEKYSNITFL+YCLIL+ +VA +H +YR+GE LL V G 
Sbjct  121   GNIFLVSFGNHQSPVYTPEQLAEKYSNITFLVYCLILIFIVAIYHYIYRKGENLLAVSGQ  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D   +W+MLLPFSYAIVSG +GSFSVLFAKSLSNLLRL++SN Y LHSWFTYSMLLLF S
Sbjct  181   D-NRYWRMLLPFSYAIVSGAVGSFSVLFAKSLSNLLRLAMSNGYQLHSWFTYSMLLLFFS  239

Query  985   TAGFWMARLNE  1017
             TAGFW+  + E
Sbjct  240   TAGFWVKIIKE  250



>ref|XP_002452179.1| hypothetical protein SORBIDRAFT_04g021230 [Sorghum bicolor]
 gb|EES05155.1| hypothetical protein SORBIDRAFT_04g021230 [Sorghum bicolor]
Length=309

 Score =   360 bits (924),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 203/311 (65%), Positives = 241/311 (77%), Gaps = 3/311 (1%)
 Frame = +1

Query  598   MVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRG  777
             MVATTFIV GNIFLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV VVAF+H +YR G
Sbjct  1     MVATTFIVFGNIFLVSFGNHQSPVYTPEQLIAKYSNLVFVLYCMSLVFVVAFNHYLYRSG  60

Query  778   ELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT  957
             E +++    D    W+ +LPFSYA+VSG IGS SVLFAKSLSN+LRL++S+ Y  HSWFT
Sbjct  61    ETIISNSSKDAGTHWRTMLPFSYAVVSGAIGSCSVLFAKSLSNMLRLTMSSRYEFHSWFT  120

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             YS++LLFL TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR
Sbjct  121   YSIVLLFLCTAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLR  180

Query  1138  TTMFVLGVMCVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERL-IMPLEDPQLKDVK  1314
               MFVLG+  VF+GISLLAPDDSK     DSS    S +  DV+R   M +E+    D  
Sbjct  181   IIMFVLGMTFVFVGISLLAPDDSKADTKGDSSTTEDSII--DVDRNGKMQMEETDTDDSN  238

Query  1315  SFSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKL  1494
             SF   V +KA  +++KAK+ACS+SLGLG+D++ ASSVL MPMVSS+ TGFRG G D++K 
Sbjct  239   SFVTSVKVKAKRVLLKAKSACSMSLGLGEDTISASSVLAMPMVSSRTTGFRGIGNDRSKY  298

Query  1495  FPGRSQGWRRI  1527
              P R+  W  +
Sbjct  299   VPLRTTDWSNL  309



>ref|XP_001759023.1| predicted protein [Physcomitrella patens]
 gb|EDQ76092.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   362 bits (929),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 209/405 (52%), Positives = 271/405 (67%), Gaps = 12/405 (3%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHS-ALGNEGTNGKA-AMKPIIHFQTW  438
             MGEW+ GA IN++GSI INFGTNLLKLGH++R + +  L  +    K    KP+  +Q+W
Sbjct  1     MGEWITGAAINVVGSISINFGTNLLKLGHNQRERQALVLDTDDPEDKILPRKPVTQYQSW  60

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
             RIG+I F+LGN LNFISFG+AAQSLLAALGS+QFVSN+ FAY + N+ VT ++++AT FI
Sbjct  61    RIGVIVFSLGNILNFISFGYAAQSLLAALGSVQFVSNVFFAYLMLNEIVTRRIILATVFI  120

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVP  798
             ++GN FLVAFGNHQS +YT  QL   Y    +L Y  IL+ +VA HHS+YRRG  L    
Sbjct  121   MVGNGFLVAFGNHQSVIYTHGQLLASYKGHIYLTYLFILLCIVAAHHSIYRRGRQLAASR  180

Query  799   GNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLF  978
             G D    W+MLLP++YA+VSG +GS SVLFAKSLS LLR ++     L  WFTY +  LF
Sbjct  181   GEDPVGVWRMLLPYTYAVVSGAVGSHSVLFAKSLSVLLRSTLEGDNQLDGWFTYIVFFLF  240

Query  979   LSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEY-QVFDALRTTMFVL  1155
             + TA FWMARLN+GL+ FDAILIVPM QI WTFFSI TGF+YF+EY QVFD  R TMF +
Sbjct  241   VGTASFWMARLNDGLAMFDAILIVPMLQIVWTFFSIFTGFIYFEEYRQVFDHFRATMFGI  300

Query  1156  GVMCVFIGISLLAPDDSK-GTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVV  1332
             GV+ +F+G+SLLAP   + G++      V          R+   +  P    + +  HV 
Sbjct  301   GVLALFVGMSLLAPQAPQLGSKGFLQLPVHGHRRKKSRTRIEASMNSPHWLRLSNRVHVA  360

Query  1333  LMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFR  1467
                        ++A  ++LGLG D + ASSV  MPM++S  T +R
Sbjct  361   W--------NVQSAARMTLGLGQDRIHASSVFSMPMIASARTPWR  397



>ref|XP_001767665.1| predicted protein [Physcomitrella patens]
 gb|EDQ67416.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   360 bits (924),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 202/405 (50%), Positives = 268/405 (66%), Gaps = 13/405 (3%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             MGEW+ GA IN++GSI INFGTNLLKLGH++R + +   ++  +   + K +  +Q+WRI
Sbjct  1     MGEWITGAAINVVGSICINFGTNLLKLGHNQRERQALDTDDSEDKTFSKKSVTQYQSWRI  60

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G+  F+ GN LNFISFG+AAQSLLAALGSIQFVSN+ FAY + N+ VT ++++AT+FIV+
Sbjct  61    GVAIFSFGNILNFISFGYAAQSLLAALGSIQFVSNVFFAYLMLNEVVTRRIVLATSFIVV  120

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             GN FLVAFGNHQS +YT EQL   Y    +L YC IL+ +VA HH++YRRG  L    G 
Sbjct  121   GNGFLVAFGNHQSVIYTSEQLLRNYGGRVYLTYCFILLCIVAVHHAIYRRGRQLTVSRGE  180

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
             D    W+MLLP++YA+VSG +GS SVLFAKSLS LLR ++     L   FTY +  LF  
Sbjct  181   DPGSVWRMLLPYTYAVVSGAVGSHSVLFAKSLSVLLRSTLEGENQLDGLFTYLVFFLFAG  240

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TA FWMARLN+GL+ FDAILIVPM QI WTFFSI TGF+YF+EY+VF   R  MF +GV+
Sbjct  241   TASFWMARLNDGLALFDAILIVPMLQIVWTFFSIFTGFIYFEEYRVFGRFRAAMFGVGVL  300

Query  1165  CVFIGISLLAPD----DSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVV  1332
              +F+G+SLLAP      SKG               +   R  +      +   +  S V 
Sbjct  301   ALFVGMSLLAPQAPQLGSKG---------FLQLPVHGHRRKKISQRRAGVTAFRYLSSVE  351

Query  1333  LMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFR  1467
               K V++    K+A  +++GLG D + AS +  MPM++S  + +R
Sbjct  352   GAKWVHVAWNVKSAARMTVGLGQDGIHASFIFSMPMIASARSPWR  396



>gb|AFW62415.1| hypothetical protein ZEAMMB73_017317 [Zea mays]
Length=324

 Score =   355 bits (910),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 239/312 (77%), Gaps = 1/312 (0%)
 Frame = +1

Query  592   KVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYR  771
             +VMVATTFIV GNIFLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV VVAF+H +YR
Sbjct  14    RVMVATTFIVFGNIFLVSFGNHQSPVYTPEQLIAKYSNLVFVLYCMSLVFVVAFNHYLYR  73

Query  772   RGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSW  951
              GE +++    +   +W+ +LPFSYA+VSG IGS SVLFAKSLSN++RL++++ Y  HSW
Sbjct  74    SGETIISNSSKNAGTYWRTMLPFSYAVVSGAIGSCSVLFAKSLSNMMRLTMNSRYEFHSW  133

Query  952   FTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDA  1131
             FTYS++LLFL TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD 
Sbjct  134   FTYSIVLLFLCTAGFWMGRLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDT  193

Query  1132  LRTTMFVLGVMCVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDV  1311
             LR  M VLG+  VF+GISLLAPDD+K   TKD S  +  S+ +      M +E+    D 
Sbjct  194   LRIIMVVLGMTFVFVGISLLAPDDTKA-DTKDGSSTAEESIIDMDRNGKMQMEETDTDDS  252

Query  1312  KSFSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAK  1491
              SF   V  KA  +++KAK+ACS+SLGLG+D++ ASSVL MPMVSS+ TGFRG   D++K
Sbjct  253   NSFVTSVKAKAKRVLLKAKSACSMSLGLGEDTISASSVLAMPMVSSRTTGFRGIEDDRSK  312

Query  1492  LFPGRSQGWRRI  1527
               P R+  W  +
Sbjct  313   YVPLRTTDWSNL  324



>ref|XP_010250448.1| PREDICTED: probable magnesium transporter NIPA8 isoform X2 [Nelumbo 
nucifera]
Length=354

 Score =   345 bits (886),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +1

Query  265  MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
            MGEWV+GAFINL GS+ INFGTNLLKLGH++R + S L N+G NGK A+KPII+FQTWR+
Sbjct  1    MGEWVVGAFINLFGSVAINFGTNLLKLGHNQRERLSMLDNDGVNGKIALKPIIYFQTWRV  60

Query  445  GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
            GI+FF+LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NK VT+KV+VAT FIVL
Sbjct  61   GILFFSLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKMVTVKVLVATAFIVL  120

Query  625  GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
            GNIFLVAFGN QSPVYTPEQL EKYSNI FLLYCLIL L+VA HHS+YRRGEL+L V  N
Sbjct  121  GNIFLVAFGNLQSPVYTPEQLVEKYSNIIFLLYCLILALIVAIHHSIYRRGELMLAVSVN  180

Query  805  DLKPFWQMLLPFSYAIVSGTIGSFSVLFAK  894
            DL  +W MLLPFSYA+VSG +GS SVLFAK
Sbjct  181  DLSSYWHMLLPFSYAVVSGAVGSCSVLFAK  210


 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 79/106 (75%), Gaps = 5/106 (5%)
 Frame = +1

Query  1261  DVERLI-MPLEDPQLKDVKSFSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMP  1437
             D++R++ +P E+ +++D +SF   ++ KA ++I KAKAAC LSLGLG+DS+ ASSVL MP
Sbjct  248   DMDRMVKLPCEETEIRDTRSFGKAMMTKATSIITKAKAACMLSLGLGEDSISASSVLAMP  307

Query  1438  MVSSKITGFRGNGVDQAKLFPGRSQGWRRISVDED----CETSAML  1563
             MVSS++TGFRG G D+ K    RS GW +IS++ED     ETS++L
Sbjct  308   MVSSRMTGFRGAGFDRTKFLSLRSPGWSKISMNEDDAEMMETSSIL  353



>ref|XP_010250446.1| PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010250447.1| PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Nelumbo 
nucifera]
Length=384

 Score =   345 bits (884),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = +1

Query  265  MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
            MGEWV+GAFINL GS+ INFGTNLLKLGH++R + S L N+G NGK A+KPII+FQTWR+
Sbjct  1    MGEWVVGAFINLFGSVAINFGTNLLKLGHNQRERLSMLDNDGVNGKIALKPIIYFQTWRV  60

Query  445  GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
            GI+FF+LGN LNFISFG+AAQSLLAALGSIQFVSNIAFAYFV NK VT+KV+VAT FIVL
Sbjct  61   GILFFSLGNCLNFISFGYAAQSLLAALGSIQFVSNIAFAYFVLNKMVTVKVLVATAFIVL  120

Query  625  GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
            GNIFLVAFGN QSPVYTPEQL EKYSNI FLLYCLIL L+VA HHS+YRRGEL+L V  N
Sbjct  121  GNIFLVAFGNLQSPVYTPEQLVEKYSNIIFLLYCLILALIVAIHHSIYRRGELMLAVSVN  180

Query  805  DLKPFWQMLLPFSYAIVSGTIGSFSVLFAK  894
            DL  +W MLLPFSYA+VSG +GS SVLFAK
Sbjct  181  DLSSYWHMLLPFSYAVVSGAVGSCSVLFAK  210


 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 79/106 (75%), Gaps = 5/106 (5%)
 Frame = +1

Query  1261  DVERLI-MPLEDPQLKDVKSFSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMP  1437
             D++R++ +P E+ +++D +SF   ++ KA ++I KAKAAC LSLGLG+DS+ ASSVL MP
Sbjct  278   DMDRMVKLPCEETEIRDTRSFGKAMMTKATSIITKAKAACMLSLGLGEDSISASSVLAMP  337

Query  1438  MVSSKITGFRGNGVDQAKLFPGRSQGWRRISVDED----CETSAML  1563
             MVSS++TGFRG G D+ K    RS GW +IS++ED     ETS++L
Sbjct  338   MVSSRMTGFRGAGFDRTKFLSLRSPGWSKISMNEDDAEMMETSSIL  383



>gb|AFW62414.1| hypothetical protein ZEAMMB73_017317 [Zea mays]
Length=310

 Score =   309 bits (792),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 165/259 (64%), Positives = 199/259 (77%), Gaps = 1/259 (0%)
 Frame = +1

Query  592   KVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYR  771
             +VMVATTFIV GNIFLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV VVAF+H +YR
Sbjct  14    RVMVATTFIVFGNIFLVSFGNHQSPVYTPEQLIAKYSNLVFVLYCMSLVFVVAFNHYLYR  73

Query  772   RGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSW  951
              GE +++    +   +W+ +LPFSYA+VSG IGS SVLFAKSLSN++RL++++ Y  HSW
Sbjct  74    SGETIISNSSKNAGTYWRTMLPFSYAVVSGAIGSCSVLFAKSLSNMMRLTMNSRYEFHSW  133

Query  952   FTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDA  1131
             FTYS++LLFL TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD 
Sbjct  134   FTYSIVLLFLCTAGFWMGRLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDT  193

Query  1132  LRTTMFVLGVMCVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDV  1311
             LR  M VLG+  VF+GISLLAPDD+K   TKD S  +  S+ +      M +E+    D 
Sbjct  194   LRIIMVVLGMTFVFVGISLLAPDDTKA-DTKDGSSTAEESIIDMDRNGKMQMEETDTDDS  252

Query  1312  KSFSHVVLMKAVNLIVKAK  1368
              SF   V  KA  +++KAK
Sbjct  253   NSFVTSVKAKAKRVLLKAK  271



>gb|AFW62413.1| hypothetical protein ZEAMMB73_017317 [Zea mays]
Length=244

 Score =   297 bits (761),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 178/212 (84%), Gaps = 1/212 (0%)
 Frame = +1

Query  592   KVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYR  771
             +VMVATTFIV GNIFLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV VVAF+H +YR
Sbjct  14    RVMVATTFIVFGNIFLVSFGNHQSPVYTPEQLIAKYSNLVFVLYCMSLVFVVAFNHYLYR  73

Query  772   RGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSW  951
              GE +++    +   +W+ +LPFSYA+VSG IGS SVLFAKSLSN++RL++++ Y  HSW
Sbjct  74    SGETIISNSSKNAGTYWRTMLPFSYAVVSGAIGSCSVLFAKSLSNMMRLTMNSRYEFHSW  133

Query  952   FTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDA  1131
             FTYS++LLFL TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD 
Sbjct  134   FTYSIVLLFLCTAGFWMGRLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDT  193

Query  1132  LRTTMFVLGVMCVFIGISLLAPDDSKGTQTKD  1227
             LR  M VLG+  VF+GISLLAPDD+K   TKD
Sbjct  194   LRIIMVVLGMTFVFVGISLLAPDDTKA-DTKD  224



>gb|AFW62411.1| hypothetical protein ZEAMMB73_017317 [Zea mays]
 gb|AFW62412.1| hypothetical protein ZEAMMB73_017317 [Zea mays]
Length=221

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 176/207 (85%), Gaps = 0/207 (0%)
 Frame = +1

Query  592   KVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYR  771
             +VMVATTFIV GNIFLV+FGNHQSPVYTPEQL  KYSN+ F+LYC+ LV VVAF+H +YR
Sbjct  14    RVMVATTFIVFGNIFLVSFGNHQSPVYTPEQLIAKYSNLVFVLYCMSLVFVVAFNHYLYR  73

Query  772   RGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSW  951
              GE +++    +   +W+ +LPFSYA+VSG IGS SVLFAKSLSN++RL++++ Y  HSW
Sbjct  74    SGETIISNSSKNAGTYWRTMLPFSYAVVSGAIGSCSVLFAKSLSNMMRLTMNSRYEFHSW  133

Query  952   FTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDA  1131
             FTYS++LLFL TAGFWM RLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD 
Sbjct  134   FTYSIVLLFLCTAGFWMGRLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDT  193

Query  1132  LRTTMFVLGVMCVFIGISLLAPDDSKG  1212
             LR  M VLG+  VF+GISLLAPDD+KG
Sbjct  194   LRIIMVVLGMTFVFVGISLLAPDDTKG  220



>dbj|BAJ86371.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=273

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 158/258 (61%), Positives = 191/258 (74%), Gaps = 8/258 (3%)
 Frame = +1

Query  769   RRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHS  948
             R GE +L+    D    W+ LLPFSYAIVSG IGS SVLFAKSLSN+LRL++S+ Y  HS
Sbjct  13    RSGETILSDNAKDTSTHWRTLLPFSYAIVSGAIGSCSVLFAKSLSNMLRLTMSSRYQFHS  72

Query  949   WFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD  1128
             WFTYS+LLLFL TAGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD
Sbjct  73    WFTYSILLLFLCTAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD  132

Query  1129  ALRTTMFVLGVMCVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLI--------MP  1284
              LR  MFVLG+  VFIGISLLAPD++K     DS+     ++  + E  +        +P
Sbjct  133   TLRIIMFVLGMTFVFIGISLLAPDENKADTKDDSNSKKDLTIDMNSEAHVPGNCRPRKLP  192

Query  1285  LEDPQLKDVKSFSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGF  1464
             +E+ +L D+ SFS  V +KA  ++ +AK+ACS+SLGLG++++ ASSVL MPMVSS+ TGF
Sbjct  193   MEETELDDMDSFSTSVRVKAKRILSRAKSACSMSLGLGEETISASSVLAMPMVSSRTTGF  252

Query  1465  RGNGVDQAKLFPGRSQGW  1518
             RG   D+ K  P RS  W
Sbjct  253   RGIRTDRLKYTPLRSTEW  270



>ref|XP_002985516.1| hypothetical protein SELMODRAFT_424601 [Selaginella moellendorffii]
 gb|EFJ13390.1| hypothetical protein SELMODRAFT_424601 [Selaginella moellendorffii]
Length=356

 Score =   249 bits (635),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 205/317 (65%), Gaps = 25/317 (8%)
 Frame = +1

Query  592   KVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYR  771
             ++++AT FIV+GN FLVAFGNHQSPV+TP++L   Y N  +L+YC +L++++A HH+ YR
Sbjct  4     RIILATAFIVVGNAFLVAFGNHQSPVFTPDELLRNYKNHMYLVYCAVLLIIIALHHAAYR  63

Query  772   RGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSW  951
             +G  L++  G++    W  L+PF YA+VSG +G+ SVLFAKSLS LLRL+++    L  W
Sbjct  64    KGRQLVHEQGSNTNRNWHFLMPFCYAVVSGAVGTHSVLFAKSLSILLRLTLNGESQLDGW  123

Query  952   FTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDA  1131
             FTY +L LF  TA FWM RLN+GLS FDAILIVPM QI+WT FSI TGFVYFQEY+VFD 
Sbjct  124   FTYLLLSLFFVTAAFWMVRLNDGLSMFDAILIVPMLQISWTTFSIFTGFVYFQEYRVFDG  183

Query  1132  LRTTMFVLGVMCVFIGISLLAPDDSKGTQ-----TKDsslvsasslsNDVERLI------  1278
              R  MF++G++ +F+GI LLAP  S  T      TK   + SA  ++N   +++      
Sbjct  184   FRVCMFIVGIVALFLGILLLAPQGSSSTSEAFKATKPDDVESAPLIANADRKVLHSTSCI  243

Query  1279  ------------MPL--EDPQLKDVKSFSHVVLMKAVNLIVKAKAACslslglgddslQA  1416
                          PL  E  +L   +     + + A++++ +AK A  +++G G D + A
Sbjct  244   WICVNLTRINFCRPLVSEQGRLSRARGVIQSIAVDALSMVGRAKTAYKMTMGFGQDQIHA  303

Query  1417  SSVLVMPMVSSKITGFR  1467
             SSV  MPMVSS  + +R
Sbjct  304   SSVFSMPMVSSSRSSWR  320



>ref|XP_002948114.1| hypothetical protein VOLCADRAFT_57599 [Volvox carteri f. nagariensis]
 gb|EFJ51102.1| hypothetical protein VOLCADRAFT_57599 [Volvox carteri f. nagariensis]
Length=342

 Score =   247 bits (631),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 200/300 (67%), Gaps = 11/300 (4%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIH-FQTWRIGI  450
             W +GA IN++GSI IN GTNL+KLGH++R K             A KP +H F+ W IG+
Sbjct  22    WYVGAIINVVGSIAINLGTNLMKLGHNKRAK--------VEYAEAQKPPVHKFKEWVIGM  73

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGN  630
              FF++GN LNF+SFGFAAQSLLAALGSIQFVSN+ FAYFV ++ +   +++AT  IV G 
Sbjct  74    SFFSVGNILNFVSFGFAAQSLLAALGSIQFVSNVIFAYFVLHEQINRMILIATACIVGGC  133

Query  631   IFLVAFGNHQSPVYTPEQLAEKYSNITFLLY-CLILVLVV-AFHHSVYRRGELLLNVPGN  804
             I LV FGN  S  YT ++L + Y+   +++Y CL+ V VV  +   ++    L      N
Sbjct  134   ILLVVFGNQTSATYTVKELTQLYTKPAYVVYLCLLGVGVVGGYILYLHVLTVLFPTCSKN  193

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
               K  W  LLP +Y++ S  IG+ SVLF+KS+S +LRL+ +    L +W+T+ +L LFL 
Sbjct  194   GQKGIWYALLPVAYSVFSALIGTQSVLFSKSMSVILRLTFTGENQLGNWYTWLVLPLFLL  253

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             TA FW+ RLN+GL  F A++IVP+ QIAWT FSI +G +YFQEY+ F  L++ MF +GV+
Sbjct  254   TAVFWITRLNKGLRMFPAMIIVPVMQIAWTLFSIVSGMLYFQEYKGFTPLKSIMFPIGVL  313



>ref|XP_001696908.1| hypothetical protein CHLREDRAFT_105319 [Chlamydomonas reinhardtii]
 gb|EDP00600.1| predicted protein [Chlamydomonas reinhardtii]
Length=294

 Score =   244 bits (622),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 138/297 (46%), Positives = 200/297 (67%), Gaps = 9/297 (3%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             W +GA IN++GSI IN GTNL+KLGH++R K     ++    K +++ I   + W +G+ 
Sbjct  1     WYVGAIINVIGSIAINLGTNLMKLGHNKRAKMPMPDDQ----KPSVRKI---KEWVVGMS  53

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
             FF++GN LNF SFGFAAQSLLAALGSIQFVSN+ FAYFV ++ +   V++ATT IV G +
Sbjct  54    FFSVGNILNFTSFGFAAQSLLAALGSIQFVSNVIFAYFVLHEQINRMVIIATTCIVGGCV  113

Query  634   FLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLK  813
              LV FGN     YT +QL + Y    +++Y  ++ + V   + +Y  G     V  N  +
Sbjct  114   LLVVFGNQSGATYTVKQLTQLYGKPAYVVYLCLMGVGVVGGYMLYLHGS--KKVAKNGPR  171

Query  814   PFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLSTAG  993
              FW  +LP +YA+ S  IG+ SVLF+KS+S +LRL+ +    L +W+T+ +L LFL+TA 
Sbjct  172   GFWYAILPVAYAVFSALIGTQSVLFSKSMSVILRLTFTGENQLGNWYTWLVLPLFLATAV  231

Query  994   FWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
             FW++RLN+GL  F A++IVP+ QI+WT FSI +G +YFQEY  F  +++ MF +GV+
Sbjct  232   FWISRLNKGLRMFPAMIIVPVMQISWTLFSIISGMLYFQEYLGFTPIKSVMFPIGVL  288



>ref|XP_002994097.1| hypothetical protein SELMODRAFT_432033 [Selaginella moellendorffii]
 gb|EFJ04844.1| hypothetical protein SELMODRAFT_432033 [Selaginella moellendorffii]
Length=263

 Score =   238 bits (606),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 156/206 (76%), Gaps = 0/206 (0%)
 Frame = +1

Query  592   KVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYR  771
             ++++AT FIV+GN FLVAFGNHQSPV+TP++L   Y N  +L+YC +L++++A HH+ YR
Sbjct  4     RIILATAFIVVGNAFLVAFGNHQSPVFTPDELLRNYKNHMYLVYCAVLLIIIALHHAAYR  63

Query  772   RGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSW  951
             +G  L++  G++    W  L+PF YA+VSG +G+ SVLFAKSLS LLRL+++    L  W
Sbjct  64    KGRQLVHEQGSNTNRNWHFLMPFCYAVVSGAVGTHSVLFAKSLSILLRLTLNGESQLDGW  123

Query  952   FTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDA  1131
             FTY +L LF  TA FWM RLN+GLS FDAILIVPM QI+WT FSI TGFVYFQEY+VFD 
Sbjct  124   FTYLLLSLFFVTAAFWMVRLNDGLSMFDAILIVPMLQISWTTFSIFTGFVYFQEYRVFDG  183

Query  1132  LRTTMFVLGVMCVFIGISLLAPDDSK  1209
              R  MF++G++ +F+GI LLAP  S 
Sbjct  184   FRVCMFIVGIVALFVGILLLAPQGSS  209



>gb|EEE57089.1| hypothetical protein OsJ_06921 [Oryza sativa Japonica Group]
Length=313

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +1

Query  265  MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
            MG+WVIGA IN++GS+ INFGTNLLKLGHD+R K S   N   N K   K ++HFQTWRI
Sbjct  1    MGDWVIGALINIVGSVAINFGTNLLKLGHDQREKLSTTNNNQGNDKFVPKSVMHFQTWRI  60

Query  445  GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
            GI+FFA GN LNF+SF +AAQSLLAALGSIQFVSNIAFAYFV NKT+++KVMVATTFIV 
Sbjct  61   GILFFAAGNCLNFMSFAYAAQSLLAALGSIQFVSNIAFAYFVLNKTISVKVMVATTFIVF  120

Query  625  GNIFLVAFGNHQSP  666
            GNIFLV+FGNHQSP
Sbjct  121  GNIFLVSFGNHQSP  134


 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 132/182 (73%), Gaps = 1/182 (1%)
 Frame = +1

Query  982   STAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGV  1161
             S AGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR  MFVLG+
Sbjct  133   SPAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRIVMFVLGM  192

Query  1162  MCVFIGISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMK  1341
               VFIGISLLAPDDSK   TKD S  +     +      M  E+ ++    SF+  V +K
Sbjct  193   TSVFIGISLLAPDDSK-VDTKDGSSATQEPAIDANRPGKMQTEETEVDGTNSFTSSVKVK  251

Query  1342  AVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWR  1521
             A  ++ KAK+ACS+SLGLG++++ ASSVL MPMVSS+ TGFRG   D++K  P RS  W 
Sbjct  252   AKRILSKAKSACSMSLGLGEETISASSVLAMPMVSSRTTGFRGIATDRSKYIPLRSTDWD  311

Query  1522  RI  1527
              +
Sbjct  312   NL  313



>gb|EMS63964.1| hypothetical protein TRIUR3_32291 [Triticum urartu]
Length=331

 Score =   199 bits (507),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 139/191 (73%), Gaps = 9/191 (5%)
 Frame = +1

Query  982   STAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGV  1161
             S AGFWMARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR  MFVLG+
Sbjct  141   SPAGFWMARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRIIMFVLGM  200

Query  1162  MCVFIGISLLAPDDSKGTQTKDsslvsasslsN---------DVERLIMPLEDPQLKDVK  1314
               VF+GISLLAPD++K   TKD S  +  +  +         +     +P+E+ ++ D+ 
Sbjct  201   TFVFVGISLLAPDENKVADTKDGSNATKDAAIDMNSEAHVSGNCRPRKLPMEETEVDDMD  260

Query  1315  SFSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKL  1494
             SFS  V +KA +++ +AK+ACS+SLGLG++++ ASSVL +PMVSS+ TGFRG   D++K 
Sbjct  261   SFSTSVKVKAKHILSRAKSACSMSLGLGEETISASSVLAIPMVSSRTTGFRGIRTDRSKY  320

Query  1495  FPGRSQGWRRI  1527
              P RS  W  +
Sbjct  321   IPLRSTDWDNL  331


 Score =   194 bits (492),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 114/142 (80%), Gaps = 8/142 (6%)
 Frame = +1

Query  265  MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSAL--------GNEGTNGKAAMKPI  420
            MG+W+IGA IN++GS+ INFGTNLLKLGHD+    SA          N   +GK   K +
Sbjct  1    MGDWIIGALINIVGSVAINFGTNLLKLGHDQDCDLSAQVQREKLYSSNNQGDGKFVPKSV  60

Query  421  IHFQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVM  600
            ++FQTWRIGI+FFA+GN LNF+SF +AAQSLLAALGSIQFVSNIAFAY V NKT+++KVM
Sbjct  61   MYFQTWRIGILFFAVGNCLNFMSFAYAAQSLLAALGSIQFVSNIAFAYVVLNKTISVKVM  120

Query  601  VATTFIVLGNIFLVAFGNHQSP  666
            VATTFIV GN+FLV+FGNHQSP
Sbjct  121  VATTFIVFGNVFLVSFGNHQSP  142



>gb|EMT12935.1| hypothetical protein F775_29752 [Aegilops tauschii]
Length=185

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 131/182 (72%), Gaps = 9/182 (5%)
 Frame = +1

Query  1000  MARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIG  1179
             MARLNEGLS FDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD LR  MF+LG+  VFIG
Sbjct  1     MARLNEGLSLFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDTLRIIMFMLGMTFVFIG  60

Query  1180  ISLLAPDDSKGTQTKDsslvsasslsN---------DVERLIMPLEDPQLKDVKSFSHVV  1332
             ISLLAPD++K   TKD S  +  +  +         +     +P+E+ ++ D+ S S  V
Sbjct  61    ISLLAPDENKVADTKDGSNATKDAAIDMNSEAHVSGNCRPRKLPMEETEVDDMDSLSTSV  120

Query  1333  LMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQ  1512
              +KA  ++ +AK+ACS+SLGLG++++ ASSVL MPMVSS+ TGFRG   D++K  P RS 
Sbjct  121   KVKAKRILSRAKSACSMSLGLGEETISASSVLAMPMVSSRTTGFRGIQTDRSKYIPLRST  180

Query  1513  GW  1518
              W
Sbjct  181   DW  182



>ref|XP_008665574.1| PREDICTED: uncharacterized protein LOC103644160 [Zea mays]
Length=175

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 124/176 (70%), Gaps = 1/176 (1%)
 Frame = +1

Query  1000  MARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIG  1179
             MARLNEGLS FDAILIVPMFQI WTFFSIC GFVYFQEYQVFD LR  MFVLG+  VF+G
Sbjct  1     MARLNEGLSLFDAILIVPMFQITWTFFSICIGFVYFQEYQVFDTLRIIMFVLGMTFVFVG  60

Query  1180  ISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKAVNLIV  1359
             ISLLAPDDSK   TKD S  +  S+ +      M +E+  + D  SF   V + A  ++ 
Sbjct  61    ISLLAPDDSKA-DTKDGSSTAEDSIIDIDRNGKMLMEETDIDDSISFVTSVKVNAKRVLS  119

Query  1360  KAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWRRI  1527
             KAK+ACS+SLGLG+ ++ ASS+L MPMVSS+ TGFRG   D+ K  P R+  W  +
Sbjct  120   KAKSACSMSLGLGESTISASSMLAMPMVSSRTTGFRGIENDRPKYVPLRTTDWSNL  175



>gb|AFW64415.1| hypothetical protein ZEAMMB73_848936 [Zea mays]
Length=237

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 124/176 (70%), Gaps = 1/176 (1%)
 Frame = +1

Query  1000  MARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIG  1179
             MARLNEGLS FDAILIVPMFQI WTFFSIC GFVYFQEYQVFD LR  MFVLG+  VF+G
Sbjct  63    MARLNEGLSLFDAILIVPMFQITWTFFSICIGFVYFQEYQVFDTLRIIMFVLGMTFVFVG  122

Query  1180  ISLLAPDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKAVNLIV  1359
             ISLLAPDDSKG  TKD S  +  S+ +      M +E+    D  SF   V + A  ++ 
Sbjct  123   ISLLAPDDSKG-DTKDGSSTAEDSIIDIDINGKMLMEETDTDDSISFVTSVKVNAKRVLS  181

Query  1360  KAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGWRRI  1527
             KAK+ACS+SLGLG+ ++ ASSVL MPMVSS+ TGFRG   D+ K  P R+  W  +
Sbjct  182   KAKSACSMSLGLGESTISASSVLAMPMVSSRTTGFRGIENDRPKYVPLRTTDWSNL  237



>ref|XP_001702244.1| hypothetical protein CHLREDRAFT_154239 [Chlamydomonas reinhardtii]
 gb|EDO97104.1| predicted protein [Chlamydomonas reinhardtii]
Length=488

 Score =   175 bits (444),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 112/307 (36%), Positives = 165/307 (54%), Gaps = 45/307 (15%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             W +GA IN+          NL+KLGH++R        E    +    PI  F++W IG+I
Sbjct  32    WYVGAIINV----------NLMKLGHNKR-------GELDMPEEEKPPIRKFKSWVIGLI  74

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
              F  GN LNF+SF FAAQSLLAALGS+Q V N+ FAY V  + VT  ++ +T  I+ G +
Sbjct  75    IFITGNVLNFVSFAFAAQSLLAALGSLQLVCNVFFAYMVNKEPVTKLIIFSTGCIIGGCV  134

Query  634   FLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLK  813
              LV FGN  S  YT ++L + Y    +++Y +++ +VV   + +Y   + +    G   +
Sbjct  135   LLVVFGNQSSETYTVDELIDFYKKPAYIVYLVMMGVVVFGTYVLYLHSKKVCRKRGQ--R  192

Query  814   PFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLSTAG  993
               W  L+  SY++ S  +GS SVLF K                      S+ ++  +T  
Sbjct  193   GVWYFLMLMSYSVFSAMLGSQSVLFGK----------------------SISVILRTT--  228

Query  994   FWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVF  1173
                +  N+GL  F A++IVP+ QI WT FSI +G +YF+EY+ F  L   MF +GV+ VF
Sbjct  229   --FSGDNQGLRMFPAMVIVPLMQICWTLFSIVSGMIYFEEYKGFTTLMWIMFPVGVVIVF  286

Query  1174  IGISLLA  1194
              G+ LL 
Sbjct  287   SGVFLLT  293



>ref|XP_006386824.1| hypothetical protein POPTR_0002s22570g [Populus trichocarpa]
 gb|ERP64621.1| hypothetical protein POPTR_0002s22570g [Populus trichocarpa]
Length=119

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 99/165 (60%), Gaps = 46/165 (28%)
 Frame = +1

Query  706   ITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVL  885
             +TFL YCLIL+L+VA HH +YRR E++L + G DL+ +W MLLPFSY +VSG +GSFS  
Sbjct  1     MTFLFYCLILILLVALHHYIYRR-EIMLAISGQDLRSYWHMLLPFSYVVVSGAVGSFS--  57

Query  886   FAKslsnllrlsisnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQI  1065
                                                   M RLNEGL+ FDAILIVPMF+I
Sbjct  58    --------------------------------------MTRLNEGLALFDAILIVPMFKI  79

Query  1066  AWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIGISLLAPD  1200
              WTFFSICTGF Y     VFDALR TM +L +  VFIGIS LAPD
Sbjct  80    VWTFFSICTGFEY-----VFDALRMTMIMLRMTSVFIGISFLAPD  119



>ref|NP_001168192.1| uncharacterized protein LOC100381948 [Zea mays]
 gb|ACN27399.1| unknown [Zea mays]
Length=157

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 109/155 (70%), Gaps = 1/155 (1%)
 Frame = +1

Query  1054  MFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQTKDss  1233
             MFQIAWTFFSICTGFVYFQEYQVFD LR  M VLG+  VF+GISLLAPDD+K   TKD S
Sbjct  1     MFQIAWTFFSICTGFVYFQEYQVFDTLRIIMVVLGMTFVFVGISLLAPDDTKA-DTKDGS  59

Query  1234  lvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKAVNLIVKAKAACslslglgddslQ  1413
               +  S+ +      M +E+    D  SF   V  KA  +++KAK+ACS+SLGLG+D++ 
Sbjct  60    STAEESIIDMDRNGKMQMEETDTDDSNSFVTSVKAKAKRVLLKAKSACSMSLGLGEDTIS  119

Query  1414  ASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGW  1518
             ASSVL MPMVSS+ TGFRG   D++K  P R+  W
Sbjct  120   ASSVLAMPMVSSRTTGFRGIEDDRSKYVPLRTTDW  154



>ref|XP_008660086.1| PREDICTED: uncharacterized protein LOC103639071 [Zea mays]
Length=157

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 107/155 (69%), Gaps = 1/155 (1%)
 Frame = +1

Query  1054  MFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQTKDss  1233
             MFQI WTFFSICTGFVYFQEYQVFD LR  M VLG+  VF+GISLLAPDDSK  + KD S
Sbjct  1     MFQIVWTFFSICTGFVYFQEYQVFDTLRIIMCVLGMTFVFVGISLLAPDDSKADR-KDGS  59

Query  1234  lvsasslsNDVERLIMPLEDPQLKDVKSFSHVVLMKAVNLIVKAKAACslslglgddslQ  1413
               S  S+ +      MP+E+    D  SF   V + A +++ KAK+ACS+SLGLG+ ++ 
Sbjct  60    STSEDSIIDIDRNGKMPMEETDTDDSISFVTSVKVSAKHVLSKAKSACSMSLGLGESTIS  119

Query  1414  ASSVLVMPMVSSKITGFRGNGVDQAKLFPGRSQGW  1518
             ASSVLVM MVSS+ TGFRG   D+ K  P R+  W
Sbjct  120   ASSVLVMLMVSSRTTGFRGIRNDRPKYAPLRTTDW  154



>ref|XP_005713339.1| unnamed protein product [Chondrus crispus]
 emb|CDF33536.1| unnamed protein product [Chondrus crispus]
Length=399

 Score =   149 bits (375),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/315 (32%), Positives = 167/315 (53%), Gaps = 25/315 (8%)
 Frame = +1

Query  325   GTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGIIFFALGNSLNFISFGFAA  504
             GTN++KL  + R+    L       + +  P+     W  G   FALG +++F +F FAA
Sbjct  2     GTNIMKLAINRRL----LLPPDERPRLSRLPM-----WTGGFGMFALGTAMSFGAFKFAA  52

Query  505   QSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQ  684
             QSLL+ LGS+QF+S + F+ F+ ++ +          I+ G IF+V FG H +  Y PE+
Sbjct  53    QSLLSGLGSVQFLSQVFFSRFILHEKIEKYAYAGVALIITGCIFIVIFGAHGTKNYRPEE  112

Query  685   LAEKYSNITFLLYCL---ILVLVVAFHHSVYR------RGELLLNVPGNDLKPFWQMLLP  837
             LA  Y    ++ Y L    L  VV+  +S  +      RG    ++  + ++   + +L 
Sbjct  113   LAALYGRSEYVCYLLGAGFLACVVSLSYSSMKQKIMRDRGIGRFDIAKSTIRE--RQVLA  170

Query  838   FSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllH----SWFTYSMLLLFLSTAGFWMA  1005
               ++I S   G+ +V+ AKSLS LL  ++  +        S+ TY ++L F++ A +W+ 
Sbjct  171   VFFSIKSALFGTQAVVLAKSLSMLLIQALHPNPAYSNPLFSYQTYFIILGFIAAATYWVT  230

Query  1006  RLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIGIS  1185
             RLN GL  F+A+ ++PM QI W  FS   G +Y++E+  F       + +G +CV +G++
Sbjct  231   RLNHGLRLFEAVYLIPMMQICWILFSTIAGGIYYEEFNGFGQKEYGAYAVGFVCVLVGVA  290

Query  1186  LLAP-DDSKGTQTKD  1227
             +L P DD+K     D
Sbjct  291   MLCPRDDTKSLNAAD  305



>emb|CBJ28314.1| conserved unknown protein [Ectocarpus siliculosus]
Length=821

 Score =   150 bits (380),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 142/257 (55%), Gaps = 9/257 (4%)
 Frame = +1

Query  436   WRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTF  615
             W +G +    G+ +NF SFGFA QSLLA+LGS+QF+SN+ F   +  + VT ++++ T  
Sbjct  306   WYLGAVLLVAGSLVNFASFGFAPQSLLASLGSVQFISNVVFGKVILREMVTRRIILGTAT  365

Query  616   IVLGNIFLVAFGNHQSPVYTPEQLAEKYS---NITFLLYCLILVLVVAFHHSVYRRGELL  786
             I+LGN   + F  HQ   ++  +L   Y    N   LL   I + + A + S  R  E  
Sbjct  366   IILGNTLTLCFSPHQDDNFSTHELKAFYDAEYNTLLLLELAIALAMHAAYKSFKRSKEQG  425

Query  787   LNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSM  966
                  +DL      ++P +YAI S  +G+ SV+ AK LS LL L+      L S FTY +
Sbjct  426   RPRRHSDL------VMPLAYAICSAIVGTQSVVNAKCLSELLTLTFQGENQLGSIFTYLV  479

Query  967   LLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTM  1146
               ++L T  FW+ R+N+ L+ F  + I+P  Q+ WTFFS+  G  YF+E+     L    
Sbjct  480   FAIWLGTTIFWLVRMNQALAMFHGLFIIPALQVFWTFFSVIDGGFYFEEFHTLHVLGGLG  539

Query  1147  FVLGVMCVFIGISLLAP  1197
             F +GV+ VF G+ LLAP
Sbjct  540   FAVGVLVVFCGVYLLAP  556



>gb|KFM26614.1| NIPA-like protein 3 [Auxenochlorella protothecoides]
Length=418

 Score =   141 bits (356),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 104/256 (41%), Positives = 150/256 (59%), Gaps = 18/256 (7%)
 Frame = +1

Query  448   IIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLG  627
             ++ F  GN LNF+SF FAAQSLLAAL  +QFV+N+ FA  +  +  T +V+ AT  +++G
Sbjct  1     MLLFVAGNVLNFLSFAFAAQSLLAALAVVQFVANVVFARLINGEVATRRVLCATGVVIVG  60

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSN---ITFLLYCLILVLVVAFHHS----VYRRGELL  786
              + LVAFGNH+SPV   + L   Y+    I +L+  L L +V A  H+     Y RG   
Sbjct  61    CVLLVAFGNHESPVMDADDLRHLYTAPAYIGYLVGLLTLAVVAAGVHAYGRKAYERG---  117

Query  787   LNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSM  966
                      P W   +P ++A+ +  +G+ S+++ KSL+ LLR S+     L  W+TY  
Sbjct  118   --------CPKWHHWVPLAFAVYAAALGTQSIVYGKSLAMLLRKSLQGPTQLTHWYTYVA  169

Query  967   LLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTM  1146
             LLLFL+ A FW+ + +E + RF  + ++PM  I W   S+ +G VYFQEY+ F  L T M
Sbjct  170   LLLFLAFAAFWVVKYSEAMRRFPVLTMMPMLMIMWVLISMLSGMVYFQEYRTFTVLSTAM  229

Query  1147  FVLGVMCVFIGISLLA  1194
             FVLG   +  GI LLA
Sbjct  230   FVLGSATLLGGIYLLA  245



>gb|EJK75739.1| hypothetical protein THAOC_02531 [Thalassiosira oceanica]
Length=660

 Score =   141 bits (356),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 150/276 (54%), Gaps = 7/276 (3%)
 Frame = +1

Query  412   KPIIHFQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTI  591
             K  I   TW +G + F  G+ LNF+S+ FAAQS+LA+L S+QFV+N+ F   +    VT 
Sbjct  131   KQPIQSPTWVVGTVIFVSGSLLNFVSYAFAAQSMLASLESVQFVTNLIFGKLLLKARVTQ  190

Query  592   KVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYR  771
              ++  T   V G +  V F + ++   T +++   Y N  ++ Y  ++ ++V      Y 
Sbjct  191   TMLAGTALTVAGTVMAVQFSSKETLDLTSDEIVALYKNPVYIGYLALVFVLVVVLQVAYH  250

Query  772   RGELLLNVPGNDLKP----FWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyl  939
                 L +V    LKP      +++LP  YA+ S   G+ SV+ AK LS LL+ +      
Sbjct  251   LLNKLKSV-ERPLKPQELVLVELVLPCIYAVSSSLFGTQSVIQAKVLSLLLQNNGEEDMF  309

Query  940   lHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQ  1119
               SWFTY+   +++ T   W+ RLN GL  FD++ I+P+ Q  + FF+I +G ++FQE+ 
Sbjct  310   A-SWFTYATATIWILTVVVWLGRLNNGLKLFDSLFIIPLLQCNFIFFAILSGGIFFQEFN  368

Query  1120  VFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQTKD  1227
              FD  +   F  G++ +F G+ LL P   K TQ K+
Sbjct  369   AFDWNQWIGFSFGIVVMFWGLFLLTP-KPKSTQIKE  403



>ref|XP_008341202.1| PREDICTED: uncharacterized protein LOC103404123 [Malus domestica]
Length=151

 Score =   129 bits (325),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 77/136 (57%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = +1

Query  1144  MFVLGVMCVFIGISLLAPDDSKGTQTKD---sslvsasslsNDVERLIMPLEDPQLKDVK  1314
             MF+LG+M VF+GI+LLAPDDS+G + K+      V +SS+  D+ R  +  ED Q++D +
Sbjct  1     MFILGMMSVFVGITLLAPDDSRGAEVKENPSLVSVVSSSIPKDMGRFAVSSEDVQIRDTR  60

Query  1315  SFSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQAKL  1494
             SF   +L+K  + IVKAK AC+LSLG GDDS+ AS+VLVMPMVSSKITGFRGNG D+AK+
Sbjct  61    SFLQGILVKISDAIVKAKTACALSLGFGDDSINASAVLVMPMVSSKITGFRGNGFDRAKI  120

Query  1495  FPGRSQGWRRISVDED  1542
             F  R+ GW ++S+DED
Sbjct  121   FSMRNSGWTKMSMDED  136



>gb|ACG24207.1| hypothetical protein [Zea mays]
Length=81

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  1000  MARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIG  1179
             M RLNEGLS FDAILIVPMFQI WTFFSICTGFVYFQEYQVFD LR  M VLG+  VF+G
Sbjct  1     MERLNEGLSLFDAILIVPMFQIVWTFFSICTGFVYFQEYQVFDTLRIIMCVLGMTFVFVG  60

Query  1180  ISLLAPDDSKGTQTK  1224
             ISLLAPDDSKG   +
Sbjct  61    ISLLAPDDSKGKMVQ  75



>gb|KDO26176.1| hypothetical protein SPRG_08537 [Saprolegnia parasitica CBS 223.65]
Length=324

 Score =   129 bits (325),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 93/311 (30%), Positives = 156/311 (50%), Gaps = 11/311 (4%)
 Frame = +1

Query  283   GAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGIIFFA  462
             G  + L+G+ + NFG N+ K     +  H A        +A  +P      W +GI    
Sbjct  11    GICVCLVGTTLSNFGLNIQKYSFTLQ-AHLA--------EADRRPYTALWQWWVGISCVI  61

Query  463   LGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIFLV  642
             +G+  +F +  FAAQS++  +GS   V+NI FA+F   + +T   +  T FI LG I + 
Sbjct  62    VGSIGDFAALSFAAQSVIMPVGSFTLVANIFFAHFWLKEALTWNDLYGTIFICLGAIIVC  121

Query  643   AFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLKPF-  819
              FG H+S  +T ++L   Y     L Y + +VLV+ F ++     E  L+  G   + + 
Sbjct  122   VFGAHESTSFTLDELIALYERWDMLFYAIFIVLVIVFLYTRVTNSEAALHTHGAASEAYA  181

Query  820   -WQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLSTAGF  996
              ++   P +YA +SG +G+ SV+FAKS   L++ +++         ++ +L     T   
Sbjct  182   VYRKWHPLAYAALSGVVGAQSVMFAKSTGELIKQTVAGDNQFSHVLSFGILAALAVTITT  241

Query  997   WMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFI  1176
                 L  GL  FDA+ IVP+F   +  FS+  G VYF+E++ +   +   F +GV+    
Sbjct  242   QTHVLAMGLKHFDALYIVPVFTCFFITFSVLGGAVYFEEFKSYSLAQAICFPIGVLVTIY  301

Query  1177  GISLLAPDDSK  1209
             GI++LA  D +
Sbjct  302   GITILAKRDMR  312



>ref|XP_008610337.1| hypothetical protein SDRG_06338 [Saprolegnia diclina VS20]
 gb|EQC36231.1| hypothetical protein SDRG_06338 [Saprolegnia diclina VS20]
Length=326

 Score =   129 bits (323),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 93/316 (29%), Positives = 157/316 (50%), Gaps = 11/316 (3%)
 Frame = +1

Query  283   GAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGIIFFA  462
             G  + L+G+ + NFG N+ K     +  H A        +A  +P      W +GI    
Sbjct  13    GICVCLVGTTLSNFGLNIQKYSFTLQ-AHLA--------EADRRPYTALWQWWVGISCVI  63

Query  463   LGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIFLV  642
             +G+  +F +  FAAQS++  +GS   V+NI FA+F   + +T   +  T FI +G I + 
Sbjct  64    VGSIGDFAALSFAAQSVIMPVGSFTLVANIFFAHFWLKEALTRNDLYGTIFICIGAIIVC  123

Query  643   AFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLKPF-  819
              FG H+S  YT ++L   Y     L Y + +VL++AF   +    E  L+  G   + + 
Sbjct  124   VFGAHESTSYTLDELIALYKRWDMLFYAIFIVLMIAFFTLLKTNSEAALHTHGASSEAYA  183

Query  820   -WQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLSTAGF  996
              ++   P +YA +SG +G+ SV+FAKS   L++ + +     +   ++ +L     T   
Sbjct  184   VYRKWHPLAYAALSGVVGAQSVMFAKSTGELIKQTFAGENQFNHVLSFVILAALAVTITT  243

Query  997   WMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFI  1176
                 L  GL  FD++ IVP+F   +  FS+  G VYF+E++ +   +   F +GV+    
Sbjct  244   QTHVLAMGLKHFDSLYIVPVFTCFFITFSVLGGAVYFEEFKSYSLAQGICFPIGVLVTIY  303

Query  1177  GISLLAPDDSKGTQTK  1224
             GI++LA  D +    K
Sbjct  304   GITILAKRDMRSPSAK  319



>dbj|BAB01731.1| unnamed protein product [Arabidopsis thaliana]
Length=151

 Score =   123 bits (309),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 72/138 (52%), Positives = 99/138 (72%), Gaps = 5/138 (4%)
 Frame = +1

Query  1144  MFVLGVMCVFIGISLLAPDDSKGTQTKDsslvsasslsNDV----ERLI-MPLEDPQLKD  1308
             MF+LG+MCVFIGISLLAPDD++G +TKD+S    S +S+ V    +RLI    ED   KD
Sbjct  1     MFILGMMCVFIGISLLAPDDTRGNETKDNSSSLDSIVSSSVPTEEDRLIPQSSEDGHSKD  60

Query  1309  VKSFSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMPMVSSKITGFRGNGVDQA  1488
              +     + MKA +LI K K AC  +LG G+DS+ AS++LVMPMVSSKITGFRGNG+++A
Sbjct  61    TRVVVQGMYMKAADLIAKTKTACLAALGFGEDSINASAILVMPMVSSKITGFRGNGLERA  120

Query  1489  KLFPGRSQGWRRISVDED  1542
             K+   R  GW +++++E+
Sbjct  121   KILSMRGSGWSKLAMEEE  138



>ref|XP_008605809.1| hypothetical protein SDRG_02028 [Saprolegnia diclina VS20]
 gb|EQC40965.1| hypothetical protein SDRG_02028 [Saprolegnia diclina VS20]
Length=356

 Score =   127 bits (319),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 94/318 (30%), Positives = 159/318 (50%), Gaps = 15/318 (5%)
 Frame = +1

Query  280   IGAFINLLGSIIINFGTNLLKLG--HDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             +G  + L+G+ + N G N+ K    H ER+  +             +P      W +G  
Sbjct  8     LGIGMCLVGTTVSNLGLNIQKYSFLHQERLPETQ-----------RRPYNTQWRWWLGFA  56

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                LG+  +F +  FAAQS++  +G+   V+N+ FA++   + +    +  T  IVLG  
Sbjct  57    CVGLGSIADFAALTFAAQSVITPIGAFTLVANLGFAHYWLKEPLGSTDLAGTGLIVLGAT  116

Query  634   FLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLK  813
              +  FG+H+SP Y+ ++L    +  + ++Y + ++ +VAF H V  R E +L   G    
Sbjct  117   AVTIFGSHESPKYSLDELIALSTRGSMVVYAIAILGLVAFFHVVRMRSEQVLRKCGKASP  176

Query  814   PF--WQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLST  987
              +   + L P SYA  +G +G+ SV+FAKS   L++LS+      +   TY +L   + T
Sbjct  177   EYRALEKLHPLSYAGFAGIVGAQSVMFAKSSGELIQLSLQGRNQFNRVLTYVILAGLVLT  236

Query  988   AGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMC  1167
                    L  GL  FDA+ +VP+F   +  FS+  G VYF E+Q F   +   F LGV  
Sbjct  237   ISVQTHMLALGLKNFDALYMVPVFTCFFISFSVLGGAVYFNEFQAFTLYQWICFPLGVAI  296

Query  1168  VFIGISLLAPDDSKGTQT  1221
               +G+ LL+  + + ++T
Sbjct  297   TVVGVILLSRREMRLSET  314



>ref|XP_002903171.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY55595.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=380

 Score =   127 bits (319),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 94/315 (30%), Positives = 155/315 (49%), Gaps = 12/315 (4%)
 Frame = +1

Query  268   GEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIG  447
             G W +G  + ++GSI  N G NL K       K  ++G++    +   +P+     W IG
Sbjct  12    GLWYVGVILTVVGSICTNMGVNLQKFSFMREAKGRSVGDKRGYFR---QPL-----WVIG  63

Query  448   IIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLG  627
             +     G+ L+F++ GF  QSL   +G    V+N+AFA  +  +  T    + T  ++LG
Sbjct  64    LFLVVGGSILDFVALGFMPQSLATPVGGSTMVANVAFASLLLKEKFTKSDAIGTALVLLG  123

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGND  807
              I +  F   +S  YT ++L   Y    F +Y  ++ +     + + ++ EL L   G  
Sbjct  124   IIVVAIFAEKESACYTVDELIALYREPLFAVYATLMGVSCLTLYLLTKKMELTLKQKGR-  182

Query  808   LKPFWQM---LLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLF  978
             + P +Q    L P SY  +SG  G+ SVLFAKS++ L++ +I       ++  Y++ +  
Sbjct  183   MSPEYQRFRKLHPVSYPALSGIFGAQSVLFAKSMAELMKTTIEGDNQFVTFGPYAITVSM  242

Query  979   LSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLG  1158
             L+     +  L  GL +FDA+ +VP+FQ  +   SI  G VYF+E+     L   MF LG
Sbjct  243   LTCVFLQIHWLAHGLQKFDAVFVVPVFQCFFISISIFGGGVYFKEFAKMAPLALGMFSLG  302

Query  1159  VMCVFIGISLLAPDD  1203
              +    G+  LA  D
Sbjct  303   ALITISGVVKLAHRD  317



>gb|ETL91611.1| hypothetical protein L917_09847 [Phytophthora parasitica]
 gb|ETM44924.1| hypothetical protein L914_09898 [Phytophthora parasitica]
 gb|ETO73724.1| hypothetical protein F444_10341 [Phytophthora parasitica P1976]
 gb|ETO73725.1| hypothetical protein, variant [Phytophthora parasitica P1976]
Length=438

 Score =   126 bits (317),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 91/314 (29%), Positives = 150/314 (48%), Gaps = 10/314 (3%)
 Frame = +1

Query  268   GEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIG  447
             G W +G  + ++GSI  N G NL K       K  ++G++    +  +        W IG
Sbjct  12    GLWYVGVILTIVGSICTNMGVNLQKFSFMREAKGRSVGDKRGYFRQPL--------WVIG  63

Query  448   IIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLG  627
             ++    G+ L+F++ GF  QSL   +G    V+N+AFA  +  +  T    + T  ++LG
Sbjct  64    LLLVVGGSVLDFVALGFMPQSLATPVGGSTMVANVAFASLLLKEKFTKSDAIGTALVLLG  123

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGND  807
              I +  F   +S  YT ++L   Y    F +Y  ++ +       + R+ E  L   G  
Sbjct  124   IIVVAIFAEKESACYTVDELIALYREPLFAVYATLMSVSCLLLFLLTRKMEHTLKHKGRT  183

Query  808   LKPF--WQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFL  981
                +  ++ L P SY  +SG  G+ SVLFAKS++ L++ +I       ++  Y++    L
Sbjct  184   SPEYTRFRKLHPVSYPALSGIFGAQSVLFAKSMAELMKTTIEGDNQFVTFGPYAIAFSML  243

Query  982   STAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGV  1161
             +     +  L  GL +FDA+ +VP+FQ  +   SI  G VYF+E+    +L   MF LG 
Sbjct  244   TCVFMQIHWLAHGLQKFDAVFVVPVFQCFFISISIFGGGVYFKEFAKMTSLALGMFSLGA  303

Query  1162  MCVFIGISLLAPDD  1203
                  G+  LA  D
Sbjct  304   FITISGVVKLAHRD  317



>gb|ETI45111.1| hypothetical protein F443_10241 [Phytophthora parasitica P1569]
 gb|ETI45112.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETK85086.1| hypothetical protein L915_10018 [Phytophthora parasitica]
 gb|ETL38510.1| hypothetical protein L916_09923 [Phytophthora parasitica]
 gb|ETP14929.1| hypothetical protein F441_10177 [Phytophthora parasitica CJ01A1]
 gb|ETP42996.1| hypothetical protein F442_10145 [Phytophthora parasitica P10297]
Length=438

 Score =   126 bits (316),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 91/314 (29%), Positives = 149/314 (47%), Gaps = 10/314 (3%)
 Frame = +1

Query  268   GEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIG  447
             G W +G  + ++GSI  N G NL K       K  ++G++    +  +        W IG
Sbjct  12    GLWYVGVILTIVGSICTNMGVNLQKFSFMREAKGRSVGDKRGYFRQPL--------WVIG  63

Query  448   IIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLG  627
             ++    G+ L+F++ GF  QSL   +G    V+N+AFA  +  +  T    + T  ++LG
Sbjct  64    LLLVVGGSVLDFVALGFMPQSLATPVGGSTMVANVAFASLLLKEKFTKSDAIGTALVLLG  123

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGND  807
              I +  F   +S  YT ++L   Y    F +Y  ++ +       + R+ E  L   G  
Sbjct  124   IIVVAIFAEKESACYTVDELIALYREPLFAVYATLMSVSCLLLFLLTRKMEHTLKHKGRT  183

Query  808   LKPF--WQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFL  981
                +  ++ L P SY  +SG  G+ SVLFAKS++ L++ +I       ++  Y++    L
Sbjct  184   SPEYTRFRKLHPVSYPALSGIFGAQSVLFAKSMAELMKTTIEGDNQFVTFGPYAIAFSML  243

Query  982   STAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGV  1161
             +     +  L  GL +FDA+ +VP+FQ  +   SI  G VYF+E+     L   MF LG 
Sbjct  244   TCVFMQIHWLAHGLQKFDAVFVVPVFQCFFISISIFGGGVYFKEFAKMTPLALGMFSLGA  303

Query  1162  MCVFIGISLLAPDD  1203
                  G+  LA  D
Sbjct  304   FITISGVVKLAHRD  317



>ref|XP_008893321.1| hypothetical protein PPTG_01689 [Phytophthora parasitica INRA-310]
 gb|ETN21538.1| hypothetical protein PPTG_01689 [Phytophthora parasitica INRA-310]
Length=438

 Score =   124 bits (311),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 90/314 (29%), Positives = 148/314 (47%), Gaps = 10/314 (3%)
 Frame = +1

Query  268   GEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIG  447
             G W +G  + ++GSI  N G NL K       K  ++G++    +  +        W IG
Sbjct  12    GLWYVGVILTIVGSICTNMGVNLQKFSFMREAKGRSVGDKRGYFRQPL--------WVIG  63

Query  448   IIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLG  627
             ++    G+ L+F++ GF  QSL   +G    V+N+AFA  +  +  T    + T  ++LG
Sbjct  64    LLLVVGGSVLDFVALGFMPQSLATPVGGSTMVANVAFASLLLKEKFTKSDAIGTALVLLG  123

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGND  807
                +  F   +S  YT ++L   Y    F +Y  ++ +       + R+ E  L   G  
Sbjct  124   ITVVAIFAEKESACYTVDELIALYREPLFAVYATLMSVSCLLLFLLTRKMEHTLKHKGRT  183

Query  808   LKPF--WQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFL  981
                +  ++ L P SY  +SG  G+ SVLFAKS++ L++ +I       ++  Y++    L
Sbjct  184   SPEYTRFRKLHPVSYPALSGIFGAQSVLFAKSMAELMKTTIEGDNQFVTFGPYAIAFSML  243

Query  982   STAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGV  1161
             +     +  L  GL +FDA+ +VP+FQ  +   SI  G VYF+E+     L   MF LG 
Sbjct  244   TCVFMQIHWLAHGLQKFDAVFVVPVFQCFFISISIFGGGVYFKEFAKMTPLALGMFSLGA  303

Query  1162  MCVFIGISLLAPDD  1203
                  G+  LA  D
Sbjct  304   FITISGVVKLAHRD  317



>ref|XP_002863735.1| hypothetical protein ARALYDRAFT_917443 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39994.1| hypothetical protein ARALYDRAFT_917443 [Arabidopsis lyrata subsp. 
lyrata]
Length=132

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 2/81 (2%)
 Frame = +1

Query  265  MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
            MGEWVIGAFIN+ GS+ INFGTNLLKLGH+ER + +   N G  GK  +KPIIHFQTWR+
Sbjct  1    MGEWVIGAFINIFGSVAINFGTNLLKLGHNERERLALQDNGG--GKMPLKPIIHFQTWRV  58

Query  445  GIIFFALGNSLNFISFGFAAQ  507
            GI+ F LGN LNFISFG+AAQ
Sbjct  59   GILVFLLGNCLNFISFGYAAQ  79



>ref|XP_009829195.1| hypothetical protein H257_05884 [Aphanomyces astaci]
 gb|ETV81337.1| hypothetical protein H257_05884 [Aphanomyces astaci]
Length=480

 Score =   124 bits (311),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 92/310 (30%), Positives = 158/310 (51%), Gaps = 11/310 (4%)
 Frame = +1

Query  280   IGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGIIFF  459
             IG  I L+GS I NFG N+ K  +   ++     +E        KP      W +G    
Sbjct  17    IGIGICLIGSTISNFGLNIQK--YSFMLQQHLPDHE-------RKPYNTQWRWWLGFAGV  67

Query  460   ALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIFL  639
              +G+  +F +  FAAQS++  +G+   V NI FA++   + +T   ++ T  I +G + +
Sbjct  68    GIGSVADFAALSFAAQSIIMPIGAFTLVCNIFFAHYWLKEKLTRNDLIGTVLICIGAVVV  127

Query  640   VAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLKPF  819
               +G+H++  YT E L   Y     L+Y ++++ VV     + +R EL+L   G     +
Sbjct  128   TIYGSHENVEYTLEILIHLYYRWDMLIYLIVIIAVVWVLIGMLKRAELVLKKKGPASLEY  187

Query  820   WQMLL--PFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLSTAG  993
               +L   P +YA ++G  G+ SV+FAKS   LL+ ++        + TY +++  + T  
Sbjct  188   KAVLKLHPLTYAGLAGVFGAQSVMFAKSSGELLKQTLRGDNQFDKFLTYVIIVALVITIS  247

Query  994   FWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVF  1173
                  L+ GL  FDA+ IVP+FQ  +  FS+  G VYF+E++ F   +  +F +GV+   
Sbjct  248   LETHCLSLGLKYFDALYIVPVFQCFFITFSVIGGAVYFEEFKDFTMTQWIVFPIGVLITI  307

Query  1174  IGISLLAPDD  1203
              G+ +L+  D
Sbjct  308   AGVIVLSSRD  317



>ref|XP_009822771.1| hypothetical protein H257_01318 [Aphanomyces astaci]
 gb|ETV87908.1| hypothetical protein H257_01318 [Aphanomyces astaci]
Length=690

 Score =   125 bits (314),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 102/318 (32%), Positives = 159/318 (50%), Gaps = 18/318 (6%)
 Frame = +1

Query  268   GEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT--WR  441
             G WV G  I+++ S + + G NL K    + +K     NE T  +   +P+  F+   W 
Sbjct  163   GAWVAGFTISVVFSFLSSIGINLQK----KALKQ----NEVTAHETGTQPMSPFRLPLWT  214

Query  442   IGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIV  621
             +G      G+ L+FI+FG A QSLLA L ++  V N+  A     + +T K + AT  I 
Sbjct  215   LGFCLIVAGSLLDFIAFGLAPQSLLAPLAALTLVWNMMLAPCFNKERLTRKDIWATLIIF  274

Query  622   LGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPG  801
             LG    V F NH SP YT + L   Y N   LLY  I+ +++  H+++ +  E  LN+  
Sbjct  275   LGATLAVVFANHNSPSYTLDDLKHLYRNPLTLLYFAIVFVLIVLHYAMIKCVE-HLNLAS  333

Query  802   NDLK-------PFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTY  960
             +  +         W  +   +YA + G +G  SVLFAKS   L++  ++         TY
Sbjct  334   HRHRIINFGDPSVWSTVRLVAYAGLGGLMGGQSVLFAKSTVELVKSLLAGGDCFTHPETY  393

Query  961   SMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRT  1140
              +++         M  LN GL+ +DA+ +VP++Q  W    +  G VYFQE + F   + 
Sbjct  394   CIIVAMGGCLVAQMHFLNGGLANYDALSVVPIYQAYWIISGVMGGAVYFQEIRSFSEFQA  453

Query  1141  TMFVLGVMCVFIGISLLA  1194
              MFVLG++    G++LLA
Sbjct  454   CMFVLGILTTIGGVALLA  471



>gb|KDO16746.1| hypothetical protein SPRG_17766 [Saprolegnia parasitica CBS 223.65]
Length=324

 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 140/278 (50%), Gaps = 3/278 (1%)
 Frame = +1

Query  397   GKAAMKPIIHFQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFN  576
              +A  +P      W +GI    +G+  +F +  FAAQS++  +GS   V+NI FA+F   
Sbjct  41    AEADRRPYTALWQWWVGISCVIVGSIGDFAALSFAAQSVIMPVGSFTLVANIFFAHFWLK  100

Query  577   KTVTIKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFH  756
             + +T   +  T FI LG I +  FG H+S  YT ++L   Y     L Y   ++LV+ F 
Sbjct  101   EALTWNDLYGTIFICLGAIIVCVFGAHESTSYTLDELIALYERWDMLFYASFILLVIVFL  160

Query  757   HSVYRRGELLLNVPGNDLKPF--WQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisn  930
             +++  + E  L   G   + +  ++   P +YA +SG +G+ SV+FAKS   L++ + + 
Sbjct  161   YTL-TKSEAALRTHGAASEAYAVYRKWHPLAYAALSGVVGAQSVMFAKSTGELIKQTFAG  219

Query  931   syllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQ  1110
                 +   ++ +L     T       L  GL  FDA+ IVP+F   +  FS+  G VYF+
Sbjct  220   DNQFNHVLSFVILAALAVTITTQTHVLAMGLKHFDALYIVPVFTCFFITFSVLGGAVYFE  279

Query  1111  EYQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQTK  1224
             E++ +   +   F +GV     GI++LA  D +    K
Sbjct  280   EFKSYSLAQAICFPIGVFVTIYGITILAKRDMRSPSVK  317



>ref|XP_008875746.1| hypothetical protein H310_10995 [Aphanomyces invadans]
 gb|ETV95553.1| hypothetical protein H310_10995 [Aphanomyces invadans]
Length=471

 Score =   122 bits (307),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 159/311 (51%), Gaps = 13/311 (4%)
 Frame = +1

Query  280   IGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGIIFF  459
             +G  I L+GS + NFG N+ K  +   ++     +E        KP      W +G    
Sbjct  15    VGITICLVGSTVSNFGLNIQK--YSFMLQQHLPDHE-------RKPYNTQWRWWLGFFGV  65

Query  460   ALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIFL  639
              LG+  +F +  FAAQS++  +G+   V NI FA++   + +T   ++ T  I +G + +
Sbjct  66    GLGSVADFAALSFAAQSIIMPIGAFTLVCNIFFAHYWLKEKLTRNDLIGTILICIGAVVV  125

Query  640   VAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPG---NDL  810
               +G+H++  YT E L   Y     L+Y L+++ VV     + ++ E +L   G   N+ 
Sbjct  126   TIYGSHENIEYTLETLINLYYRWDMLVYLLVILAVVWTLIGMLKKAEFVLKKKGPTSNEY  185

Query  811   KPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLSTA  990
             K   +M  P +YA ++G  G+ SV+FAKS   LL+ S+  S     + TY ++   + T 
Sbjct  186   KAVLKM-HPLTYAGLAGVFGAQSVMFAKSTGELLKQSLKGSNQFDKFLTYVIIAALVLTI  244

Query  991   GFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCV  1170
                   L+ GL  FDA+ IVP+FQ  +  FS+  G VYF+E++ F   +  +F LGV+  
Sbjct  245   SLETHCLSLGLKYFDALYIVPVFQCFFITFSVIGGAVYFEEFKHFTTTQWIVFPLGVLIT  304

Query  1171  FIGISLLAPDD  1203
               G+ +L+  +
Sbjct  305   IAGVVVLSSRE  315



>ref|XP_005703095.1| hypothetical protein Gasu_58080 [Galdieria sulphuraria]
 gb|EME26575.1| hypothetical protein Gasu_58080 [Galdieria sulphuraria]
Length=397

 Score =   121 bits (303),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 94/327 (29%), Positives = 148/327 (45%), Gaps = 21/327 (6%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
              W IG  +++LGS+  N G NL KL  ++R+  +         + +  P+          
Sbjct  25    SWWIGIVLSVLGSVGTNLGVNLQKLAINQRLMLA----PSQRRRLSQTPLWLLGL-----  75

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGN  630
               F   N   F S+ +AAQS+LA L S+QF+S++ FA F+  +   +     T  I+ G 
Sbjct  76    FLFLFSNVTGFFSYRYAAQSVLAGLSSLQFLSHVLFARFILKEQTDMNAYYGTALIISGC  135

Query  631   IFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVY---------RRGEL  783
              F+V FG H++  Y  E L   +    F+ Y  ++  +     + Y         R G  
Sbjct  136   FFVVLFGKHEARAYDVEDLILLFGKSPFVCYGFVIAFISVISSTTYTQIKQKVARRHGVA  195

Query  784   LLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWF-TY  960
                     L+      L   YA+ S   G+FSV+ AK  S L    IS+     +++ TY
Sbjct  196   KFEPTLASLRE--GQFLAILYALSSAVWGTFSVVLAKGSSMLFAQVISSFPGPLTYYETY  253

Query  961   SMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRT  1140
              + L   + A FWM RLN  L  FD     PM QI W  FS+  G +Y++E+  ++    
Sbjct  254   FIPLGLTAAALFWMNRLNHALKLFDVSYAFPMMQICWILFSLLAGGIYYEEFLQWNKRDI  313

Query  1141  TMFVLGVMCVFIGISLLAPDDSKGTQT  1221
               F +G+  +F G+ L+ P   K  +T
Sbjct  314   GFFGIGICLLFGGVVLICPAAKKDHRT  340



>gb|KDO27804.1| hypothetical protein SPRG_07403 [Saprolegnia parasitica CBS 223.65]
Length=755

 Score =   123 bits (309),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 93/318 (29%), Positives = 156/318 (49%), Gaps = 15/318 (5%)
 Frame = +1

Query  280   IGAFINLLGSIIINFGTNLLKLG--HDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             +G  + L+G+ + N G N+ K    H  R+  +             +P      W +G  
Sbjct  8     LGIGMCLVGTTVSNLGLNIQKYSFLHQVRLPETQ-----------RRPYTTQWRWWLGFA  56

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                LG+  +F +  FAAQS++  +G+   V+N+ FA++   + +    +  T  IVLG  
Sbjct  57    CVGLGSIADFAALTFAAQSVITPIGAFTLVANLCFAHYWLKEPLCRTDVAGTGLIVLGAT  116

Query  634   FLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLK  813
              +  FG+H+SP Y+ ++L   Y   +  +Y + ++ +V F H V  R E +L   G    
Sbjct  117   TVAIFGSHESPEYSLDELIALYMRGSMAVYAIAILGLVVFFHVVLMRSEQVLRKCGKASP  176

Query  814   PF--WQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLST  987
              +   + L P SYA  +G +G+ SV+FAKS   L++LS+      +   TY +L   + T
Sbjct  177   EYRALEKLHPLSYAGFAGIVGAQSVMFAKSSGELIQLSLQGRNQFNRVLTYVILAGLVLT  236

Query  988   AGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMC  1167
                    L  GL  FDA+ +VP+F   +  FS+  G VYF E+Q F   ++  F LGV  
Sbjct  237   ISVQTHMLALGLKHFDALYMVPVFTCFFISFSVLGGAVYFDEFQAFTLYQSICFPLGVAI  296

Query  1168  VFIGISLLAPDDSKGTQT  1221
                G+ LL+  + + ++T
Sbjct  297   TVGGVILLSRREMRLSET  314


 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 93/308 (30%), Positives = 148/308 (48%), Gaps = 25/308 (8%)
 Frame = +1

Query  280   IGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGIIFF  459
             IG  I L+GS I N G N+ K      I  + L +         KP      W +G    
Sbjct  357   IGIGICLIGSTISNLGLNIQKYSF---IMQAHLPDH------ERKPYNTQWRWWLGFFGV  407

Query  460   ALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIFL  639
              +G+  +F +  FAAQS++  +G+   V NI FA+F   + +T   +  T +IV+G + +
Sbjct  408   GVGSIADFAALTFAAQSIIMPVGAFTLVCNIMFAHFWLKEKLTRNDLWGTVWIVIGAVMV  467

Query  640   VAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLKPF  819
               FG+H+S  YT  +L   Y     L+Y L+ ++ V    + Y+            LK  
Sbjct  468   TIFGSHESTNYTLHELLRLYYRWDMLIY-LVFIIGVGALSTEYK----------TVLKTH  516

Query  820   WQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLSTAGFW  999
                  P +YA ++G  G+ SV+FAKS   L++ S S     +   TY +L+  + T    
Sbjct  517   -----PLAYAGLAGVFGAQSVMFAKSTGELIKQSASGDNQFNKGLTYVILVCLVLTIAMQ  571

Query  1000  MARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIG  1179
                L+ GL  FDA+ IVP+FQ  +  FS+  G +YFQE++ +   +   F LGV     G
Sbjct  572   THLLSLGLKYFDALYIVPVFQCFFITFSVLGGAIYFQEFKDYSVTQYICFPLGVFITIYG  631

Query  1180  ISLLAPDD  1203
             + +L+  +
Sbjct  632   VWVLSSRE  639



>ref|XP_009531108.1| hypothetical protein PHYSODRAFT_511769 [Phytophthora sojae]
 gb|EGZ13679.1| hypothetical protein PHYSODRAFT_511769 [Phytophthora sojae]
Length=464

 Score =   121 bits (303),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 90/316 (28%), Positives = 147/316 (47%), Gaps = 14/316 (4%)
 Frame = +1

Query  268   GEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT--WR  441
             G W +G  ++++GSI  N G NL K       K          G++ +    +F+   W 
Sbjct  12    GLWYVGVILSIVGSICTNMGVNLQKFSFMREAK----------GRSVVDKRGYFRQPLWV  61

Query  442   IGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIV  621
             IG++    G+ L+F++ GF  QSL   +G    V+N+ FA     +  T    + T  ++
Sbjct  62    IGLLLVVGGSILDFVALGFLPQSLATPVGGSTMVANVVFASLFLKEKFTRSDAIGTALVL  121

Query  622   LGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPG  801
             LG I +  F   +S  YT  +L   Y    F +Y  ++ +       + R+ E  L   G
Sbjct  122   LGIIVVATFAEKESKCYTVHELVALYREPLFAVYATLMCVSCVVLFLLVRKMEQTLRHKG  181

Query  802   NDLKPF--WQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLL  975
                  +  ++ L P SY  +SG  G+ SVLFAKS++ L++ +I       ++  Y++ L 
Sbjct  182   RTSPEYNRFRKLHPVSYPALSGIFGAQSVLFAKSMAELMKTTIEGDNQFVTFGAYAITLS  241

Query  976   FLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVL  1155
                     +  L  GL +FDA+ +VP+FQ  +   SI  G VYF+E+     L   MF +
Sbjct  242   MFLCVFLQIHWLAHGLQKFDAVFVVPVFQCFFISVSIFGGGVYFKEFAQMSPLALAMFTV  301

Query  1156  GVMCVFIGISLLAPDD  1203
             G +    G+  LA  D
Sbjct  302   GAIITISGVVKLAHRD  317



>ref|XP_009532339.1| hypothetical protein PHYSODRAFT_516367 [Phytophthora sojae]
 gb|EGZ12006.1| hypothetical protein PHYSODRAFT_516367 [Phytophthora sojae]
Length=647

 Score =   122 bits (307),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 96/319 (30%), Positives = 158/319 (50%), Gaps = 28/319 (9%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             WVIG  I ++ S + + G NL K    + +K + LG E        KP      W +G +
Sbjct  135   WVIGFTIAVVFSFLASVGINLQK----KALKQNELGPEP-------KPAYQLPLWTLGFV  183

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
               A+G+ L+F++FG A QSLLA L ++  V N+  A     + +T K +V+T  I +G  
Sbjct  184   LCAVGSVLDFVAFGLAPQSLLAPLAALTLVWNMMLAPCFNKEKLTKKDIVSTLIIFVGAT  243

Query  634   FLVAFGNHQSPVYTPEQLAEKYSN-ITFLLYCLILVLVVAFHHSV----------YRRGE  780
               V F +H SP Y  + L + Y + +T + +C++++ +VA   ++           R   
Sbjct  244   IAVVFASHTSPSYNLDMLMQLYRDPLTIVYFCVVVLTIVAHFSAIKVVDTFCLMSKRHRI  303

Query  781   LLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWF-T  957
             + +  PG      W  +    YA ++GT+G  SVLFAKS + L +   +      + + T
Sbjct  304   IQVGTPG-----MWSTIRLVGYAGLAGTLGGQSVLFAKSTAELFKGVFNGDASCFAHYQT  358

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             Y +    +      +  LN GL  +DA+ +VP++Q  W    +  G +YFQE + F  L+
Sbjct  359   YLIAFALVVCLCLQIKYLNGGLVHYDALSMVPVYQAYWVISGVLGGVIYFQEIRTFSVLQ  418

Query  1138  TTMFVLGVMCVFIGISLLA  1194
               MFVLG+     G+ LL+
Sbjct  419   AVMFVLGIGVSIFGVVLLS  437



>ref|XP_008605808.1| hypothetical protein SDRG_02027 [Saprolegnia diclina VS20]
 gb|EQC40964.1| hypothetical protein SDRG_02027 [Saprolegnia diclina VS20]
Length=432

 Score =   119 bits (297),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 94/310 (30%), Positives = 154/310 (50%), Gaps = 11/310 (4%)
 Frame = +1

Query  280   IGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGIIFF  459
             IG  I L+GS I N G N+ K      I  + L +         KP      W +G    
Sbjct  13    IGIGICLIGSTISNLGLNIQKYSF---IMQAHLPDH------ERKPYNTQWRWWLGFFGV  63

Query  460   ALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIFL  639
              +G+  +F +  FAAQS++  +G+   V NI FA+F   + +T   +  T +IV+G + +
Sbjct  64    GVGSIADFAALTFAAQSIIMPVGAFTLVCNIVFAHFWLKEKLTRNDLWGTVWIVVGAVMV  123

Query  640   VAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLKPF  819
               FG+H++  YT  +L   Y     L+Y + ++ V+ F +S+    E +L   G     +
Sbjct  124   TIFGSHENTNYTLHELLRLYYRWDMLIYLVFIIGVLFFLYSMLMNAERILKKKGALSTEY  183

Query  820   WQMLL--PFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLSTAG  993
               +L   P +YA ++G  G+ SV+FAKS   L++ S S     +   TY +L+  + T  
Sbjct  184   KSVLKTHPLAYAGLAGVFGAQSVMFAKSTGELIKQSASGDNQFNKGLTYVILVGLVLTIS  243

Query  994   FWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVF  1173
                  L+ GL  FDA+ IVP+FQ  +  FS+  G +YFQE++ +   +   F LGV    
Sbjct  244   MQTHLLSLGLKYFDALYIVPVFQCFFITFSVLGGAIYFQEFKDYTVTQYICFPLGVFITI  303

Query  1174  IGISLLAPDD  1203
              G+ +L+  +
Sbjct  304   YGVWVLSSRE  313



>ref|XP_008870043.1| hypothetical protein H310_06676 [Aphanomyces invadans]
 gb|ETW01045.1| hypothetical protein H310_06676 [Aphanomyces invadans]
Length=683

 Score =   120 bits (301),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 101/317 (32%), Positives = 155/317 (49%), Gaps = 16/317 (5%)
 Frame = +1

Query  268   GEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT--WR  441
             G WV G  I+++ S + + G NL K    +        NE T  +   +P+  F+   W 
Sbjct  158   GAWVAGFTISVVFSFLSSVGINLQKRALKQ--------NEVTAHETGTQPLSPFRLPLWT  209

Query  442   IGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIV  621
             +G      G+ L+FI+FG A QSLLA L ++  V N+  A     + ++ K + AT  I 
Sbjct  210   LGFCLIVAGSLLDFIAFGLAPQSLLAPLAALTLVWNMMLAPCFNKERLSRKDIWATLIIF  269

Query  622   LGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGE-LLLNVP  798
             LG    V F NH SP YT + L   Y N   LLY  I+ +++  H+ V +  E L L   
Sbjct  270   LGATLAVVFANHNSPSYTLDDLKHLYRNSLTLLYFAIVFVLILLHYVVIKCVEHLHLASH  329

Query  799   GNDLKPF-----WQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYS  963
              + +  F     W  +   +YA + G +G  SVLFAKS   L++   +         TY 
Sbjct  330   RHRIINFGDPSVWSTVRLVAYAGLGGLMGGQSVLFAKSTIELVKSLFAGGDCFTHAETYC  389

Query  964   MLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTT  1143
             +++         M  LN GL+ +DA+ +VP++Q  W    +  G VYFQE + F   +  
Sbjct  390   IIVAMGGCLIAQMHFLNGGLANYDALSVVPIYQAYWIISGVMGGAVYFQEIRSFSEFQAC  449

Query  1144  MFVLGVMCVFIGISLLA  1194
             MFV+G++    G++LLA
Sbjct  450   MFVVGILTTIGGVALLA  466



>ref|XP_008612411.1| hypothetical protein SDRG_08308 [Saprolegnia diclina VS20]
 gb|EQC34099.1| hypothetical protein SDRG_08308 [Saprolegnia diclina VS20]
Length=635

 Score =   119 bits (297),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 96/316 (30%), Positives = 164/316 (52%), Gaps = 14/316 (4%)
 Frame = +1

Query  268   GEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIG  447
             G W+ G  I+++ S + + G NL K    + +K + L  + +N  A + P      W +G
Sbjct  157   GAWIAGFVISVVFSFLASVGINLQK----KALKQNELKAQESN-TAPLSPF-RLPLWTLG  210

Query  448   IIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLG  627
              +   +G+ L+F++FG A QSLLA L ++  V N+  A     + ++ K + AT  I LG
Sbjct  211   FVLILIGSLLDFVAFGLAPQSLLAPLAALTLVWNMLLAPCFNKERLSRKDIWATLIIFLG  270

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGND  807
                 V F +H SP YT + L   Y N   ++Y +I+VL++  H+++ +  E  LN+  + 
Sbjct  271   ATLAVVFASHNSPSYTLDDLKLLYDNTYTIVYFVIVVLLILLHYAMIKFVE-HLNLASSR  329

Query  808   LK-------PFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSM  966
              +         W  +   +Y+ + G +G  SVLFAKS + L++  I+         TY++
Sbjct  330   HRMINVGQPAMWSTVRLVAYSGMGGLMGGQSVLFAKSTAELVKSFINGGDCFTHPETYAI  389

Query  967   LLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTM  1146
             ++         M  LN GL  +DA+ +VP++Q  W    +  G VYF+E + F   + +M
Sbjct  390   IVALGFCLVLQMHFLNGGLVNYDALSVVPIYQAYWIISGVMGGAVYFEEIRSFSEFQASM  449

Query  1147  FVLGVMCVFIGISLLA  1194
             FVLG++    G++LLA
Sbjct  450   FVLGILTTIGGVALLA  465



>ref|XP_008875745.1| hypothetical protein, variant [Aphanomyces invadans]
 gb|ETV95552.1| hypothetical protein, variant [Aphanomyces invadans]
Length=337

 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 82/267 (31%), Positives = 141/267 (53%), Gaps = 4/267 (1%)
 Frame = +1

Query  412   KPIIHFQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTI  591
             KP      W +G +   +G+  +F +  FAAQS++  +G+   V NI FA++   + +T 
Sbjct  12    KPYNTQWRWWLGFLGVGIGSVADFAALSFAAQSIIMPIGAFTLVCNIFFAHYWLKEKLTR  71

Query  592   KVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYR  771
               ++ T  I +G + +  FG H++  YT + L   Y     L+Y L+L++V+     + +
Sbjct  72    NDLIGTILICIGAVLVTVFGAHENTEYTLDILIHLYYRWDMLIYLLVLLVVLWVLIGMLK  131

Query  772   RGELLLNVPG---NDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyll  942
             + E +L   G   N+ K   + + P SYA ++GT G+ SV+FAKS   L++ S+      
Sbjct  132   KAEAVLKKKGPTSNEYKTVLK-IHPLSYAGLAGTFGAQSVMFAKSTGELIKQSVKGDNQF  190

Query  943   HSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQV  1122
               + TY ++   + T       L+ GL  FDA+ IVP+FQ  +  FS+  G VYF+E++ 
Sbjct  191   DKFLTYVIIAALVLTISLQTHCLSLGLKYFDALYIVPVFQCFFITFSVIGGAVYFEEFKD  250

Query  1123  FDALRTTMFVLGVMCVFIGISLLAPDD  1203
             F   +  +F LGV+    G+ +L+  D
Sbjct  251   FSTTQWIVFPLGVLVTIAGVVVLSSRD  277



>emb|CCA16969.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=649

 Score =   118 bits (295),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 96/313 (31%), Positives = 153/313 (49%), Gaps = 12/313 (4%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             WV+G  I ++ S + + G NL K    + +K + L       +    P+     W IG +
Sbjct  148   WVLGFSIAIIFSFLASVGINLQK----KALKQNELS--ANEHEQEPLPVYRLPLWVIGFV  201

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                 G+ L+F++FG A QSLLA L ++  V N+  A     + +  K +VAT  I  G  
Sbjct  202   LIVAGSILDFVAFGLAPQSLLAPLAALTLVWNMMLAPCFNKEKLECKDIVATLVIFAGAT  261

Query  634   FLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELL-LNVPGNDL  810
               V F +H +P YT   L   Y N+    Y   +++ +  H+ + +  E   LN   +  
Sbjct  262   LAVVFASHTTPSYTLTMLLALYENVLTCGYFAFVIVCIVLHYGMIKAVETCNLNTRQHHF  321

Query  811   -----KPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLL  975
                    FW  +    YA ++GT+G  SVLFAKS + LL+ S+S       + TY+ ++ 
Sbjct  322   IEFGTPAFWTRIRMIGYAGLAGTLGGQSVLFAKSCAELLKSSMSGDSPFKHFETYAFIIA  381

Query  976   FLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVL  1155
                   F +  LN GL  FDA+L+VP++Q  W   S+  G +YFQE + F  ++   FV+
Sbjct  382   LFVCLLFQVHFLNCGLLHFDALLMVPVYQAYWIVSSVLGGAIYFQEIRSFSVVQAACFVI  441

Query  1156  GVMCVFIGISLLA  1194
             G+     G+ LL+
Sbjct  442   GITTTIGGVILLS  454



>ref|XP_009829196.1| hypothetical protein H257_05885 [Aphanomyces astaci]
 gb|ETV81338.1| hypothetical protein H257_05885 [Aphanomyces astaci]
Length=338

 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 152/314 (48%), Gaps = 17/314 (5%)
 Frame = +1

Query  277   VIGAFINLLGSIIINFGTNLLKLG---HDERIKHSALGNEGTNGKAAMKPIIHFQTWRIG  447
             V G  + L+G+ I NFG N+ K      + + +H              KP      W +G
Sbjct  13    VTGIAMCLVGTTISNFGLNIQKYSFMLQERQPEHD------------RKPYNTQWRWWLG  60

Query  448   IIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLG  627
             +   A+G+  +F +  +AAQS++A +G+   V+NI FA++   + +    ++ T  I +G
Sbjct  61    LFGVAVGSIADFAALTYAAQSVIAPVGAFTLVANIFFAHYWLRERLGRNDLIGTMLICIG  120

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN-  804
              I +  FG+H S  +T ++L   Y     L+Y   +  V+    +   R E  L V GN 
Sbjct  121   AIMVTVFGSHSSTSHTLDELLALYYRWDMLVYACAVCAVLIGLFTALVRSEDALRVHGNL  180

Query  805   -DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFL  981
              D    ++ + P +Y+ ++G  G+ SV+FAKS   L++ +           +Y +L    
Sbjct  181   SDEYKTFRKIHPLAYSGLAGVWGAQSVMFAKSTGELIKQTAHGLNQFDKVPSYIILACLA  240

Query  982   STAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGV  1161
              T       L+ GL  FDA+ IVP+F   +  FS+  G VYF+E++ F  ++   F  GV
Sbjct  241   GTITMQTHLLSLGLKSFDALYIVPVFTCFFITFSVLGGAVYFEEFKSFGLMQWLGFPCGV  300

Query  1162  MCVFIGISLLAPDD  1203
             +    G+++L+  D
Sbjct  301   VVTICGVAVLSKRD  314



>ref|XP_008875744.1| hypothetical protein H310_10994 [Aphanomyces invadans]
 gb|ETV95551.1| hypothetical protein H310_10994 [Aphanomyces invadans]
Length=425

 Score =   115 bits (287),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 81/266 (30%), Positives = 139/266 (52%), Gaps = 2/266 (1%)
 Frame = +1

Query  412   KPIIHFQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTI  591
             KP      W +G +   +G+  +F +  FAAQS++  +G+   V NI FA++   + +T 
Sbjct  12    KPYNTQWRWWLGFLGVGIGSVADFAALSFAAQSIIMPIGAFTLVCNIFFAHYWLKEKLTR  71

Query  592   KVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYR  771
               ++ T  I +G + +  FG H++  YT + L   Y     L+Y L+L++V+     + +
Sbjct  72    NDLIGTILICIGAVLVTVFGAHENTEYTLDILIHLYYRWDMLIYLLVLLVVLWVLIGMLK  131

Query  772   RGELLLNVPGNDLKPFWQMLL--PFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllH  945
             + E +L   G     +  +L   P SYA ++GT G+ SV+FAKS   L++ S+       
Sbjct  132   KAEAVLKKKGPTSNEYKTVLKIHPLSYAGLAGTFGAQSVMFAKSTGELIKQSVKGDNQFD  191

Query  946   SWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVF  1125
              + TY ++   + T       L+ GL  FDA+ IVP+FQ  +  FS+  G VYF+E++ F
Sbjct  192   KFLTYVIIAALVLTISLQTHCLSLGLKYFDALYIVPVFQCFFITFSVIGGAVYFEEFKDF  251

Query  1126  DALRTTMFVLGVMCVFIGISLLAPDD  1203
                +  +F LGV+    G+ +L+  D
Sbjct  252   STTQWIVFPLGVLVTIAGVVVLSSRD  277



>emb|CCI47841.1| unnamed protein product [Albugo candida]
Length=601

 Score =   117 bits (292),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 97/314 (31%), Positives = 156/314 (50%), Gaps = 14/314 (4%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSAL-GNEGTNGKAAMKPIIHFQTWRIGI  450
             WV+G  I ++ S + + G NL K    + +K + L  NE         P+     W +G 
Sbjct  97    WVLGFSIAIIFSFLASVGINLQK----KALKQNELSANEHEQDPL---PVYRLPLWIVGF  149

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGN  630
             +    G+ L+F++FG A QSLLA L ++  V N+  A     + +  K +VAT  I  G 
Sbjct  150   VLIVAGSILDFVAFGLAPQSLLAPLAALTLVWNMMLAPCFNKEKLECKDIVATLVIFAGA  209

Query  631   IFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELL-LNVPGND  807
                V F +H +P YT   L   Y N+   +Y   +++ +  H+ + +  E   LN   + 
Sbjct  210   TLAVVFASHTTPSYTLTMLLTLYENVLTCVYFAFVIVCIVLHYGMIKVVETCHLNTRQHH  269

Query  808   LKP-----FWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLL  972
             +       FW  +    YA ++GT+G  SVLFAKS + LL+ S+S       + TY+ ++
Sbjct  270   MIEFGSLAFWTRVRMIGYAGLAGTLGGQSVLFAKSCAELLKSSMSGDSPFKHFETYAFIV  329

Query  973   LFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFV  1152
                    F +  LN GL  FDA+L+VP++Q  W   S+  G +YFQE + F  ++   FV
Sbjct  330   ALSFCLLFQVHFLNCGLLHFDALLMVPVYQAYWIVSSVLGGAIYFQEIRSFSVVQAACFV  389

Query  1153  LGVMCVFIGISLLA  1194
             +G+     G+ LL+
Sbjct  390   IGITTTIAGVILLS  403



>ref|XP_008875742.1| hypothetical protein H310_10993 [Aphanomyces invadans]
 gb|ETV95549.1| hypothetical protein H310_10993 [Aphanomyces invadans]
Length=345

 Score =   114 bits (284),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 87/319 (27%), Positives = 153/319 (48%), Gaps = 27/319 (8%)
 Frame = +1

Query  283   GAFINLLGSIIINFGTNLLKLGH--DERIKHSALGNEGTNGKAAMKPIIHFQTWRIGIIF  456
             G  + L+G+ I NFG N+ K      ER+            +   KP      W +G+  
Sbjct  19    GIAMCLVGTTISNFGLNIQKYSFIVQERLP-----------EHERKPYNTQWRWWLGLFG  67

Query  457   FALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIF  636
              A+G+  +F +  +AAQS++A +G+   V+NI FA++   + ++   +  T  I +G + 
Sbjct  68    IAVGSIADFAALTYAAQSIIAPVGAFTLVANIFFAHYWLRERLSHNDLFGTILICIGAVM  127

Query  637   LVAFGNHQSPVYTPEQLAEKYSNITFLLY--------CLILVLVVAFHHSVYRRGELLLN  792
             +  FG+H S  Y+ ++L   Y     L+Y        C + + +V    ++ R G+L   
Sbjct  128   VTVFGSHSSTSYSLDELLRLYYRWDMLVYFSAICALLCTLYIALVRSEEALQRHGKL---  184

Query  793   VPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLL  972
                 + +   Q + P SYA ++G  G+ SV+FAKS   L++ +         + TY +L 
Sbjct  185   --SPEYRACRQ-IHPLSYAGLAGVFGAQSVMFAKSTGELIKQTARGFNQFDRFLTYVILT  241

Query  973   LFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFV  1152
               + T       L+ GL  FDA+ +VP+F   +  FS+  G VYF+E+  F  ++   F 
Sbjct  242   CLVMTITMQTHLLSLGLKNFDALYMVPVFTCFYITFSVMGGAVYFEEFATFGQVQWLCFP  301

Query  1153  LGVMCVFIGISLLAPDDSK  1209
              GV     G+++L+  D +
Sbjct  302   FGVFITICGVAVLSRRDMR  320



>ref|XP_002900355.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY60148.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=624

 Score =   116 bits (290),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 97/314 (31%), Positives = 154/314 (49%), Gaps = 18/314 (6%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             WVIG  I ++ S + + G NL K    + +K + L  E        KP      W +G I
Sbjct  122   WVIGFAIAVVFSFLASVGINLQK----KALKQNELMAEP-------KPAYRLPLWMLGFI  170

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                +G+ L+F++FG A QSLLA L ++  V N+  A     + ++ K +V+T  I +G  
Sbjct  171   LCVVGSVLDFVAFGLAPQSLLAPLAALTLVWNMMLAPCFNKEKLSRKDIVSTLIIFVGAT  230

Query  634   FLVAFGNHQSPVYTPEQLAEKYSN-ITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDL  810
               V F +H SP Y  E L + Y + +T + +C++ + VVA   ++     L L    + +
Sbjct  231   IAVVFASHTSPSYNLEMLMQLYRDPLTIVYFCVVFLTVVAHFAAIKVVDNLCLMSKRHRI  290

Query  811   -----KPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWF-TYSMLL  972
                     W  +    YA ++GT+G  SVLFAKS + LL+   +        + TY + L
Sbjct  291   IQVGTPAMWSTIRLVGYAGLAGTLGGQSVLFAKSTAELLKGVFNGDASCFVHYQTYLIAL  350

Query  973   LFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFV  1152
                      +  LN GL  +DA+ +VP++Q  W    +  G +YFQE + F  L+  MFV
Sbjct  351   ALAVCLVLQIKYLNGGLVHYDALSMVPVYQAYWVISGVLGGVIYFQEIRTFSVLQAVMFV  410

Query  1153  LGVMCVFIGISLLA  1194
             LG+     G+ LL+
Sbjct  411   LGIGISIFGVVLLS  424



>gb|ETI33557.1| hypothetical protein F443_19763 [Phytophthora parasitica P1569]
 gb|ETL27353.1| hypothetical protein L916_19089 [Phytophthora parasitica]
 gb|ETL80593.1| hypothetical protein L917_18910 [Phytophthora parasitica]
 gb|ETO62361.1| hypothetical protein F444_19724 [Phytophthora parasitica P1976]
 gb|ETP03413.1| hypothetical protein F441_19597 [Phytophthora parasitica CJ01A1]
Length=659

 Score =   113 bits (283),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 95/319 (30%), Positives = 155/319 (49%), Gaps = 28/319 (9%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             WVIG  I ++ S + + G NL K    + +K + L        A  KP      W +G I
Sbjct  150   WVIGFTIAVVFSFLASVGINLQK----KALKQNEL-------MAEPKPAYRLPLWMLGFI  198

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                +G+ L+F++FG A QSLLA L ++  V N+  A     + ++ K +V+T  I +G  
Sbjct  199   LCVVGSVLDFVAFGLAPQSLLAPLAALTLVWNMMLAPCFNKEKLSRKDIVSTLVIFVGAT  258

Query  634   FLVAFGNHQSPVYTPEQLAEKYSN-ITFLLYCLILVLVVAFHHSV----------YRRGE  780
               V F +H SP Y  + L + Y + +T + +C++ + +VA + ++           R   
Sbjct  259   IAVVFASHTSPSYNLDMLMQLYRDPLTIVYFCVVFLTIVAHYAAIKIVDMFCLMSKRHRI  318

Query  781   LLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWF-T  957
             + +  P       W  +    YA ++GT+G  SVLFAKS + LL+   +        + T
Sbjct  319   IQVGTPA-----MWSTIRLVGYAGLAGTLGGQSVLFAKSTAELLKGVFNGDASCFVHYQT  373

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             Y + L         +  LN GL  +DA+ +VP++Q  W    +  G +YFQE + F  L+
Sbjct  374   YLIALALAVCLVLQIKYLNGGLVHYDALSMVPVYQAYWVISGVLGGVIYFQEIRTFSVLQ  433

Query  1138  TTMFVLGVMCVFIGISLLA  1194
               MFVLG+     G+ LL+
Sbjct  434   AVMFVLGIGISIFGVVLLS  452



>gb|ETK73921.1| hypothetical protein L915_19195 [Phytophthora parasitica]
 gb|ETM33786.1| hypothetical protein L914_18999 [Phytophthora parasitica]
Length=659

 Score =   113 bits (283),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 95/319 (30%), Positives = 155/319 (49%), Gaps = 28/319 (9%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             WVIG  I ++ S + + G NL K    + +K + L        A  KP      W +G I
Sbjct  150   WVIGFTIAVVFSFLASVGINLQK----KALKQNEL-------MAEPKPAYRLPLWMLGFI  198

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                +G+ L+F++FG A QSLLA L ++  V N+  A     + ++ K +V+T  I +G  
Sbjct  199   LCVVGSVLDFVAFGLAPQSLLAPLAALTLVWNMMLAPCFNKEKLSRKDIVSTLVIFVGAT  258

Query  634   FLVAFGNHQSPVYTPEQLAEKYSN-ITFLLYCLILVLVVAFHHSV----------YRRGE  780
               V F +H SP Y  + L + Y + +T + +C++ + +VA + ++           R   
Sbjct  259   IAVVFASHTSPSYNLDMLMQLYRDPLTIVYFCVVFLTIVAHYAAIKIVDMFCLMSKRHRI  318

Query  781   LLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWF-T  957
             + +  P       W  +    YA ++GT+G  SVLFAKS + LL+   +        + T
Sbjct  319   IQVGTPA-----MWSTIRLVGYAGLAGTLGGQSVLFAKSTAELLKGVFNGDASCFVHYQT  373

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             Y + L         +  LN GL  +DA+ +VP++Q  W    +  G +YFQE + F  L+
Sbjct  374   YLIALALAVCLVLQIKYLNGGLVHYDALSMVPVYQAYWVISGVLGGVIYFQEIRTFSVLQ  433

Query  1138  TTMFVLGVMCVFIGISLLA  1194
               MFVLG+     G+ LL+
Sbjct  434   AVMFVLGIGISIFGVVLLS  452



>gb|ETP31597.1| hypothetical protein F442_19543 [Phytophthora parasitica P10297]
Length=659

 Score =   113 bits (283),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 95/319 (30%), Positives = 155/319 (49%), Gaps = 28/319 (9%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             WVIG  I ++ S + + G NL K    + +K + L        A  KP      W +G I
Sbjct  150   WVIGFTIAVVFSFLASVGINLQK----KALKQNEL-------MAEPKPAYRLPLWMLGFI  198

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                +G+ L+F++FG A QSLLA L ++  V N+  A     + ++ K +V+T  I +G  
Sbjct  199   LCVVGSVLDFVAFGLAPQSLLAPLAALTLVWNMMLAPCFNKEKLSRKDIVSTLVIFVGAT  258

Query  634   FLVAFGNHQSPVYTPEQLAEKYSN-ITFLLYCLILVLVVAFHHSV----------YRRGE  780
               V F +H SP Y  + L + Y + +T + +C++ + +VA + ++           R   
Sbjct  259   IAVVFASHTSPSYNLDMLMQLYRDPLTIVYFCVVFLTIVAHYAAIKIVDMFCLMSKRHRI  318

Query  781   LLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWF-T  957
             + +  P       W  +    YA ++GT+G  SVLFAKS + LL+   +        + T
Sbjct  319   IQVGTPA-----MWSTIRLVGYAGLAGTLGGQSVLFAKSTAELLKGVFNGDASCFVHYQT  373

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             Y + L         +  LN GL  +DA+ +VP++Q  W    +  G +YFQE + F  L+
Sbjct  374   YLIALALAVCLVLQIKYLNGGLVHYDALSMVPVYQAYWVISGVLGGVIYFQEIRTFSVLQ  433

Query  1138  TTMFVLGVMCVFIGISLLA  1194
               MFVLG+     G+ LL+
Sbjct  434   AVMFVLGIGISIFGVVLLS  452



>ref|XP_008913758.1| hypothetical protein PPTG_17308 [Phytophthora parasitica INRA-310]
 gb|ETN00992.1| hypothetical protein PPTG_17308 [Phytophthora parasitica INRA-310]
Length=659

 Score =   113 bits (283),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 95/319 (30%), Positives = 155/319 (49%), Gaps = 28/319 (9%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             WVIG  I ++ S + + G NL K    + +K + L        A  KP      W +G I
Sbjct  150   WVIGFTIAVVFSFLASVGINLQK----KALKQNEL-------MAEPKPAYRLPLWMLGFI  198

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                +G+ L+F++FG A QSLLA L ++  V N+  A     + ++ K +V+T  I +G  
Sbjct  199   LCVVGSVLDFVAFGLAPQSLLAPLAALTLVWNMMLAPCFNKEKLSRKDIVSTLVIFVGAT  258

Query  634   FLVAFGNHQSPVYTPEQLAEKYSN-ITFLLYCLILVLVVAFHHSV----------YRRGE  780
               V F +H SP Y  + L + Y + +T + +C++ + +VA + ++           R   
Sbjct  259   IAVVFASHTSPSYNLDMLMQLYRDPLTIVYFCVVFLTIVAHYAAIKIVDMFCLMSKRHRI  318

Query  781   LLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWF-T  957
             + +  P       W  +    YA ++GT+G  SVLFAKS + LL+   +        + T
Sbjct  319   IQVGTPA-----MWSTIRLVGYAGLAGTLGGQSVLFAKSTAELLKGVFNGDASCFVHYQT  373

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             Y + L         +  LN GL  +DA+ +VP++Q  W    +  G +YFQE + F  L+
Sbjct  374   YLIALALAVCLVLQIKYLNGGLVHYDALSMVPVYQAYWVISGVLGGVIYFQEIRTFSVLQ  433

Query  1138  TTMFVLGVMCVFIGISLLA  1194
               MFVLG+     G+ LL+
Sbjct  434   AVMFVLGIGISIFGVVLLS  452



>ref|XP_008913759.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETN00993.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
Length=598

 Score =   112 bits (281),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 95/319 (30%), Positives = 155/319 (49%), Gaps = 28/319 (9%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             WVIG  I ++ S + + G NL K    + +K + L        A  KP      W +G I
Sbjct  150   WVIGFTIAVVFSFLASVGINLQK----KALKQNEL-------MAEPKPAYRLPLWMLGFI  198

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                +G+ L+F++FG A QSLLA L ++  V N+  A     + ++ K +V+T  I +G  
Sbjct  199   LCVVGSVLDFVAFGLAPQSLLAPLAALTLVWNMMLAPCFNKEKLSRKDIVSTLVIFVGAT  258

Query  634   FLVAFGNHQSPVYTPEQLAEKYSN-ITFLLYCLILVLVVAFHHSV----------YRRGE  780
               V F +H SP Y  + L + Y + +T + +C++ + +VA + ++           R   
Sbjct  259   IAVVFASHTSPSYNLDMLMQLYRDPLTIVYFCVVFLTIVAHYAAIKIVDMFCLMSKRHRI  318

Query  781   LLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWF-T  957
             + +  P       W  +    YA ++GT+G  SVLFAKS + LL+   +        + T
Sbjct  319   IQVGTPA-----MWSTIRLVGYAGLAGTLGGQSVLFAKSTAELLKGVFNGDASCFVHYQT  373

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             Y + L         +  LN GL  +DA+ +VP++Q  W    +  G +YFQE + F  L+
Sbjct  374   YLIALALAVCLVLQIKYLNGGLVHYDALSMVPVYQAYWVISGVLGGVIYFQEIRTFSVLQ  433

Query  1138  TTMFVLGVMCVFIGISLLA  1194
               MFVLG+     G+ LL+
Sbjct  434   AVMFVLGIGISIFGVVLLS  452



>gb|ETI33558.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETL27354.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL80594.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETO62362.1| hypothetical protein, variant [Phytophthora parasitica P1976]
 gb|ETP03414.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
 gb|ETP31598.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=598

 Score =   112 bits (281),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 95/319 (30%), Positives = 155/319 (49%), Gaps = 28/319 (9%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             WVIG  I ++ S + + G NL K    + +K + L        A  KP      W +G I
Sbjct  150   WVIGFTIAVVFSFLASVGINLQK----KALKQNEL-------MAEPKPAYRLPLWMLGFI  198

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                +G+ L+F++FG A QSLLA L ++  V N+  A     + ++ K +V+T  I +G  
Sbjct  199   LCVVGSVLDFVAFGLAPQSLLAPLAALTLVWNMMLAPCFNKEKLSRKDIVSTLVIFVGAT  258

Query  634   FLVAFGNHQSPVYTPEQLAEKYSN-ITFLLYCLILVLVVAFHHSV----------YRRGE  780
               V F +H SP Y  + L + Y + +T + +C++ + +VA + ++           R   
Sbjct  259   IAVVFASHTSPSYNLDMLMQLYRDPLTIVYFCVVFLTIVAHYAAIKIVDMFCLMSKRHRI  318

Query  781   LLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWF-T  957
             + +  P       W  +    YA ++GT+G  SVLFAKS + LL+   +        + T
Sbjct  319   IQVGTPA-----MWSTIRLVGYAGLAGTLGGQSVLFAKSTAELLKGVFNGDASCFVHYQT  373

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             Y + L         +  LN GL  +DA+ +VP++Q  W    +  G +YFQE + F  L+
Sbjct  374   YLIALALAVCLVLQIKYLNGGLVHYDALSMVPVYQAYWVISGVLGGVIYFQEIRTFSVLQ  433

Query  1138  TTMFVLGVMCVFIGISLLA  1194
               MFVLG+     G+ LL+
Sbjct  434   AVMFVLGIGISIFGVVLLS  452



>gb|ETK73922.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM33787.1| hypothetical protein, variant [Phytophthora parasitica]
Length=598

 Score =   112 bits (281),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 95/319 (30%), Positives = 155/319 (49%), Gaps = 28/319 (9%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             WVIG  I ++ S + + G NL K    + +K + L        A  KP      W +G I
Sbjct  150   WVIGFTIAVVFSFLASVGINLQK----KALKQNEL-------MAEPKPAYRLPLWMLGFI  198

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                +G+ L+F++FG A QSLLA L ++  V N+  A     + ++ K +V+T  I +G  
Sbjct  199   LCVVGSVLDFVAFGLAPQSLLAPLAALTLVWNMMLAPCFNKEKLSRKDIVSTLVIFVGAT  258

Query  634   FLVAFGNHQSPVYTPEQLAEKYSN-ITFLLYCLILVLVVAFHHSV----------YRRGE  780
               V F +H SP Y  + L + Y + +T + +C++ + +VA + ++           R   
Sbjct  259   IAVVFASHTSPSYNLDMLMQLYRDPLTIVYFCVVFLTIVAHYAAIKIVDMFCLMSKRHRI  318

Query  781   LLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWF-T  957
             + +  P       W  +    YA ++GT+G  SVLFAKS + LL+   +        + T
Sbjct  319   IQVGTPA-----MWSTIRLVGYAGLAGTLGGQSVLFAKSTAELLKGVFNGDASCFVHYQT  373

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             Y + L         +  LN GL  +DA+ +VP++Q  W    +  G +YFQE + F  L+
Sbjct  374   YLIALALAVCLVLQIKYLNGGLVHYDALSMVPVYQAYWVISGVLGGVIYFQEIRTFSVLQ  433

Query  1138  TTMFVLGVMCVFIGISLLA  1194
               MFVLG+     G+ LL+
Sbjct  434   AVMFVLGIGISIFGVVLLS  452



>gb|KHN70024.1| hypothetical protein M896_030090 [Ordospora colligata OC4]
Length=467

 Score =   108 bits (271),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 90/333 (27%), Positives = 158/333 (47%), Gaps = 29/333 (9%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
              W+ G  +++ G+I IN G NL K  +    +H+ +  E  N +        FQT  +G 
Sbjct  134   SWMFGVLLSISGNIGINIGVNLQKKSY----RHACI--EILNTR--------FQTLYLGC  179

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGN  630
             I + +G    + S+ F  QSL+AAL +   VSN  FA  + N+  T +   A  F+  G 
Sbjct  180   IMYGIGKFFGYCSYVFGNQSLIAALSATGLVSNSIFAPMINNEVFTWRDFCAIFFVFAGT  239

Query  631   IFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLN--VPGN  804
               +V        VY+  +L + Y     L++  ++++V+ +  +  +  E+  N  +PG 
Sbjct  240   TLVVMNTTITHKVYSLCELIKMYKRTETLVWFGLILVVIVYLFAFIKYVEINSNWELPGE  299

Query  805   DLK-----PFW--------QMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllH  945
              +K       W        + ++  +Y  +S  I SF+ L  KSL  ++  +IS      
Sbjct  300   RMKFLKSSSVWFEEDGFVMKYVMALAYVCLSSFIASFTTLSVKSLGEMIDKTISGDNQFV  359

Query  946   SWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVF  1125
                TY  +L+  +   F +  LN  L  +DA+L++PMF + WTF SI T  +YF+E++ +
Sbjct  360   FSTTYFFILVLGTCTFFQIYWLNRALRHYDALLVIPMFHVTWTFLSIITAGIYFREFEQY  419

Query  1126  DALRTTMFVLGVMCVFIGISLLAPDDSKGTQTK  1224
                +  +F  GV  +F+G   L    +  T+ +
Sbjct  420   TTSQLRVFAFGVAVIFVGSFFLGSRITNKTRIR  452



>emb|CCI47840.1| unnamed protein product [Albugo candida]
Length=618

 Score =   109 bits (272),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 100/331 (30%), Positives = 158/331 (48%), Gaps = 31/331 (9%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSAL-GNEGTNGKAAMKPIIHFQTWRIGI  450
             WV+G  I ++ S + + G NL K    + +K + L  NE         P+     W +G 
Sbjct  97    WVLGFSIAIIFSFLASVGINLQK----KALKQNELSANEHEQDPL---PVYRLPLWIVGF  149

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIA--FAYF--------------VFNKT  582
             +    G+ L+F++FG A QSLLA L ++  V N+     Y                FNK 
Sbjct  150   VLIVAGSILDFVAFGLAPQSLLAPLAALTLVWNMVTYLCYLTVFFLILPTQMLAPCFNKE  209

Query  583   -VTIKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHH  759
              +  K +VAT  I  G    V F +H +P YT   L   Y N+   +Y   +++ +  H+
Sbjct  210   KLECKDIVATLVIFAGATLAVVFASHTTPSYTLTMLLTLYENVLTCVYFAFVIVCIVLHY  269

Query  760   SVYRRGELL-LNVPGNDLKPF-----WQMLLPFSYAIVSGTIGSFSVLFAKslsnllrls  921
              + +  E   LN   + +  F     W  +    YA ++GT+G  SVLFAKS + LL+ S
Sbjct  270   GMIKVVETCHLNTRQHHMIEFGSLAFWTRVRMIGYAGLAGTLGGQSVLFAKSCAELLKSS  329

Query  922   isnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFV  1101
             +S       + TY+ ++       F +  LN GL  FDA+L+VP++Q  W   S+  G +
Sbjct  330   MSGDSPFKHFETYAFIVALSFCLLFQVHFLNCGLLHFDALLMVPVYQAYWIVSSVLGGAI  389

Query  1102  YFQEYQVFDALRTTMFVLGVMCVFIGISLLA  1194
             YFQE + F  ++   FV+G+     G+ LL+
Sbjct  390   YFQEIRSFSVVQAACFVIGITTTIAGVILLS  420



>gb|KDO33115.1| hypothetical protein SPRG_01927 [Saprolegnia parasitica CBS 223.65]
Length=635

 Score =   109 bits (272),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 98/316 (31%), Positives = 163/316 (52%), Gaps = 14/316 (4%)
 Frame = +1

Query  268   GEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIG  447
             G W+ G  I+++ S + + G NL K    + +K + L  +  N  A + P      W +G
Sbjct  157   GAWIAGFIISVVFSFLASVGINLQK----KALKQNELKAQEAN-TAPLSPF-RLPLWTLG  210

Query  448   IIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLG  627
              +    G+ L+F++FG A QSLLA L ++  V N+  A     + ++ K + AT  I LG
Sbjct  211   FVLILAGSLLDFVAFGLAPQSLLAPLAALTLVWNMLLAPCFNKERLSRKDIWATLIIFLG  270

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPG--  801
                 V F +H SP YT + L   Y+N   ++Y ++++L++  H+++ +  E  LN+    
Sbjct  271   ATLAVVFASHNSPSYTLDDLKLLYNNTYTIVYFVVVLLLILLHYAMIKFVE-HLNLASSR  329

Query  802   ----NDLKP-FWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSM  966
                 N  +P  W  +   +Y+ + G +G  SVLFAKS + L++  I+         TY++
Sbjct  330   HRMINVGQPVMWSTVRLVAYSGMGGLMGGQSVLFAKSTAELVKSFINGGDCFTHPETYAI  389

Query  967   LLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTM  1146
             ++         M  LN GL  +DA+ +VP++Q  W    +  G VYFQE + F   + TM
Sbjct  390   IVALGFCLVLQMHFLNGGLVNYDALSVVPIYQAYWIISGVMGGAVYFQEIRSFTEFQATM  449

Query  1147  FVLGVMCVFIGISLLA  1194
             FVLG+     G++LLA
Sbjct  450   FVLGISTTIGGVALLA  465



>ref|XP_009264123.1| hypothetical protein EROM_030070 [Encephalitozoon romaleae SJ-2008]
 gb|AFN82626.1| hypothetical protein EROM_030070 [Encephalitozoon romaleae SJ-2008]
Length=467

 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 91/321 (28%), Positives = 152/321 (47%), Gaps = 37/321 (12%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             W+ G F+++ G+I IN G NL K  + +   H  L N            ++ QT+  G  
Sbjct  135   WIFGVFLSISGNIGINVGINLQKKSYKQ--SHIRLFN------------MNLQTFYAGCF  180

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
              + LG    + S+ F  QSL+A L +   VSN  FA  +  +  T K   A  F+  G  
Sbjct  181   IYGLGKIFGYCSYIFGNQSLMAVLSATGLVSNSIFAPMINEEIFTWKDFCAIFFVFAGTT  240

Query  634   FLVAFGNHQSPVYTPEQLAEKYSNITFLLYC--LILVLVVAF-----------------H  756
              +V        VYT  +L + Y  +  LL+   +IL++VV F                 +
Sbjct  241   LIVMNTTTSHKVYTLCELMKMYRRVETLLWFGFIILIIVVLFVFIKYIEINSNWELPDEN  300

Query  757   HSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsy  936
              +  RR ++  +  G  +K  + M+L  +Y  +S  I SF+ L  KSL  ++  +I+   
Sbjct  301   MTFLRREDVWFDEEGVIMK--YTMVL--AYVCLSSFIASFTTLSVKSLGEMIDKTIAGDN  356

Query  937   llHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEY  1116
                   TY  +++ +    F +  LN  L  +DA+L++PMF + WT  SI T  +YF+E+
Sbjct  357   QFIFLTTYFFIIVLVICTFFQIYWLNRALRHYDALLVIPMFHVTWTLLSILTAGIYFREF  416

Query  1117  QVFDALRTTMFVLGVMCVFIG  1179
             + + + +  +FV G+  +FIG
Sbjct  417   EQYTSYQLGVFVGGIGLIFIG  437



>ref|XP_008872364.1| hypothetical protein H310_08423 [Aphanomyces invadans]
 gb|ETV98936.1| hypothetical protein H310_08423 [Aphanomyces invadans]
Length=401

 Score =   103 bits (258),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 83/320 (26%), Positives = 146/320 (46%), Gaps = 11/320 (3%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             W +G  +++  S+  N G NL K       K       G          I    W +G+ 
Sbjct  14    WYVGVIMSVGASVCTNMGVNLQKYSFMRECKKPTATKRG---------YIRQPLWMLGLW  64

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                 G+  +F + GF  QSL   +G    V+N+ FA+   ++  T +  + T  I+ G +
Sbjct  65    LVIFGSLGDFGALGFIPQSLATPVGGSTIVANVFFAHKFLHEVFTRRDGIGTALILTGIV  124

Query  634   FLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLK  813
              + AF +  +  +T +QL   Y    F+ Y +++ + +A  +   RR   ++   G + K
Sbjct  125   VVAAFADKSNGCHTLDQLIALYGQPAFIAYVVLVSVTMAVVYIFVRRIRSIVATCGKNSK  184

Query  814   PFWQMLLPFSYA--IVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLST  987
              + + +   S A   +SG  G+ SVL AKS++ L++ +I+      +  TY++ L     
Sbjct  185   QYRRFVTFHSLANPALSGVFGAQSVLLAKSVAELIKSTIAGDNQFTTVGTYAIALGMFGC  244

Query  988   AGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMC  1167
                 +  L +GL  FDA+ +VP+FQ  +   SI  G VYF E+         MF++GV+ 
Sbjct  245   IFLQIHWLAQGLEHFDAVFVVPIFQCVFISTSILGGAVYFGEFATMSTTTIIMFLVGVVI  304

Query  1168  VFIGISLLAPDDSKGTQTKD  1227
                G+ +L+  D    + K 
Sbjct  305   TLSGVGILSQRDMASLKPKQ  324



>ref|XP_008870535.1| hypothetical protein H310_07038 [Aphanomyces invadans]
 gb|ETW00400.1| hypothetical protein H310_07038 [Aphanomyces invadans]
Length=557

 Score =   103 bits (258),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 96/324 (30%), Positives = 158/324 (49%), Gaps = 29/324 (9%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             +G W+ G  I+L+ SI+ + G NL K        +S   +  +N  +  +P+     W +
Sbjct  178   VGMWIAGFSISLVFSILNSVGINLQK--------YSLSQHSNSNKTSFQQPL-----WVL  224

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G++F  LG+ L+F++FG A Q+LLA L ++  V N+  A F   + VT + +VAT  I +
Sbjct  225   GMVFVILGSILDFVAFGMAPQTLLAPLAALSLVWNMFIAPFFHKEKVTRRNLVATAIIFV  284

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY--CLILVLVVAFHHSVYRRGELLLNVP  798
             G    V F  H +P Y  + L   Y       Y  C++L L++ F  + Y     +    
Sbjct  285   GVTITVIFAGHSTPTYDLDDLILLYQTPVMYAYITCVVLFLLIMFGATRYIEKNHVYE--  342

Query  799   GNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllH--SWFTYSMLL  972
                   F+ ++    Y  ++GT G  SVL AKS   LL+ +I            TY ++ 
Sbjct  343   ----DGFFHIVC---YGGIAGTFGGQSVLLAKSTVELLKSAIWGDGADAFVHITTYVIIA  395

Query  973   LFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFV  1152
               ++     ++ LN GL RFDA++++P++Q  W   S+  G +YF+EY    +L   MF 
Sbjct  396   GLVTCLLCQISFLNGGLKRFDALVVIPVYQSFWILMSVLGGIMYFEEYVSMTSLEKYMFT  455

Query  1153  LGVMCVFIGISLL---APDDSKGT  1215
              G +    GI  L   + +DS G+
Sbjct  456   AGGVITISGIVYLLQGSSEDSGGS  479



>ref|XP_002783331.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER15127.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=520

 Score =   103 bits (256),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 93/353 (26%), Positives = 168/353 (48%), Gaps = 39/353 (11%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
              +VIG  +N++G+I  NFGT L+K  +   +KH         GK          +  IG+
Sbjct  5     RFVIGIVVNIVGAITTNFGTVLMK--YHTAVKH---------GKG--------HSLIIGL  45

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGN  630
             + F +G+ L F SF FA QSLL+ + +IQFVSN+ F ++   +  TI  +  T  I+   
Sbjct  46    VLFCVGSILTFGSFAFAPQSLLSGISAIQFVSNLFFVHYFLKEPFTIFNVCGTVVIIGAI  105

Query  631   IFLVAFGNHQSPVYTPEQLAEKY----SNITFLLYCLILVLVVAF--------------H  756
             + LV   N    + + + + +++    ++  F+L  ++L++V+ F               
Sbjct  106   VMLVVSSNKSEAINSVDLMFQQFYFSATHGYFVLGLIVLIMVIGFAFWMRTGAPILWFSR  165

Query  757   HSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrls-isns  933
                 +R +  L++P +  +   + L+P  Y      +G+ SV+  K LS ++  +   + 
Sbjct  166   SKWPKRIQWELSLPRSHNR-VTRFLVPTGYTFCVAAVGAQSVVSGKVLSLIVTQAFGGHV  224

Query  934   yllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQE  1113
               L+   T+ +L  +L  A FW+  LN  L  F    +VP+ Q+ WT  ++ +G + F+E
Sbjct  225   SQLYQGRTFLVLFAWLFAAIFWVIHLNRALRIFPGAFLVPLTQVCWTLSTMLSGGIVFKE  284

Query  1114  YQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQTKDsslvsasslsNDVER  1272
             +    + +  +F  G   +F G+ LL+P  +   Q       S +S  N V R
Sbjct  285   FVAMQSWQLGVFFGGTGVLFFGVFLLSPRTTDDDQEMARRRSSIASSQNVVAR  337



>ref|WP_028830909.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-E04]
Length=718

 Score =   104 bits (259),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 93/313 (30%), Positives = 145/313 (46%), Gaps = 16/313 (5%)
 Frame = +1

Query  307   SIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT------WRIGIIFFALG  468
             S + N G NL KL     ++ +A  +E    + A K     +T      W  G++   +G
Sbjct  113   STVANLGMNLQKLA----LRRAAALDEVEVEEGAFKNSRTVETRKNRAIWVCGLLCIIMG  168

Query  469   NSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIFLVAF  648
             +  +F +  F AQSL+A L S+  V+NI  A  +  +  + +    T  I+ G +  V F
Sbjct  169   SVGDFGALAFGAQSLIAPLSSLALVANIVIATGMHGEEFSKRDGGCTLVIISGCVVSVIF  228

Query  649   GNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPG--NDLKPFW  822
                    Y+ E L   ++    L Y + ++  V       +  E +L   G  + L   W
Sbjct  229   AQQDDVQYSTECLFTLFAEPGALCYFIFIICAVTGGVLFVKWIERVLESYGAQSSLYQKW  288

Query  823   QMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyll--HSWFTYSMLLLFLSTAGF  996
                  FSYA ++GT G+ SVL AK L   +   ++    +    W  Y ++L    +   
Sbjct  289   YKYHRFSYACIAGTAGAQSVLLAKCLIEAISEWVNGKNKIFLAYWQIYPVILFLCLSVAM  348

Query  997   WMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGV-MCVF  1173
              +  LN GL+RFDA+  VP+FQ  W  FS   G V+FQE+  F  ++  MF LGV +CVF
Sbjct  349   QIYWLNMGLARFDALYNVPVFQCFWMLFSTIGGGVFFQEFWSFSLIQALMFPLGVSLCVF  408

Query  1174  IGISLLAPDDSKG  1212
              G+ LL+     G
Sbjct  409   -GVYLLSQRPQSG  420



>gb|KDO21227.1| hypothetical protein SPRG_13727 [Saprolegnia parasitica CBS 223.65]
Length=546

 Score =   102 bits (253),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 94/318 (30%), Positives = 151/318 (47%), Gaps = 28/318 (9%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLK--LGHDERIKHSALGNEGTNGKAAMKPIIHFQTW  438
             +G W+ G  I+L+ SI+ + G NL K  L  +E++        G+   +  +P+     W
Sbjct  168   VGMWIAGFSISLVFSILNSVGINLQKYSLTQNEKL--------GSQKGSFQQPM-----W  214

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
              +G++F  LG+ L+F++FG A Q+LLA L ++  V N+  A F   + VT + +VAT  I
Sbjct  215   VLGLVFVCLGSILDFVAFGMAPQTLLAPLAALSLVWNMLIAPFFHKEKVTRRNLVATCII  274

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYSN--ITFLLYCLILVLVVAFHHSVYRRGELLLN  792
               G    V F  H +P Y  E L + Y    + F +  ++L L+  F  + Y     L  
Sbjct  275   FFGVTLTVIFAGHSTPAYDLEDLIKLYQTPVMYFYIVSILLFLITLFASTRYIETNHLYE  334

Query  793   VPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsi--snsyllHSWFTYSM  966
                        +     Y  ++GT G  SVL AKS   LL+ +I    +       TY++
Sbjct  335   D---------GLFHIVCYGGIAGTFGGQSVLLAKSTVELLKSAIWGDGADAFKHPATYAI  385

Query  967   LLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTM  1146
             +   +      +  LN GL RFDA++++P++Q  W   S+  G +YF+EY         M
Sbjct  386   ISGLVVCLLCQITFLNGGLKRFDALVVIPVYQSFWILTSVLGGIMYFEEYISMTQTEMVM  445

Query  1147  FVLGVMCVFIGISLLAPD  1200
             F +G +    GI  L  D
Sbjct  446   FTMGGVVTISGIIYLLQD  463



>ref|XP_002782851.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER14647.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=630

 Score =   102 bits (253),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 90/335 (27%), Positives = 158/335 (47%), Gaps = 39/335 (12%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
              +VIG  +N++G+I  NFGT L+K  +   +KH         GK          +  IG+
Sbjct  5     RFVIGIVVNIVGAITTNFGTVLMK--YHTAVKH---------GKG--------HSLIIGL  45

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGN  630
             I F +G+ L F SF FA QSLL+ + +IQFVSN+ F ++   +  T+  +  T  I+   
Sbjct  46    ILFCIGSVLTFGSFAFAPQSLLSGISAIQFVSNLFFVHYFLQEPFTVFNVCGTVVIIGAI  105

Query  631   IFLVAFGNHQSPVYTPEQLAEKY----SNITFLLYCLILVLVVAF--------------H  756
             + LV        +   +Q+   +    ++  F+L  L+L+  +AF               
Sbjct  106   VMLVVSSTKSEAINNVDQMFNDFYFSATHGYFVLGLLLLICFIAFAFWMRTGAPILWFTR  165

Query  757   HSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrls-isns  933
                 +R +  L++P +  +   + L+P  Y      +G+ SV+  K LS ++  +     
Sbjct  166   SKWPKRIQWELSLPRSHNR-VTRFLVPSGYTFCVAAVGAQSVVSGKVLSLIVTQAFGGQV  224

Query  934   yllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQE  1113
               L+   T+ +L  +L  A FW+  LN  L  F    +VP+ Q+ WT  ++ +G + F+E
Sbjct  225   SQLYQGRTFLVLFAWLFAAVFWVIHLNRALRIFPGAFLVPLTQVCWTLSTMLSGGIVFKE  284

Query  1114  YQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQ  1218
             +    + +  +F  G   +F G+ LL+P  S+  Q
Sbjct  285   FVAMQSWQLGVFFSGTGVLFFGVFLLSPRTSEDDQ  319



>ref|XP_008604095.1| hypothetical protein SDRG_00400 [Saprolegnia diclina VS20]
 gb|EQC42672.1| hypothetical protein SDRG_00400 [Saprolegnia diclina VS20]
Length=548

 Score =   101 bits (252),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 94/316 (30%), Positives = 149/316 (47%), Gaps = 24/316 (8%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             +G W+ G  I+L+ SI+ + G NL K    +  K       GT   +  +P+     W +
Sbjct  168   VGMWIAGFSISLVFSILNSVGINLQKYSLTQNDKL------GTQKGSFQQPM-----WVL  216

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G++F  LG+ L+F++FG A Q+LLA L ++  V N+  A F   + VT + +VAT  I +
Sbjct  217   GLVFVCLGSILDFVAFGMAPQTLLAPLAALSLVWNMLIAPFFHKEKVTRRNLVATCIIFV  276

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSN--ITFLLYCLILVLVVAFHHSVYRRGELLLNVP  798
             G    V F  H +P Y  E L + Y    + F +  ++L LV  F  + Y     +    
Sbjct  277   GVTLTVIFAGHSTPAYDLEDLIKLYQTPVMYFYIVSVVLFLVSLFAATRYIETNHVYED-  335

Query  799   GNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsi--snsyllHSWFTYSMLL  972
                      +     Y  ++GT G  SVL AKS   LL+ +I    +       TY+++ 
Sbjct  336   --------GLFHIVCYGGIAGTFGGQSVLLAKSTVELLKSAIWGDGADAFKHPATYAIIT  387

Query  973   LFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFV  1152
               +      +  LN GL RFDA++++P++Q  W   S+  G +YF+EY         MF 
Sbjct  388   GLVVCLLCQITFLNGGLKRFDALVVIPVYQSFWILTSVLGGIMYFEEYISMTQTEMVMFT  447

Query  1153  LGVMCVFIGISLLAPD  1200
             +G +    GI  L  D
Sbjct  448   MGGVITISGIIYLLQD  463



>gb|ETO63681.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
Length=438

 Score =   100 bits (248),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 92/333 (28%), Positives = 153/333 (46%), Gaps = 37/333 (11%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT-  435
             N+ G+W IG  I +  +++ N G N+ KL H                +   KP+   QT 
Sbjct  20    NVQGKW-IGLAIVITSAVLSNLGVNVQKLSHV---------------REEEKPVFERQTY  63

Query  436   -----WRIGIIFFALGNSLNFISFGFAAQSLLAAL-GSIQFVSNIAFAYFVFNKTVTIKV  597
                  W IG++   LG   +F + GFA Q+L+A++ G    ++N+ FA+    + +T   
Sbjct  64    YTRPLWLIGLVLVVLGAVGDFEALGFAPQALVASVGGGFTVLANVFFAHLWLGQILTKTD  123

Query  598   MVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRG  777
             ++ T  I++G + L    N      +  +L +++  + FL+Y  ++ +V+     ++ + 
Sbjct  124   VLGTLLIIIG-VVLSTVANEPDEQMSLVELEKQFFQLGFLIYLGVMTVVLG---GIFGQI  179

Query  778   ELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT  957
             E +L +P   L      LLPF YA  SG  GSFSVL AK  S LL L+ S       + T
Sbjct  180   EAILRLP-RALNENKYRLLPFMYATASGIFGSFSVLLAKCASILLILTFSGENQFVYFTT  238

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             Y  +   + T       LN  +   D + + PMFQ  W   S+  G V++++Y  F    
Sbjct  239   YLFMGGMMCTLVLQTDLLNRAIMAGDTLSVFPMFQCFWIGSSVIGGVVFYEKYMRFSLFD  298

Query  1138  TTMFVLGVMCVFIGISLLA---------PDDSK  1209
                  + +  + +GI LLA         PDD +
Sbjct  299   WLCLPIALAFIIMGIYLLAKHGEGESDDPDDPE  331



>gb|ETL28639.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETP04799.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
Length=438

 Score =   100 bits (248),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 92/333 (28%), Positives = 153/333 (46%), Gaps = 37/333 (11%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT-  435
             N+ G+W IG  I +  +++ N G N+ KL H                +   KP+   QT 
Sbjct  20    NVQGKW-IGLAIVITSAVLSNLGVNVQKLSHV---------------REEEKPVFERQTY  63

Query  436   -----WRIGIIFFALGNSLNFISFGFAAQSLLAAL-GSIQFVSNIAFAYFVFNKTVTIKV  597
                  W IG++   LG   +F + GFA Q+L+A++ G    ++N+ FA+    + +T   
Sbjct  64    YTRPLWLIGLVLVVLGAVGDFEALGFAPQALVASVGGGFTVLANVFFAHLWLGQILTKTD  123

Query  598   MVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRG  777
             ++ T  I++G + L    N      +  +L +++  + FL+Y  ++ +V+     ++ + 
Sbjct  124   VLGTLLIIIG-VVLSTVANEPDEQMSLVELEKQFFQLGFLIYLGVMTVVLG---GIFGQI  179

Query  778   ELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT  957
             E +L +P   L      LLPF YA  SG  GSFSVL AK  S LL L+ S       + T
Sbjct  180   EAILRLP-RALNENKYRLLPFMYATASGIFGSFSVLLAKCASILLILTFSGENQFVYFTT  238

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             Y  +   + T       LN  +   D + + PMFQ  W   S+  G V++++Y  F    
Sbjct  239   YLFMGGMMCTLVLQTDLLNRAIMAGDTLSVFPMFQCFWIGSSVIGGVVFYEKYTRFSLFD  298

Query  1138  TTMFVLGVMCVFIGISLLA---------PDDSK  1209
                  + +  + +GI LLA         PDD +
Sbjct  299   WLCLPIALAFIIMGIYLLAKHGEGESDDPDDPE  331



>ref|XP_008913389.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETI34922.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
 gb|ETL81893.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETM35097.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETN01288.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETP32924.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297]
Length=438

 Score = 99.8 bits (247),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 92/333 (28%), Positives = 153/333 (46%), Gaps = 37/333 (11%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT-  435
             N+ G+W IG  I +  +++ N G N+ KL H                +   KP+   QT 
Sbjct  20    NVQGKW-IGLAIVITSAVLSNLGVNVQKLSHV---------------REEEKPVFERQTY  63

Query  436   -----WRIGIIFFALGNSLNFISFGFAAQSLLAAL-GSIQFVSNIAFAYFVFNKTVTIKV  597
                  W IG++   LG   +F + GFA Q+L+A++ G    ++N+ FA+    + +T   
Sbjct  64    YTRPLWLIGLVLVVLGAVGDFEALGFAPQALVASVGGGFTVLANVFFAHLWLGQILTKTD  123

Query  598   MVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRG  777
             ++ T  I++G + L    N      +  +L +++  + FL+Y  ++ +V+     ++ + 
Sbjct  124   VLGTLLIIIG-VVLSTVANEPDEQMSLVELEKQFFQLGFLIYLGVMTVVLG---GIFGQI  179

Query  778   ELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT  957
             E +L +P   L      LLPF YA  SG  GSFSVL AK  S LL L+ S       + T
Sbjct  180   EAILRLP-RALNENKYRLLPFMYATASGIFGSFSVLLAKCASILLILTFSGENQFVYFTT  238

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             Y  +   + T       LN  +   D + + PMFQ  W   S+  G V++++Y  F    
Sbjct  239   YLFMGGMMCTLVLQTDLLNRAIMAGDTLSVFPMFQCFWIGSSVIGGVVFYEKYTRFSLFD  298

Query  1138  TTMFVLGVMCVFIGISLLA---------PDDSK  1209
                  + +  + +GI LLA         PDD +
Sbjct  299   WLCLPIALAFIIMGIYLLAKHGEGESDDPDDPE  331



>ref|XP_009518923.1| hypothetical protein PHYSODRAFT_487294 [Phytophthora sojae]
 gb|EGZ23635.1| hypothetical protein PHYSODRAFT_487294 [Phytophthora sojae]
Length=565

 Score =   100 bits (250),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 94/325 (29%), Positives = 150/325 (46%), Gaps = 25/325 (8%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT-WR  441
             +G WV G  I+L+ S++ + G NL KL                N  A +K     Q  W 
Sbjct  172   VGMWVAGFLISLVFSVLNSVGINLQKLSMTR------------NDTAEVKKTTLKQPLWM  219

Query  442   IGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIV  621
             +G     LG+ L+F++FG A Q+LLA L ++  V N+  A     + VT + ++AT  I 
Sbjct  220   LGFGLVCLGSLLDFVAFGMAPQTLLAPLAALSLVWNMLIAPIFHKEKVTRENLLATAIIF  279

Query  622   LGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPG  801
             +G    V F  H +P Y  E L   Y       Y +++V  +    +  R  E   N   
Sbjct  280   IGVTLTVIFAGHNTPTYELEDLIRLYQQPAMYAYIVLIVCFLGGLFAFCRYIERTHN---  336

Query  802   NDLKPFWQMLLP-FSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSW---FTYSML  969
                  F + L     Y  ++GT G  SVL AKS   LL+ +I      + +    +Y ++
Sbjct  337   -----FEEGLFHIICYGGIAGTFGGQSVLLAKSTVELLKSAIWGDSGFYMFTQPTSYVII  391

Query  970   LLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMF  1149
                 +  GF +  LN GL+RFDA++++P++Q  W   S+  G +YF+EY     ++  MF
Sbjct  392   AGLGACLGFQVHFLNGGLARFDALVVIPVYQSFWILMSVLGGIMYFEEYVSMTRMQMLMF  451

Query  1150  VLGVMCVFIGISLLAPDDSKGTQTK  1224
              +G     +GI +L      G  ++
Sbjct  452   TIGSCVTILGIIVLLKTRHSGEASR  476



>gb|ETK75214.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=438

 Score = 99.8 bits (247),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 92/333 (28%), Positives = 153/333 (46%), Gaps = 37/333 (11%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT-  435
             N+ G+W IG  I +  +++ N G N+ KL H                +   KP+   QT 
Sbjct  20    NVQGKW-IGLAIVITSAVLSNLGVNVQKLSHV---------------REEEKPVFERQTY  63

Query  436   -----WRIGIIFFALGNSLNFISFGFAAQSLLAAL-GSIQFVSNIAFAYFVFNKTVTIKV  597
                  W IG++   LG   +F + GFA Q+L+A++ G    ++N+ FA+    + +T   
Sbjct  64    YTRPLWLIGLVLVVLGAVGDFEALGFAPQALVASVGGGFTVLANVFFAHLWLGQILTKTD  123

Query  598   MVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRG  777
             ++ T  I++G + L    N      +  +L +++  + FL+Y  ++ +V+     ++ + 
Sbjct  124   VLGTLLIIVG-VVLSTVANEPDEQMSLVELEKQFFQLGFLIYLGVMTVVLG---GIFGQI  179

Query  778   ELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT  957
             E +L +P   L      LLPF YA  SG  GSFSVL AK  S LL L+ S       + T
Sbjct  180   EAILRLP-RALNENKYRLLPFMYATASGIFGSFSVLLAKCASILLILTFSGENQFVYFTT  238

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             Y  +   + T       LN  +   D + + PMFQ  W   S+  G V++++Y  F    
Sbjct  239   YLFMGGMMCTLVLQTDLLNRAIMAGDTLSVFPMFQCFWIGSSVIGGVVFYEKYTRFSLFD  298

Query  1138  TTMFVLGVMCVFIGISLLA---------PDDSK  1209
                  + +  + +GI LLA         PDD +
Sbjct  299   WLCLPIALAFIIMGIYLLAKHGEGESDDPDDPE  331



>ref|XP_009842058.1| hypothetical protein H257_15596 [Aphanomyces astaci]
 gb|ETV68432.1| hypothetical protein H257_15596 [Aphanomyces astaci]
Length=560

 Score =   100 bits (250),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 92/313 (29%), Positives = 151/313 (48%), Gaps = 26/313 (8%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             +G W+ G  I+L+ SI+ + G NL K        +S   N  +   +  +P+     W +
Sbjct  177   VGMWIAGFSISLVFSILNSVGINLQK--------YSLSQNANSTKTSFQQPL-----WVL  223

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G++F  LG+ L+F++FG A Q+LLA L ++  V N+  A F   + VT + +VAT  I +
Sbjct  224   GMVFVILGSILDFVAFGMAPQTLLAPLAALSLVWNMFIAPFFHKEKVTRRNLVATAIIFV  283

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY--CLILVLVVAFHHSVYRRGELLLNVP  798
             G    V F  H +P Y  + L   Y       Y  C++L L+  F  + Y     +    
Sbjct  284   GVTITVIFAGHSTPTYDLDDLILLYQTPVMYAYITCVVLFLLTMFAATRYIETNHVYE--  341

Query  799   GNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsi--snsyllHSWFTYSMLL  972
                   F+ ++    Y  ++GT G  SVL AKS   LL+ +I    +       TY ++ 
Sbjct  342   ----DGFFHIVC---YGGIAGTFGGQSVLLAKSTVELLKSAIWGDGADAFAHVTTYVIIA  394

Query  973   LFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFV  1152
               ++     ++ LN GL RFDA++++P++Q  W   S+  G +YF+EY    ++   MF 
Sbjct  395   GLVTCLLCQISFLNGGLKRFDALVVIPVYQSFWILMSVLGGIMYFEEYVSMTSVEKYMFT  454

Query  1153  LGVMCVFIGISLL  1191
              G +    GI  L
Sbjct  455   AGGVITISGIVYL  467



>ref|XP_008614573.1| hypothetical protein SDRG_10365 [Saprolegnia diclina VS20]
 gb|EQC32171.1| hypothetical protein SDRG_10365 [Saprolegnia diclina VS20]
Length=432

 Score = 98.6 bits (244),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 84/313 (27%), Positives = 145/313 (46%), Gaps = 13/313 (4%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             W +G  ++++ SI  N G NL K       K   L   G      ++P      W  G+ 
Sbjct  22    WYVGVLMSVVASICTNMGVNLQKYSFLCEAKRPLLLKRGYF----LQP-----KWAFGLF  72

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                 G+  +F + GF  QSL   +G    V+N+ FA++   +  + +  V T  IVLG +
Sbjct  73    LVVFGSIGDFAALGFIPQSLAIPVGGFTIVANVFFAHYFLKEPFSKRDGVGTGLIVLGIM  132

Query  634   FLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVP---GN  804
              + AF +  +  YT ++L   ++   F++Y  ILV V +    +Y R    + +    G+
Sbjct  133   VVAAFASKANDCYTVDELLLLFNQTHFIVYA-ILVSVTSVGLYLYIRKIRAIAIQYGVGS  191

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLS  984
              +   +          +SG  G+ SVLFAK+ + L + +++      ++ TY++  L L 
Sbjct  192   PMHRAYAKSQSIICPALSGVCGAQSVLFAKAFAELFKSTLAGDNQFTTFGTYAIAFLMLL  251

Query  985   TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVM  1164
                  +  L +GL   DA+ ++P+FQ  +   SI  G VYF E+     L+  MF LGV 
Sbjct  252   CVLLQIHWLAQGLETSDAVFVIPIFQCFFISVSILGGAVYFNEFATMSVLQLAMFFLGVT  311

Query  1165  CVFIGISLLAPDD  1203
                 G+ +L+  +
Sbjct  312   ITLGGVLVLSKRE  324



>ref|XP_002999246.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY69392.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=559

 Score = 99.8 bits (247),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 94/320 (29%), Positives = 145/320 (45%), Gaps = 23/320 (7%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT-WR  441
             MG WV G  I+L+ S++ + G NL KL                N  A +K     Q  W 
Sbjct  173   MGMWVAGFLISLIFSVLNSVGINLQKLSMSR------------NDTAEVKKTTLKQPLWM  220

Query  442   IGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIV  621
             +G     LG+ L+F++FG A Q+LLA L ++  V N+  A     + VT + ++AT  I 
Sbjct  221   LGFGLVCLGSLLDFVAFGMAPQTLLAPLAALSLVWNMLIAPIFHKEKVTRQNLIATAIIF  280

Query  622   LGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPG  801
             +G    V F  H +P Y  E L   Y       Y  ++V  +    +  R  E   N   
Sbjct  281   VGVTLTVIFAGHSTPSYELEDLIRLYQQPAMYAYITLIVCFLGGLFTFCRYIERTHNYEE  340

Query  802   NDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSW---FTYSMLL  972
                     +     Y  ++GT G  SVL AKS   LL+ +I     L+ +    +Y ++ 
Sbjct  341   G-------LFHIICYGGIAGTFGGQSVLLAKSTVELLKSAIWGDAGLYMFTQLTSYVIVA  393

Query  973   LFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFV  1152
                +  GF +  LN GL+RFDA++++P++Q  W   S+  G +YF+EY      +  MF 
Sbjct  394   GMCACLGFQVHFLNGGLARFDALVVIPVYQSFWILTSVLGGIMYFEEYVSMTRTQMFMFT  453

Query  1153  LGVMCVFIGISLLAPDDSKG  1212
             +G     +GI +L      G
Sbjct  454   IGGCVTILGIIVLLKTSHSG  473



>gb|ETP47186.1| hypothetical protein F442_06736 [Phytophthora parasitica P10297]
Length=573

 Score = 99.4 bits (246),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 90/312 (29%), Positives = 144/312 (46%), Gaps = 21/312 (7%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             +G WV G  I+L+ S++ + G NL KL            N+  + K   K  +    W +
Sbjct  173   VGMWVAGFLISLVFSVLNSVGINLQKLSMSR--------NDTADVK---KTTLEQPLWML  221

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G     LG+ L+F++FG A Q+LLA L ++  V N+  A     + VT + ++AT  I +
Sbjct  222   GFGLVCLGSLLDFVAFGMAPQTLLAPLAALSLVWNMLIAPIFHKEKVTRQNLIATAIIFI  281

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             G    V F  H +P Y  E L   Y       Y  ++V  +    +  R  E   N    
Sbjct  282   GVTLTVIFAGHSTPSYELEDLIRLYQQPAMYAYITLIVCFLGGLFTFCRYIERTHNYEEG  341

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllH---SWFTYSMLLL  975
                    +     Y  ++GT G  SVL AKS   LL+ +I      +    + +Y ++  
Sbjct  342   -------LFHIICYGGIAGTFGGQSVLLAKSTVELLKSAIWGDSGFYMFTQFTSYVIVAG  394

Query  976   FLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVL  1155
               +  GF +  LN GL+RFDA++++P++Q  W   S+  G +YF+EY      +  MF +
Sbjct  395   MCACLGFQVHFLNGGLARFDALVVIPVYQSFWILMSVLGGIMYFEEYVSMTRTQMLMFTI  454

Query  1156  GVMCVFIGISLL  1191
             G     +GI +L
Sbjct  455   GGCVTILGIIVL  466



>ref|XP_008892304.1| hypothetical protein PPTG_02790 [Phytophthora parasitica INRA-310]
 gb|ETI49354.1| hypothetical protein F443_06701 [Phytophthora parasitica P1569]
 gb|ETK89352.1| hypothetical protein L915_06573 [Phytophthora parasitica]
 gb|ETL42683.1| hypothetical protein L916_06512 [Phytophthora parasitica]
 gb|ETL95931.1| hypothetical protein L917_06382 [Phytophthora parasitica]
 gb|ETM49125.1| hypothetical protein L914_06485 [Phytophthora parasitica]
 gb|ETN23106.1| hypothetical protein PPTG_02790 [Phytophthora parasitica INRA-310]
 gb|ETO78087.1| hypothetical protein F444_06768 [Phytophthora parasitica P1976]
 gb|ETP19127.1| hypothetical protein F441_06704 [Phytophthora parasitica CJ01A1]
Length=573

 Score = 99.0 bits (245),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 90/312 (29%), Positives = 144/312 (46%), Gaps = 21/312 (7%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
             +G WV G  I+L+ S++ + G NL KL            N+  + K   K  +    W +
Sbjct  173   VGMWVAGFLISLVFSVLNSVGINLQKLSMSR--------NDTADVK---KTTLKQPLWML  221

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G     LG+ L+F++FG A Q+LLA L ++  V N+  A     + VT + ++AT  I +
Sbjct  222   GFGLVCLGSLLDFVAFGMAPQTLLAPLAALSLVWNMLIAPIFHKEKVTRQNLIATAIIFI  281

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN  804
             G    V F  H +P Y  E L   Y       Y  ++V  +    +  R  E   N    
Sbjct  282   GVTLTVIFAGHSTPSYELEDLIRLYQQPAMYAYITLIVCFLGGLFTFCRYIERTHNYEEG  341

Query  805   DLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllH---SWFTYSMLLL  975
                    +     Y  ++GT G  SVL AKS   LL+ +I      +    + +Y ++  
Sbjct  342   -------LFHIICYGGIAGTFGGQSVLLAKSTVELLKSAIWGDSGFYMFTQFTSYVIVAG  394

Query  976   FLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVL  1155
               +  GF +  LN GL+RFDA++++P++Q  W   S+  G +YF+EY      +  MF +
Sbjct  395   MCACLGFQVHFLNGGLARFDALVVIPVYQSFWILMSVLGGIMYFEEYVSMTRTQMLMFTI  454

Query  1156  GVMCVFIGISLL  1191
             G     +GI +L
Sbjct  455   GGCVTILGIIVL  466



>ref|XP_002767514.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER00232.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=360

 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 88/330 (27%), Positives = 155/330 (47%), Gaps = 39/330 (12%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
              +VIG  +N++G+I  NFGT L+K  +   +KH         GK          +  IG+
Sbjct  5     RFVIGIVVNIVGAITTNFGTVLMK--YHTAVKH---------GKG--------HSLIIGL  45

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGN  630
             I F +G+ L F SF FA QSLL+ + +IQFVSN+ F ++   +  T+  +  T  I+   
Sbjct  46    ILFCIGSVLTFGSFAFAPQSLLSGISAIQFVSNLFFVHYFLQEPFTVFNVCGTVVIIGAI  105

Query  631   IFLVAFGNHQSPVYTPEQLAEKY----SNITFLLYCLILVLVVAF--------------H  756
             + LV        +   +Q+   +    ++  F+L  L+L+  +AF               
Sbjct  106   VMLVVSSTKSEAINNVDQMFNDFYFSATHGYFVLGLLLLICFIAFAFWMRTGAPILWFTR  165

Query  757   HSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsi-sns  933
                 +R +  L++P +  +   + L+P  Y      +G+ SV+  K LS ++  +     
Sbjct  166   SKWPKRIQWELSLPRSHNRVT-RFLVPSGYTFCVAAVGAQSVVSGKVLSLIVTQAFGGQV  224

Query  934   yllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQE  1113
               L+   T+ +L  +L  A FW+  LN  L  F    +VP+ Q+ WT  ++ +G + F+E
Sbjct  225   SQLYQGRTFLVLFAWLFAAVFWVIHLNRALRIFPGAFLVPLTQVCWTLSTMLSGGIVFKE  284

Query  1114  YQVFDALRTTMFVLGVMCVFIGISLLAPDD  1203
             +    + +  +F  G   +F G+ LL+P  
Sbjct  285   FVAMQSWQLGVFFSGTGVLFFGVFLLSPRT  314



>gb|KFG26894.1| hypothetical protein NESG_01050 [Nematocida sp. 1 ERTm6]
Length=457

 Score = 97.8 bits (242),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 88/340 (26%), Positives = 161/340 (47%), Gaps = 41/340 (12%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             WV G  +++ G++ IN G NL K  +    + S +G             +    + +G+ 
Sbjct  129   WVFGPVLSITGNLFINVGLNLQKKSYTVE-RESIMG-------------LSVNLFGMGVF  174

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
              + +G    F S+ F  QSL+ +LG++  ++N  FA  +  +  T+   +   F+++G+ 
Sbjct  175   LYVVGKISGFSSYVFGNQSLMTSLGAVGLIANSIFAPMINKEVFTVYDFLCIVFVLIGSS  234

Query  634   FLVAFGNHQSPVYTPEQLAEKYSNITFLLY---------CLILVLVVAFHHSVYRRGE--  780
             F+++        Y+   L + Y  +T  L+          LI+  +V   +S ++ G   
Sbjct  235   FVLSNSGSGKKEYSLFSLLKNYFTLTTFLWFSFLVSMISALIIFCIVVEENSDWKIGTHA  294

Query  781   ----LLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHS  948
                 L   +  N     + ML  F+Y  VS  I SF+ LFAKS   L+ +++  +     
Sbjct  295   PWVALDRKISKNSYLLKYGML--FAYIGVSACIASFTTLFAKSFGVLISITMGGNNQFFG  352

Query  949   WFTYSM-LLLFLSTAG--FWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQ  1119
                Y    L+FL T G  +W   LN  L R+DA+L++P+F I WT  S+ T  +YF+++ 
Sbjct  353   PGPYLFGSLVFLCTVGQIYW---LNRALKRYDALLVIPVFHIMWTLLSVTTAGIYFKDFS  409

Query  1120  VFDALRTTMFVLGVMCVFIGISLLA----PDDSKGTQTKD  1227
             +F + +   F+ G++ +FIG   L       D+  T+++ 
Sbjct  410   MFTSSQFKNFLAGLVTIFIGSGFLTFRMIGKDAPSTESES  449



>ref|XP_009837075.1| hypothetical protein H257_11752 [Aphanomyces astaci]
 gb|ETV73649.1| hypothetical protein H257_11752 [Aphanomyces astaci]
Length=405

 Score = 97.1 bits (240),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 81/320 (25%), Positives = 146/320 (46%), Gaps = 11/320 (3%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             W +G  + +  S+  N G NL K       K  A    G       +P+     W +G+ 
Sbjct  15    WYVGVILGIGASVCTNMGVNLQKYSFMRETKKPAATKRGY----LRQPL-----WMLGLW  65

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                 G+  +F++ GF  QSL   +G    V+N+ FA+   ++  + +  + T  I+ G +
Sbjct  66    LVIFGSLGDFVALGFIPQSLAVPVGGSTIVANVFFAHKFLHEAFSRRDGIGTALILTGIV  125

Query  634   FLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLK  813
              + AF +  +  +T +QL   YS   F++Y  ++ + +   +   RR   ++   G    
Sbjct  126   VVAAFADKSNGCHTLDQLIALYSQPAFVVYVAVVCVAMVVFYYCVRRIRFIVRTFGKTST  185

Query  814   PFWQMLLPFSYA--IVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLST  987
              + +     S     +SG  G+ S+LFAKS++ L++ S+       +  TY++ L   + 
Sbjct  186   QYKRFATFHSLVNPALSGVFGAQSILFAKSVAELVKSSLDGENQFTTVGTYAIALAMFAC  245

Query  988   AGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMC  1167
                 +  L +GL  FDA+ +VP+FQ  +   SI  G VYF E+         MF++GV+ 
Sbjct  246   IFLQIHWLAQGLEHFDAVFVVPIFQCVFISTSIVGGAVYFNEFATMSTTTVVMFLVGVVI  305

Query  1168  VFIGISLLAPDDSKGTQTKD  1227
                G+ +L+  D    + K 
Sbjct  306   TLSGVGILSRRDMTSLKPKQ  325



>emb|CAD26163.2| hypothetical protein [Encephalitozoon cuniculi GB-M1]
Length=467

 Score = 97.1 bits (240),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 89/341 (26%), Positives = 150/341 (44%), Gaps = 31/341 (9%)
 Frame = +1

Query  250   CHLNLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPI-IH  426
             C  +    W+ G F+++ G+I IN G NL K  + +               A M+   ++
Sbjct  127   CVPDKSSSWIFGVFLSVSGNIGINVGINLQKKSYKQ---------------AHMRLFGMN  171

Query  427   FQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVA  606
              QT+  G   + LG  L + S+ F  QSL+AAL +   VSN  FA  +  +  T K   A
Sbjct  172   LQTFYAGCFTYGLGKILGYCSYVFGNQSLIAALSATGLVSNSIFAPMINEEVFTWKDFCA  231

Query  607   TTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYC--LILVLVVAFHHSVYRRGE  780
               F   G   +V        +YT  +L + Y     L++   ++LV+VV F    Y    
Sbjct  232   IFFAFAGTTLIVMNTAITHKMYTLCELMKMYRRTETLIWFGFIVLVIVVLFTFIKYVEVN  291

Query  781   LLLNVPGNDL-----KPFW--------QMLLPFSYAIVSGTIGSFSVLFAKslsnllrls  921
                 +P   +     +  W        +  +  +Y  +S  I SF+ L  KSL  ++  +
Sbjct  292   SNWELPDESMTFLRKEGVWFDEEGVVMKYTMVLAYVCLSSFIASFTTLSVKSLGEMIDKT  351

Query  922   isnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFV  1101
             I+         TY  ++       F +  LN  L  +DA+L++PMF + WT  SI T  +
Sbjct  352   IAGDNQFIFLTTYLFIMTLAICTFFQIYWLNRALRHYDALLVIPMFHVTWTLLSILTAGI  411

Query  1102  YFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQTK  1224
             YF+E++ + + +  +F  GV  +F+G   L    +  T+ +
Sbjct  412   YFREFEQYTSYQLDVFAAGVGMIFVGSFFLGSRITNKTRIR  452



>ref|NP_597528.1| hypothetical protein ECU03_0170 [Encephalitozoon cuniculi GB-M1]
Length=478

 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 89/341 (26%), Positives = 150/341 (44%), Gaps = 31/341 (9%)
 Frame = +1

Query  250   CHLNLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPI-IH  426
             C  +    W+ G F+++ G+I IN G NL K  + +               A M+   ++
Sbjct  138   CVPDKSSSWIFGVFLSVSGNIGINVGINLQKKSYKQ---------------AHMRLFGMN  182

Query  427   FQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVA  606
              QT+  G   + LG  L + S+ F  QSL+AAL +   VSN  FA  +  +  T K   A
Sbjct  183   LQTFYAGCFTYGLGKILGYCSYVFGNQSLIAALSATGLVSNSIFAPMINEEVFTWKDFCA  242

Query  607   TTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYC--LILVLVVAFHHSVYRRGE  780
               F   G   +V        +YT  +L + Y     L++   ++LV+VV F    Y    
Sbjct  243   IFFAFAGTTLIVMNTAITHKMYTLCELMKMYRRTETLIWFGFIVLVIVVLFTFIKYVEVN  302

Query  781   LLLNVPGNDL-----KPFW--------QMLLPFSYAIVSGTIGSFSVLFAKslsnllrls  921
                 +P   +     +  W        +  +  +Y  +S  I SF+ L  KSL  ++  +
Sbjct  303   SNWELPDESMTFLRKEGVWFDEEGVVMKYTMVLAYVCLSSFIASFTTLSVKSLGEMIDKT  362

Query  922   isnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFV  1101
             I+         TY  ++       F +  LN  L  +DA+L++PMF + WT  SI T  +
Sbjct  363   IAGDNQFIFLTTYLFIMTLAICTFFQIYWLNRALRHYDALLVIPMFHVTWTLLSILTAGI  422

Query  1102  YFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQTK  1224
             YF+E++ + + +  +F  GV  +F+G   L    +  T+ +
Sbjct  423   YFREFEQYTSYQLDVFAAGVGMIFVGSFFLGSRITNKTRIR  463



>ref|XP_002898925.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY62683.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=437

 Score = 95.9 bits (237),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 164/365 (45%), Gaps = 32/365 (9%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT-  435
             N+ G+W IG  I +  +++ N G N+ KL H                +   KP+   QT 
Sbjct  20    NVQGKW-IGLAIVITSAVLSNLGVNVQKLSHV---------------REEEKPVFERQTY  63

Query  436   -----WRIGIIFFALGNSLNFISFGFAAQSLLAALGS-IQFVSNIAFAYFVFNKTVTIKV  597
                  W  G++   LG   +F + GFA Q+L+A++G     ++N+ FA+    + +T   
Sbjct  64    YTRPLWLTGLVLVVLGAVGDFEALGFAPQALVASVGGGFTVLANVFFAHLWLGQILTRTD  123

Query  598   MVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRG  777
             ++ T  I++G + L    N      +  +L +++  + FL+Y  ++ +V+    +++ + 
Sbjct  124   VLGTLLIIIG-VVLSTVANEPDEQMSLVELEKQFFQLGFLIYLGVMTVVLG---AIFGQI  179

Query  778   ELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT  957
             E +  +P   L      LLPF YA  SG  GSFSVL AK  S LL L++S       + T
Sbjct  180   EAISRLP-RALNESKYRLLPFMYATASGIFGSFSVLLAKCASILLILTVSGENQFVYFTT  238

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             Y  +   + T       LN  +   D + + PMFQ  W   S+  G V++++Y  F    
Sbjct  239   YLFMGGMMCTLVLQTDLLNRAIMVGDTLSVFPMFQCFWIGSSVIGGVVFYEKYTRFSLFD  298

Query  1138  TTMFVLGVMCVFIGISLLA---PDDSKGTQTKDsslvsasslsNDVERLIMPLEDPQLKD  1308
                  + +  + +GI LLA    D+S      + +     +        +MPL  PQ   
Sbjct  299   WICLPIALAFIIMGIYLLAKHGEDESDDLDDPEHTTPGHRAHLTGHFGALMPLS-PQGHS  357

Query  1309  VKSFS  1323
               +FS
Sbjct  358   YSTFS  362



>gb|AGE96559.1| hypothetical protein ECU03_0170 [Encephalitozoon cuniculi]
Length=478

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 89/341 (26%), Positives = 150/341 (44%), Gaps = 31/341 (9%)
 Frame = +1

Query  250   CHLNLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPI-IH  426
             C  +    W+ G F+++ G+I IN G NL K  + +               A M+   ++
Sbjct  138   CVPDKSSSWIFGVFLSVSGNIGINVGINLQKKSYKQ---------------AHMRLFGMN  182

Query  427   FQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVA  606
              QT+  G   + LG  L + S+ F  QSL+AAL +   VSN  FA  +  +  T K   A
Sbjct  183   LQTFYAGCFTYGLGKILGYCSYVFGNQSLIAALSATGLVSNSIFAPMINEEVFTWKDFCA  242

Query  607   TTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYC--LILVLVVAFHHSVYRRGE  780
               F   G   +V        +YT  +L + Y     L++   ++LV+VV F    Y    
Sbjct  243   IFFAFAGTTLIVMNTAITHRMYTLCELMKMYRRTETLIWFGFIVLVIVVLFTFIKYVEVN  302

Query  781   LLLNVPGNDL-----KPFW--------QMLLPFSYAIVSGTIGSFSVLFAKslsnllrls  921
                 +P   +     +  W        +  +  +Y  +S  I SF+ L  KSL  ++  +
Sbjct  303   SNWELPDESMTFLRKEGVWFDEEGVVMKYTMVLAYVCLSSFIASFTTLSVKSLGEMIDKT  362

Query  922   isnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFV  1101
             I+         TY  ++       F +  LN  L  +DA+L++PMF + WT  SI T  +
Sbjct  363   IAGDNQFIFLTTYLFIMTLAICTFFQIYWLNRALRHYDALLVIPMFHVTWTLLSILTAGI  422

Query  1102  YFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQTK  1224
             YF+E++ + + +  +F  GV  +F+G   L    +  T+ +
Sbjct  423   YFREFEQYTSYQLDVFAAGVGMIFVGSFFLGSRITNKTRIR  463



>gb|AHW68400.1| putative nucleotide-sugar transporter [Nosema pernyi]
Length=464

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 89/324 (27%), Positives = 154/324 (48%), Gaps = 35/324 (11%)
 Frame = +1

Query  277   VIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGIIF  456
             + G  +++ G+I IN G NL K  +    K S++   G          +    + +G   
Sbjct  136   IFGVLLSVSGNIFINTGVNLQKKSY----KQSSVNLLG----------VDLDLFFVGCFV  181

Query  457   FALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIF  636
             + +G   +++S+ F  QSLLAAL +   VSN   A  +  +  T K ++A  F+  G   
Sbjct  182   YLIGKITSYLSYIFGNQSLLAALSATGLVSNSILAPMINKEIFTWKDLIAIFFVFSGTTL  241

Query  637   LVAFGNHQSPVYTPEQLAEKYSN-ITFLLYCLILVLVVAFHHSV-YRRGELLLNVPGNDL  810
             +V   N     Y+  +L + Y    T + +  IL+ ++  +  + +        +P   L
Sbjct  242   IVINNNVSHKNYSLCELMKMYKRPETIMWFAFILMTILGLYFFIKFVEVNSDWELPDEQL  301

Query  811   KPF-----W--------QMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSW  951
             + F     W        + L+  +Y  +S  I SF+ L  KSL  ++  ++       S+
Sbjct  302   RIFKRENVWFEEEGVVMKYLMILAYVWLSSFIASFTTLSIKSLGEIIDKTLGGENQFASY  361

Query  952   FTYSMLL-LFLSTAG--FWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQV  1122
              TY  +L L + T G  +W   LN  L R+DA+L+VP+F I WT  SI T  +YFQE++ 
Sbjct  362   VTYIFILGLIICTFGQIYW---LNRALRRYDALLVVPLFHITWTILSIFTAGIYFQEFEY  418

Query  1123  FDALRTTMFVLGVMCVFIGISLLA  1194
             +  ++ T F++G+  +F+G   LA
Sbjct  419   YSKVQFTNFLIGIGLIFLGSMFLA  442



>ref|XP_008871405.1| hypothetical protein H310_07436 [Aphanomyces invadans]
 gb|ETV99987.1| hypothetical protein H310_07436 [Aphanomyces invadans]
Length=411

 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 80/325 (25%), Positives = 144/325 (44%), Gaps = 19/325 (6%)
 Frame = +1

Query  262   LMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWR  441
             L G   +G +I +   I  N G  L K  H  + + +    E ++        +H + W 
Sbjct  26    LTGSNALGMWITITAGICSNLGVQLQKHAHQRQARAAQHVKENSSTSVY---FVH-KHWI  81

Query  442   IGIIFFALGNSLNFISFGFAAQSLLAALGS-IQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
             +G++   +G+  +F +  FA QSL+A +G     ++N+ F+     +T T++    T  I
Sbjct  82    LGMVLVVIGSIGDFEALSFATQSLVATVGGGTTVLTNVFFSTIWHGETFTLRDAYGTCCI  141

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVP  798
             +LG + L+A  + +   Y  EQL  K+   + L Y   +   + F HS+ R G++   +P
Sbjct  142   LLG-VTLIALCSPEDEQYNVEQLVVKFQRPSVLAYLAFVAAAIYFMHSIIRSGDVHAAIP  200

Query  799   GN-----DLKPFWQM--------LLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyl  939
              +      ++ F  M        + P  YAI SG +GS S+L  K  S ++  ++     
Sbjct  201   TSLGTSARVRRFLHMDQASGQVCVQPLLYAINSGIMGSLSMLLGKCASEMVTTTLHGRNQ  260

Query  940   lHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQ  1119
              +    +       +T G  +   N+ L   D  ++ P+FQ+ W  F    G V + +  
Sbjct  261   FNHPLPFIFFAGMAATIGVQVHWFNQSLMLGDMAMVFPVFQVFWIGFGAVGGMVLYGDVA  320

Query  1120  VFDALRTTMFVLGVMCVFIGISLLA  1194
                  ++  FVL   C+ IG+  LA
Sbjct  321   RLAFFQSVSFVLAFWCILIGVYNLA  345



>ref|XP_008290388.1| PREDICTED: NIPA-like protein 2 [Stegastes partitus]
Length=365

 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 80/325 (25%), Positives = 141/325 (43%), Gaps = 37/325 (11%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTW  438
             N +  +++G  I++ G+++I+   N+ K  H   ++ S  G+         KP      W
Sbjct  26    NPLQTYLLGIIISICGNVLISISLNIQKYAH---VRQSQRGS---------KPYYTSAMW  73

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
               G++   +G   NF ++GFA  SL+A LG +  +++   +     +TV    +V  T  
Sbjct  74    WCGVVLMGVGELGNFAAYGFAPASLIAPLGCVSVIASAVISVVFLKETVRASDIVGGTLA  133

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVP  798
             + G   LV F  H S   T   +     +  FLLY  I V++      +Y+R  +   V 
Sbjct  134   ITGTYLLVTFAPHTSTHITAHLVQYYAVSWHFLLYLFIEVIIFCILLYLYKRRNVKHIVI  193

Query  799   GNDLKPFWQMLLPFSYAIVSGTI-----GSFSVLFAKslsnllrlsisnsyllHSWFTYS  963
                L      L   S   VSG I     G   +++                       Y 
Sbjct  194   VMLLVALLASLTVISVKAVSGMITESIKGQLQLIYP--------------------IFYV  233

Query  964   MLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTT  1143
             ML++ +++  F +  LN+ +  FDA  +VP+  + +T  +I  G V++QE++    L   
Sbjct  234   MLVVMVASCAFQIKFLNQAMKMFDATEVVPINFVFFTASAIVAGIVFYQEFEGLALLNIF  293

Query  1144  MFVLGVMCVFIGISLLAPDDSKGTQ  1218
             MF+ G +  F+G+ L+A +  K  Q
Sbjct  294   MFLFGCLLSFLGVFLIARNRPKIKQ  318



>ref|XP_009518122.1| hypothetical protein PHYSODRAFT_486419 [Phytophthora sojae]
 gb|EGZ22834.1| hypothetical protein PHYSODRAFT_486419 [Phytophthora sojae]
Length=448

 Score = 95.1 bits (235),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 97/365 (27%), Positives = 164/365 (45%), Gaps = 32/365 (9%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT-  435
             N+ G+W IG  I +  +++ N G N+ KL H                +   KP+   QT 
Sbjct  17    NVQGKW-IGLAIVITSAVLSNLGVNVQKLSHV---------------REEDKPVFERQTY  60

Query  436   -----WRIGIIFFALGNSLNFISFGFAAQSLLAALGS-IQFVSNIAFAYFVFNKTVTIKV  597
                  W  G++   LG   +F + GFA Q+L+A++G     ++N+ FA+    + +T   
Sbjct  61    YTRPLWLTGLVLVVLGAIGDFEALGFAPQALVASVGGGFTVLANVFFAHLWLGQILTKTD  120

Query  598   MVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRG  777
             ++ T  I++G + L    N      +  +L +++  + FL+Y  ++  V+     ++ + 
Sbjct  121   VLGTLLIIIG-VVLSTVANEPDEQMSLLELEKQFFQLGFLIYLGVMTAVLG---GIFGQI  176

Query  778   ELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT  957
             E +  +P   L      LLPF YA  SG  GSFSVL AK  S LL L++S       + T
Sbjct  177   EAISRLP-RALNESKYRLLPFMYATASGIFGSFSVLLAKCASILLILTVSGENQFVYFTT  235

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             Y  +   + T       LN  +   D + + PMFQ  W   S+  G V++++Y  F    
Sbjct  236   YLFMGGMMCTLVLQTDLLNRAIMAGDTLSVFPMFQCFWIGSSVIGGVVFYEKYTRFTLFD  295

Query  1138  TTMFVLGVMCVFIGISLLAPD-DSKGTQTKDsslvsasslsNDVERL--IMPLEDPQLKD  1308
                  + +  + +GI LLA   + +G   +D    +    ++       +MPL  PQ   
Sbjct  296   WICLPIALAFIIMGIYLLAKHGEDEGDDPEDPEHTTPGHRAHLTGHFGALMPLS-PQGHS  354

Query  1309  VKSFS  1323
               SFS
Sbjct  355   YSSFS  359



>emb|CCI39701.1| unnamed protein product [Albugo candida]
Length=563

 Score = 95.5 bits (236),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 99/326 (30%), Positives = 149/326 (46%), Gaps = 27/326 (8%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNE--GTNGKAAMKPIIHFQTW  438
             MG WV G  I  + SI  + G NL KL        S   NE  G    +  +P+     W
Sbjct  170   MGMWVAGFLIAFIFSIFNSIGINLQKL--------SMTRNEASGLKRNSFQQPL-----W  216

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
              +G     LG+ L+F++FG A Q+LLA L ++  V N+  A F  N+ VT + ++AT  I
Sbjct  217   LLGFSLVCLGSILDFVAFGMAPQTLLAPLAALSLVWNMMIAPFFHNEKVTKQSVIATVII  276

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVP  798
              +G I  V F  H +P Y  + L + Y       Y   + + +A    + +  E   N  
Sbjct  277   FIGVILTVIFAGHSTPEYELQDLIDLYQQHAMYAYMFFVFVFLAALFGLTKYIEKTHNFE  336

Query  799   GNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT----YSM  966
                    + ++    Y  ++GT G  SVL AKS   LL+ +I  +    + FT    Y +
Sbjct  337   NG----IYHIVC---YGGIAGTFGGQSVLLAKSTVELLKSAIWGADGA-AVFTNVAPYLI  388

Query  967   LLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTM  1146
             L   +    F +  LN GL+RFDA+++VP++Q  W   S+  G +YF EY         M
Sbjct  389   LCGLIICLVFQVFFLNGGLARFDALVVVPVYQSFWILMSVLGGIMYFAEYVSMTKTSLYM  448

Query  1147  FVLGVMCVFIGISLLAPDDSKGTQTK  1224
             F LG +    GI  L    S    ++
Sbjct  449   FTLGALITISGIIYLLKSRSNENSSE  474



>ref|XP_010744902.1| PREDICTED: NIPA-like protein 2 isoform X2 [Larimichthys crocea]
Length=365

 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 82/326 (25%), Positives = 144/326 (44%), Gaps = 39/326 (12%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTW  438
             N +  +++G  I++ G+++I+   N+ K  H   ++ +  G+         KP      W
Sbjct  26    NPLRTYLLGIIISICGNVLISISLNIQKYAH---VRQAQRGS---------KPYYTSVMW  73

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
               G++   +G   NF ++GFA  SL+A LG +  +++   +     +TV    +V  T  
Sbjct  74    WCGVVLMGIGELGNFAAYGFAPASLIAPLGCVSVIASAVISVVFLKETVRASDIVGGTLA  133

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYS-NITFLLYCLILVLVVAFHHSVYRRGELLLNV  795
             + G   LV F  H S  +    L + Y+ +  FLLY  I V+       +Y+R ++   V
Sbjct  134   ITGTYLLVTFAPHTS-THITAHLVQYYAISWHFLLYLFIEVIAFCILLYLYKRKKVKHIV  192

Query  796   PGNDLKPFWQMLLPFSYAIVSGTI-----GSFSVLFAKslsnllrlsisnsyllHSWFTY  960
                 L      L   S   VSG I     G   +++                       Y
Sbjct  193   IVMLLVALLASLTVISVKAVSGMITESIKGQLQLIYP--------------------IFY  232

Query  961   SMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRT  1140
              ML++ + +  F +  LN+ +  FDA  +VP+  + +T  +I  G V++QE++    L  
Sbjct  233   VMLVVMVVSCAFQIKFLNQAMKMFDATEVVPINFVFFTASAIIAGIVFYQEFEGLALLNI  292

Query  1141  TMFVLGVMCVFIGISLLAPDDSKGTQ  1218
              MF+LG +  F+GI L+A +  K  Q
Sbjct  293   FMFLLGCLLSFLGIFLIARNRPKIKQ  318



>ref|XP_005930224.1| PREDICTED: NIPA-like protein 2-like [Haplochromis burtoni]
Length=368

 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 79/321 (25%), Positives = 143/321 (45%), Gaps = 29/321 (9%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTW  438
             N +  +++G  I++ G+++I+   N+ K  H  + +  +            KP     TW
Sbjct  29    NPLQTYLLGIIISICGNVLISISLNIQKYAHVRQAQRGS------------KPYYTSATW  76

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
               G++   +G   NF ++GFA  SL+A LG +  +++   +     +T+    +V  T  
Sbjct  77    WCGVVLMGVGELGNFAAYGFAPASLIAPLGCVSVIASAIISVVFLKETLCASDIVGGTLA  136

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYS-NITFLLYCLILVLVVAFHHSVYRRGELLLNV  795
             + G   LV F  H S  +    L + Y+ +  FLLY  I +++      +Y+R  +   V
Sbjct  137   ITGTYVLVTFAPHTS-THITAHLVQYYTISWHFLLYLFIEIVIFCLLLYLYKRRNMKHIV  195

Query  796   PGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLL  975
                 L      L   S   VSG I                       L++S F Y M ++
Sbjct  196   IVMLLVALLASLTVISVKAVSGMITE--------------SIKGQLQLIYSIF-YVMFVV  240

Query  976   FLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVL  1155
              +++  F +  LN+ +  FDA  +VP+  + +T  +I  G V++QE++    L   MF+ 
Sbjct  241   MVASCAFQIKFLNQAMKMFDATEVVPINFVFFTASAILAGIVFYQEFEGLALLNIGMFLF  300

Query  1156  GVMCVFIGISLLAPDDSKGTQ  1218
             G +  F+G+ L+A +  K  Q
Sbjct  301   GCLLSFVGVFLIARNRPKIKQ  321



>ref|XP_010744901.1| PREDICTED: NIPA-like protein 2 isoform X1 [Larimichthys crocea]
Length=371

 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 82/326 (25%), Positives = 144/326 (44%), Gaps = 39/326 (12%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTW  438
             N +  +++G  I++ G+++I+   N+ K  H   ++ +  G+         KP      W
Sbjct  32    NPLRTYLLGIIISICGNVLISISLNIQKYAH---VRQAQRGS---------KPYYTSVMW  79

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
               G++   +G   NF ++GFA  SL+A LG +  +++   +     +TV    +V  T  
Sbjct  80    WCGVVLMGIGELGNFAAYGFAPASLIAPLGCVSVIASAVISVVFLKETVRASDIVGGTLA  139

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYS-NITFLLYCLILVLVVAFHHSVYRRGELLLNV  795
             + G   LV F  H S  +    L + Y+ +  FLLY  I V+       +Y+R ++   V
Sbjct  140   ITGTYLLVTFAPHTS-THITAHLVQYYAISWHFLLYLFIEVIAFCILLYLYKRKKVKHIV  198

Query  796   PGNDLKPFWQMLLPFSYAIVSGTI-----GSFSVLFAKslsnllrlsisnsyllHSWFTY  960
                 L      L   S   VSG I     G   +++                       Y
Sbjct  199   IVMLLVALLASLTVISVKAVSGMITESIKGQLQLIYP--------------------IFY  238

Query  961   SMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRT  1140
              ML++ + +  F +  LN+ +  FDA  +VP+  + +T  +I  G V++QE++    L  
Sbjct  239   VMLVVMVVSCAFQIKFLNQAMKMFDATEVVPINFVFFTASAIIAGIVFYQEFEGLALLNI  298

Query  1141  TMFVLGVMCVFIGISLLAPDDSKGTQ  1218
              MF+LG +  F+GI L+A +  K  Q
Sbjct  299   FMFLLGCLLSFLGIFLIARNRPKIKQ  324



>ref|XP_008605810.1| hypothetical protein, variant [Saprolegnia diclina VS20]
 gb|EQC40966.1| hypothetical protein, variant [Saprolegnia diclina VS20]
Length=254

 Score = 92.0 bits (227),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 105/209 (50%), Gaps = 15/209 (7%)
 Frame = +1

Query  280  IGAFINLLGSIIINFGTNLLKLG--HDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
            +G  + L+G+ + N G N+ K    H ER+  +             +P      W +G  
Sbjct  8    LGIGMCLVGTTVSNLGLNIQKYSFLHQERLPETQ-----------RRPYNTQWRWWLGFA  56

Query  454  FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
               LG+  +F +  FAAQS++  +G+   V+N+ FA++   + +    +  T  IVLG  
Sbjct  57   CVGLGSIADFAALTFAAQSVITPIGAFTLVANLGFAHYWLKEPLGSTDLAGTGLIVLGAT  116

Query  634  FLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLK  813
             +  FG+H+SP Y+ ++L    +  + ++Y + ++ +VAF H V  R E +L   G    
Sbjct  117  AVTIFGSHESPKYSLDELIALSTRGSMVVYAIAILGLVAFFHVVRMRSEQVLRKCGKASP  176

Query  814  PF--WQMLLPFSYAIVSGTIGSFSVLFAK  894
             +   + L P SYA  +G +G+ SV+FAK
Sbjct  177  EYRALEKLHPLSYAGFAGIVGAQSVMFAK  205



>emb|CCA15657.1| conserved hypothetical protein [Albugo laibachii Nc14]
 emb|CCA16279.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=563

 Score = 95.1 bits (235),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 93/311 (30%), Positives = 142/311 (46%), Gaps = 25/311 (8%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT--W  438
             MG W+ G  I  + SI  + G NL KL               T  +AA      FQ   W
Sbjct  172   MGMWIAGFLIAFIFSIFNSIGINLQKLSM-------------TRNEAAKLKKKSFQQPLW  218

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
              +G     +G+ L+F++FG A Q+LLA L ++  V N+  A F  ++ VT + ++AT  I
Sbjct  219   LLGFSLVCVGSILDFVAFGMAPQTLLAPLAALSLVWNMMIAPFFHDEKVTKQSVIATVII  278

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVP  798
              +G I  V F  H +P Y  + L + Y       Y   + + +A   ++ +  E   N  
Sbjct  279   FIGVILTVIFAGHSTPEYELKDLIDLYQQPAMYAYMFFVFVFLAALFALTKYIEKTHNFE  338

Query  799   GNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT---YSML  969
             G      + ++    Y  ++GT G  SVL AKS   LL+ +I  +     +     Y +L
Sbjct  339   GG----IYHIV---CYGGIAGTFGGQSVLLAKSTVELLKSAIWGAGGAGVFTNVAPYLIL  391

Query  970   LLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMF  1149
                +    F +  LN GL+RFDA+++VP++Q  W   S+  G  YF EY         MF
Sbjct  392   CGLIICLVFQVFFLNGGLARFDALVVVPVYQSFWILMSVLGGITYFAEYVSMTKTSLYMF  451

Query  1150  VLGVMCVFIGI  1182
              LG +    GI
Sbjct  452   TLGALITISGI  462



>gb|EIJ89780.1| hypothetical protein NEQG_00550 [Nematocida parisii ERTm3]
 gb|EIJ94017.1| hypothetical protein NEPG_00682 [Nematocida parisii ERTm1]
Length=476

 Score = 94.4 bits (233),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 91/350 (26%), Positives = 168/350 (48%), Gaps = 45/350 (13%)
 Frame = +1

Query  250   CHLNLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHF  429
             C  ++   W+ G  +++ G+I IN G NL K         S +   GT     +      
Sbjct  140   CVPSIHKMWIFGPILSVTGNIFINIGLNLQK--------KSYVMERGTFWGMTI------  185

Query  430   QTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVAT  609
               + +G++ + +G    F S+ F  QSL+ +LG++  ++N  FA  +  +  T+   +  
Sbjct  186   NLFALGVLSYVVGKISGFSSYVFGNQSLMTSLGAVGIIANSIFAPMINKEVFTVYDFLCI  245

Query  610   TFIVLGNIFLVAFGNHQSPVYTPEQLAEKY-SNITFLLYCLILVLVVAF--------HHS  762
              F+++G+  +++        +    L + Y S  TF+ +  +L L+VA          +S
Sbjct  246   VFVLIGSSLVLSNAGTGKKDHNLFGLLKNYFSAATFIWFLCLLCLIVALIIFCRIVEDNS  305

Query  763   VYRRG--------ELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrl  918
              ++ G        +  L+  G  LK     ++  +Y  VS +I SF+ LFAKS   L+ L
Sbjct  306   DWKLGTEKPWISLDKKLSKNGYCLK----YIMVVAYVAVSASIASFTTLFAKSFGVLISL  361

Query  919   sisnsyllHSWFTYSM-LLLFLSTAG--FWMARLNEGLSRFDAILIVPMFQIAWTFFSIC  1089
             ++      +    Y    L+FL T G  +W   LN+ L R+DA+L++P+F I WT  S+ 
Sbjct  362   TLDGQNQFYGPGPYLFGSLVFLCTVGQIYW---LNKALKRYDALLVIPIFHIMWTLLSVT  418

Query  1090  TGFVYFQEYQVFDALRTTMFVLGVMCVFIGISLL----APDDSKGTQTKD  1227
             T  +YF+++ +F + +   F+LG++ +FIG   L       D+  T+++ 
Sbjct  419   TAGIYFKDFSMFTSSQFKNFLLGLVTIFIGSGFLIFRMVGKDTPSTESEK  468



>ref|XP_006796034.1| PREDICTED: NIPA-like protein 2-like [Neolamprologus brichardi]
Length=368

 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 143/328 (44%), Gaps = 39/328 (12%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTW  438
             N +  +++G  I++ G+++I+   N+ K  H  + +  +            KP     TW
Sbjct  29    NPLQTYLLGIIISICGNVLISISLNIQKYAHVRQAQRGS------------KPYYTSATW  76

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
               G++   +G   NF ++GFA  SL+A LG +  +++   +     +T+    +V  T  
Sbjct  77    WCGVVLMGVGELGNFAAYGFAPASLIAPLGCVSVIASAIISVVFLKETLCASDIVGGTLA  136

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYS-NITFLLYCLILVLVVAFHHSVYRRGELLLNV  795
             + G   LV F  H S  +    L + Y+ +  FLLY  I +++      +Y+R  +   V
Sbjct  137   ITGTYVLVTFAPHTS-THITAHLVQYYAISWHFLLYLFIEIVIFCLLLYLYKRRNMKHIV  195

Query  796   PGNDLKPFWQMLLPFSYAIVSGTI-----GSFSVLFAKslsnllrlsisnsyllHSWFTY  960
                 L      L   S   VSG I     G   +++                       Y
Sbjct  196   IVMLLVALLASLTVISVKAVSGMITESIKGQLQLIYP--------------------IFY  235

Query  961   SMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRT  1140
              M ++ +++  F +  LN+ +  FDA  +VP+  + +T  +I  G V++QE++    L  
Sbjct  236   VMFVVMVASCAFQIKFLNQAMKMFDATEVVPINFVFFTASAILAGIVFYQEFEGLALLNI  295

Query  1141  TMFVLGVMCVFIGISLLAPDDSKGTQTK  1224
              MF+ G +  F+G+ L+A +  K  Q +
Sbjct  296   GMFLFGCLLSFVGVFLIARNRPKIKQQE  323



>ref|XP_004560082.1| PREDICTED: NIPA-like protein 2-like isoform X1 [Maylandia zebra]
 ref|XP_004560083.1| PREDICTED: NIPA-like protein 2-like isoform X2 [Maylandia zebra]
Length=368

 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 77/326 (24%), Positives = 142/326 (44%), Gaps = 39/326 (12%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTW  438
             N +  +++G  I++ G+++I+   N+ K  H  + +  +            KP     TW
Sbjct  29    NPLQTYLLGIIISICGNVLISISLNIQKYAHVRQAQRGS------------KPYYTSATW  76

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
               G++   +G   NF ++GFA  SL+A LG +  +++   +     +T+    +V  T  
Sbjct  77    WCGVVLMGVGELGNFAAYGFAPASLIAPLGCVSVIASAIISVVFLKETLCASDIVGGTLA  136

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYS-NITFLLYCLILVLVVAFHHSVYRRGELLLNV  795
             + G   LV F  H S  +    L + Y+ +  FLLY  I +++      +Y+R  +   V
Sbjct  137   ITGTYVLVTFAPHTS-THITAHLVQYYTISWHFLLYLFIEIVIFCLLLYLYKRRNMKHIV  195

Query  796   PGNDLKPFWQMLLPFSYAIVSGTI-----GSFSVLFAKslsnllrlsisnsyllHSWFTY  960
                 L      L   S   VSG I     G   +++                       Y
Sbjct  196   IVMLLVALLASLTVISVKAVSGMITESIKGQLQLIYP--------------------IFY  235

Query  961   SMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRT  1140
              M ++ +++  F +  LN+ +  FDA  +VP+  + +T  +I  G V++QE++    L  
Sbjct  236   VMFVVMVASCAFQIKFLNQAMKMFDATEVVPINFVFFTASAILAGIVFYQEFEGLALLNI  295

Query  1141  TMFVLGVMCVFIGISLLAPDDSKGTQ  1218
              MF+ G +  F+G+ L+A +  K  Q
Sbjct  296   GMFLFGCLLSFVGVFLIARNRPKIKQ  321



>ref|XP_005742974.1| PREDICTED: NIPA-like protein 2-like [Pundamilia nyererei]
Length=368

 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 77/326 (24%), Positives = 142/326 (44%), Gaps = 39/326 (12%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTW  438
             N +  +++G  I++ G+++I+   N+ K  H  + +  +            KP     TW
Sbjct  29    NPLQTYLLGIIISICGNVLISISLNIQKYAHVRQAQRGS------------KPYYTSTTW  76

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
               G++   +G   NF ++GFA  SL+A LG +  +++   +     +T+    +V  T  
Sbjct  77    WCGVVLMGVGELGNFAAYGFAPASLIAPLGCVSVIASAIISVVFLKETLCASDIVGGTLA  136

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYS-NITFLLYCLILVLVVAFHHSVYRRGELLLNV  795
             + G   LV F  H S  +    L + Y+ +  FLLY  I +++      +Y+R  +   V
Sbjct  137   ITGTYVLVTFAPHTS-THITAHLVQYYTISWHFLLYLFIEIVIFCLLLYLYKRRNMKHIV  195

Query  796   PGNDLKPFWQMLLPFSYAIVSGTI-----GSFSVLFAKslsnllrlsisnsyllHSWFTY  960
                 L      L   S   VSG I     G   +++                       Y
Sbjct  196   IVMLLVALLASLTVISVKAVSGMITESIKGQLQLIYP--------------------IFY  235

Query  961   SMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRT  1140
              M ++ +++  F +  LN+ +  FDA  +VP+  + +T  +I  G V++QE++    L  
Sbjct  236   VMFVVMVASCAFQIKFLNQAMKMFDATEVVPINFVFFTASAILAGIVFYQEFEGLALLNI  295

Query  1141  TMFVLGVMCVFIGISLLAPDDSKGTQ  1218
              MF+ G +  F+G+ L+A +  K  Q
Sbjct  296   GMFLFGCLLSFVGVFLIARNRPKIKQ  321



>ref|XP_003965886.1| PREDICTED: NIPA-like protein 2-like [Takifugu rubripes]
Length=362

 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 83/326 (25%), Positives = 144/326 (44%), Gaps = 39/326 (12%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTW  438
             N +  +++G  I++ G+++I+   N+ K  H   ++ +  G+         KP      W
Sbjct  23    NPLQMYLLGIIISICGNVLISISLNVQKYTH---LRQAERGS---------KPYYTSPVW  70

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
               G++   +G   NF ++GFA  +L+A LG +  +++   +     +TV    +   T  
Sbjct  71    WFGVVLMGVGEMGNFAAYGFAPATLIAPLGCVSVIASAIISVVFLKETVRASDIFGGTLA  130

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYS-NITFLLYCLILVLVVAFHHSVYRRGELLLNV  795
             + G   LV F  H S V+    L + Y  +  FLLY LI V+V +    +Y+R  +   V
Sbjct  131   ITGTYLLVTFAPHSS-VHITAHLVQYYMFSWQFLLYLLIEVVVFSVLLYLYKRRNVKHIV  189

Query  796   PGNDLKPFWQMLLPFSYAIVSGTI-----GSFSVLFAKslsnllrlsisnsyllHSWFTY  960
                 L      L   S   VSG I     G    ++                       Y
Sbjct  190   VVMLLVALLASLTVISVKAVSGMITESIKGQLQFIYP--------------------IFY  229

Query  961   SMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRT  1140
              ML++  ++ GF +  LNE +  FDA  +VP+  + +T  +I  G V++QE+Q    L  
Sbjct  230   VMLVVMFASCGFQIKFLNEAMKVFDATEVVPINFVFFTASAIIAGVVFYQEFQGLALLNI  289

Query  1141  TMFVLGVMCVFIGISLLAPDDSKGTQ  1218
              MF+ G +  F+G+ L+A +  K  +
Sbjct  290   FMFLFGCLLCFLGVFLIARNRPKSKE  315



>gb|EJW03703.1| hypothetical protein EDEG_00191 [Edhazardia aedis USNM 41457]
Length=473

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 152/334 (46%), Gaps = 37/334 (11%)
 Frame = +1

Query  250   CHLNLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHF  429
             C    M  W++G F+++ G+++IN G NL K  + +  K   +GN            I  
Sbjct  130   CESKNMNSWIVGVFLSINGNLLINIGINLQKRSYTQ--KKILIGN------------ITV  175

Query  430   QTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVAT  609
               + +G+  + LG    F S+ F  QSLLA+LG++  ++N  FA  + ++  T K  ++ 
Sbjct  176   SLFALGVFVYVLGKISGFSSYIFGNQSLLASLGAVGLIANSIFAPLINDEVFTWKDFMSI  235

Query  610   TFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY-----CLILVLVVAFHH-----  759
              F++ G+  +V        V++  +L + Y     L++      LI  L  A  +     
Sbjct  236   IFVLTGSSVIVMNSGRSHKVFSLCELLKMYQRKETLIWFAFIGILIFSLFFALKYIEVNS  295

Query  760   ---------SVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnll  912
                      +  +R  +     G  L  ++ +L    Y  +S    S + LFAKS   ++
Sbjct  296   DWAFPGDKMNFLKRENVHYEESGK-LLSYYMILF---YVGLSSVTASLTTLFAKSFGEMI  351

Query  913   rlsisnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICT  1092
               ++S         TY   ++ +      +  +N  L  +DA+L++P F + WT FS+ T
Sbjct  352   DKTLSGDNQFFYGITYIFFIMIVFCTFTQIYWINRALRYYDALLVIPTFHVVWTLFSVMT  411

Query  1093  GFVYFQEYQVFDALRTTMFVLGVMCVFIGISLLA  1194
               +YFQ+++ +   +   F+ G++ +F+G   LA
Sbjct  412   AGIYFQDFEHYSIEQFKGFLSGLLIIFLGSGFLA  445



>ref|XP_008074381.1| hypothetical protein VCUG_01363 [Vavraia culicis subsp. floridensis]
 gb|ELA47174.1| hypothetical protein VCUG_01363 [Vavraia culicis subsp. floridensis]
Length=468

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 87/333 (26%), Positives = 158/333 (47%), Gaps = 45/333 (14%)
 Frame = +1

Query  250   CHLNLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSA-LGNEGTNGKAAMKPIIH  426
             C    MG W +G ++++ G++ IN G NL K     R  HS  L   G          + 
Sbjct  122   CMGKNMGAWSLGVYLSVQGNLCINIGLNLQK-----RSYHSPYLRIRG----------VS  166

Query  427   FQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVA  606
                + IG++ +  G    F+S+ F  QSLLA+LG++  ++N  FA  + ++  T K  +A
Sbjct  167   VSMFYIGVVVYVAGKVSGFMSYIFGNQSLLASLGAVGLIANSVFAPLINSEVFTWKDFMA  226

Query  607   TTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVV-------------  747
               F++ G+  ++         +T  +L + Y     L++  ++VL++             
Sbjct  227   IVFVLTGSSVILMNSGRSHKTFTLCELLKMYQKKETLVWFGVIVLLILSLFLLVKFIEVN  286

Query  748   ---AFHHSVY---RRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnl  909
                +F   ++   +R  +     G  LK  + M++   Y  +SG I SF+ LFAKS   +
Sbjct  287   SEWSFTDDLFDFMKRDRVYFEETGRILK--YSMVVL--YVGLSGIIASFTTLFAKSFGEM  342

Query  910   lrlsisnsyllHSWFTY---SMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFF  1080
             +  ++          TY   + ++LF     FWM   N+ L  +DA+L++P+F + WT F
Sbjct  343   VDQTLLGDNQFLYGITYLFFANIVLFTGLQIFWM---NKALRHYDALLVIPLFFVIWTLF  399

Query  1081  SICTGFVYFQEYQVFDALRTTMFVLGVMCVFIG  1179
             S+ T  +YFQ+++ +   +   FV G++ +  G
Sbjct  400   SVLTAGIYFQDFEYYTLDQFKGFVYGLVIIMAG  432



>ref|XP_008864473.1| hypothetical protein, variant 1 [Aphanomyces invadans]
 gb|ETW06398.1| hypothetical protein, variant 1 [Aphanomyces invadans]
Length=401

 Score = 90.9 bits (224),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 89/320 (28%), Positives = 144/320 (45%), Gaps = 27/320 (8%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
             +W IG  I +  +I+ N G N+ KL H +  K S             +P      W IG+
Sbjct  41    KW-IGLAIVIGSAILSNLGVNVQKLSHVKEEKRSMFQR---------RPYYVRPLWIIGM  90

Query  451   IFFALGNSLNFISFGFAAQSLLAALGS-IQFVSNIAFAYFVFNKTVTIKVMVATTFIVLG  627
              F  LG+  +F +  FA Q+L+A++G     ++N+ FA+    + +T   ++ T FI++G
Sbjct  91    AFVVLGSIGDFEALAFAPQALVASVGGGCTVLANMGFAHLWLGQRLTWYDVLGTFFILVG  150

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY----CLILVLVVAFHHSVYRRGELLLNV  795
              + L    N      T  +L  ++ ++ FL+Y    CL+L  +     S+ RR  L    
Sbjct  151   -VVLSTLANTPDAQLTIVELELQFQHLEFLVYFSIMCLVLFGIFGEIRSIARRSRLT---  206

Query  796   PGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLL  975
                    +    LP+ YA  SG  GSFSVL AK  S LL L+           TY  +  
Sbjct  207   -----HEYLHRRLPYLYATASGIFGSFSVLLAKCTSMLLLLTFQGDNQFVYPITYVFVGG  261

Query  976   FLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVL  1155
              ++T       LN  +   D + + P+FQ  W   S+  G V++Q++  F         +
Sbjct  262   MIATLVLQTDLLNRAIMSGDTLSVFPVFQCFWIGSSVVGGVVFYQKFDSFTLFEWISLPI  321

Query  1156  GVMCVFIGISLL---APDDS  1206
              +  + +GI LL   A DD+
Sbjct  322   ALALIILGIYLLTQVANDDA  341



>ref|XP_005803537.1| PREDICTED: NIPA-like protein 2-like [Xiphophorus maculatus]
Length=364

 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 79/321 (25%), Positives = 153/321 (48%), Gaps = 29/321 (9%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTW  438
             N +  +++G  I++ G+++I+   N+ K  H   ++ +  G+         KP      W
Sbjct  26    NPLQNYLLGIIISICGNVLISVSLNIQKYAH---VRQAQRGS---------KPYYTSGMW  73

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
               G++   +G   NF ++GFA  SL+A LG +  + +   +     +T+    +V  +  
Sbjct  74    WSGVVLMGVGELGNFAAYGFAPASLIAPLGCVSVIGDAVISVVFLKETIRASDVVGGSLA  133

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYS-NITFLLYCLILVLVVAFHHSVYRRGELLLNV  795
             + G   LV F  H S  +    L + Y+ +  FLLY  I V++      +Y+R       
Sbjct  134   ITGTYLLVTFAPHAS-THITAHLVQYYAISWHFLLYLFIEVVLFCILLYLYKR-------  185

Query  796   PGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLL  975
                 +K    ++L      +   + SF+V+  K++S ++  SI++   L     Y ML++
Sbjct  186   --RGVKHIVIVML------LVALLASFTVISVKAVSGMITESITSQLQLIYPIFYVMLVV  237

Query  976   FLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVL  1155
              +++  F +  LN+ +  FDA  +VP+  + +T  +I  G +++QE++    L   MF+ 
Sbjct  238   MVASCAFQIKFLNQAMKMFDATEVVPINFVFFTASAIIAGIIFYQEFEGLALLNIFMFLF  297

Query  1156  GVMCVFIGISLLAPDDSKGTQ  1218
             G +  FIG+ L+A +  K  Q
Sbjct  298   GCLLSFIGVFLIARNRPKIKQ  318



>gb|KDO23222.1| hypothetical protein SPRG_11154 [Saprolegnia parasitica CBS 223.65]
Length=405

 Score = 90.5 bits (223),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 78/328 (24%), Positives = 145/328 (44%), Gaps = 32/328 (10%)
 Frame = +1

Query  277   VIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGIIF  456
             ++G  I +  +++ N G  L KL H      +A   +              + W +G+  
Sbjct  27    LVGLGITIAAAVVSNCGVQLQKLAHASTDNETAYFGQ--------------RQWVLGLAL  72

Query  457   FALGNSLNFISFGFAAQSLLAALGS-IQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
               LG+  +F +  FA QSL+A +G     V+N+ F+ +   +++T++    T  I+LG +
Sbjct  73    VVLGSIGDFEALSFATQSLVATVGGGATVVTNVLFSTYWHGESLTVRDAYGTICILLG-V  131

Query  634   FLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLIL--------VLVVAFHHSVYRRGELLL  789
              L+A  + Q   Y  +QL  ++ +   L Y L+L        +L+ +   +      +L 
Sbjct  132   LLIALSSPQDEEYNIDQLVSRFESPVVLAYLLVLGGLIGYLLILIQSERDATSSESRVLW  191

Query  790   NVPGND-LKPFWQM-------LLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllH  945
             +  G   L+ F +        + P  YA VSG  GS S+L  K  S +++ S+       
Sbjct  192   SGRGQSRLRRFLRCSDETCTNIEPTLYATVSGITGSISMLLGKCASEMVKTSLEGPSQFT  251

Query  946   SWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVF  1125
                TY      L T    +   N+ L R D  ++ P+FQ+ W  F +  G V++ +    
Sbjct  252   HPTTYFFFGGMLGTVLLQIHWFNQALMRGDIAVVFPIFQVFWIAFGVVGGMVFYGDLARL  311

Query  1126  DALRTTMFVLGVMCVFIGISLLAPDDSK  1209
             +  ++  F+L   C+ +G+  LA  + +
Sbjct  312   EFFQSISFLLAFACILVGVYYLAQHEPQ  339



>emb|CCI50505.1| unnamed protein product [Albugo candida]
Length=458

 Score = 90.9 bits (224),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 91/316 (29%), Positives = 147/316 (47%), Gaps = 29/316 (9%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
             +W IG  I +  +I  N G N+ KL H +  K + LG          +P+     W IG+
Sbjct  85    KW-IGLSIVVASAIASNLGVNVQKLSHVQEAKQAHLGKR----TYYTRPL-----WLIGM  134

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFV-SNIAFAYFVFNKTVTIKVMVATTFIVLG  627
             I    G+  + I+ GFA Q+L+A++G    V  N+ FA+    + +T+   + T  IV+G
Sbjct  135   ILIVFGSIGDLIALGFAPQALVASVGGGSTVLVNVFFAHLWLGQALTLIDGIGTFLIVVG  194

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGND  807
              + L    N      + E+L  ++    FL+Y  + +LV+    S  +  +  +     D
Sbjct  195   -VVLSTVANTPDSQLSLEELEYQFVQSEFLVYVFLTILVLLCISSELQAIKKTMRARAGD  253

Query  808   LKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLST  987
              +      LPF YA  SG +GS+SVL AK  + LL L+I  +    + F Y+   LF+  
Sbjct  254   HQA---RKLPFLYATASGIVGSYSVLLAKCAAILLILTIRGT----NQFVYTTTYLFV--  304

Query  988   AGFWMARL-------NEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTM  1146
              G  +A L       N  +   D + + PMFQ  W   S   G V++ +Y+ F     T 
Sbjct  305   -GGTVASLLLQTDLFNRAIMEGDTLRVYPMFQCFWIGSSFIGGVVFYGKYRQFGIFEWTC  363

Query  1147  FVLGVMCVFIGISLLA  1194
               + ++ +  GI LLA
Sbjct  364   LPIALIFIISGIYLLA  379



>emb|CCG84103.1| protein of unknown function [Taphrina deformans PYCC 5710]
Length=400

 Score = 90.1 bits (222),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 68/321 (21%), Positives = 147/321 (46%), Gaps = 25/321 (8%)
 Frame = +1

Query  277   VIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGIIF  456
              IG  I++LG+++++   N+ +L H +++ H     E  +G  +    +    W  GI+ 
Sbjct  4     TIGCVISILGNVVVSLSLNIQRLAH-KKLGHDNNTQEAEDGAESNGNYLRSGWWWSGIVL  62

Query  457   FALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIF  636
              A+G + NF+++ FA  S++A LG+   ++N+ FA  +  +      +V     + G + 
Sbjct  63    MAIGETGNFLAYAFAPASVVATLGTTGLIANVFFAPLILKEKFRRIDLVGVAIAIAGGVT  122

Query  637   LVAFGNHQSPVYTPEQLAEKYSNITFLLYCLI-LVLVVAFHHSVYRRGE--LLLNVPGND  807
             +V     + P   P+++ E  S   FL Y  + L L++   +   + G+  +LL++    
Sbjct  123   VVLSAQAEQPQLDPQEILEAVSQRPFLAYLAVALTLIIGLLYLSPKYGDRYILLDL----  178

Query  808   LKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLST  987
                   +   F+     G     S LF K+L   +               +++L++ +ST
Sbjct  179   --GLVALFGGFTALSTKGVSSMLSTLFYKALRYPIF--------------WTLLVVLIST  222

Query  988   AGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMC  1167
             A   +  LN  L+ FD+  ++P     +T  +I    + +++++        MF+ G + 
Sbjct  223   AVLQVRYLNRSLANFDSTRVIPCQFCTFTISTIVGSAILYKDFERMSPGTIAMFICGCLL  282

Query  1168  VFIGISLLA-PDDSKGTQTKD  1227
              F+G+ + +   D++   ++D
Sbjct  283   TFLGVWITSYRTDARAESSQD  303



>gb|ETL28638.1| hypothetical protein L916_18041 [Phytophthora parasitica]
 gb|ETP04798.1| hypothetical protein F441_18516 [Phytophthora parasitica CJ01A1]
Length=439

 Score = 90.5 bits (223),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 133/282 (47%), Gaps = 21/282 (7%)
 Frame = +1

Query  412   KPIIHFQT------WRIGIIFFALGNSLNFISFGFAAQSLLAAL-GSIQFVSNIAFAYFV  570
             KP+   QT      W IG++   LG   +F + GFA Q+L+A++ G    ++N+ FA+  
Sbjct  56    KPVFERQTYYTRPLWLIGLVLVVLGAVGDFEALGFAPQALVASVGGGFTVLANVFFAHLW  115

Query  571   FNKTVTIKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVA  750
               + +T   ++ T  I++G + L    N      +  +L +++  + FL+Y  ++ +V+ 
Sbjct  116   LGQILTKTDVLGTLLIIIG-VVLSTVANEPDEQMSLVELEKQFFQLGFLIYLGVMTVVLG  174

Query  751   FHHSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisn  930
                 ++ + E +L +P   L      LLPF YA  SG  GSFSVL AK  S LL L+ S 
Sbjct  175   ---GIFGQIEAILRLP-RALNENKYRLLPFMYATASGIFGSFSVLLAKCASILLILTFSG  230

Query  931   syllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQ  1110
                   + TY  +   + T       LN  +   D + + PMFQ  W   S+  G V+++
Sbjct  231   ENQFVYFTTYLFMGGMMCTLVLQTDLLNRAIMAGDTLSVFPMFQCFWIGSSVIGGVVFYE  290

Query  1111  EYQVFDALRTTMFVLGVMCVFIGISLLA---------PDDSK  1209
             +Y  F         + +  + +GI LLA         PDD +
Sbjct  291   KYTRFSLFDWLCLPIALAFIIMGIYLLAKHGEGESDDPDDPE  332



>ref|XP_007550545.1| PREDICTED: NIPA-like protein 2 isoform X2 [Poecilia formosa]
Length=364

 Score = 89.4 bits (220),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 79/321 (25%), Positives = 151/321 (47%), Gaps = 29/321 (9%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTW  438
             N +  +++G  I++ G+++I+   N+ K  H  +             + A KP      W
Sbjct  26    NPLQNYLLGIIISICGNVLISVSLNIQKYSHVRQ------------AQRASKPYYTSGMW  73

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
               G++   +G   NF ++GFA  SL+A LG +  +++   +     +TV    +V  +  
Sbjct  74    WSGVVLMGVGELGNFAAYGFAPASLIAPLGCVSVIASAVISVVFLKETVRASDVVGGSLA  133

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYS-NITFLLYCLILVLVVAFHHSVYRRGELLLNV  795
             + G   LV F  H S  +    L + Y+ +  FLLY  I V++      +Y+R       
Sbjct  134   ITGTYLLVTFAPHAS-THITAHLVQYYAISWHFLLYLFIEVILFCILLYLYKR-------  185

Query  796   PGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLL  975
                 +K    ++L      +   + S +V+  K++S ++  SI++   L     Y ML++
Sbjct  186   --RGVKHIVIVML------LVALLASLTVISVKAVSGMITESITSQLQLIYPIFYVMLVV  237

Query  976   FLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVL  1155
              +++  F +  LN+ +  FDA  +VP+  + +T  +I  G +++QE++    L   MF+ 
Sbjct  238   MVASCAFQIKFLNQAMKMFDATEVVPINFVFFTASAIVAGIIFYQEFEGLALLNIFMFLF  297

Query  1156  GVMCVFIGISLLAPDDSKGTQ  1218
             G +  FIG+ L+A +  K  Q
Sbjct  298   GCLLSFIGVFLIARNRPKIKQ  318



>ref|XP_008913388.1| hypothetical protein PPTG_17410 [Phytophthora parasitica INRA-310]
 gb|ETI34921.1| hypothetical protein F443_18655 [Phytophthora parasitica P1569]
 gb|ETM35096.1| hypothetical protein L914_17944 [Phytophthora parasitica]
 gb|ETN01287.1| hypothetical protein PPTG_17410 [Phytophthora parasitica INRA-310]
 gb|ETP32923.1| hypothetical protein F442_18458 [Phytophthora parasitica P10297]
Length=439

 Score = 90.5 bits (223),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 133/282 (47%), Gaps = 21/282 (7%)
 Frame = +1

Query  412   KPIIHFQT------WRIGIIFFALGNSLNFISFGFAAQSLLAAL-GSIQFVSNIAFAYFV  570
             KP+   QT      W IG++   LG   +F + GFA Q+L+A++ G    ++N+ FA+  
Sbjct  56    KPVFERQTYYTRPLWLIGLVLVVLGAVGDFEALGFAPQALVASVGGGFTVLANVFFAHLW  115

Query  571   FNKTVTIKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVA  750
               + +T   ++ T  I++G + L    N      +  +L +++  + FL+Y  ++ +V+ 
Sbjct  116   LGQILTKTDVLGTLLIIIG-VVLSTVANEPDEQMSLVELEKQFFQLGFLIYLGVMTVVLG  174

Query  751   FHHSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisn  930
                 ++ + E +L +P   L      LLPF YA  SG  GSFSVL AK  S LL L+ S 
Sbjct  175   ---GIFGQIEAILRLP-RALNENKYRLLPFMYATASGIFGSFSVLLAKCASILLILTFSG  230

Query  931   syllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQ  1110
                   + TY  +   + T       LN  +   D + + PMFQ  W   S+  G V+++
Sbjct  231   ENQFVYFTTYLFMGGMMCTLVLQTDLLNRAIMAGDTLSVFPMFQCFWIGSSVIGGVVFYE  290

Query  1111  EYQVFDALRTTMFVLGVMCVFIGISLLA---------PDDSK  1209
             +Y  F         + +  + +GI LLA         PDD +
Sbjct  291   KYTRFSLFDWLCLPIALAFIIMGIYLLAKHGEGESDDPDDPE  332



>gb|ETO63680.1| hypothetical protein F444_18651 [Phytophthora parasitica P1976]
Length=439

 Score = 90.5 bits (223),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 133/282 (47%), Gaps = 21/282 (7%)
 Frame = +1

Query  412   KPIIHFQT------WRIGIIFFALGNSLNFISFGFAAQSLLAAL-GSIQFVSNIAFAYFV  570
             KP+   QT      W IG++   LG   +F + GFA Q+L+A++ G    ++N+ FA+  
Sbjct  56    KPVFERQTYYTRPLWLIGLVLVVLGAVGDFEALGFAPQALVASVGGGFTVLANVFFAHLW  115

Query  571   FNKTVTIKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVA  750
               + +T   ++ T  I++G + L    N      +  +L +++  + FL+Y  ++ +V+ 
Sbjct  116   LGQILTKTDVLGTLLIIIG-VVLSTVANEPDEQMSLVELEKQFFQLGFLIYLGVMTVVLG  174

Query  751   FHHSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisn  930
                 ++ + E +L +P   L      LLPF YA  SG  GSFSVL AK  S LL L+ S 
Sbjct  175   ---GIFGQIEAILRLP-RALNENKYRLLPFMYATASGIFGSFSVLLAKCASILLILTFSG  230

Query  931   syllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQ  1110
                   + TY  +   + T       LN  +   D + + PMFQ  W   S+  G V+++
Sbjct  231   ENQFVYFTTYLFMGGMMCTLVLQTDLLNRAIMAGDTLSVFPMFQCFWIGSSVIGGVVFYE  290

Query  1111  EYQVFDALRTTMFVLGVMCVFIGISLLA---------PDDSK  1209
             +Y  F         + +  + +GI LLA         PDD +
Sbjct  291   KYMRFSLFDWLCLPIALAFIIMGIYLLAKHGEGESDDPDDPE  332



>gb|ETL81892.1| hypothetical protein L917_17858 [Phytophthora parasitica]
Length=439

 Score = 90.1 bits (222),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 133/282 (47%), Gaps = 21/282 (7%)
 Frame = +1

Query  412   KPIIHFQT------WRIGIIFFALGNSLNFISFGFAAQSLLAAL-GSIQFVSNIAFAYFV  570
             KP+   QT      W IG++   LG   +F + GFA Q+L+A++ G    ++N+ FA+  
Sbjct  56    KPVFERQTYYTRPLWLIGLVLVVLGAVGDFEALGFAPQALVASVGGGFTVLANVFFAHLW  115

Query  571   FNKTVTIKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVA  750
               + +T   ++ T  I++G + L    N      +  +L +++  + FL+Y  ++ +V+ 
Sbjct  116   LGQILTKTDVLGTLLIIIG-VVLSTVANEPDEQMSLVELEKQFFQLGFLIYLGVMTVVLG  174

Query  751   FHHSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisn  930
                 ++ + E +L +P   L      LLPF YA  SG  GSFSVL AK  S LL L+ S 
Sbjct  175   ---GIFGQIEAILRLP-RALNENKYRLLPFMYATASGIFGSFSVLLAKCASILLILTFSG  230

Query  931   syllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQ  1110
                   + TY  +   + T       LN  +   D + + PMFQ  W   S+  G V+++
Sbjct  231   ENQFVYFTTYLFMGGMMCTLVLQTDLLNRAIMAGDTLSVFPMFQCFWIGSSVIGGVVFYE  290

Query  1111  EYQVFDALRTTMFVLGVMCVFIGISLLA---------PDDSK  1209
             +Y  F         + +  + +GI LLA         PDD +
Sbjct  291   KYTRFSLFDWLCLPIALAFIIMGIYLLAKHGEGESDDPDDPE  332



>ref|XP_008431105.1| PREDICTED: NIPA-like protein 2 isoform X2 [Poecilia reticulata]
Length=364

 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 79/321 (25%), Positives = 153/321 (48%), Gaps = 29/321 (9%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTW  438
             N +  +++G  I++ G+++I+   N+ K  H   ++ +  G+         KP      W
Sbjct  26    NPLQNYLLGIIISICGNVLISVSLNIQKYAH---VRQAQRGS---------KPYYTSGMW  73

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
               G++   +G   NF ++GFA  SL+A LG +  +++   +     +TV    +V  +  
Sbjct  74    WSGVVLMGVGELGNFAAYGFAPASLIAPLGCVSVIASAVISVVFLKETVRTSDVVGGSLA  133

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYS-NITFLLYCLILVLVVAFHHSVYRRGELLLNV  795
             + G   LV F  H S  +    L + Y+ +  FLLY  I V++      +Y+R       
Sbjct  134   ITGTYLLVTFAPHAS-THITAHLVQYYAISWHFLLYLFIEVVLFCILLYLYKR-------  185

Query  796   PGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLL  975
                 +K    ++L      +   + S +V+  K++S ++  SI++   L     Y ML++
Sbjct  186   --RGVKHIVIVML------LVALLASLTVISVKAVSGMITESITSQLQLIYPIFYVMLVV  237

Query  976   FLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVL  1155
              +++  F +  LN+ +  FDA  +VP+  + +T  +I  G +++QE++    L   MF+ 
Sbjct  238   MVASCAFQIKFLNQAMKMFDATEVVPINFVFFTASAIVAGIIFYQEFEDLALLNIFMFLF  297

Query  1156  GVMCVFIGISLLAPDDSKGTQ  1218
             G +  FIG+ L+A +  K  Q
Sbjct  298   GCLLSFIGVFLIARNRPKIKQ  318



>gb|ETK75213.1| hypothetical protein L915_18138 [Phytophthora parasitica]
Length=439

 Score = 90.1 bits (222),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 133/282 (47%), Gaps = 21/282 (7%)
 Frame = +1

Query  412   KPIIHFQT------WRIGIIFFALGNSLNFISFGFAAQSLLAAL-GSIQFVSNIAFAYFV  570
             KP+   QT      W IG++   LG   +F + GFA Q+L+A++ G    ++N+ FA+  
Sbjct  56    KPVFERQTYYTRPLWLIGLVLVVLGAVGDFEALGFAPQALVASVGGGFTVLANVFFAHLW  115

Query  571   FNKTVTIKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVA  750
               + +T   ++ T  I++G + L    N      +  +L +++  + FL+Y  ++ +V+ 
Sbjct  116   LGQILTKTDVLGTLLIIVG-VVLSTVANEPDEQMSLVELEKQFFQLGFLIYLGVMTVVLG  174

Query  751   FHHSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisn  930
                 ++ + E +L +P   L      LLPF YA  SG  GSFSVL AK  S LL L+ S 
Sbjct  175   ---GIFGQIEAILRLP-RALNENKYRLLPFMYATASGIFGSFSVLLAKCASILLILTFSG  230

Query  931   syllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQ  1110
                   + TY  +   + T       LN  +   D + + PMFQ  W   S+  G V+++
Sbjct  231   ENQFVYFTTYLFMGGMMCTLVLQTDLLNRAIMAGDTLSVFPMFQCFWIGSSVIGGVVFYE  290

Query  1111  EYQVFDALRTTMFVLGVMCVFIGISLLA---------PDDSK  1209
             +Y  F         + +  + +GI LLA         PDD +
Sbjct  291   KYTRFSLFDWLCLPIALAFIIMGIYLLAKHGEGESDDPDDPE  332



>gb|KDO28741.1| hypothetical protein SPRG_19958 [Saprolegnia parasitica CBS 223.65]
Length=396

 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 127/259 (49%), Gaps = 2/259 (1%)
 Frame = +1

Query  436   WRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTF  615
             W  G+     G+  +F + GF  QSL   +G    V+N+ FA++   +  + +  V T  
Sbjct  38    WAFGLFLVVFGSIGDFAALGFIPQSLAIPVGGFTIVANVFFAHYFLKEPFSKRDGVGTGL  97

Query  616   IVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLV-VAFHHSVYR-RGELLL  789
             IVLG + + AF +  +  YT ++L   ++   F++Y +++    +A +  + + R   + 
Sbjct  98    IVLGIMVVAAFASKTNDCYTIDELLVLFNQTNFIVYVIVVACTSLALYLYIRKIRAVAIQ  157

Query  790   NVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSML  969
             +  G+ +   +          +SG  G+ SVLFAK+ + L + +++      S  TY++ 
Sbjct  158   HGAGSSMHRAYAKTHSVICPALSGVCGAQSVLFAKASAELFKSTLAGDNQFTSVATYAIA  217

Query  970   LLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMF  1149
             L+ L      +  L +GL   D I +VP+FQ  +   SI  G VYF E+     L+  MF
Sbjct  218   LMMLICIVLQIHWLAQGLKTSDTIFVVPVFQCFFIAVSIVGGAVYFNEFATMSVLQLIMF  277

Query  1150  VLGVMCVFIGISLLAPDDS  1206
              +GV+    G+ +L+  ++
Sbjct  278   FVGVVITLGGVLILSKRET  296



>ref|XP_002286051.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED95692.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=850

 Score = 91.3 bits (225),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 77/260 (30%), Positives = 124/260 (48%), Gaps = 42/260 (16%)
 Frame = +1

Query  433   TWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATT  612
             TW +G I F  G+ LNF S+ FAAQS+LA+L S+QFV+N+ F  F+    VT  ++V T 
Sbjct  404   TWVVGTIVFVSGSLLNFASYAFAAQSMLASLESVQFVTNLLFGRFMLGAHVTQTMLVGTL  463

Query  613   FIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLN  792
               V G +  V F +  +     + + + Y N  +L Y  I+ +++   H +YRR    L+
Sbjct  464   LTVTGTVMAVQFSSKDTLELDVDDIKQLYLNPVYLSYLGIMGVLLLVLHIIYRR----LD  519

Query  793   VPGNDLKPFWQ--MLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSM  966
                N  KP  Q  +++P  Y++ S  +G+ S + AK L+                     
Sbjct  520   DLQNKNKPMKQSEIIMPIVYSVWSAMVGTQSTVQAKVLAE--------------------  559

Query  967   LLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTM  1146
              LL + ++G                  V      + FF+I +G ++F E+  FDA +   
Sbjct  560   -LLAVQSSGHDN---------------VFASWFFFIFFAIVSGGIFFLEFDSFDANQWIG  603

Query  1147  FVLGVMCVFIGISLLAPDDS  1206
             F LG++ +F G+ LL P  S
Sbjct  604   FWLGIIVMFSGLVLLTPPPS  623



>ref|XP_008321951.1| PREDICTED: NIPA-like protein 2 [Cynoglossus semilaevis]
Length=360

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 79/320 (25%), Positives = 140/320 (44%), Gaps = 27/320 (8%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTW  438
             N +  +++G  I++ G+++I+   N+ K  H  + +               KP      W
Sbjct  21    NPLQTYLLGIIISICGNVLISISLNIQKYAHMRQSQRDT------------KPYYSSPVW  68

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
               G++   +G   NF ++GFA  SL+A LGS+  +++   +     +T+    +   T  
Sbjct  69    WSGVVLMGVGELGNFAAYGFAPASLIAPLGSVSVIASAIISVVFLKETLRPSDIFGGTLA  128

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVP  798
             + G   LV F  H S   T   +     +  FL+Y  I ++V      +Y+R  +   V 
Sbjct  129   ITGTYLLVTFAPHTSTHITAHLVQYYVVSWHFLIYIFIEIVVFCILLYLYKRRNVKHIVV  188

Query  799   GNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLF  978
                L      L   S   VSG I                   S   L++  F Y ML++ 
Sbjct  189   VMLLVALLASLTVISVKAVSGMITE--------------SITSQLQLIYPIF-YVMLVVM  233

Query  979   LSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLG  1158
             +++  F +  LN+ +  FDA  +VP+  + +T  +I  G V++QE++    L   MF+LG
Sbjct  234   VASCAFQIKFLNQAMKMFDATEVVPINFVFFTASAILAGIVFYQEFEGLALLNIFMFLLG  293

Query  1159  VMCVFIGISLLAPDDSKGTQ  1218
              +  F+G+ L+A +  K  Q
Sbjct  294   CLLSFLGVFLIARNRPKKKQ  313



>ref|XP_005464985.1| PREDICTED: NIPA-like protein 2-like, partial [Oreochromis niloticus]
Length=372

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 139/321 (43%), Gaps = 39/321 (12%)
 Frame = +1

Query  274   WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
             +++G  I++ G+++I+   N+ K  H  + +  +            KP      W  G++
Sbjct  38    YLLGIIISICGNVLISISLNIQKYAHVRQAQRGS------------KPYYTSVMWWCGVV  85

Query  454   FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
                +G   NF ++GFA  SL+A LG +  +++   +     +T+    +V  T  + G  
Sbjct  86    LMGVGELGNFAAYGFAPASLIAPLGCVSVIASAIISVVFLKETLCASDIVGGTLAITGTY  145

Query  634   FLVAFGNHQSPVYTPEQLAEKYS-NITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDL  810
              LV F  H S  +    L + Y+ +  FLLY  I +++      +Y+R  +   V    L
Sbjct  146   VLVTFAPHTS-THITAHLVQYYAISWHFLLYLFIEIVIFCLLLYLYKRRNMKHIVIVMLL  204

Query  811   KPFWQMLLPFSYAIVSGTI-----GSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLL  975
                   L   S   VSG I     G   +++                       Y M ++
Sbjct  205   VALLASLTVISVKAVSGMITESIKGQLQLIYP--------------------IFYVMFVV  244

Query  976   FLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVL  1155
              +++  F +  LN+ +  FDA  +VP+  + +T  +I  G V++QE++    L   MF+ 
Sbjct  245   MVASCAFQIKFLNQAMKMFDATEVVPINFVFFTASAIVAGIVFYQEFEGLALLNIGMFLF  304

Query  1156  GVMCVFIGISLLAPDDSKGTQ  1218
             G +  F+G+ L+A +  K  Q
Sbjct  305   GCLLSFVGVFLIARNRPKIKQ  325



>ref|XP_007550544.1| PREDICTED: NIPA-like protein 2 isoform X1 [Poecilia formosa]
Length=375

 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 80/317 (25%), Positives = 141/317 (44%), Gaps = 29/317 (9%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
              +++G  I++ G+++I+   N+ K  H  +             + A KP      W  G+
Sbjct  41    NYLLGIIISICGNVLISVSLNIQKYSHVRQ------------AQRASKPYYTSGMWWSGV  88

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGN  630
             +   +G   NF ++GFA  SL+A LG +  +++   +     +TV    +V  +  + G 
Sbjct  89    VLMGVGELGNFAAYGFAPASLIAPLGCVSVIASAVISVVFLKETVRASDVVGGSLAITGT  148

Query  631   IFLVAFGNHQSPVYTPEQLAEKYS-NITFLLYCLILVLVVAFHHSVYRRGELLLNVPGND  807
               LV F  H S  +    L + Y+ +  FLLY  I V++      +Y+R  +   V    
Sbjct  149   YLLVTFAPHAS-THITAHLVQYYAISWHFLLYLFIEVILFCILLYLYKRRGVKHIVIVML  207

Query  808   LKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLST  987
             L      L   S   VSG I                   S   L++  F Y ML++ +++
Sbjct  208   LVALLASLTVISVKAVSGMITE--------------SITSQLQLIYPIF-YVMLVVMVAS  252

Query  988   AGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMC  1167
               F +  LN+ +  FDA  +VP+  + +T  +I  G +++QE++    L   MF+ G + 
Sbjct  253   CAFQIKFLNQAMKMFDATEVVPINFVFFTASAIVAGIIFYQEFEGLALLNIFMFLFGCLL  312

Query  1168  VFIGISLLAPDDSKGTQ  1218
              FIG+ L+A +  K  Q
Sbjct  313   SFIGVFLIARNRPKIKQ  329



>gb|EQB61629.1| nucleotide-sugar transporter [Nosema apis BRL 01]
Length=415

 Score = 88.2 bits (217),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 82/314 (26%), Positives = 132/314 (42%), Gaps = 62/314 (20%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
              W+ GA    +G  +IN G N  K  + +   +    N             ++ T+ IG+
Sbjct  131   SWIFGAIFIYIGKCLINTGVNFQKYSYQK--TNLTFFN------------YNYNTFYIGM  176

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGN  630
             + + LG  L ++S+ F  QSL+AAL +   VSN   A  + N+  T K   A  F+  G 
Sbjct  177   LIYILGKILGYLSYIFGNQSLIAALSATGLVSNSILAPLINNEIFTYKDFFAILFVFCGT  236

Query  631   IFLVAFGNHQSPVYTPEQLAEKY------SNITFLLYCLILVLVVAFHHSVYRRGELLLN  792
              +++         Y+  +L + Y      +N TF                ++R   +  N
Sbjct  237   TYIIMNNKSSHRSYSLCELLKLYHKPYVETNSTF----------NEDDSRIFRNENIWFN  286

Query  793   VPGNDLKPFWQMLLPFSYA---IVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYS  963
                  +K F   +   +Y    I   +I  F   F                         
Sbjct  287   DDCYIMKYFMYKIFIRNYTKNFIRRKSIYIFISYFF------------------------  322

Query  964   MLLLFLSTAG--FWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALR  1137
             +  L + T G  +W   LN+GL RFDA+L+VP+F I WT  SI T  +YFQE++ +D  +
Sbjct  323   IFTLCICTFGQIYW---LNKGLKRFDALLVVPLFHITWTLLSIITAGIYFQEFEKYDWEQ  379

Query  1138  TTMFVLGVMCVFIG  1179
                F+LG++ +FIG
Sbjct  380   FRSFLLGILIIFIG  393



>ref|XP_008431104.1| PREDICTED: NIPA-like protein 2 isoform X1 [Poecilia reticulata]
Length=375

 Score = 87.4 bits (215),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 80/317 (25%), Positives = 143/317 (45%), Gaps = 29/317 (9%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
              +++G  I++ G+++I+   N+ K  H   ++ +  G+         KP      W  G+
Sbjct  41    NYLLGIIISICGNVLISVSLNIQKYAH---VRQAQRGS---------KPYYTSGMWWSGV  88

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGN  630
             +   +G   NF ++GFA  SL+A LG +  +++   +     +TV    +V  +  + G 
Sbjct  89    VLMGVGELGNFAAYGFAPASLIAPLGCVSVIASAVISVVFLKETVRTSDVVGGSLAITGT  148

Query  631   IFLVAFGNHQSPVYTPEQLAEKYS-NITFLLYCLILVLVVAFHHSVYRRGELLLNVPGND  807
               LV F  H S  +    L + Y+ +  FLLY  I V++      +Y+R  +   V    
Sbjct  149   YLLVTFAPHAS-THITAHLVQYYAISWHFLLYLFIEVVLFCILLYLYKRRGVKHIVIVML  207

Query  808   LKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLST  987
             L      L   S   VSG I                   S   L++  F Y ML++ +++
Sbjct  208   LVALLASLTVISVKAVSGMITE--------------SITSQLQLIYPIF-YVMLVVMVAS  252

Query  988   AGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMC  1167
               F +  LN+ +  FDA  +VP+  + +T  +I  G +++QE++    L   MF+ G + 
Sbjct  253   CAFQIKFLNQAMKMFDATEVVPINFVFFTASAIVAGIIFYQEFEDLALLNIFMFLFGCLL  312

Query  1168  VFIGISLLAPDDSKGTQ  1218
              FIG+ L+A +  K  Q
Sbjct  313   SFIGVFLIARNRPKIKQ  329



>ref|XP_005836246.1| hypothetical protein GUITHDRAFT_135966 [Guillardia theta CCMP2712]
 gb|EKX49266.1| hypothetical protein GUITHDRAFT_135966 [Guillardia theta CCMP2712]
Length=1432

 Score = 89.4 bits (220),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 83/154 (54%), Gaps = 17/154 (11%)
 Frame = +1

Query  274  WVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGII  453
            W+ G  +   GSI +N    ++KL H ++       + GT+             W  G++
Sbjct  8    WLTGCLLYAGGSITVNLAQIIIKLSHLDQ-------DHGTSSF----------MWWFGVV  50

Query  454  FFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNI  633
             F  G+ LN I   +AAQSLL A GSIQFVSN+ F+ F+ ++ V  + +V+T  I+ GNI
Sbjct  51   LFGAGDVLNVIGLNYAAQSLLEAFGSIQFVSNLCFSTFILHENVQRRHVVSTCLIIAGNI  110

Query  634  FLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLIL  735
             +VA+G+H++   T  +L E      F++Y  I+
Sbjct  111  CIVAWGDHKNKKITLSRLEELAGTTAFIVYISII  144



>ref|XP_003886885.1| hypothetical protein EHEL_030050 [Encephalitozoon hellem ATCC 
50504]
 gb|AFM97904.1| hypothetical protein EHEL_030050 [Encephalitozoon hellem ATCC 
50504]
Length=467

 Score = 87.8 bits (216),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 78/272 (29%), Positives = 128/272 (47%), Gaps = 23/272 (8%)
 Frame = +1

Query  421   IHFQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVM  600
             ++ QT+ +G   + LG    + S+ F  QSL+A L +   VSN  FA  +  +  T K  
Sbjct  170   MNLQTFYVGCFIYGLGKIFGYCSYIFGNQSLMAVLSATGLVSNSIFAPMINEEVFTWKDF  229

Query  601   VATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYC--LILVLVVAFHHSVY--  768
              A  F   G   +V      +  YT  +L + Y  I  LL+   +ILV++V F    Y  
Sbjct  230   WAIFFAFAGTTLIVMNTTISNRAYTLCELMKMYRRIETLLWFGFIILVIIVLFVFVKYIE  289

Query  769   ---------------RRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKsls  903
                            RR  +  +  G  +K  + M+L  +Y  +S  I SF+ L  KSL 
Sbjct  290   INSNWELPDENMTFLRREGVWFDEEGVIMK--YTMVL--AYVCLSSFIASFTTLSIKSLG  345

Query  904   nllrlsisnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFS  1083
              ++  +I+         TY  +++ +    F +  LN  L  +DA+L++PMF + WT  S
Sbjct  346   EMIDKTIAGDNQFIFLTTYFFIMVLVICTFFQIYWLNRALRHYDALLVIPMFHVTWTLLS  405

Query  1084  ICTGFVYFQEYQVFDALRTTMFVLGVMCVFIG  1179
             I T  +YF+E++ + + +  MF  G+  +FIG
Sbjct  406   IFTAGIYFREFEQYTSYQLGMFAGGIGLIFIG  437



>dbj|BAD94846.1| hypothetical protein [Arabidopsis thaliana]
Length=116

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = +1

Query  1267  ERLI-MPLEDPQLKDVKSFSHVVLMKAVNLIVKAKAACslslglgddslQASSVLVMPMV  1443
             +RLI    ED   KD +     + MKA +LI K K AC  +LG G+DS+ AS++LVMPMV
Sbjct  11    DRLIPQSSEDGHSKDTRVVVQGMYMKAADLIAKTKTACLAALGFGEDSINASAILVMPMV  70

Query  1444  SSKITGFRGNGVDQAKLFPGRSQGWRRISVDED  1542
             SSKITGFRGNG+++AK+   R  GW +++++E+
Sbjct  71    SSKITGFRGNGLERAKILSMRGSGWSKLAMEEE  103



>gb|EKC35858.1| NIPA-like protein 2 [Crassostrea gigas]
Length=367

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 73/284 (26%), Positives = 134/284 (47%), Gaps = 22/284 (8%)
 Frame = +1

Query  334   LLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGIIFFALGNSLNFISFGFAAQSL  513
             L + G   +  H       T       P+     W  GI+   LG   NF ++GF+  SL
Sbjct  3     LARTGRTPKYSHMKNAENPTPVHYTRDPL-----WWSGILLMGLGEIGNFSAYGFSPASL  57

Query  514   LAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAE  693
             +A LG+   V+N+  A  V  + +  + +  +   V+G   L+AF      V   ++L +
Sbjct  58    VAPLGTTTVVANMFLAALVLKEKIKAEHLFGSALAVIGAFLLIAFSAKNEKVLNGDELNQ  117

Query  694   KYSNITFLLY-CLILVLVVAFHHSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIG  870
               + ++F++Y C+ LV++      +Y +          ++K     LL      +S  + 
Sbjct  118   ALTQLSFVIYICVELVVLGVLFFFLYYK----------EMKKVVLFLL------ISSVVA  161

Query  871   SFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIV  1050
             SF+V+ AK++S+L +LS + +        Y M+++ + TA   +  LNE +  FDA ++V
Sbjct  162   SFTVIAAKAVSSLFQLSFAGNSQFSYPILYIMIVVMIVTAITQVKYLNEAMKNFDATVVV  221

Query  1051  PMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIGI  1182
             P   + +T  +I  G V+++E+   + L   MF +G    FIG+
Sbjct  222   PTNFVFFTISAIIAGIVFYKEFWGMNGLEIFMFFIGCFLSFIGV  265



>emb|CCI50504.1| unnamed protein product [Albugo candida]
Length=457

 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 90/316 (28%), Positives = 143/316 (45%), Gaps = 30/316 (9%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
             +W IG  I +  +I  N G N+ KL H +  K + LG          +P+     W IG+
Sbjct  85    KW-IGLSIVVASAIASNLGVNVQKLSHVQEAKQAHLGKR----TYYTRPL-----WLIGM  134

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFV-SNIAFAYFVFNKTVTIKVMVATTFIVLG  627
             I    G+  + I+ GFA Q+L+A++G    V  N+ FA+    +    + M         
Sbjct  135   ILIVFGSIGDLIALGFAPQALVASVGGGSTVLVNVFFAHLWLGQVPIYRYMHKKKVKYES  194

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGND  807
             N+F VA  N      + E+L  ++    FL+Y  + +LV+    S  +  +  +     D
Sbjct  195   NLFTVA--NTPDSQLSLEELEYQFVQSEFLVYVFLTILVLLCISSELQAIKKTMRARAGD  252

Query  808   LKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLST  987
              +      LPF YA  SG +GS+SVL AK  + LL L+I  +    + F Y+   LF+  
Sbjct  253   HQA---RKLPFLYATASGIVGSYSVLLAKCAAILLILTIRGT----NQFVYTTTYLFV--  303

Query  988   AGFWMARL-------NEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTM  1146
              G  +A L       N  +   D + + PMFQ  W   S   G V++ +Y+ F     T 
Sbjct  304   -GGTVASLLLQTDLFNRAIMEGDTLRVYPMFQCFWIGSSFIGGVVFYGKYRQFGIFEWTC  362

Query  1147  FVLGVMCVFIGISLLA  1194
               + ++ +  GI LLA
Sbjct  363   LPIALIFIISGIYLLA  378



>gb|ETP04801.1| hypothetical protein, variant 3 [Phytophthora parasitica CJ01A1]
Length=322

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 130/278 (47%), Gaps = 28/278 (10%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT-  435
             N+ G+W IG  I +  +++ N G N+ KL H                +   KP+   QT 
Sbjct  20    NVQGKW-IGLAIVITSAVLSNLGVNVQKLSHV---------------REEEKPVFERQTY  63

Query  436   -----WRIGIIFFALGNSLNFISFGFAAQSLLAAL-GSIQFVSNIAFAYFVFNKTVTIKV  597
                  W IG++   LG   +F + GFA Q+L+A++ G    ++N+ FA+    + +T   
Sbjct  64    YTRPLWLIGLVLVVLGAVGDFEALGFAPQALVASVGGGFTVLANVFFAHLWLGQILTKTD  123

Query  598   MVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRG  777
             ++ T  I++G + L    N      +  +L +++  + FL+Y  ++ +V+     ++ + 
Sbjct  124   VLGTLLIIIG-VVLSTVANEPDEQMSLVELEKQFFQLGFLIYLGVMTVVLG---GIFGQI  179

Query  778   ELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT  957
             E +L +P   L      LLPF YA  SG  GSFSVL AK  S LL L+ S       + T
Sbjct  180   EAILRLP-RALNENKYRLLPFMYATASGIFGSFSVLLAKCASILLILTFSGENQFVYFTT  238

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAW  1071
             Y  +   + T       LN  +   D + + PMFQ  W
Sbjct  239   YLFMGGMMCTLVLQTDLLNRAIMAGDTLSVFPMFQCFW  276



>ref|XP_008913391.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETI34924.1| hypothetical protein, variant 3 [Phytophthora parasitica P1569]
 gb|ETL28641.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETL81895.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETM35099.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETN01290.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETO63683.1| hypothetical protein, variant 3 [Phytophthora parasitica P1976]
 gb|ETP32926.1| hypothetical protein, variant 3 [Phytophthora parasitica P10297]
Length=322

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 130/278 (47%), Gaps = 28/278 (10%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT-  435
             N+ G+W IG  I +  +++ N G N+ KL H                +   KP+   QT 
Sbjct  20    NVQGKW-IGLAIVITSAVLSNLGVNVQKLSHV---------------REEEKPVFERQTY  63

Query  436   -----WRIGIIFFALGNSLNFISFGFAAQSLLAAL-GSIQFVSNIAFAYFVFNKTVTIKV  597
                  W IG++   LG   +F + GFA Q+L+A++ G    ++N+ FA+    + +T   
Sbjct  64    YTRPLWLIGLVLVVLGAVGDFEALGFAPQALVASVGGGFTVLANVFFAHLWLGQILTKTD  123

Query  598   MVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRG  777
             ++ T  I++G + L    N      +  +L +++  + FL+Y  ++ +V+     ++ + 
Sbjct  124   VLGTLLIIIG-VVLSTVANEPDEQMSLVELEKQFFQLGFLIYLGVMTVVLG---GIFGQI  179

Query  778   ELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT  957
             E +L +P   L      LLPF YA  SG  GSFSVL AK  S LL L+ S       + T
Sbjct  180   EAILRLP-RALNENKYRLLPFMYATASGIFGSFSVLLAKCASILLILTFSGENQFVYFTT  238

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAW  1071
             Y  +   + T       LN  +   D + + PMFQ  W
Sbjct  239   YLFMGGMMCTLVLQTDLLNRAIMAGDTLSVFPMFQCFW  276



>gb|AFW62416.1| hypothetical protein ZEAMMB73_017317 [Zea mays]
Length=142

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  265  MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRI  444
            MG+W+IGA IN++GS+ INFGTNLLKLGHD+R K S + N   N K   K ++HFQTWRI
Sbjct  1    MGDWIIGALINIVGSVGINFGTNLLKLGHDQREKLSLINNSEGNEKFVPKSVMHFQTWRI  60



>gb|ELQ76324.1| Drug/Metabolite Transporter (DMT) Superfamily, partial [Trachipleistophora 
hominis]
Length=521

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 85/328 (26%), Positives = 157/328 (48%), Gaps = 45/328 (14%)
 Frame = +1

Query  265   MGEWVIGAFINLLGSIIINFGTNLLKLG-HDERIKHSALGNEGTNGKAAMKPIIHFQTWR  441
             MG W +G ++++ G++ IN G NL K   HD  ++                  +    + 
Sbjct  180   MGAWSLGVYLSVQGNLCINVGLNLQKRSYHDPYLRIRG---------------VSVSMFY  224

Query  442   IGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIV  621
             +G++ +  G    F+S+ F  QSLLA+LG++  ++N  FA  + ++  T K  +A  F++
Sbjct  225   VGVVVYVAGKVSGFMSYIFGNQSLLASLGAVGLIANSVFAPLINSEVFTWKDFMAIVFVL  284

Query  622   LGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVV----------------AF  753
              G+  ++         +T  +L + Y     L++  ++VL+V                +F
Sbjct  285   TGSSVILMNSGRSHKTFTLCELLKMYQKKETLVWFGVIVLLVLFLFTLVKFIEVNSEWSF  344

Query  754   HHSVY---RRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsi  924
              + V+   +R  L     G  LK  + M++   Y  +SG I SF+ LFAKS   ++  ++
Sbjct  345   TNDVFDFMKRDRLYFEETGRILK--YSMVVL--YVGLSGIIASFTTLFAKSFGEMVDQTL  400

Query  925   snsyllHSWFTY---SMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTG  1095
                       TY   + ++LF     FWM   N+ L  +DA+L++P+F + WT FS+ T 
Sbjct  401   LGDNQFLYGITYLFFTNIVLFTGLQIFWM---NKALRHYDALLVIPLFFVVWTLFSVLTA  457

Query  1096  FVYFQEYQVFDALRTTMFVLGVMCVFIG  1179
              +YFQ+++ +   +   FV G++ +  G
Sbjct  458   GIYFQDFEYYTLDQFKGFVYGLVIIIAG  485



>gb|ETK75216.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=322

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 130/278 (47%), Gaps = 28/278 (10%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT-  435
             N+ G+W IG  I +  +++ N G N+ KL H                +   KP+   QT 
Sbjct  20    NVQGKW-IGLAIVITSAVLSNLGVNVQKLSHV---------------REEEKPVFERQTY  63

Query  436   -----WRIGIIFFALGNSLNFISFGFAAQSLLAAL-GSIQFVSNIAFAYFVFNKTVTIKV  597
                  W IG++   LG   +F + GFA Q+L+A++ G    ++N+ FA+    + +T   
Sbjct  64    YTRPLWLIGLVLVVLGAVGDFEALGFAPQALVASVGGGFTVLANVFFAHLWLGQILTKTD  123

Query  598   MVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRG  777
             ++ T  I++G + L    N      +  +L +++  + FL+Y  ++ +V+     ++ + 
Sbjct  124   VLGTLLIIVG-VVLSTVANEPDEQMSLVELEKQFFQLGFLIYLGVMTVVLG---GIFGQI  179

Query  778   ELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT  957
             E +L +P   L      LLPF YA  SG  GSFSVL AK  S LL L+ S       + T
Sbjct  180   EAILRLP-RALNENKYRLLPFMYATASGIFGSFSVLLAKCASILLILTFSGENQFVYFTT  238

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAW  1071
             Y  +   + T       LN  +   D + + PMFQ  W
Sbjct  239   YLFMGGMMCTLVLQTDLLNRAIMAGDTLSVFPMFQCFW  276



>gb|ETO63686.1| hypothetical protein, variant 6 [Phytophthora parasitica P1976]
 gb|ETO63687.1| hypothetical protein, variant 7 [Phytophthora parasitica P1976]
Length=284

 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 130/278 (47%), Gaps = 28/278 (10%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT-  435
             N+ G+W IG  I +  +++ N G N+ KL H                +   KP+   QT 
Sbjct  20    NVQGKW-IGLAIVITSAVLSNLGVNVQKLSHV---------------REEEKPVFERQTY  63

Query  436   -----WRIGIIFFALGNSLNFISFGFAAQSLLAAL-GSIQFVSNIAFAYFVFNKTVTIKV  597
                  W IG++   LG   +F + GFA Q+L+A++ G    ++N+ FA+    + +T   
Sbjct  64    YTRPLWLIGLVLVVLGAVGDFEALGFAPQALVASVGGGFTVLANVFFAHLWLGQILTKTD  123

Query  598   MVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRG  777
             ++ T  I++G + L    N      +  +L +++  + FL+Y  ++ +V+     ++ + 
Sbjct  124   VLGTLLIIIG-VVLSTVANEPDEQMSLVELEKQFFQLGFLIYLGVMTVVLG---GIFGQI  179

Query  778   ELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT  957
             E +L +P   L      LLPF YA  SG  GSFSVL AK  S LL L+ S       + T
Sbjct  180   EAILRLP-RALNENKYRLLPFMYATASGIFGSFSVLLAKCASILLILTFSGENQFVYFTT  238

Query  958   YSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAW  1071
             Y  +   + T       LN  +   D + + PMFQ  W
Sbjct  239   YLFMGGMMCTLVLQTDLLNRAIMAGDTLSVFPMFQCFW  276



>ref|XP_009829197.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV81339.1| hypothetical protein, variant [Aphanomyces astaci]
Length=258

 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 103/211 (49%), Gaps = 17/211 (8%)
 Frame = +1

Query  277  VIGAFINLLGSIIINFGTNLLKLG---HDERIKHSALGNEGTNGKAAMKPIIHFQTWRIG  447
            V G  + L+G+ I NFG N+ K      + + +H              KP      W +G
Sbjct  13   VTGIAMCLVGTTISNFGLNIQKYSFMLQERQPEHD------------RKPYNTQWRWWLG  60

Query  448  IIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLG  627
            +   A+G+  +F +  +AAQS++A +G+   V+NI FA++   + +    ++ T  I +G
Sbjct  61   LFGVAVGSIADFAALTYAAQSVIAPVGAFTLVANIFFAHYWLRERLGRNDLIGTMLICIG  120

Query  628  NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGELLLNVPGN-  804
             I +  FG+H S  +T ++L   Y     L+Y   +  V+    +   R E  L V GN 
Sbjct  121  AIMVTVFGSHSSTSHTLDELLALYYRWDMLVYACAVCAVLIGLFTALVRSEDALRVHGNL  180

Query  805  -DLKPFWQMLLPFSYAIVSGTIGSFSVLFAK  894
             D    ++ + P +Y+ ++G  G+ SV+FAK
Sbjct  181  SDEYKTFRKIHPLAYSGLAGVWGAQSVMFAK  211



>ref|XP_008864472.1| hypothetical protein H310_02670 [Aphanomyces invadans]
 gb|ETW06397.1| hypothetical protein H310_02670 [Aphanomyces invadans]
Length=417

 Score = 84.3 bits (207),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 88/340 (26%), Positives = 147/340 (43%), Gaps = 51/340 (15%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
             +W IG  I +  +I+ N G N+ KL H +  K S             +P      W IG+
Sbjct  41    KW-IGLAIVIGSAILSNLGVNVQKLSHVKEEKRSMFQR---------RPYYVRPLWIIGM  90

Query  451   IFFALGNSLNFISFGFAAQSLLAALGS-IQFVSNIAFAYFVFNKTVTIKVMVATTFIVLG  627
              F  LG+  +F +  FA Q+L+A++G     ++N+ FA+    + +T   ++ T FI++G
Sbjct  91    AFVVLGSIGDFEALAFAPQALVASVGGGCTVLANMGFAHLWLGQRLTWYDVLGTFFILVG  150

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY----CLILVLVVAFHHSVYRRGELLLNV  795
              + L    N      T  +L  ++ ++ FL+Y    CL+L  +     S+ RR  L    
Sbjct  151   -VVLSTLANTPDAQLTIVELELQFQHLEFLVYFSIMCLVLFGIFGEIRSIARRSRLT---  206

Query  796   PGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLL  975
                    +    LP+ YA  SG  GSFSVL AK       + +  ++   + F Y +  +
Sbjct  207   -----HEYLHRRLPYLYATASGIFGSFSVLLAK----CTSMLLLLTFQGDNQFVYPITYV  257

Query  976   FL--STAGFWM------------------ARLNEGLSRFDAILIVPMFQIAWTFFSICTG  1095
             F+    A F M                    LN  +   D + + P+FQ  W   S+  G
Sbjct  258   FVGGELAAFAMDLRMIKVVGMIATLVLQTDLLNRAIMSGDTLSVFPVFQCFWIGSSVVGG  317

Query  1096  FVYFQEYQVFDALRTTMFVLGVMCVFIGISLL---APDDS  1206
              V++Q++  F         + +  + +GI LL   A DD+
Sbjct  318   VVFYQKFDSFTLFEWISLPIALALIILGIYLLTQVANDDA  357



>ref|XP_003072512.1| hypothetical protein Eint_030060 [Encephalitozoon intestinalis 
ATCC 50506]
 gb|ADM11152.1| hypothetical protein Eint_030060 [Encephalitozoon intestinalis 
ATCC 50506]
Length=467

 Score = 84.7 bits (208),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 134/286 (47%), Gaps = 17/286 (6%)
 Frame = +1

Query  421   IHFQTWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVM  600
             ++ QT+  G   + LG  L + S+ F  QSL+A L +   VSN   A  +  +  T K  
Sbjct  170   MNLQTFYAGCFTYGLGKILGYCSYLFGNQSLMAVLSATGLVSNSILAPMINEEIFTWKDF  229

Query  601   VATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYRRGE  780
              A  F+  G   +V        VYT  +L + Y+ +  L++   ++LV+       +  E
Sbjct  230   SAIFFVFAGTTLIVMNTATSHKVYTLCELLKMYTRVETLVWLGFIILVIIVLFIFVKYVE  289

Query  781   LLLN--VPGNDL-----KPFW--------QMLLPFSYAIVSGTIGSFSVLFAKslsnllr  915
             +  N  +P  ++     +  W        +  +  +Y  +S  I SF+ L  KSL  ++ 
Sbjct  290   VNSNWELPDENMIFLRREGVWFDEEGTVIKYTMVLAYVCLSSFIASFTTLSIKSLGEMID  349

Query  916   lsisnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTG  1095
              +++         TY  +++  +   F +  LN  L  +DA+L++PMF + WT  SI T 
Sbjct  350   KTVAGDNQFIFLTTYCFIIILATCTFFQIYWLNRALRHYDALLVIPMFHVTWTLLSIFTA  409

Query  1096  FVYFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGT--QTKD  1227
              +YF+E++ +   + ++FV GV+ +F G   L    +  T  +TKD
Sbjct  410   GIYFREFEQYTRYQLSVFVCGVILIFFGSFFLGSRITNKTYIKTKD  455



>ref|XP_005842413.1| hypothetical protein GUITHDRAFT_160462 [Guillardia theta CCMP2712]
 gb|EKX55433.1| hypothetical protein GUITHDRAFT_160462 [Guillardia theta CCMP2712]
Length=752

 Score = 84.3 bits (207),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 130/258 (50%), Gaps = 13/258 (5%)
 Frame = +1

Query  433   TWRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATT  612
             TW +G   FA+GN  +F++ G + QS++  +GS   V N   A F+  +  + K  +++ 
Sbjct  184   TWLLGFCIFAIGNLFDFLALGISKQSVVTLVGSWALVVNTLTAKFILREHTSKKDYMSSL  243

Query  613   FIVLGNIFLVAFGNHQSPV-YTPEQLAEKY--SNITFLLYCLILVLVVAF-----HHSVY  768
              I+ G I L  FG+ ++ + ++ E L  +Y  +N+  +L C++  L+ A         V 
Sbjct  244   IIICG-ILLTVFGSEKNQIDWSIEILVNQYKKTNVKVML-CILASLIGACFIIMRMDYVK  301

Query  769   RRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHS  948
             RR E       N+        +   Y IV+  +  F+VLF K+ S L+  SI+ S     
Sbjct  302   RRNEARSK---NEAIERPSTRIGAVYCIVASFVADFTVLFGKAFSGLIIPSITGSNQFTD  358

Query  949   WFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFD  1128
              F   ++++F  +    +  +N+ LS  DA+  +P F + W   SI TG ++++E   F 
Sbjct  359   PFVAVIIVVFCISLPSQLFLINKSLSVNDALYHIPNFYVFWNVGSIITGAIFYEEMVNFS  418

Query  1129  ALRTTMFVLGVMCVFIGI  1182
                  MF+LGV+ +F+G+
Sbjct  419   VQNWVMFILGVLILFVGV  436



>ref|XP_004077670.1| PREDICTED: NIPA-like protein 2-like [Oryzias latipes]
Length=359

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 82/334 (25%), Positives = 143/334 (43%), Gaps = 55/334 (16%)
 Frame = +1

Query  259   NLMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTW  438
             N +  +++G  I++ G+++I+F  N+ K  H  + +  +            KP      W
Sbjct  20    NPLQNYLLGILISICGNVLISFSLNIQKYAHVRQAQRGS------------KPYYTSGVW  67

Query  439   RIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFI  618
               G+    +G   NF ++GFA  SL+A LG +  ++++  +     +TV    +V  T  
Sbjct  68    WCGVTLMGVGELGNFAAYGFAPASLIAPLGCVSVIASVVISVVFLKETVYTSDIVGGTLA  127

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKY---------SNITFLLYCLILVLVVAFHHSVYR  771
             + G   LV F  H S  +    L + Y           I  +L+C++L L        Y+
Sbjct  128   ITGTYLLVTFAPHTS-THITAHLVQYYFISWHFLLYLLIEIILFCILLYL--------YK  178

Query  772   RGELLLNVPGNDLKPFWQMLLPFSYAIVSGTI-----GSFSVLFAKslsnllrlsisnsy  936
             R  +   V    L      L   S   VSG I     G   +++                
Sbjct  179   RRNVKHIVVVMLLVALLASLTVISVKAVSGMITESIQGQLQLIYP---------------  223

Query  937   llHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEY  1116
                    Y ML++ +++ GF +  LN+ +  FDA  +VP+  + +T  +I  G V++QE+
Sbjct  224   -----IFYVMLVVMVASCGFQIKFLNQAMKMFDATEVVPINFVFFTTSAIVAGIVFYQEF  278

Query  1117  QVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQ  1218
             +    L   MF+LG +  F+GI L+A +  K  Q
Sbjct  279   EGLALLNILMFLLGCLLSFLGIFLIARNRPKIKQ  312



>emb|CCF51775.1| uncharacterized protein UHOR_03790 [Ustilago hordei]
Length=637

 Score = 83.6 bits (205),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 129/280 (46%), Gaps = 18/280 (6%)
 Frame = +1

Query  346   GHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGIIFFALGNSLNFISFGFAAQSLLAAL  525
             G D+++ +S   + G N        +H + W +G+    +G + NFIS+GFA  SL+A L
Sbjct  76    GEDQQVSNSR-SSGGNNNNGMDTEFLHSKLWWLGLALMTIGEAGNFISYGFAPASLVAPL  134

Query  526   GSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGNIFLVAFGNHQSPVYT-PEQLAEKYS  702
             G++  +SN+  +  +  +      +      ++G + +V F + Q+ V   P QL     
Sbjct  135   GAVALLSNVIISPILLRERFRPSDIGGILLAIIGAVTVV-FSSKQNDVRVGPSQLLLAIK  193

Query  703   NITFLLYCLILVLVVAFHHSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSV  882
              + FL+Y  I V            G LL  +    L   W ++   + AI     G F+V
Sbjct  194   RLEFLIYTAISV----------SSGALLAFLSTTSLGDSWVLIDVGTCAI----FGGFTV  239

Query  883   LFAKslsnllrlsisnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQ  1062
             L  K +S+L+        L     TY +LL+  +TA   +  LN  L RFD+  ++P   
Sbjct  240   LSTKGISSLISGGKPIEALKFP-ITYGLLLVLAATAVVQITYLNRALQRFDSREVIPTQF  298

Query  1063  IAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIGI  1182
             + +T  +I    + +++++  DA R   F+ G +  F G+
Sbjct  299   VFFTISAIVGSAILYRDFENMDAHRLINFLFGCLTTFAGV  338



>ref|XP_009839898.1| hypothetical protein H257_13908 [Aphanomyces astaci]
 gb|ETV70515.1| hypothetical protein H257_13908 [Aphanomyces astaci]
Length=435

 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 88/344 (26%), Positives = 148/344 (43%), Gaps = 34/344 (10%)
 Frame = +1

Query  262   LMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWR  441
             L G   +G +I +   I  N G  L K  H  R     LG E  N    M      + W 
Sbjct  28    LTGSNALGLWITISAGICSNLGVQLQKHAHQAR--RPRLGKE--NNSVGM--YFAQKQWI  81

Query  442   IGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVS-NIAFAYFVFNKTVTIKVMVATTFI  618
             +G+    +G+  +F +  FA QSL+A +G    V  N+ F+     +  TI+    T  I
Sbjct  82    VGMALVLVGSIGDFEALSFATQSLVATVGGGTTVVTNVLFSTIWHGEHFTIRDAYGTFCI  141

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYR---------  771
             +LG + L+A  + Q   Y  EQL  K+ + + + Y  ++  ++   H++ +         
Sbjct  142   LLG-VLLIALCSPQDEQYNVEQLVYKFQSPSVVAYLALVAALLYVLHAIVQGSNDSDDIH  200

Query  772   --------------RGELLLNVP---GNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKsl  900
                              L   +P   G+ +    + + P  YAI+SG +GS S+L  K  
Sbjct  201   IIAFPSAINACRQTSARLRRFIPVDTGSMMMASQESIQPVVYAIMSGIMGSLSMLLGKCA  260

Query  901   snllrlsisnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFF  1080
             S +L+ +   S   +   TY      ++T G  +   N+ L R D  ++ P+FQ+ W  F
Sbjct  261   SEMLQTTFQGSSQFNHPVTYLFFTGMVATIGLQVHWFNQSLMRGDMAIVFPVFQVFWIGF  320

Query  1081  SICTGFVYFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDSKG  1212
              +  G V + +    +  +   FVL   C+ IG+  LA  +S+G
Sbjct  321   GVVGGMVLYGDLARLEFFQGVSFVLAFWCILIGVYNLAQHESQG  364



>ref|XP_005851241.1| hypothetical protein CHLNCDRAFT_137963 [Chlorella variabilis]
 gb|EFN59139.1| hypothetical protein CHLNCDRAFT_137963 [Chlorella variabilis]
Length=147

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 68/115 (59%), Gaps = 14/115 (12%)
 Frame = +1

Query  265  MGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHF-----  429
            M  W +GA IN++GSI+IN GTN++KLGH +    +A G +    K + +P   +     
Sbjct  1    MALWAVGAIINVVGSIMINLGTNIIKLGHTKTELAAADGGDKPP-KMSKEPRRWWSFPGN  59

Query  430  QTWRIGIIFFALGNSLN--------FISFGFAAQSLLAALGSIQFVSNIAFAYFV  570
            + W  G++ F +GN L          +SF F AQSLL+ALG +QF+SNIAF  +V
Sbjct  60   RVWLGGMLLFTVGNMLKCAGGWGGCLVSFAFTAQSLLSALGVVQFISNIAFGRWV  114



>ref|XP_008620005.1| hypothetical protein SDRG_15605 [Saprolegnia diclina VS20]
 gb|EQC26575.1| hypothetical protein SDRG_15605 [Saprolegnia diclina VS20]
Length=388

 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 86/331 (26%), Positives = 143/331 (43%), Gaps = 47/331 (14%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT-----  435
             +W IG  I +  +I+ N G N+ KL H        +G EG       +P+   +T     
Sbjct  22    KW-IGLAIVVGSAILSNLGVNVQKLSH--------VGEEG-------RPLFERRTYYTRP  65

Query  436   -WRIGIIFFALGNSLNFISFGFAAQSLLAALGS-IQFVSNIAFAYFVFNKTVTIKVMVAT  609
              W  G++   LG+  +F +  FA Q+L+AA+G     ++N+ FA+    + +T      T
Sbjct  66    LWITGMVLVILGSIGDFEALAFAPQALVAAVGGGCTVLANVFFAHLWLGQRLTWYDTSGT  125

Query  610   TFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY----CLILVLVVAFHHSVYRRG  777
              FI++G + L   GN      T  +L  ++  + FL+Y    C++L  +     S+ R  
Sbjct  126   FFIIVG-VVLSTLGNQPDAQLTLNELEAQFCGLEFLVYFTFMCIMLFCIFGEIRSIGRNQ  184

Query  778   ELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT  957
                          +    LP+ YA  SG  GSFSVL AK       + +  ++   + F 
Sbjct  185   R--------KTHEYLYRRLPYLYATASGIFGSFSVLLAK----CASMLLLLTFQGQNQFV  232

Query  958   YSMLLLFLS----TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVF  1125
             Y    LF+     T       LN  +   D + + P+FQ  W   S+  G V+++++  F
Sbjct  233   YPTTYLFVGGMVVTLVLQTDLLNRAIMSGDTLSVFPVFQCFWIGSSVVGGIVFYRKFYDF  292

Query  1126  DALRTTMFVLGVMCVFIGISLL---APDDSK  1209
                        +  + IGI LL   A DD++
Sbjct  293   HLFEWICLPSALGLILIGIYLLTQHASDDAE  323



>ref|XP_009835023.1| hypothetical protein H257_10240 [Aphanomyces astaci]
 gb|ETV75389.1| hypothetical protein H257_10240 [Aphanomyces astaci]
Length=402

 Score = 82.0 bits (201),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 83/316 (26%), Positives = 139/316 (44%), Gaps = 32/316 (10%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
             +W IG  I +  +I+ N G N+ KL H +  K S             +P      W IG+
Sbjct  41    KW-IGLAIVVGSAILSNLGVNVQKLSHVKEEKRSLF---------LRRPYYVRPLWIIGM  90

Query  451   IFFALGNSLNFISFGFAAQSLLAALGS-IQFVSNIAFAYFVFNKTVTIKVMVATTFIVLG  627
              F  LG+  +F +  FA Q+L+A++G     ++N+ FA+    + +T   +  T FI++G
Sbjct  91    TFVVLGSIGDFEALAFAPQALVASVGGGCTVLANMGFAHLWLGQRLTWYDVFGTFFILVG  150

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY----CLILVLVVAFHHSVYRRGELLLNV  795
              + L    N         +L   + ++ FL+Y    CLIL ++     S+ R        
Sbjct  151   -VVLSTLANTPDAQLDLNELELHFRHLEFLVYFSVMCLILFILFGEIRSIARHSR-----  204

Query  796   PGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLL  975
             P +D        L + YA  SG  GSFSVL AK       + +  ++   + F Y +  L
Sbjct  205   PTHD---HLHRRLAYLYATASGIFGSFSVLLAK----CTSMLLLLTFQGDNQFVYPITYL  257

Query  976   F----LSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTT  1143
             F    ++T       LN  +   D + + P+FQ  W   S+  G V++Q++  F      
Sbjct  258   FVGGMVATLVLQTDLLNRAIMSGDTLSVFPVFQCFWIGSSVVGGVVFYQKFNTFTLFEWI  317

Query  1144  MFVLGVMCVFIGISLL  1191
                + +  + +GI LL
Sbjct  318   SLPVALASIILGIYLL  333



>ref|XP_009839899.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV70516.1| hypothetical protein, variant [Aphanomyces astaci]
Length=415

 Score = 82.0 bits (201),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 88/348 (25%), Positives = 148/348 (43%), Gaps = 34/348 (10%)
 Frame = +1

Query  262   LMGEWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWR  441
             L G   +G +I +   I  N G  L K  H  R     LG E  N    M      + W 
Sbjct  28    LTGSNALGLWITISAGICSNLGVQLQKHAHQAR--RPRLGKE--NNSVGM--YFAQKQWI  81

Query  442   IGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVS-NIAFAYFVFNKTVTIKVMVATTFI  618
             +G+    +G+  +F +  FA QSL+A +G    V  N+ F+     +  TI+    T  I
Sbjct  82    VGMALVLVGSIGDFEALSFATQSLVATVGGGTTVVTNVLFSTIWHGEHFTIRDAYGTFCI  141

Query  619   VLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFHHSVYR---------  771
             +LG + L+A  + Q   Y  EQL  K+ + + + Y  ++  ++   H++ +         
Sbjct  142   LLG-VLLIALCSPQDEQYNVEQLVYKFQSPSVVAYLALVAALLYVLHAIVQGSNDSDDIH  200

Query  772   --------------RGELLLNVP---GNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKsl  900
                              L   +P   G+ +    + + P  YAI+SG +GS S+L  K  
Sbjct  201   IIAFPSAINACRQTSARLRRFIPVDTGSMMMASQESIQPVVYAIMSGIMGSLSMLLGKCA  260

Query  901   snllrlsisnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFF  1080
             S +L+ +   S   +   TY      ++T G  +   N+ L R D  ++ P+FQ+ W  F
Sbjct  261   SEMLQTTFQGSSQFNHPVTYLFFTGMVATIGLQVHWFNQSLMRGDMAIVFPVFQVFWIGF  320

Query  1081  SICTGFVYFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQTK  1224
              +  G V + +    +  +   FVL   C+ IG+  LA  +S+G    
Sbjct  321   GVVGGMVLYGDLARLEFFQGVSFVLAFWCILIGVYNLAQHESQGVDAS  368



>gb|KDO28115.1| hypothetical protein SPRG_20272 [Saprolegnia parasitica CBS 223.65]
Length=388

 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 85/331 (26%), Positives = 143/331 (43%), Gaps = 47/331 (14%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT-----  435
             +W IG  I +  +I+ N G N+ KL H        +G EG       +P+   +T     
Sbjct  22    KW-IGLAIVVGSAILSNLGVNVQKLSH--------VGEEG-------RPLFERRTYYTRP  65

Query  436   -WRIGIIFFALGNSLNFISFGFAAQSLLAALGS-IQFVSNIAFAYFVFNKTVTIKVMVAT  609
              W  G++   LG+  +F +  FA Q+L+AA+G     ++N+ FA+    + +T     A 
Sbjct  66    LWITGMVLVILGSIGDFEALAFAPQALVAAVGGGCTVLANVFFAHLWLGQRLTWN-DTAG  124

Query  610   TFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY----CLILVLVVAFHHSVYRRG  777
             TF+++  + L   GN      T  +L  ++  + FL+Y    C++L  +     S+ R  
Sbjct  125   TFLIIVGVVLSTLGNQPDAQLTLNELEAQFCGLEFLVYFSFMCVMLFCIFGEIRSIGRNS  184

Query  778   ELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFT  957
                          +    LP+ YA  SG  GSFSVL AK       + +  ++   + F 
Sbjct  185   R--------KTHEYLYRRLPYLYATASGIFGSFSVLLAK----CASMLLLLTFQGQNQFV  232

Query  958   YSMLLLFLS----TAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVF  1125
             Y    LF+     T       LN  +   D + + P+FQ  W   S+  G V+++++  F
Sbjct  233   YPTTYLFVGGMIVTLVLQTDLLNRAIMSGDTLSVFPVFQCFWIGSSVVGGIVFYRKFYDF  292

Query  1126  DALRTTMFVLGVMCVFIGISLL---APDDSK  1209
                        +  + IGI LL   A DD++
Sbjct  293   HLFEWICLPSALGLILIGIYLLTQHARDDAE  323



>ref|XP_008864475.1| hypothetical protein, variant 3 [Aphanomyces invadans]
 gb|ETW06400.1| hypothetical protein, variant 3 [Aphanomyces invadans]
Length=338

 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 80/289 (28%), Positives = 127/289 (44%), Gaps = 24/289 (8%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
             +W IG  I +  +I+ N G N+ KL H +  K S             +P      W IG+
Sbjct  41    KW-IGLAIVIGSAILSNLGVNVQKLSHVKEEKRSMFQR---------RPYYVRPLWIIGM  90

Query  451   IFFALGNSLNFISFGFAAQSLLAALGS-IQFVSNIAFAYFVFNKTVTIKVMVATTFIVLG  627
              F  LG+  +F +  FA Q+L+A++G     ++N+ FA+    + +T   ++ T FI++G
Sbjct  91    AFVVLGSIGDFEALAFAPQALVASVGGGCTVLANMGFAHLWLGQRLTWYDVLGTFFILVG  150

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLY----CLILVLVVAFHHSVYRRGELLLNV  795
              + L    N      T  +L  ++ ++ FL+Y    CL+L  +     S+ RR  L    
Sbjct  151   -VVLSTLANTPDAQLTIVELELQFQHLEFLVYFSIMCLVLFGIFGEIRSIARRSRLT---  206

Query  796   PGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLL  975
                    +    LP+ YA  SG  GSFSVL AK  S LL L+           TY  +  
Sbjct  207   -----HEYLHRRLPYLYATASGIFGSFSVLLAKCTSMLLLLTFQGDNQFVYPITYVFVGG  261

Query  976   FLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQV  1122
              ++T       LN  +   D + + P+FQ  W    +C   V     +V
Sbjct  262   MIATLVLQTDLLNRAIMSGDTLSVFPVFQCFWIGVRLCANSVRLLAREV  310



>emb|CCA27702.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=1004

 Score = 83.2 bits (204),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 89/318 (28%), Positives = 149/318 (47%), Gaps = 33/318 (10%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQTWRIGI  450
             +W IG  I +  +I  N G N+ KL H +  K + LG          +P+     W IG+
Sbjct  637   KW-IGLSIVVGSAIASNLGVNVQKLSHVQEAKLAHLGKR----TYFTRPV-----WLIGM  686

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFV-SNIAFAYFVFNKTVTIKVMVATTFIVLG  627
             I   LG+  + I+ GFA Q+L+A++G    V  N+ FA+    + +T+   + T  IV+G
Sbjct  687   ILIVLGSIGDLIALGFAPQALVASVGGGSTVLVNVFFAHLWLGQALTLIDGIGTFLIVVG  746

Query  628   NIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYC----LILVLVVAFHHSVYRRGELLLNV  795
              +      N      + E+L  ++    FL+Y     L+L+ + +  H++ +R  L   +
Sbjct  747   -VVSSTVANTPDSQLSLEELEYQFVQTEFLVYVFLTILVLLCISSQLHAIKKR--LRGGI  803

Query  796   PGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTY-----  960
               +  +      LPF YA  SG +GS+SVL AK  + LL L++  +       TY     
Sbjct  804   AESQARK-----LPFLYATASGIVGSYSVLLAKCAAILLILTVRGTNQFVYLTTYLFVGG  858

Query  961   SMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRT  1140
             +++ L + T  F     N  +   D + + PMFQ  W   S   G V++++Y  F     
Sbjct  859   TVVSLVIQTDLF-----NRAIMEGDTLRVYPMFQCFWIGSSFIGGVVFYEKYLQFGIFEW  913

Query  1141  TMFVLGVMCVFIGISLLA  1194
             T   + ++ +  GI LLA
Sbjct  914   TCLPIALVFIISGIYLLA  931



>gb|EPR80014.1| hypothetical protein SLOPH_2238 [Spraguea lophii 42_110]
Length=464

 Score = 82.0 bits (201),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 75/302 (25%), Positives = 135/302 (45%), Gaps = 31/302 (10%)
 Frame = +1

Query  271   EWVIGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHF--QTWRI  444
             +W++G  +++ G+++IN G N  K  +                +     +  F   T+  
Sbjct  131   KWILGVLLSVSGNLMINLGVNFQKKSY----------------RVDTMVVFGFTISTFSF  174

Query  445   GIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVL  624
             G+  +  G    F S+ +  QSLLA+L  +  + N  FA  + N+T T K       I+ 
Sbjct  175   GMFIYIFGKFFGFFSYVYGNQSLLASLSGVGLLFNSVFAPLINNETFTWKDFAGIICILT  234

Query  625   GNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILVLVVAFH---------HSVYRRG  777
             G+  +V    H + VYT  +L + Y +   +++   L+L++            +S +R  
Sbjct  235   GSAIIVKNSGHSTHVYTLCELLKLYESRNTIVWFSFLILLIILLFFLLKNFEINSDWRLS  294

Query  778   ELLLNVPGNDLKPFWQMLLPFS----YAIVSGTIGSFSVLFAKslsnllrlsisnsyllH  945
             +        D+      L  +S    Y +++ TI SFS LFAKS   +L  ++       
Sbjct  295   DDFFMFLKRDIHYEESNLFRYSMLLFYDVLAATIASFSSLFAKSFGEMLDQTVKGENQFL  354

Query  946   SWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVF  1125
             +  TY  L L +      +  +N  L  +DA+++VP+F + WT  SI T  +YF +++ F
Sbjct  355   TGITYIFLTLIVICTVLQIYWINRALRHYDALIVVPIFHMTWTLLSITTAGIYFHDFENF  414

Query  1126  DA  1131
              A
Sbjct  415   TA  416



>gb|ESA20040.1| hypothetical protein GLOINDRAFT_18955 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX78077.1| hypothetical protein RirG_018080 [Rhizophagus irregularis DAOM 
197198w]
Length=426

 Score = 81.6 bits (200),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 136/301 (45%), Gaps = 18/301 (6%)
 Frame = +1

Query  364   KHSALGNEGTNGKAAMKPIIHFQTWRIGIIFFALGNSL-NFISFGFAAQSLLAALGSIQF  540
             + S + NE    K   +       W +G   + + N + +  S G+    +LA LG++  
Sbjct  44    RKSYVINENIYPKELRRSACRQPLWHLGFDTYIISNIIGSAFSIGYLPIVILAPLGAVTL  103

Query  541   VSNIAFAYFVFNKTVTIKVMVATTFIVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLL  720
             V N  FA  +     T K ++ T FI++G + +  FG    P ++ E L E Y    F+ 
Sbjct  104   VFNAFFAKILLGDVFTKKTLIGTFFILIGAVMIALFGVVNEPNHSLEDLIELYKRPAFIA  163

Query  721   YCLILVLVVAFHHSVYRRGELLLN---------VPGNDLKPFWQMLLPFSYAIVSGTIGS  873
             Y  ++  VV       + GE  LN         + G  LK F Q LL  SY  V+G I  
Sbjct  164   YFSVVEFVVISILIANKFGEYALNQMIRNENDIIFGWSLKKF-QKLLGISYGCVAGMISG  222

Query  874   FSVLFAKslsnllrlsisnsyllH----SWFTYSMLLLFLSTAGFWMARLNEGLSRFDAI  1041
              ++LFAKS   LL LSI N         SWF  + L++   TA   +  LN+GL   D I
Sbjct  223   QTLLFAKSGIELLLLSIFNCENQFNRPLSWFIVAALVV---TALIQLYYLNKGLRLCDTI  279

Query  1042  LIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIGISLLAPDDSKGTQT  1221
             +++P+    +   +I  G VYF ++      +  + +LGV  +  G+ +L+   S   + 
Sbjct  280   ILIPLSFCTYNVSTIFNGLVYFNQWSRLYWWQIFLVILGVWILLCGVLILSWRRSTAPEE  339

Query  1222  K  1224
             +
Sbjct  340   E  340



>emb|CDI56421.1| duf803-domain-containing protein [Melanopsichium pennsylvanicum 
4]
Length=660

 Score = 82.4 bits (202),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 129/275 (47%), Gaps = 19/275 (7%)
 Frame = +1

Query  367   HSALGNEGTNGKAAMKPIIHFQT--WRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQF  540
             +S   N+ + G      I+  Q+  W +G+    +G + NFIS+GFA  SL+A LG++  
Sbjct  101   NSTESNQSSQGSGNGMDIMFLQSKLWWLGLSLMTVGEAGNFISYGFAPASLVAPLGAVAL  160

Query  541   VSNIAFAYFVFNKTVTIKVMVATTFIVLGNIFLVAFGNHQSPVY-TPEQLAEKYSNITFL  717
             +SN+  +  +  +T  +  +   T  ++G + +V F + QS     P QL +    + FL
Sbjct  161   LSNVIISPILLGETFKLSDIGGITLAIIGAVTVV-FSSKQSDARLDPSQLLDAIKRLDFL  219

Query  718   LYCLILVLVVAFHHSVYRRGELLLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKs  897
             +Y  I V            G LL ++    L   W ++   + AI     G F+VL  K 
Sbjct  220   IYSAISVSC----------GVLLASLSTTRLGDRWVLIDVGTCAI----FGGFTVLSTKG  265

Query  898   lsnllrlsisnsyllHSWFTYSMLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTF  1077
             +S+L+        L     TY ++++  +TA   +  LN  L RFD+  ++P   + +T 
Sbjct  266   ISSLISGGQPIEALKFP-ITYCLVIVLAATAVVQITYLNRALQRFDSREVIPTQFVFFTI  324

Query  1078  FSICTGFVYFQEYQVFDALRTTMFVLGVMCVFIGI  1182
              +I    + ++++   DA R   F+ G +  F G+
Sbjct  325   SAIVGSAILYRDFANMDAHRLINFLFGCLTTFGGV  359



>ref|XP_005107839.1| PREDICTED: NIPA-like protein 2-like [Aplysia californica]
Length=413

 Score = 81.3 bits (199),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 141/309 (46%), Gaps = 34/309 (11%)
 Frame = +1

Query  280   IGAFINLLGSIIINFGTNLLKLGHDERIKHSALGNEGTNGKAAMKPIIHFQT---WRIGI  450
             IG+ + + G+I+I+   NL K  H        L N      AA +  +H+     W  G+
Sbjct  25    IGSGLAVAGNILISVSLNLQKYVH--------LRN------AAREVEVHYTKELLWWFGL  70

Query  451   IFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTFIVLGN  630
             +    G   NF ++GFA  S++A LG+   V+N+  A     + +  + +      ++G 
Sbjct  71    LLMGAGELFNFTAYGFAPASVVAPLGTTTVVANLFLAAIFLKEKIRSENLFGCGLAIVGA  130

Query  631   IFLVAFGNHQSPVYTPEQLAEKYSNITFLLY-CLILVLVVAFHHSVYRRGELLLNVPGND  807
               LV F N    V    ++ E  S   F+ Y C  ++++      +Y +           
Sbjct  131   FLLVYFSNQNEKVMGSYEIIEGLSQPIFVAYVCFEMIVLAGLLCMLYHK-----------  179

Query  808   LKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYSMLLLFLST  987
                  +M     Y ++S    SF+V+ AK++S +++LS            Y+M+++ + T
Sbjct  180   -----KMEHVLIYLLISSITASFTVISAKAVSGMIQLSFVGYSQWDQPVLYAMIVVLIVT  234

Query  988   AGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTTMFVLGVMC  1167
             A   +  +N  +  ++A ++VP+  + +T  +I  G V+++E+   + L+ TMF+ G   
Sbjct  235   ALVQIKFVNLAMKNYEATIVVPVNFVIFTISAILAGIVFYKEFYGMNGLQITMFLFGCAL  294

Query  1168  VFIGISLLA  1194
              F+ +  +A
Sbjct  295   SFMAVYFIA  303



>gb|KGB78790.1| hypothetical protein CNBG_4628 [Cryptococcus gattii R265]
Length=450

 Score = 81.3 bits (199),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 119/268 (44%), Gaps = 24/268 (9%)
 Frame = +1

Query  436   WRIGIIFFALGNSLNFISFGFAAQSLLAALGSIQFVSNIAFAYFVFNKTVTIKVMVATTF  615
             W +G++  A+G   NF+S+GFA  S++A LG++  ++N  FA  +  +    + MV    
Sbjct  8     WWLGMVLIAVGEGGNFLSYGFAPASVVAPLGTVALIANCIFAPLILGERFRTRDMVGMAL  67

Query  616   IVLGNIFLVAFGNHQSPVYTPEQLAEKYSNITFLLYCLILV----LVVAFHHSVYRRGEL  783
              ++G + +V   +  SP   P+QL    + + FLLY L  +     +V   +S + +  L
Sbjct  68    AIIGAVTVVQSSSDTSPRLNPDQLLTALTRLPFLLYTLFSILLLPPLVLLSNSSFGQAHL  127

Query  784   LLNVPGNDLKPFWQMLLPFSYAIVSGTIGSFSVLFAKslsnllrlsisnsyllHSWFTYS  963
             +++V                   +    G F+VL  K  +    LS        S  T++
Sbjct  128   MIDVG------------------ICALFGGFTVLATK--ALSSLLSGDFIRAWKSGVTWA  167

Query  964   MLLLFLSTAGFWMARLNEGLSRFDAILIVPMFQIAWTFFSICTGFVYFQEYQVFDALRTT  1143
              L++   T+   +  LN  L RF +  ++P   + +T   I    V +QE++     R  
Sbjct  168   CLVVVGGTSLGQIRWLNRALMRFQSKEVIPTQFVFFTLAVIIGSAVLYQEFRDITRSRFI  227

Query  1144  MFVLGVMCVFIGISLLAPDDSKGTQTKD  1227
              F  G+  +F+G+ LL    S     KD
Sbjct  228   NFAFGIATIFLGVHLLTSTTSPILMAKD  255



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6504825089772