BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23956_g1_i1 len=649 path=[989:0-114 1104:115-156 1146:157-157
27:158-255 125:256-278 2383:279-291 2396:292-324 2419:325-335
205:336-366 236:367-403 1344:404-498 360:499-648]

Length=649
                                                                      Score     E

emb|CBI21924.3|  unnamed protein product                                169   6e-49   
ref|XP_002278190.1|  PREDICTED: trans-resveratrol di-O-methyltran...    173   2e-48   Vitis vinifera
emb|CAN79968.1|  hypothetical protein VITISV_043678                     170   3e-47   Vitis vinifera
emb|CAN73270.1|  hypothetical protein VITISV_021918                     169   4e-47   Vitis vinifera
ref|XP_011091734.1|  PREDICTED: trans-resveratrol di-O-methyltran...    168   8e-47   
ref|XP_002278211.1|  PREDICTED: trans-resveratrol di-O-methyltran...    169   9e-47   Vitis vinifera
emb|CAN61955.1|  hypothetical protein VITISV_020020                     169   9e-47   Vitis vinifera
gb|EYU30737.1|  hypothetical protein MIMGU_mgv1a009866mg                167   2e-46   
ref|XP_009780941.1|  PREDICTED: trans-resveratrol di-O-methyltran...    167   3e-46   
emb|CBI21931.3|  unnamed protein product                                165   3e-46   
ref|XP_011091580.1|  PREDICTED: trans-resveratrol di-O-methyltran...    167   4e-46   
emb|CBI21929.3|  unnamed protein product                                165   4e-46   
emb|CAN69556.1|  hypothetical protein VITISV_027590                     165   9e-46   Vitis vinifera
ref|XP_006366298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    166   1e-45   
gb|AEF97347.1|  O-methyltransferase                                     166   2e-45   
ref|XP_003633248.1|  PREDICTED: trans-resveratrol di-O-methyltran...    166   2e-45   
ref|XP_009602136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    166   2e-45   
ref|XP_002281368.2|  PREDICTED: trans-resveratrol di-O-methyltran...    166   2e-45   Vitis vinifera
ref|XP_003633249.1|  PREDICTED: trans-resveratrol di-O-methyltran...    166   2e-45   
gb|AEC13057.1|  orcinol O-methyltransferase-like protein                166   2e-45   
emb|CDP21551.1|  unnamed protein product                                163   2e-45   
ref|NP_001267963.1|  O-methyltransferase                                165   3e-45   
emb|CAQ76879.1|  resveratrol O-methyltransferase                        165   3e-45   Vitis vinifera
gb|AFX68805.1|  O-metyltransferase                                      164   5e-45   
emb|CBI22005.3|  unnamed protein product                                163   6e-45   
ref|XP_006376396.1|  hypothetical protein POPTR_0013s12670g             164   6e-45   
ref|XP_009594948.1|  PREDICTED: trans-resveratrol di-O-methyltran...    164   7e-45   
ref|XP_006371493.1|  hypothetical protein POPTR_0019s12280g             162   7e-45   
ref|XP_009764108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    164   7e-45   
ref|XP_011002662.1|  PREDICTED: trans-resveratrol di-O-methyltran...    163   1e-44   
ref|XP_011002663.1|  PREDICTED: trans-resveratrol di-O-methyltran...    163   1e-44   
sp|B6VJS4.2|ROMT_VITVI  RecName: Full=Trans-resveratrol di-O-meth...    163   1e-44   Vitis vinifera
ref|XP_006368013.1|  PREDICTED: trans-resveratrol di-O-methyltran...    162   2e-44   
gb|AAM23005.1|AF502434_1  orcinol O-methyltransferase                   163   2e-44   Rosa hybrid cultivar
emb|CDP15884.1|  unnamed protein product                                160   2e-44   
gb|ABK96707.1|  unknown                                                 162   2e-44   Populus trichocarpa x Populus deltoides
ref|XP_006346268.1|  PREDICTED: trans-resveratrol di-O-methyltran...    162   3e-44   
ref|XP_004303127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    162   3e-44   
ref|NP_001268044.1|  trans-resveratrol di-O-methyltransferase           162   3e-44   
ref|XP_011037436.1|  PREDICTED: trans-resveratrol di-O-methyltran...    158   4e-44   
gb|ABQ02270.2|  O-methyltransferase                                     162   4e-44   Vitis vinifera
ref|XP_011085639.1|  PREDICTED: chavicol O-methyltransferase-like       162   4e-44   
emb|CDP17644.1|  unnamed protein product                                161   4e-44   
ref|XP_007142076.1|  hypothetical protein PHAVU_008G250600g             161   5e-44   
emb|CBI21926.3|  unnamed protein product                                160   6e-44   
emb|CAN78992.1|  hypothetical protein VITISV_005827                     161   6e-44   Vitis vinifera
ref|XP_002278294.1|  PREDICTED: trans-resveratrol di-O-methyltran...    161   6e-44   Vitis vinifera
emb|CDP15888.1|  unnamed protein product                                161   1e-43   
ref|XP_011070200.1|  PREDICTED: trans-resveratrol di-O-methyltran...    163   1e-43   
gb|KHN19130.1|  8-hydroxyquercetin 8-O-methyltransferase                157   1e-43   
ref|XP_004248183.1|  PREDICTED: trans-resveratrol di-O-methyltran...    160   1e-43   
gb|AAM23004.1|AF502433_1  orcinol O-methyltransferase                   160   2e-43   Rosa hybrid cultivar
emb|CDP19709.1|  unnamed protein product                                160   2e-43   
ref|XP_007142043.1|  hypothetical protein PHAVU_008G247600g             160   2e-43   
emb|CAJ65638.1|  putative orcinol O-methyltransferase                   160   2e-43   Rosa hugonis
emb|CBI21927.3|  unnamed protein product                                158   2e-43   
emb|CAJ65639.1|  putative orcinol O-methyltransferase                   160   2e-43   Rosa hugonis
ref|XP_006388574.1|  hypothetical protein POPTR_0151s00220g             159   2e-43   
emb|CAH05084.1|  orcinol O-methyltransferase 3                          159   2e-43   Rosa hybrid cultivar
emb|CAJ65603.1|  putative orcinol O-methyltransferase                   159   3e-43   Rosa banksiae
emb|CAJ65607.1|  putative orcinol O-methyltransferase                   159   3e-43   Rosa beggeriana
emb|CAJ65602.1|  putative orcinol O-methyltransferase                   159   3e-43   Rosa banksiae
emb|CAJ65609.1|  putative orcinol O-methyltransferase                   159   3e-43   Rosa bracteata [Macartny rose]
ref|XP_007142077.1|  hypothetical protein PHAVU_008G250700g             159   4e-43   
gb|KHN08846.1|  8-hydroxyquercetin 8-O-methyltransferase                157   4e-43   
emb|CAJ65601.1|  putative orcinol O-methyltransferase                   159   5e-43   Rosa chinensis [China rose]
emb|CAJ65661.1|  putative orcinol O-methyltransferase                   158   6e-43   Rosa odorata [tea rose]
emb|CDP21787.1|  unnamed protein product                                159   6e-43   
ref|XP_011002666.1|  PREDICTED: trans-resveratrol di-O-methyltran...    159   6e-43   
emb|CAH05080.1|  putative orcinol O-methyltransferase                   158   7e-43   Rosa gallica [apothecary rose]
emb|CAJ65665.1|  putative orcinol O-methyltransferase                   158   7e-43   Rosa odorata [tea rose]
gb|KHN08844.1|  8-hydroxyquercetin 8-O-methyltransferase                157   9e-43   
emb|CAH05081.1|  putative orcinol O-methyltransferase                   158   1e-42   Rosa hybrid cultivar
emb|CAJ65622.1|  putative orcinol O-methyltransferase                   158   1e-42   Rosa gallica [apothecary rose]
emb|CAJ65635.1|  putative orcinol O-methyltransferase                   158   1e-42   Rosa odorata var. gigantea
emb|CAH05090.1|  putative orcinol O-methyltransferase                   158   1e-42   Rosa odorata var. gigantea
emb|CAH05087.1|  orcinol O-methyltransferase 4                          158   1e-42   Rosa hybrid cultivar
emb|CAJ65621.1|  putative orcinol O-methyltransferase                   158   1e-42   Rosa gallica [apothecary rose]
emb|CAH05083.1|  putative orcinol O-methyltransferase                   158   1e-42   Rosa hybrid cultivar
emb|CAJ65628.1|  putative orcinol O-methyltransferase                   158   1e-42   Rosa odorata var. gigantea
emb|CAJ65632.1|  putative orcinol O-methyltransferase                   158   1e-42   Rosa odorata var. gigantea
emb|CAJ65610.1|  putative orcinol O-methyltransferase                   158   1e-42   Rosa canina [dog briar]
emb|CAJ65648.1|  putative orcinol O-methyltransferase                   157   1e-42   Rosa woodsii var. ultramontana
emb|CAJ65606.1|  putative orcinol O-methyltransferase                   157   1e-42   Rosa beggeriana
ref|XP_011091578.1|  PREDICTED: trans-resveratrol di-O-methyltran...    158   1e-42   
emb|CAJ65641.1|  putative orcinol O-methyltransferase                   157   1e-42   Rosa marretii
emb|CAJ65608.1|  putative orcinol O-methyltransferase                   157   1e-42   Rosa bracteata [Macartny rose]
emb|CAJ65640.1|  putative orcinol O-methyltransferase                   157   1e-42   Rosa majalis [cinnamon rose]
emb|CAJ65597.1|  putative orcinol O-methyltransferase                   157   1e-42   Rosa chinensis [China rose]
emb|CAJ65605.1|  putative orcinol O-methyltransferase                   157   1e-42   Rosa beggeriana
gb|ACU19152.1|  unknown                                                 156   1e-42   Glycine max [soybeans]
ref|XP_003615966.1|  O-methyltransferase                                158   1e-42   
ref|XP_002278316.1|  PREDICTED: trans-resveratrol di-O-methyltran...    157   2e-42   Vitis vinifera
emb|CAJ65623.1|  putative orcinol O-methyltransferase                   157   2e-42   Rosa gallica [apothecary rose]
ref|XP_003544912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    157   2e-42   
ref|XP_006376388.1|  6a-hydroxymaackiain methyltransferase family...    157   2e-42   
emb|CAJ65630.1|  putative orcinol O-methyltransferase                   157   2e-42   Rosa odorata var. gigantea
emb|CAJ65633.1|  putative orcinol O-methyltransferase                   157   2e-42   Rosa odorata var. gigantea
ref|XP_006376381.1|  6a-hydroxymaackiain methyltransferase family...    157   2e-42   
emb|CDP15886.1|  unnamed protein product                                157   2e-42   
emb|CAD29556.1|  orcinol O-methyltransferase                            157   2e-42   Rosa hybrid cultivar
emb|CAJ65664.1|  putative orcinol O-methyltransferase                   157   2e-42   Rosa odorata [tea rose]
emb|CAJ65634.1|  putative orcinol O-methyltransferase                   157   2e-42   Rosa odorata var. gigantea
emb|CAJ65663.1|  putative orcinol O-methyltransferase                   157   2e-42   Rosa odorata [tea rose]
ref|XP_006376386.1|  hypothetical protein POPTR_0013s12560g             157   3e-42   
emb|CAJ65618.1|  putative orcinol O-methyltransferase                   157   3e-42   Rosa chinensis var. spontanea
emb|CAH05082.1|  putative orcinol O-methyltransferase                   157   3e-42   Rosa hybrid cultivar
ref|XP_002278398.1|  PREDICTED: trans-resveratrol di-O-methyltran...    157   3e-42   Vitis vinifera
emb|CDP21583.1|  unnamed protein product                                155   3e-42   
emb|CAJ65656.1|  putative orcinol O-methyltransferase                   156   4e-42   Rosa odorata [tea rose]
emb|CAJ65598.1|  putative orcinol O-methyltransferase                   156   4e-42   Rosa chinensis [China rose]
emb|CAJ65626.1|  putative orcinol O-methyltransferase                   156   4e-42   Rosa gallica [apothecary rose]
emb|CAJ65642.1|  putative orcinol O-methyltransferase                   156   5e-42   Rosa marretii
ref|XP_003544914.1|  PREDICTED: trans-resveratrol di-O-methyltran...    156   5e-42   
emb|CAH05086.1|  orcinol O-methyltransferase 4                          156   5e-42   Rosa hybrid cultivar
ref|XP_003557042.1|  PREDICTED: trans-resveratrol di-O-methyltran...    156   5e-42   
ref|XP_008229109.1|  PREDICTED: trans-resveratrol di-O-methyltran...    156   6e-42   
emb|CAJ65636.1|  putative orcinol O-methyltransferase                   156   6e-42   Rosa odorata var. gigantea
emb|CAJ65647.1|  putative orcinol O-methyltransferase                   156   6e-42   Rosa rugosa [Japanese rose]
emb|CAJ65612.1|  putative orcinol O-methyltransferase                   156   6e-42   Rosa canina [dog briar]
emb|CAH05085.1|  orcinol O-methyltransferase 3                          156   6e-42   Rosa hybrid cultivar
emb|CAJ65660.1|  putative orcinol O-methyltransferase                   155   6e-42   Rosa odorata [tea rose]
emb|CAJ65627.1|  putative orcinol O-methyltransferase                   155   6e-42   Rosa odorata var. gigantea
emb|CAJ65659.1|  putative orcinol O-methyltransferase                   155   6e-42   Rosa odorata [tea rose]
gb|AAB71213.1|  methyltransferase                                       156   6e-42   Prunus armeniaca
emb|CAD29555.1|  orcinol O-methyltransferase                            155   7e-42   Rosa hybrid cultivar
emb|CAJ65614.1|  putative orcinol O-methyltransferase                   155   7e-42   Rosa chinensis var. spontanea
ref|XP_006469135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    157   7e-42   
emb|CAJ65611.1|  putative orcinol O-methyltransferase                   155   7e-42   Rosa canina [dog briar]
emb|CAJ65657.1|  putative orcinol O-methyltransferase                   155   7e-42   Rosa odorata [tea rose]
emb|CAJ65625.1|  putative orcinol O-methyltransferase                   155   7e-42   Rosa gallica [apothecary rose]
emb|CAJ65624.1|  putative orcinol O-methyltransferase                   155   7e-42   Rosa gallica [apothecary rose]
emb|CAJ65615.1|  putative orcinol O-methyltransferase                   155   7e-42   Rosa chinensis var. spontanea
emb|CAH05079.1|  putative orcinol O-methyltransferase                   155   7e-42   Rosa gallica [apothecary rose]
emb|CAJ65620.1|  putative orcinol O-methyltransferase                   155   8e-42   Rosa chinensis var. spontanea
emb|CAJ65613.1|  putative orcinol O-methyltransferase                   155   8e-42   Rosa chinensis var. spontanea
emb|CAH05088.1|  putative orcinol O-methyltransferase                   155   8e-42   Rosa odorata var. gigantea
ref|XP_004235335.1|  PREDICTED: trans-resveratrol di-O-methyltran...    157   8e-42   
emb|CAJ65662.1|  putative orcinol O-methyltransferase                   155   9e-42   Rosa odorata [tea rose]
ref|XP_002278517.1|  PREDICTED: trans-resveratrol di-O-methyltran...    155   1e-41   Vitis vinifera
gb|KDP24057.1|  hypothetical protein JCGZ_25714                         154   1e-41   
ref|XP_006446726.1|  hypothetical protein CICLE_v10015705mg             155   1e-41   
emb|CAJ65604.1|  putative orcinol O-methyltransferase                   154   2e-41   Rosa beggeriana
emb|CAJ65596.1|  putative orcinol O-methyltransferase                   154   2e-41   Rosa chinensis [China rose]
emb|CAJ65646.1|  putative orcinol O-methyltransferase                   154   2e-41   Rosa rugosa [Japanese rose]
ref|XP_008229108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    155   2e-41   
emb|CAJ65655.1|  putative orcinol O-methyltransferase                   154   2e-41   Rosa lucieae [memorial rose]
ref|XP_006446728.1|  hypothetical protein CICLE_v10015708mg             155   2e-41   
emb|CAJ65645.1|  putative orcinol O-methyltransferase                   154   2e-41   Rosa roxburghii [chestnut rose]
emb|CAA11131.1|  O-methyltransferase                                    154   3e-41   Prunus dulcis [sweet almond]
emb|CDP21661.1|  unnamed protein product                                154   3e-41   
emb|CDP21836.1|  unnamed protein product                                154   3e-41   
ref|XP_006388573.1|  hypothetical protein POPTR_0151s00210g             154   3e-41   
ref|XP_006376392.1|  hypothetical protein POPTR_0013s12620g             154   3e-41   
ref|XP_003615962.1|  O-methyltransferase                                154   4e-41   
ref|XP_003615973.1|  O-methyltransferase                                154   4e-41   
emb|CBI21932.3|  unnamed protein product                                155   4e-41   
emb|CAJ65599.1|  putative orcinol O-methyltransferase                   154   5e-41   Rosa chinensis [China rose]
ref|XP_011091583.1|  PREDICTED: trans-resveratrol di-O-methyltran...    154   5e-41   
emb|CAH05089.1|  putative orcinol O-methyltransferase                   153   5e-41   Rosa odorata var. gigantea
ref|XP_011100233.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    154   6e-41   
emb|CDP19840.1|  unnamed protein product                                154   6e-41   
emb|CAJ65631.1|  putative orcinol O-methyltransferase                   153   6e-41   Rosa odorata var. gigantea
ref|XP_011091736.1|  PREDICTED: trans-resveratrol di-O-methyltran...    156   7e-41   
emb|CAJ65666.1|  putative orcinol O-methyltransferase                   153   7e-41   Rosa odorata [tea rose]
emb|CAJ65643.1|  putative orcinol O-methyltransferase                   153   7e-41   Rosa marretii
emb|CAJ65616.1|  putative orcinol O-methyltransferase                   153   7e-41   Rosa chinensis var. spontanea
ref|XP_011037442.1|  PREDICTED: trans-resveratrol di-O-methyltran...    153   8e-41   
ref|XP_004505627.1|  PREDICTED: trans-resveratrol di-O-methyltran...    154   9e-41   
emb|CAH05091.1|  putative orcinol O-methyltransferase                   152   1e-40   Rosa odorata var. gigantea
emb|CAJ65637.1|  putative orcinol O-methyltransferase                   152   1e-40   Rosa odorata var. gigantea
gb|KDO41475.1|  hypothetical protein CISIN_1g0225151mg                  149   2e-40   
ref|XP_008245137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    152   2e-40   
ref|XP_006469137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    152   2e-40   
ref|XP_006346269.1|  PREDICTED: trans-resveratrol di-O-methyltran...    152   2e-40   
ref|XP_003615967.1|  O-methyltransferase                                152   2e-40   
ref|XP_008778505.1|  PREDICTED: trans-resveratrol di-O-methyltran...    150   3e-40   
ref|XP_011085377.1|  PREDICTED: chavicol O-methyltransferase-like       152   3e-40   
emb|CAJ65629.1|  putative orcinol O-methyltransferase                   151   3e-40   Rosa odorata var. gigantea
dbj|BAF36052.1|  O-methyltransferase                                    152   4e-40   Iris x hollandica [Dutch iris]
emb|CAJ65617.1|  putative orcinol O-methyltransferase                   151   4e-40   Rosa chinensis var. spontanea
ref|XP_002305103.1|  6a-hydroxymaackiain methyltransferase family...    151   4e-40   Populus trichocarpa [western balsam poplar]
gb|AEQ94124.1|  putative O-methyltransferase                            147   4e-40   
ref|XP_003615968.1|  O-methyltransferase                                150   5e-40   
ref|XP_004490686.1|  PREDICTED: trans-resveratrol di-O-methyltran...    151   6e-40   
gb|AGQ21572.1|  flavone 8-O-methyltransferase                           151   6e-40   
emb|CDP19839.1|  unnamed protein product                                150   6e-40   
emb|CAJ65600.1|  putative orcinol O-methyltransferase                   150   6e-40   Rosa chinensis [China rose]
gb|KHN07780.1|  Tabersonine 16-O-methyltransferase                      150   7e-40   
emb|CBI22002.3|  unnamed protein product                                144   7e-40   
ref|XP_009612081.1|  PREDICTED: trans-resveratrol di-O-methyltran...    150   8e-40   
ref|XP_004241914.1|  PREDICTED: myricetin O-methyltransferase-like      150   8e-40   
ref|XP_011016237.1|  PREDICTED: trans-resveratrol di-O-methyltran...    150   9e-40   
ref|XP_002326036.2|  hypothetical protein POPTR_0019s12290g             150   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_011100228.1|  PREDICTED: trans-resveratrol di-O-methyltran...    150   1e-39   
ref|XP_006356529.1|  PREDICTED: trans-resveratrol di-O-methyltran...    150   1e-39   
ref|XP_003527407.1|  PREDICTED: trans-resveratrol di-O-methyltran...    150   1e-39   
ref|XP_011100227.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    150   1e-39   
ref|XP_009605623.1|  PREDICTED: myricetin O-methyltransferase-like      150   1e-39   
emb|CAN83014.1|  hypothetical protein VITISV_029725                     150   1e-39   Vitis vinifera
ref|XP_010088036.1|  8-hydroxyquercetin 8-O-methyltransferase           150   1e-39   
emb|CAG27621.1|  putative O-methyltransferase                           143   2e-39   Populus deltoides x Populus maximowiczii
emb|CAJ65649.1|  putative orcinol O-methyltransferase                   149   2e-39   Rosa woodsii var. ultramontana
ref|XP_004490696.1|  PREDICTED: trans-resveratrol di-O-methyltran...    150   2e-39   
ref|XP_006428632.1|  hypothetical protein CICLE_v10012033mg             149   2e-39   
ref|XP_002278057.1|  PREDICTED: trans-resveratrol di-O-methyltran...    149   3e-39   Vitis vinifera
ref|XP_006480453.1|  PREDICTED: trans-resveratrol di-O-methyltran...    149   3e-39   
ref|XP_011037437.1|  PREDICTED: trans-resveratrol di-O-methyltran...    149   4e-39   
ref|XP_006377432.1|  6a-hydroxymaackiain methyltransferase family...    149   4e-39   
ref|XP_011001214.1|  PREDICTED: trans-resveratrol di-O-methyltran...    149   4e-39   
emb|CAN69333.1|  hypothetical protein VITISV_003273                     148   5e-39   Vitis vinifera
ref|XP_011077108.1|  PREDICTED: chavicol O-methyltransferase-like       148   5e-39   
ref|XP_006351391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    148   6e-39   
ref|XP_002277927.2|  PREDICTED: trans-resveratrol di-O-methyltran...    148   6e-39   Vitis vinifera
gb|AES89720.2|  orcinol O-methyltransferase                             148   6e-39   
ref|XP_008788394.1|  PREDICTED: trans-resveratrol di-O-methyltran...    148   6e-39   
ref|XP_002274019.2|  PREDICTED: trans-resveratrol di-O-methyltran...    148   6e-39   Vitis vinifera
ref|XP_007043718.1|  Flavonoid o-methyltransferase related              148   8e-39   
ref|XP_010938927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    147   1e-38   
ref|XP_008807987.1|  PREDICTED: trans-resveratrol di-O-methyltran...    147   1e-38   
emb|CDP19708.1|  unnamed protein product                                144   1e-38   
gb|AFK40900.1|  unknown                                                 147   1e-38   
ref|XP_008778275.1|  PREDICTED: trans-resveratrol di-O-methyltran...    147   2e-38   
ref|XP_010920172.1|  PREDICTED: trans-resveratrol di-O-methyltran...    147   2e-38   
emb|CBI21921.3|  unnamed protein product                                146   2e-38   
ref|XP_002538902.1|  o-methyltransferase, putative                      143   2e-38   Ricinus communis
ref|XP_009780812.1|  PREDICTED: myricetin O-methyltransferase-like      146   3e-38   
ref|XP_002525159.1|  o-methyltransferase, putative                      146   3e-38   Ricinus communis
ref|XP_011027757.1|  PREDICTED: trans-resveratrol di-O-methyltran...    146   3e-38   
ref|XP_003633245.1|  PREDICTED: trans-resveratrol di-O-methyltran...    146   3e-38   
ref|XP_010920173.1|  PREDICTED: trans-resveratrol di-O-methyltran...    146   4e-38   
ref|XP_007132751.1|  hypothetical protein PHAVU_011G1221001g            142   6e-38   
ref|XP_006366911.1|  PREDICTED: trans-resveratrol di-O-methyltran...    141   6e-38   
gb|AJD20223.1|  norcoclaurine 6-O-methyltransferase                     145   8e-38   
ref|XP_002454762.1|  hypothetical protein SORBIDRAFT_04g036900          145   9e-38   Sorghum bicolor [broomcorn]
ref|XP_009779391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    145   1e-37   
ref|XP_004249745.2|  PREDICTED: trans-resveratrol di-O-methyltran...    144   1e-37   
gb|ADZ76434.1|  myricetin O-methyltransferase 2                         145   1e-37   
ref|XP_004241912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    145   1e-37   
ref|XP_010052388.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    139   1e-37   
gb|KDP24061.1|  hypothetical protein JCGZ_25718                         144   2e-37   
gb|ABZ89567.1|  O-methyltransferase 3                                   145   2e-37   Humulus lupulus [common hop]
ref|XP_008455549.1|  PREDICTED: trans-resveratrol di-O-methyltran...    142   2e-37   
ref|XP_002525160.1|  o-methyltransferase, putative                      144   2e-37   Ricinus communis
ref|XP_010110665.1|  8-hydroxyquercetin 8-O-methyltransferase           145   2e-37   
ref|XP_006474725.1|  PREDICTED: trans-resveratrol di-O-methyltran...    144   3e-37   
gb|KDO73905.1|  hypothetical protein CISIN_1g017835mg                   144   3e-37   
emb|CDP21212.1|  unnamed protein product                                143   3e-37   
ref|XP_003607523.1|  O-methyltransferase                                144   3e-37   
ref|XP_010110664.1|  8-hydroxyquercetin 8-O-methyltransferase           144   3e-37   
ref|XP_008455550.1|  PREDICTED: trans-resveratrol di-O-methyltran...    141   4e-37   
ref|XP_008788395.1|  PREDICTED: trans-resveratrol di-O-methyltran...    144   4e-37   
emb|CDP21582.1|  unnamed protein product                                143   4e-37   
ref|XP_011037440.1|  PREDICTED: trans-resveratrol di-O-methyltran...    143   4e-37   
ref|XP_011091579.1|  PREDICTED: trans-resveratrol di-O-methyltran...    143   5e-37   
ref|XP_010097399.1|  8-hydroxyquercetin 8-O-methyltransferase           143   6e-37   
ref|XP_002517833.1|  o-methyltransferase, putative                      143   7e-37   Ricinus communis
ref|XP_004979388.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    142   9e-37   
ref|XP_006356530.1|  PREDICTED: trans-resveratrol di-O-methyltran...    142   1e-36   
ref|XP_010070176.1|  PREDICTED: trans-resveratrol di-O-methyltran...    142   1e-36   
ref|XP_010097396.1|  8-hydroxyquercetin 8-O-methyltransferase           140   1e-36   
ref|XP_006388414.1|  6a-hydroxymaackiain methyltransferase family...    142   1e-36   
gb|EMT31218.1|  O-methyltransferase ZRP4                                142   2e-36   
emb|CBI38115.3|  unnamed protein product                                139   2e-36   
ref|XP_010070166.1|  PREDICTED: trans-resveratrol di-O-methyltran...    142   2e-36   
ref|XP_002517832.1|  o-methyltransferase, putative                      141   2e-36   Ricinus communis
ref|XP_010920171.1|  PREDICTED: trans-resveratrol di-O-methyltran...    141   2e-36   
gb|AAR02421.1|  putative O-methyltransferase                            141   2e-36   Catharanthus roseus [chatas]
ref|XP_004170025.1|  PREDICTED: trans-resveratrol di-O-methyltran...    136   2e-36   
ref|XP_010023967.1|  PREDICTED: trans-resveratrol di-O-methyltran...    141   2e-36   
ref|XP_002517827.1|  o-methyltransferase, putative                      141   3e-36   Ricinus communis
ref|XP_010093978.1|  Tabersonine 16-O-methyltransferase                 141   3e-36   
emb|CBI30626.3|  unnamed protein product                                135   3e-36   
ref|XP_002437453.1|  hypothetical protein SORBIDRAFT_10g027360          141   3e-36   Sorghum bicolor [broomcorn]
gb|KEH30981.1|  isoflavone-7-O-methyltransferase                        140   4e-36   
ref|XP_008778546.1|  PREDICTED: trans-resveratrol di-O-methyltran...    140   4e-36   
ref|XP_010231167.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    136   5e-36   
ref|XP_006356531.1|  PREDICTED: trans-resveratrol di-O-methyltran...    140   5e-36   
ref|XP_006452811.1|  hypothetical protein CICLE_v10008718mg             140   5e-36   
ref|XP_007132709.1|  hypothetical protein PHAVU_011G118100g             140   5e-36   
gb|EYU30782.1|  hypothetical protein MIMGU_mgv1a021078mg                140   6e-36   
emb|CBI21922.3|  unnamed protein product                                138   6e-36   
ref|XP_004975403.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    140   7e-36   
ref|XP_002262833.1|  PREDICTED: trans-resveratrol di-O-methyltran...    140   7e-36   
gb|KDO37374.1|  hypothetical protein CISIN_1g023625mg                   138   9e-36   
ref|XP_010070184.1|  PREDICTED: trans-resveratrol di-O-methyltran...    140   1e-35   
ref|XP_008229106.1|  PREDICTED: trans-resveratrol di-O-methyltran...    140   1e-35   
ref|XP_004984099.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    140   1e-35   
gb|ABR20105.1|  16-hydroxytabersonine O-methyltransferase               134   1e-35   
ref|XP_006428633.1|  hypothetical protein CICLE_v10013393mg             137   1e-35   
ref|XP_010231166.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    136   1e-35   
gb|KCW89595.1|  hypothetical protein EUGRSUZ_A01877                     139   2e-35   
ref|XP_009593020.1|  PREDICTED: trans-resveratrol di-O-methyltran...    139   2e-35   
ref|XP_006469069.1|  PREDICTED: trans-resveratrol di-O-methyltran...    139   2e-35   
ref|XP_009778350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    138   3e-35   
gb|KDP24060.1|  hypothetical protein JCGZ_25717                         138   3e-35   
ref|XP_002437452.1|  hypothetical protein SORBIDRAFT_10g027340          139   3e-35   
ref|XP_010231165.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    136   3e-35   
sp|Q6VMW0.1|Q8OMT_MENPI  RecName: Full=8-hydroxyquercetin 8-O-met...    138   5e-35   
ref|XP_002278149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    138   5e-35   
ref|XP_006365443.1|  PREDICTED: trans-resveratrol di-O-methyltran...    137   5e-35   
ref|XP_008778001.1|  PREDICTED: trans-resveratrol di-O-methyltran...    137   5e-35   
ref|XP_006357086.1|  PREDICTED: tabersonine 16-O-methyltransferas...    137   5e-35   
emb|CAN73269.1|  hypothetical protein VITISV_021917                     137   5e-35   
ref|XP_008783118.1|  PREDICTED: trans-resveratrol di-O-methyltran...    136   5e-35   
emb|CBI21925.3|  unnamed protein product                                136   5e-35   
ref|XP_009625456.1|  PREDICTED: trans-resveratrol di-O-methyltran...    137   6e-35   
gb|KDP24062.1|  hypothetical protein JCGZ_25719                         137   6e-35   
gb|KEH30982.1|  isoflavone-7-O-methyltransferase                        137   6e-35   
ref|XP_003527405.1|  PREDICTED: trans-resveratrol di-O-methyltran...    137   7e-35   
emb|CDP19713.1|  unnamed protein product                                137   7e-35   
gb|AFX68806.1|  O-metyltransferase                                      137   7e-35   
ref|XP_002438878.1|  hypothetical protein SORBIDRAFT_10g027650          137   8e-35   
ref|XP_004170024.1|  PREDICTED: trans-resveratrol di-O-methyltran...    137   8e-35   
ref|XP_010231163.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    137   9e-35   
ref|XP_004303135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    137   1e-34   
ref|XP_011092041.1|  PREDICTED: trans-resveratrol di-O-methyltran...    137   1e-34   
gb|EMT21689.1|  O-methyltransferase ZRP4                                135   1e-34   
ref|XP_002517835.1|  o-methyltransferase, putative                      137   1e-34   
gb|KGN44538.1|  hypothetical protein Csa_7G328260                       136   1e-34   
ref|XP_009597680.1|  PREDICTED: trans-resveratrol di-O-methyltran...    137   1e-34   
ref|XP_004139733.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    137   1e-34   
ref|XP_004139732.1|  PREDICTED: trans-resveratrol di-O-methyltran...    137   1e-34   
ref|XP_009618299.1|  PREDICTED: trans-resveratrol di-O-methyltran...    136   1e-34   
ref|XP_007153628.1|  hypothetical protein PHAVU_003G051600g             136   1e-34   
ref|XP_010231162.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    137   1e-34   
ref|NP_001130621.1|  hypothetical protein                               137   2e-34   
ref|XP_009398848.1|  PREDICTED: trans-resveratrol di-O-methyltran...    136   2e-34   
ref|XP_002449557.1|  hypothetical protein SORBIDRAFT_05g019040          136   2e-34   
ref|XP_010052318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    136   2e-34   
ref|XP_002438877.1|  hypothetical protein SORBIDRAFT_10g027640          136   2e-34   
ref|XP_004961504.1|  PREDICTED: O-methyltransferase ZRP4-like           136   2e-34   
ref|XP_002447425.1|  hypothetical protein SORBIDRAFT_06g000820          136   3e-34   
ref|XP_002444017.1|  hypothetical protein SORBIDRAFT_07g005970          136   3e-34   
ref|XP_004158564.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    135   3e-34   
sp|Q8GSN1.1|MOMT_CATRO  RecName: Full=Myricetin O-methyltransfera...    135   3e-34   
ref|XP_004987341.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    136   3e-34   
ref|XP_004961502.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    136   3e-34   
ref|XP_008660003.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    135   3e-34   
ref|XP_002278127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    135   4e-34   
emb|CAN75970.1|  hypothetical protein VITISV_009881                     135   4e-34   
gb|EMS47465.1|  O-methyltransferase ZRP4                                135   4e-34   
ref|XP_004229155.1|  PREDICTED: myricetin O-methyltransferase-lik...    135   4e-34   
ref|XP_010916033.1|  PREDICTED: trans-resveratrol di-O-methyltran...    135   4e-34   
sp|B0EXJ8.1|HTOMT_CATRO  RecName: Full=Tabersonine 16-O-methyltra...    135   5e-34   
ref|XP_008455944.1|  PREDICTED: trans-resveratrol di-O-methyltran...    135   5e-34   
ref|XP_004151906.1|  PREDICTED: trans-resveratrol di-O-methyltran...    135   5e-34   
ref|XP_002522586.1|  o-methyltransferase, putative                      135   6e-34   
gb|EMT22927.1|  O-methyltransferase ZRP4                                134   7e-34   
gb|AAR02417.1|  putative O-methyltransferase                            134   7e-34   
gb|AES78098.2|  isoflavone-7-O-methyltransferase                        134   7e-34   
ref|XP_010916032.1|  PREDICTED: trans-resveratrol di-O-methyltran...    134   8e-34   
gb|AES78096.2|  isoflavone-7-O-methyltransferase                        134   9e-34   
ref|XP_010109381.1|  Tabersonine 16-O-methyltransferase                 134   1e-33   
emb|CBI21920.3|  unnamed protein product                                128   1e-33   
ref|NP_001148593.1|  O-methyltransferase ZRP4                           134   1e-33   
ref|XP_008783119.1|  PREDICTED: trans-resveratrol di-O-methyltran...    134   1e-33   
ref|XP_006365444.1|  PREDICTED: trans-resveratrol di-O-methyltran...    134   1e-33   
ref|XP_008779862.1|  PREDICTED: trans-resveratrol di-O-methyltran...    130   1e-33   
gb|KDP35397.1|  hypothetical protein JCGZ_10381                         134   1e-33   
ref|XP_003621880.1|  Caffeate O-methyltransferase-1                     134   1e-33   
ref|XP_004983195.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    134   1e-33   
ref|XP_002441374.1|  hypothetical protein SORBIDRAFT_09g025530          134   1e-33   
gb|EMT10452.1|  O-methyltransferase ZRP4                                134   2e-33   
ref|XP_006469063.1|  PREDICTED: trans-resveratrol di-O-methyltran...    134   2e-33   
emb|CBI21913.3|  unnamed protein product                                127   2e-33   
gb|ACF84530.1|  unknown                                                 133   2e-33   
ref|XP_004232927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    133   2e-33   
ref|XP_004961505.1|  PREDICTED: O-methyltransferase ZRP4-like           133   2e-33   
ref|XP_006446725.1|  hypothetical protein CICLE_v10015630mg             133   3e-33   
ref|XP_010243530.1|  PREDICTED: trans-resveratrol di-O-methyltran...    135   3e-33   
gb|ACV65500.1|  deoxyhemigossypol-6-O-methyltransferase                 133   3e-33   
gb|KCW89582.1|  hypothetical protein EUGRSUZ_A01865                     129   3e-33   
ref|XP_006371494.1|  hypothetical protein POPTR_0019s12300g             127   3e-33   
gb|AFW78710.1|  O-methyltransferase ZRP4                                133   3e-33   
ref|XP_004490687.1|  PREDICTED: trans-resveratrol di-O-methyltran...    132   4e-33   
ref|XP_002454761.1|  hypothetical protein SORBIDRAFT_04g036890          133   4e-33   
ref|XP_010920170.1|  PREDICTED: trans-resveratrol di-O-methyltran...    132   5e-33   
ref|XP_006469138.1|  PREDICTED: trans-resveratrol di-O-methyltran...    134   5e-33   
gb|KCW89583.1|  hypothetical protein EUGRSUZ_A01867                     129   6e-33   
ref|XP_010052409.1|  PREDICTED: trans-resveratrol di-O-methyltran...    132   6e-33   
gb|ACG32338.1|  O-methyltransferase ZRP4                                132   7e-33   
gb|AEN94899.1|  desoxyhemigossypol-6-O-methyltransferase                132   9e-33   
gb|ACN31450.1|  unknown                                                 129   9e-33   
emb|CAP72304.1|  O-methyltransferase                                    132   9e-33   
gb|AEF14418.1|  isoflavone O-methyltranferase                           131   1e-32   
gb|KEH30963.1|  isoflavone-7-O-methyltransferase                        131   1e-32   
ref|XP_002441379.1|  hypothetical protein SORBIDRAFT_09g025550          129   1e-32   
ref|XP_003568106.1|  PREDICTED: O-methyltransferase ZRP4-like           131   1e-32   
sp|Q84KK5.1|D7OMT_GLYEC  RecName: Full=Isoflavone 7-O-methyltrans...    131   1e-32   
ref|XP_008455942.1|  PREDICTED: trans-resveratrol di-O-methyltran...    131   2e-32   
ref|XP_002522501.1|  o-methyltransferase, putative                      131   2e-32   
gb|ACY41220.1|  O-methyltransferase-like protein                        131   2e-32   
gb|KDP35391.1|  hypothetical protein JCGZ_10375                         130   2e-32   
ref|XP_010040912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    130   2e-32   
gb|KDP21023.1|  hypothetical protein JCGZ_21494                         130   2e-32   
ref|XP_008792251.1|  PREDICTED: trans-resveratrol di-O-methyltran...    130   2e-32   
ref|XP_008656425.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    130   2e-32   
ref|NP_001140761.1|  uncharacterized protein LOC100272836               130   3e-32   
ref|XP_003536187.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    130   3e-32   
gb|ABR20106.1|  16-hydroxytabersonine O-methyltransferase               124   3e-32   
ref|XP_006364328.1|  PREDICTED: trans-resveratrol di-O-methyltran...    130   4e-32   
ref|XP_008656437.1|  PREDICTED: O-methyltransferase ZRP4-like           130   4e-32   
gb|KCW89599.1|  hypothetical protein EUGRSUZ_A01884                     130   4e-32   
ref|XP_010070255.1|  PREDICTED: trans-resveratrol di-O-methyltran...    130   4e-32   
ref|XP_004151735.1|  PREDICTED: trans-resveratrol di-O-methyltran...    130   4e-32   
ref|XP_009396879.1|  PREDICTED: trans-resveratrol di-O-methyltran...    130   4e-32   
ref|XP_004169298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    130   4e-32   
gb|AFK37355.1|  unknown                                                 127   4e-32   
gb|EMS45259.1|  O-methyltransferase ZRP4                                130   5e-32   
gb|KDP35402.1|  hypothetical protein JCGZ_10386                         129   5e-32   
gb|ACF81837.1|  unknown                                                 123   5e-32   
ref|XP_002450325.1|  hypothetical protein SORBIDRAFT_05g003780          130   5e-32   
ref|XP_002522500.1|  o-methyltransferase, putative                      129   5e-32   
ref|XP_010093977.1|  Tabersonine 16-O-methyltransferase                 129   5e-32   
ref|XP_003564176.2|  PREDICTED: O-methyltransferase ZRP4-like           130   6e-32   
ref|XP_004505392.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    129   6e-32   
gb|KCW75545.1|  hypothetical protein EUGRSUZ_E04305                     129   6e-32   
ref|XP_010683510.1|  PREDICTED: trans-resveratrol di-O-methyltran...    129   7e-32   
ref|XP_010058047.1|  PREDICTED: trans-resveratrol di-O-methyltran...    129   7e-32   
ref|XP_010058046.1|  PREDICTED: trans-resveratrol di-O-methyltran...    129   7e-32   
gb|EEE64356.1|  hypothetical protein OsJ_19196                          129   8e-32   
ref|XP_010070153.1|  PREDICTED: trans-resveratrol di-O-methyltran...    129   8e-32   
emb|CDP19711.1|  unnamed protein product                                129   9e-32   
emb|CDP22155.1|  unnamed protein product                                122   9e-32   
ref|XP_008660004.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    129   9e-32   
gb|AGS16668.1|  DIMBOA-Glc O-methyltransferase BX10c                    129   1e-31   
gb|EMT23556.1|  O-methyltransferase ZRP4                                129   1e-31   
gb|AAR02419.1|  flavonoid 4'-O-methyltransferase                        129   1e-31   
ref|XP_004973018.1|  PREDICTED: O-methyltransferase ZRP4-like           129   1e-31   
gb|EAZ17920.1|  hypothetical protein OsJ_33466                          128   1e-31   
gb|KHN05356.1|  Isoflavone-7-O-methyltransferase 9                      124   1e-31   
gb|EMT24461.1|  O-methyltransferase ZRP4                                128   1e-31   
ref|NP_001056039.1|  Os05g0515500                                       129   1e-31   
ref|NP_001056040.1|  Os05g0515600                                       129   1e-31   
ref|XP_008656430.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    129   1e-31   
gb|ABA98340.1|  O-methyltransferase ZRP4, putative, expressed           129   1e-31   
ref|XP_003571634.2|  PREDICTED: O-methyltransferase ZRP4-like           129   1e-31   
ref|XP_010052330.1|  PREDICTED: trans-resveratrol di-O-methyltran...    129   1e-31   
gb|KCW44789.1|  hypothetical protein EUGRSUZ_L01645                     128   1e-31   
ref|XP_004252468.1|  PREDICTED: trans-resveratrol di-O-methyltran...    128   1e-31   
gb|EMT13345.1|  O-methyltransferase ZRP4                                128   1e-31   
ref|XP_002461689.1|  hypothetical protein SORBIDRAFT_02g006640          123   2e-31   
gb|EAY82987.1|  hypothetical protein OsI_38209                          128   2e-31   
ref|XP_010260367.1|  PREDICTED: trans-resveratrol di-O-methyltran...    128   2e-31   
emb|CAN75971.1|  hypothetical protein VITISV_009882                     127   2e-31   
gb|AIB06955.1|  orcinol O-methyltransferase                             128   2e-31   
ref|XP_006448856.1|  hypothetical protein CICLE_v10015723mg             127   3e-31   
ref|XP_002441380.1|  hypothetical protein SORBIDRAFT_09g025570          127   3e-31   
ref|NP_001067566.1|  Os11g0235500                                       128   3e-31   
gb|EMS45261.1|  O-methyltransferase ZRP4                                125   3e-31   
ref|XP_003552574.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    127   3e-31   
ref|XP_004489528.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    127   3e-31   
dbj|BAK00281.1|  predicted protein                                      127   4e-31   
pdb|1ZGA|A  Chain A, Crystal Structure Of Isoflavanone 4'-o-methy...    127   4e-31   
pdb|1ZG3|A  Chain A, Crystal Structure Of The Isoflavanone 4'-o-m...    127   4e-31   
sp|Q29U70.1|I4OMT_MEDTR  RecName: Full=Isoflavone 4'-O-methyltran...    127   4e-31   
pdb|1ZGJ|A  Chain A, Crystal Structure Of Isoflavanone 4'-O-Methy...    127   4e-31   
ref|XP_006654645.1|  PREDICTED: O-methyltransferase ZRP4-like           127   4e-31   
ref|XP_010032853.1|  PREDICTED: trans-resveratrol di-O-methyltran...    127   5e-31   
ref|XP_003533873.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    127   5e-31   
ref|NP_001057265.1|  Os06g0240800                                       126   6e-31   
gb|EMS45262.1|  O-methyltransferase ZRP4                                127   6e-31   
ref|XP_008364163.1|  PREDICTED: trans-resveratrol di-O-methyltran...    127   6e-31   
ref|XP_010023968.1|  PREDICTED: trans-resveratrol di-O-methyltran...    127   6e-31   
gb|KHG15351.1|  8-hydroxyquercetin 8-O-methyltransferase                127   7e-31   
gb|ACG33694.1|  O-methyltransferase ZRP4                                127   7e-31   
ref|XP_002278092.1|  PREDICTED: trans-resveratrol di-O-methyltran...    126   7e-31   
emb|CDP00481.1|  unnamed protein product                                127   8e-31   
gb|KCW74499.1|  hypothetical protein EUGRSUZ_E03211                     126   1e-30   
ref|XP_002441372.1|  hypothetical protein SORBIDRAFT_09g025510          126   1e-30   
ref|XP_009351009.1|  PREDICTED: trans-resveratrol di-O-methyltran...    126   1e-30   
gb|EAY80452.1|  hypothetical protein OsI_35633                          126   1e-30   
ref|XP_004151089.1|  PREDICTED: trans-resveratrol di-O-methyltran...    124   1e-30   
ref|XP_010057348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    126   1e-30   
gb|KDO75191.1|  hypothetical protein CISIN_1g018205mg                   126   1e-30   
ref|XP_006468348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    126   1e-30   
gb|ACG33863.1|  O-methyltransferase ZRP4                                126   1e-30   
ref|XP_003574581.2|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    126   1e-30   
gb|EMT16388.1|  O-methyltransferase ZRP4                                126   1e-30   
ref|XP_003569832.1|  PREDICTED: LOW QUALITY PROTEIN: O-methyltran...    126   1e-30   
gb|EMS48795.1|  O-methyltransferase ZRP4                                125   1e-30   
ref|XP_006364318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    125   1e-30   
ref|XP_004970090.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    126   1e-30   
ref|XP_003568107.1|  PREDICTED: O-methyltransferase ZRP4-like           125   2e-30   
ref|XP_010040590.1|  PREDICTED: trans-resveratrol di-O-methyltran...    125   2e-30   
ref|XP_006446727.1|  hypothetical protein CICLE_v10015762mg             125   2e-30   
sp|O24305.1|M3OM1_PEA  RecName: Full=(+)-6a-hydroxymaackiain 3-O-...    125   2e-30   
gb|AAM97498.1|  O-methyltransferase                                     125   2e-30   
ref|XP_004979084.1|  PREDICTED: probable O-methyltransferase 2-like     125   2e-30   
ref|NP_001061464.1|  Os08g0290700                                       125   2e-30   
ref|NP_001120719.1|  TRIBOA-glucoside O-methyltransferase BX7           125   2e-30   
gb|EMS57229.1|  putative O-methyltransferase 2                          125   2e-30   
gb|EAZ42206.1|  hypothetical protein OsJ_26771                          125   2e-30   
gb|KCW45078.1|  hypothetical protein EUGRSUZ_L01321                     125   2e-30   
ref|XP_003621488.1|  Isoflavone-7-O-methyltransferase                   124   2e-30   
gb|EAY82990.1|  hypothetical protein OsI_38212                          125   2e-30   
gb|KCW74012.1|  hypothetical protein EUGRSUZ_E02637                     125   2e-30   
ref|XP_006587135.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    124   2e-30   
gb|EAZ06416.1|  hypothetical protein OsI_28646                          125   2e-30   



>emb|CBI21924.3| unnamed protein product [Vitis vinifera]
Length=187

 Score =   169 bits (429),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGLEG+KNL Y+ G+MF+ IPPA A+ LKWI+HDWND++CVKIL++C++AI S+EKGGKV
Sbjct  59   AGLEGSKNLNYLGGDMFKGIPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKV  118

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  Q GD+ES++ Q++ D+ MM+   GQER  KEW K+F DAGF+ YK T I 
Sbjct  119  IIIDMMME-NQKGDDESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGYKITPIL  177

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  178  GLRSLIEVYP  187



>ref|XP_002278190.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGLEG+KNL Y+AG+MF+AIPPA A+ LKWI+HDWN D+CVKILK+C++AI S+EKGGKV
Sbjct  229  AGLEGSKNLNYLAGDMFEAIPPADAILLKWILHDWNHDECVKILKRCRDAIPSKEKGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQI  358
            II+DM+++  Q  D+ESI+ Q++ D+ MM+   GQER +K+W K+F+DAGF+ YK T  +
Sbjct  289  IIIDMMME-NQKADDESIETQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSGYKITPML  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>emb|CAN79968.1| hypothetical protein VITISV_043678 [Vitis vinifera]
Length=357

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E GGKV
Sbjct  229  AGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+ +   GD++SI+ Q++ D+ MM++  G+ER   EW KIF DAGF+ YK T I 
Sbjct  289  IIIDMIM-MKNQGDDKSIETQLFFDMTMMIFSAGRERDENEWEKIFLDAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>emb|CAN73270.1| hypothetical protein VITISV_021918 [Vitis vinifera]
Length=328

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 107/131 (82%), Gaps = 3/131 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLK-WIMHDWNDDDCVKILKKCKEAISSREKGGK  178
            AGLEG+KNL Y+AG+MF+AIPPA A+ LK WI+HDWN D+CVKILK+C++AI S+EKGGK
Sbjct  199  AGLEGSKNLNYLAGDMFEAIPPADAILLKQWILHDWNHDECVKILKRCRDAIPSKEKGGK  258

Query  179  VIIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQ  355
            VII+DM+++  Q  D+ESI+ Q++ D+ MM+   GQER +K+W K+F+DAGF+ YK T  
Sbjct  259  VIIIDMMME-NQKADDESIETQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSGYKITPM  317

Query  356  IGTSSLIQLFP  388
            +G  SLI+++P
Sbjct  318  LGLRSLIEVYP  328



>ref|XP_011091734.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=337

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGLEGT+NL YV G+MF+ IPPA AV LKWI+HDW+D++CVKILK+CKEAI S EK GKV
Sbjct  209  AGLEGTRNLKYVEGDMFEYIPPADAVLLKWILHDWSDEECVKILKRCKEAIKSNEKRGKV  268

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQ-I  358
            +I++M++D  QN D +S++ Q++ D+ MM   GG+ER  KEW K+F+DAGFT+YK +  +
Sbjct  269  VIIEMVVD-DQNSDHKSVETQLFFDMLMMTVVGGKERNQKEWAKLFFDAGFTNYKISPLL  327

Query  359  GTSSLIQLFP  388
            G  S+I+++P
Sbjct  328  GIRSIIEVYP  337



>ref|XP_002278211.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   169 bits (427),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGLEG+KNL Y+ G+MF+ IPPA A+ LKWI+HDWND++CVKIL++C++AI S+EKGGKV
Sbjct  229  AGLEGSKNLNYLGGDMFKGIPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  Q GD+ES++ Q++ D+ MM+   GQER  KEW K+F DAGF+ YK T I 
Sbjct  289  IIIDMMME-NQKGDDESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera]
Length=357

 Score =   169 bits (427),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGLEG+KNL Y+ G+MF+ IPPA A+ LKWI+HDWND++CVKIL++C++AI S+EKGGKV
Sbjct  229  AGLEGSKNLNYLGGDMFKGIPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  Q GD+ES++ Q++ D+ MM+   GQER  KEW K+F DAGF+ YK T I 
Sbjct  289  IIIDMMME-NQKGDDESMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>gb|EYU30737.1| hypothetical protein MIMGU_mgv1a009866mg [Erythranthe guttata]
Length=329

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 105/131 (80%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREK-GGK  178
             GLEG+ NL +V G+MF+AIP   AVFLKWI+HDWND+DCVKILKKCK+AI  ++K GGK
Sbjct  199  VGLEGSNNLTFVGGDMFEAIPCGDAVFLKWILHDWNDEDCVKILKKCKDAIPDKDKGGGK  258

Query  179  VIIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQ  355
            +II+DM++++ +  D +++++Q++ D+ MM Y  G+ER+ KEWVK+F+DAGFT+YK T  
Sbjct  259  LIIIDMVMNIYEGDDNKAMEDQLFFDMAMMAYLNGKERSEKEWVKLFFDAGFTNYKITPA  318

Query  356  IGTSSLIQLFP  388
             G  SLI+++P
Sbjct  319  FGVRSLIEVYP  329



>ref|XP_009780941.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=363

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLEG KNL YV G+ F +IPPA A+ LKWI+HDW+D++ VKILKKCKEAI SREKGGKVI
Sbjct  236  GLEGNKNLNYVGGDFFVSIPPADALLLKWILHDWSDEESVKILKKCKEAIPSREKGGKVI  295

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            I+DM++D  + GD+ESI+ QI+ D+ MMV   G+ER+ K W K+F DAGF+DYK T I G
Sbjct  296  IIDMMVD-NKIGDDESIETQIFFDMLMMVLVTGRERSEKGWAKLFSDAGFSDYKVTPILG  354

Query  362  TSSLIQLFP  388
              SLI+++P
Sbjct  355  LRSLIEVYP  363



>emb|CBI21931.3| unnamed protein product [Vitis vinifera]
Length=278

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG++F+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E GGKV
Sbjct  150  AGLQGSKNLNYFAGDIFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKV  209

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+ +   GD +SI+ Q++ D+ MM++  G+ER   EW K+F DAGF+ YK T I 
Sbjct  210  IIIDMIM-MKNQGDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPIL  268

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  269  GLRSLIEVYP  278



>ref|XP_011091580.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGLEGT+NL YV G+MF+ IPPA AV LKWI+HDW+D++CV+ILK+CKEAI S EKGGKV
Sbjct  230  AGLEGTRNLKYVEGDMFEYIPPADAVLLKWILHDWSDEECVEILKRCKEAIKSNEKGGKV  289

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQ-I  358
            +I++M++D  QN D +S++ Q+  D+ MM   GG+ER  KEW K+F DAGFT+YK +  +
Sbjct  290  VIIEMVVD-DQNSDHKSVETQLLFDMLMMTVVGGKERNQKEWAKLFSDAGFTNYKISPLL  348

Query  359  GTSSLIQLFP  388
            G  S+I+++P
Sbjct  349  GIRSIIEVYP  358



>emb|CBI21929.3| unnamed protein product [Vitis vinifera]
Length=294

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG++F+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E GGKV
Sbjct  166  AGLQGSKNLNYFAGDIFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKV  225

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+   Q GD +SI+ Q++ D+ MM++  G+ER   EW K+F DAGF+ YK T I 
Sbjct  226  IIIDMIMMKNQ-GDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPIL  284

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  285  GLRSLIEVYP  294



>emb|CAN69556.1| hypothetical protein VITISV_027590 [Vitis vinifera]
Length=323

 Score =   165 bits (418),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG++F+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E GGKV
Sbjct  195  AGLQGSKNLNYFAGDIFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKV  254

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+ +   GD +SI+ Q++ D+ MM++  G+ER   EW K+F DAGF+ YK T I 
Sbjct  255  IIIDMIM-MKNQGDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPIL  313

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  314  GLRSLIEVYP  323



>ref|XP_006366298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=365

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLEG+ NL+YV G+ F ++PPA A+ LKWI+HDW+D++ VKILKKCKEAI S+EKGGKVI
Sbjct  238  GLEGSDNLSYVGGDFFVSVPPADALLLKWILHDWSDEESVKILKKCKEAIPSKEKGGKVI  297

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            I+DM++D  + GD+ESI+ QI+ D+ MMV   G+ER+ + W KIF++AGF+DYK T I G
Sbjct  298  IIDMMVD-NKIGDDESIETQIFFDMLMMVLVTGRERSERGWAKIFFEAGFSDYKVTPILG  356

Query  362  TSSLIQLFP  388
              SLI+++P
Sbjct  357  LRSLIEVYP  365



>gb|AEF97347.1| O-methyltransferase [Vitis pseudoreticulata]
Length=357

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E GGKV
Sbjct  229  AGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+ +   GD +S + Q++ D+ MM++  G+ER   EW K+F DAGF+ YK T I 
Sbjct  289  IIIDMIM-MKNQGDYKSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>ref|XP_003633248.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG++F+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E GGKV
Sbjct  229  AGLQGSKNLNYFAGDIFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+ +   GD +SI+ Q++ D+ MM++  G+ER   EW K+F DAGF+ YK T I 
Sbjct  289  IIIDMIM-MKNQGDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>ref|XP_009602136.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLE +KNL YV G+ F +IPPA A+ LKWI+HDW+D++ VKILKKCKEAI SREKGGKVI
Sbjct  234  GLEESKNLNYVGGDFFVSIPPADALLLKWILHDWSDEESVKILKKCKEAIPSREKGGKVI  293

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            I+DM++D  + GD+ESI+ QI+ D+ MMV   G+ER+ K W K+F DAGF+DYK T I G
Sbjct  294  IIDMMVD-NKIGDDESIETQIFFDMLMMVLVTGRERSEKGWAKLFLDAGFSDYKVTPILG  352

Query  362  TSSLIQLFP  388
              SLI+++P
Sbjct  353  LRSLIEVYP  361



>ref|XP_002281368.2| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E GGKV
Sbjct  229  AGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+ +   GD +S + Q++ D+ MM++  G+ER   EW K+F DAGF+ YK T I 
Sbjct  289  IIIDMIM-MKNQGDYKSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>ref|XP_003633249.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG++F+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E GGKV
Sbjct  229  AGLQGSKNLNYFAGDIFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+ +   GD +SI+ Q++ D+ MM++  G+ER   EW K+F DAGF+ YK T I 
Sbjct  289  IIIDMIM-MKNQGDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa chinensis]
Length=367

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  239  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKV  298

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I 
Sbjct  299  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  357

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  358  GLRSLIEVYP  367



>emb|CDP21551.1| unnamed protein product [Coffea canephora]
Length=269

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 103/130 (79%), Gaps = 3/130 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            G E +KNLAYV G+MF+AIPPA AV LKWI+HDW+D++CV+IL+KCKEAI S+EKGGKVI
Sbjct  138  GWESSKNLAYVGGDMFEAIPPADAVLLKWILHDWSDEECVQILRKCKEAIPSKEKGGKVI  197

Query  185  IVDMILDVTQNGDE--ESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            I+DM+L   QNGD+  E+I+ Q++ D+ MMV+  G+ER  K+W K+F +AGF  YK T +
Sbjct  198  IIDMLLKSQQNGDDDAEAIETQLFFDILMMVHAKGRERNEKDWEKLFLEAGFNGYKITPV  257

Query  359  -GTSSLIQLF  385
             G  S+I+++
Sbjct  258  LGLRSIIEVY  267



>ref|NP_001267963.1| O-methyltransferase [Vitis vinifera]
 gb|AEP17010.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF+AIPPA A+ LKWI+HDW+D++CVKILK+C+ AI S+EKGGKV
Sbjct  229  AGLQGSKNLNYFAGDMFEAIPPAVAILLKWILHDWSDEECVKILKRCRGAIPSKEKGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+ +   GD +SI+ Q++ D+ MM++  G+ER   EW K+F DAGF+ YK T I 
Sbjct  289  IIIDMIM-MKNQGDYKSIETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>emb|CAQ76879.1| resveratrol O-methyltransferase [Vitis vinifera]
Length=357

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E GGKV
Sbjct  229  AGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+ +   GD +S + Q++ D+ MM++  G+ER   EW K+F DAGF+ YK T I 
Sbjct  289  IIIDMIM-MKNQGDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>gb|AFX68805.1| O-metyltransferase [Vitis riparia]
Length=357

 Score =   164 bits (416),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E GGKV
Sbjct  229  AGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+ +   GD +SI+ Q++ D+ M ++  G+ER   EW K+F DAGF+ YK T I 
Sbjct  289  IIIDMIM-MKNQGDYKSIETQLFFDMTMTIFAPGRERDENEWEKLFLDAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>emb|CBI22005.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   163 bits (412),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF+AIPPA A+ LKWI+HDW++++CVKILK+C+EAI S+E GGKV
Sbjct  181  AGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSNEECVKILKRCREAIPSKENGGKV  240

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+   Q GD +S + Q++ D+ MM++  G+ER   EW K+F DAGF+ YK T I 
Sbjct  241  IIIDMIMMKNQ-GDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPIL  299

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  300  GLRSLIEVYP  309



>ref|XP_006376396.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
 gb|ERP54193.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
Length=359

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 103/130 (79%), Gaps = 4/130 (3%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSR--EKGGKV  181
            L+G KNL YVAG+MFQA+PPA+A+ LKW++H+W+D+DCVKILK+CK+AI S+  +K GKV
Sbjct  231  LQGCKNLKYVAGDMFQAVPPAEAILLKWMLHNWSDEDCVKILKRCKQAIMSKGQQKAGKV  290

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ +   NGDE SI+ Q++ DL MMV  GG ER  KEW K+F+DAGF +YK   + 
Sbjct  291  IIIDMVRE-NLNGDEGSIETQLFFDLQMMVVVGGMERNEKEWAKLFFDAGFLNYKIHPVL  349

Query  359  GTSSLIQLFP  388
            GT +LI+L+P
Sbjct  350  GTRALIELYP  359



>ref|XP_009594948.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=359

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLEG+  L+YV G+MF+++P A A+ LKWI+HDW+D+DCVKILKKCKEAI S+E GGKVI
Sbjct  232  GLEGSNKLSYVGGDMFKSVPSADAILLKWILHDWSDEDCVKILKKCKEAIPSKENGGKVI  291

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            I+D+++D +Q GD +S + Q++ D  MMV+  G+ER  +EWVK+F DAGF+DYK   I G
Sbjct  292  IIDIVVD-SQKGDNKSFETQLFSDTLMMVHVSGKERNREEWVKLFCDAGFSDYKIIPILG  350

Query  362  TSSLIQLFP  388
              SLI+++P
Sbjct  351  LRSLIEVYP  359



>ref|XP_006371493.1| hypothetical protein POPTR_0019s12280g [Populus trichocarpa]
 gb|ERP49290.1| hypothetical protein POPTR_0019s12280g [Populus trichocarpa]
Length=283

 Score =   162 bits (409),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 103/130 (79%), Gaps = 3/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G++NL YV G+MF+AIPPA  + LKWI+HDWND++CV+ILKKCKEAI  RE GGKV
Sbjct  156  ADLQGSENLKYVGGDMFEAIPPADGIVLKWILHDWNDEECVRILKKCKEAIKDRE-GGKV  214

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            +I+DM+++  Q G++ESI+ QI+ D+ MM+   GQER  KEW K+F DAGF+++K T I 
Sbjct  215  MIIDMMME-NQKGEDESIETQIFFDMLMMILVTGQERNEKEWAKLFSDAGFSNFKITPIL  273

Query  359  GTSSLIQLFP  388
            G  S+I++FP
Sbjct  274  GLRSIIEVFP  283



>ref|XP_009764108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=360

 Score =   164 bits (414),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 103/129 (80%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLEG+KNL+YV G+MF+++P A A+ LKWI+HDW+D+DCVKILKKCKEAI S+E  GKVI
Sbjct  233  GLEGSKNLSYVGGDMFKSVPSADAILLKWILHDWSDEDCVKILKKCKEAIPSKENRGKVI  292

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            I+D+++D +Q GD +S + Q++ D+ MMV+  G+ER  +EW K+F DAGF+DYK   I G
Sbjct  293  IIDIVVD-SQKGDNKSFETQLFSDILMMVHVSGKERNREEWAKLFCDAGFSDYKINPILG  351

Query  362  TSSLIQLFP  388
              S+I+++P
Sbjct  352  LRSVIEVYP  360



>ref|XP_011002662.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 103/130 (79%), Gaps = 3/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G++NL YV G+MF+AIPPA  + LKWI+HDWND++CVKILKKCKEAI  RE GGKV
Sbjct  230  ADLQGSENLKYVGGDMFEAIPPADGIVLKWILHDWNDEECVKILKKCKEAIKDRE-GGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            +I++M+++  Q G++ESI+ QI+ D+ MM+   GQER  KEW K+F DAGF++YK T I 
Sbjct  289  MIIEMMME-NQKGEDESIETQIFFDMLMMILFTGQERNEKEWAKLFSDAGFSNYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  S+I++FP
Sbjct  348  GLRSIIEVFP  357



>ref|XP_011002663.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 103/130 (79%), Gaps = 3/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G++NL YV G+MF+AIPPA  + LKWI+HDWND++CVKILKKCKEAI  RE GGKV
Sbjct  230  ADLQGSENLKYVGGDMFEAIPPADGIVLKWILHDWNDEECVKILKKCKEAIKDRE-GGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            +I++M+++  Q G++ESI+ QI+ D+ MM+   GQER  KEW K+F DAGF++YK T I 
Sbjct  289  MIIEMMME-NQKGEDESIETQIFFDMLMMILFTGQERNEKEWAKLFSDAGFSNYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  S+I++FP
Sbjct  348  GLRSIIEVFP  357



>sp|B6VJS4.2|ROMT_VITVI RecName: Full=Trans-resveratrol di-O-methyltransferase; AltName: 
Full=Resveratrol O-methyltransferase; Short=ROMT; Short=VvROMT 
[Vitis vinifera]
Length=357

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF+AIPPA A+ LKWI+HDW++++CVKILK+C+EAI S+E GGKV
Sbjct  229  AGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSNEECVKILKRCREAIPSKENGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+ +   GD +S + Q++ D+ MM++  G+ER   EW K+F DAGF+ YK T I 
Sbjct  289  IIIDMIM-MKNQGDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>ref|XP_006368013.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLEG  NL+Y+ G+MF+++P A A+ LKWI+HDW+D+DC KILKKCKEAI S+E GGKVI
Sbjct  226  GLEGGNNLSYITGDMFKSVPSADAILLKWILHDWSDEDCAKILKKCKEAIPSKENGGKVI  285

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            ++D ++D  Q GD++S + Q++LD+ MMV+  G+ER  +EW K+F DAGF+DYK + I G
Sbjct  286  VIDTVID-NQKGDDKSFETQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSDYKISPILG  344

Query  362  TSSLIQLFP  388
              S+I+++P
Sbjct  345  LRSVIEVYP  353



>gb|AAM23005.1|AF502434_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29459.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05078.1| orcinol O-methyltransferase 2 [Rosa chinensis]
 dbj|BAQ20440.1| 3,5-dimethoxytoluene [Rosa hybrid cultivar]
Length=366

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++C+KILK+ + AI+S++K GKV
Sbjct  238  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKV  297

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    GQER  KEW K+F DAGF+DYK T I 
Sbjct  298  IIIDMMME-NQKGDEESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPIL  356

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  357  GLRSLIEVYP  366



>emb|CDP15884.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AG EGT+NL +VAG+M + +P A A+ LKWI+HDW+D+DCVKILK CKEAI  REKGGKV
Sbjct  154  AGQEGTENLDFVAGDMLEKVPAADAILLKWILHDWSDEDCVKILKNCKEAIPGREKGGKV  213

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQ-I  358
            II+DMIL+ +Q  D+ES++ Q+ +++ M++ +G +ER+ KEW K+F DAGF+DYK    +
Sbjct  214  IIIDMILE-SQMKDDESVETQVGVNMQMLMGYGAKERSEKEWAKLFQDAGFSDYKALPLL  272

Query  359  GTSSLIQLFP  388
            G   LI+++P
Sbjct  273  GVCCLIEVYP  282



>gb|ABK96707.1| unknown [Populus trichocarpa x Populus deltoides]
Length=359

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 102/130 (78%), Gaps = 4/130 (3%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSR--EKGGKV  181
            L+G KNL +VAG+MFQA+PPA+A+ LKWI+H+W+D+DCVKILK+CK+AI S+  +K GKV
Sbjct  231  LQGCKNLKFVAGDMFQAVPPAEAILLKWILHNWSDEDCVKILKRCKQAIMSKGQQKAGKV  290

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ +   NGDE SI+ Q++ DL MMV  GG ER  KEW K+F+DAGF +YK   + 
Sbjct  291  IIIDMVRE-NLNGDEGSIETQLFFDLQMMVVAGGMERNEKEWAKLFFDAGFLNYKIYPVL  349

Query  359  GTSSLIQLFP  388
            G  +LI+L+P
Sbjct  350  GPRALIELYP  359



>ref|XP_006346268.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLEG  NL+Y+ G+MF+++P A A+ LKWI+HDW+D DC KILKKCKEAI S+E GGKVI
Sbjct  226  GLEGGNNLSYITGDMFKSVPSADAILLKWILHDWSDKDCAKILKKCKEAIPSKENGGKVI  285

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            ++D ++D  Q GD++S ++Q++LD+ MMV+  G+ER  +EW K+F DAGF+DYK + I G
Sbjct  286  VIDTVID-NQKGDDKSFESQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSDYKISPILG  344

Query  362  TSSLIQLFP  388
              S+I+++P
Sbjct  345  LRSVIEVYP  353



>ref|XP_004303127.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=367

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA AV LKWI+HDWND++CVKIL++ KEAI+ ++K GKV
Sbjct  239  ADLQGSKNLKYTGGDMFEAVPPADAVLLKWILHDWNDEECVKILERSKEAITGKDKKGKV  298

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  Q GDEES++ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I 
Sbjct  299  IIIDMMME-NQKGDEESMETQLFFDMLMMALVTGKERNEKEWSKLFTDAGFSDYKITPIL  357

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  358  GLRSLIEVYP  367



>ref|NP_001268044.1| trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 gb|AEP17011.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF+AIPPA A+ LKW +HDW+D++CVKILK+C+EAI S+E GGKV
Sbjct  229  AGLQGSKNLNYFAGDMFEAIPPADAILLKWTLHDWSDEECVKILKRCREAIPSKENGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+ +   GD +SI+ Q++ D+ MM++  G+ER   EW K+F  AGF+ YK T I 
Sbjct  289  IIIDMIM-MKNQGDYKSIETQLFFDMTMMIFAPGRERDENEWEKLFLGAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>ref|XP_011037436.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=227

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISS--REKGGKV  181
            L+G KNL YVAG+MFQA+PPA+A+ LK I+HDW+D+DCVKILK+CK+AI S   +K GKV
Sbjct  99   LQGCKNLKYVAGDMFQAVPPAEAILLKCILHDWSDEDCVKILKRCKQAIMSEGHQKAGKV  158

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ +  QNGDE SI+ Q+  DL MMV   G ER  KEW K+F+D+GF +YK   + 
Sbjct  159  IIIDMVRE-NQNGDERSIETQLVFDLAMMVAVSGMERNEKEWAKLFFDSGFLNYKIHTVP  217

Query  359  GTSSLIQLFP  388
            GT ++I+L+P
Sbjct  218  GTRAVIELYP  227



>gb|ABQ02270.2| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF AIPPA A+ LKWI+HDW++++CVKILK+C+EAI S+E GGKV
Sbjct  229  AGLQGSKNLNYFAGDMFGAIPPADAILLKWILHDWSNEECVKILKRCREAIPSKENGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+   Q GD +S + Q++ D+ MM++  G+ER   EW K+F DAGF+ YK T I 
Sbjct  289  IIIDMIMMKNQ-GDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>ref|XP_011085639.1| PREDICTED: chavicol O-methyltransferase-like [Sesamum indicum]
Length=361

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKG-GKV  181
            GLEGT NL+Y AGNMF+ IP A AVFLKWI+HDWND+DCVKILKKCKEAI+ ++ G  KV
Sbjct  233  GLEGTDNLSYAAGNMFETIPSADAVFLKWILHDWNDEDCVKILKKCKEAITGKDMGDTKV  292

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQ-I  358
            +I+DM+LD+    D+++++  ++ D+ MM Y  G+ER  KEW K+F+D+GFT YK T   
Sbjct  293  MIIDMVLDI-YGRDDKAVETHLFFDIAMMSYINGKERTEKEWAKLFFDSGFTSYKITNAF  351

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  352  GLRSLIEVYP  361



>emb|CDP17644.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   161 bits (408),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 103/132 (78%), Gaps = 5/132 (4%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            G E +KNLAYV G+MF+AIPP+ AV LKWI+HDW+D++CV+IL+KCKEAI S+EKGGKVI
Sbjct  214  GSESSKNLAYVGGDMFEAIPPSDAVLLKWILHDWSDEECVQILRKCKEAIPSKEKGGKVI  273

Query  185  IVDMILDVTQNGDE----ESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTT  352
            I+DM+L   QNGD+    E+I+ Q++ D+ MMV   G+ER  K+W K+F++AGF  YK T
Sbjct  274  IIDMLLKSRQNGDDDDNAEAIETQLFFDMLMMVLVKGRERNEKDWAKLFFEAGFNGYKIT  333

Query  353  QI-GTSSLIQLF  385
             + G  S+I+++
Sbjct  334  PVLGLRSIIEVY  345



>ref|XP_007142076.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
 gb|ESW14070.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
Length=357

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            +GL+G++NL YV G+MF+AIPPA A+ LKWI+HDW+D++CVKILKKCKEAIS + K GKV
Sbjct  229  SGLQGSENLKYVGGDMFEAIPPADAILLKWILHDWSDEECVKILKKCKEAISRKGKEGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM++D  +  D+ES + Q++ DL MMV   G+ER  KEWVK+   AGF +YK T + 
Sbjct  289  IIIDMVVD-KEMKDDESFETQLFFDLMMMVLFNGKERNKKEWVKLISSAGFNNYKITPVM  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GIRSLIEIYP  357



>emb|CBI21926.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+ +KNL Y AG+MF+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E GGKV
Sbjct  169  AGLQESKNLNYFAGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKV  228

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+   Q GD +S++ Q+Y D+ MM+   G+ER   EW K+F DAGF+ YK T I 
Sbjct  229  IIIDMIMMKNQ-GDYKSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHYKITPIL  287

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  288  GLRSLIEVYP  297



>emb|CAN78992.1| hypothetical protein VITISV_005827 [Vitis vinifera]
Length=357

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+ +KNL Y AG+MF+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E GGKV
Sbjct  229  AGLQESKNLNYFAGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+ +   GD +S++ Q+Y D+ MM+   G+ER   EW K+F DAGF+ YK T I 
Sbjct  289  IIIDMIM-MKNQGDYKSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>ref|XP_002278294.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+ +KNL Y AG+MF+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E GGKV
Sbjct  229  AGLQESKNLNYFAGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMI+ +   GD +S++ Q+Y D+ MM+   G+ER   EW K+F DAGF+ YK T I 
Sbjct  289  IIIDMIM-MKNQGDYKSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>emb|CDP15888.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 102/130 (78%), Gaps = 3/130 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            G E +KNLAYV G+MF+AIPPA AV LKWI+HDW+D++CV+IL+KCKEAI S EKGGKVI
Sbjct  231  GWESSKNLAYVGGDMFEAIPPADAVLLKWILHDWSDEECVQILRKCKEAIPSMEKGGKVI  290

Query  185  IVDMILDVTQNGDE--ESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            I+DM+L   QNGD+  E+I+ Q++ D+ MMV+  G+ER  K+W K+F +AGF  YK T +
Sbjct  291  IIDMLLKSQQNGDDDAEAIETQLFFDMLMMVHVKGRERNEKDWEKLFLEAGFNGYKITPV  350

Query  359  -GTSSLIQLF  385
             G  S+I+++
Sbjct  351  LGLRSIIEVY  360



>ref|XP_011070200.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=458

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGLEGT+NL YV G+MF+ IPPA AV LKW++HDWND++CV+ILK+CKEAI S EK GKV
Sbjct  330  AGLEGTRNLKYVEGDMFEYIPPADAVLLKWLLHDWNDEECVEILKRCKEAIKSNEKRGKV  389

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQ-I  358
            +I++M++D  QN D +S++ Q++ D  +M    G+ER+ KEW K+F+DAGF++YK +  +
Sbjct  390  VIIEMVVD-DQNSDHKSVETQLFFDTLVMTIADGRERSQKEWAKLFFDAGFSNYKISPLL  448

Query  359  GTSSLIQLFP  388
            G  S+I+++P
Sbjct  449  GLRSIIEVYP  458



>gb|KHN19130.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=246

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            +GL+G++NL YVAG+MF+AIPPA A+ LKWI+HDWND++CV ILKKCKEAI+ + K GKV
Sbjct  118  SGLKGSENLKYVAGDMFEAIPPADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKV  177

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  +  D+ES++ Q++ D+ MMV   G+ER+ KEW K+   AG+ +YK T + 
Sbjct  178  IIIDMVVE-DEKRDDESVETQLFFDMQMMVLVTGKERSKKEWTKLISSAGYNNYKITPVL  236

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  237  GLRSLIEIYP  246



>ref|XP_004248183.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=362

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLEG+ NL YV G+ F +IP A+A+ LKWI+HDW+D++ VKILKKCKEAI S+EKGGKVI
Sbjct  235  GLEGSDNLTYVGGDFFVSIPHAEALLLKWILHDWSDEESVKILKKCKEAIPSKEKGGKVI  294

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            I+DM++D  + GD+ESI+ QI+ D+ MMV   G+ER+ + W KIF +AGF+DYK T I G
Sbjct  295  IIDMMVD-NKIGDDESIETQIFFDMLMMVLVTGRERSERGWAKIFSEAGFSDYKVTPILG  353

Query  362  TSSLIQLFP  388
              SLI+++P
Sbjct  354  LRSLIEVYP  362



>gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29458.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05077.1| orcinol O-methyltransferase 1 [Rosa chinensis]
Length=367

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDW+D++C+KIL++ + AI+ +EK GKV
Sbjct  239  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKV  298

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I 
Sbjct  299  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIS  357

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  358  GLRSLIEVYP  367



>emb|CDP19709.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AG EGT+NL +VAG+M + +P A A+ LKWI+HDW+DDDCVKILK CKEAI  R+KGGKV
Sbjct  220  AGQEGTENLDFVAGDMLEKVPAADAILLKWILHDWSDDDCVKILKNCKEAIPGRDKGGKV  279

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DMIL+ +   D+ES++ Q  +D+ M+  +G +ER  KEW K+F DAGF+DYK   + 
Sbjct  280  IIIDMILE-SHMKDDESVETQFVVDMQMLTCYGAKERTEKEWAKVFQDAGFSDYKVLPVL  338

Query  359  GTSSLIQLFP  388
            G   LI+++P
Sbjct  339  GVRCLIEVYP  348



>ref|XP_007142043.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
 gb|ESW14037.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
Length=357

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            +GL+G++NL YV G+MF+AIPPA A+ LKWI+HDW+D++CV ILKKCKEA+S + K GKV
Sbjct  229  SGLQGSENLKYVGGDMFEAIPPADAILLKWILHDWSDEECVNILKKCKEALSRKGKEGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQ-I  358
            II+DM++D  +  D+ES + Q++ D+ MMV   G+ER  KEWVK+F  AGF +YK T  +
Sbjct  289  IIIDMVVD-KEMKDDESFETQLFFDILMMVLLTGKERNKKEWVKLFSSAGFNNYKITPFV  347

Query  359  GTSSLIQLFP  388
            G+ SLI+++P
Sbjct  348  GSRSLIEIYP  357



>emb|CAJ65638.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+CKEAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRCKEAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DMI++  Q  DEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMIME-NQKVDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CBI21927.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 104/131 (79%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y+AG+MF+AIPPA A+ LKWI+HDW+D++C+KIL++C+ AI S+EKGGKV
Sbjct  147  ADLQGSKNLTYLAGDMFEAIPPADAILLKWILHDWSDEECLKILEQCRGAIPSKEKGGKV  206

Query  182  IIVDM-ILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            +I+DM IL+   + DE  ++ Q+++D+ MMV + G+ER  KEW K+F D+GF+ YK T I
Sbjct  207  MIIDMAILNKKGDEDESKVETQLFMDMLMMVLYPGREREEKEWKKLFLDSGFSGYKITPI  266

Query  359  -GTSSLIQLFP  388
             G  SLI+++P
Sbjct  267  LGLRSLIEVYP  277



>emb|CAJ65639.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+CKEAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRCKEAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DMI++  Q  DEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMIME-NQKVDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_006388574.1| hypothetical protein POPTR_0151s00220g [Populus trichocarpa]
 gb|ERP47488.1| hypothetical protein POPTR_0151s00220g [Populus trichocarpa]
Length=326

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 101/130 (78%), Gaps = 4/130 (3%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSR--EKGGKV  181
            L+G KNL +V G+MF+A+PPA A+ LKWI+HDW+D+DCVKILK+CK+AI+S+  +K GKV
Sbjct  198  LQGGKNLKHVGGDMFEAVPPADALLLKWILHDWSDEDCVKILKRCKQAITSKGQQKVGKV  257

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ +  QNGDE SI+ Q+  DL MMV   G ER  KEW K+F+DAGF +YK   + 
Sbjct  258  IIIDMVRE-NQNGDEGSIETQLLFDLQMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVL  316

Query  359  GTSSLIQLFP  388
            GT +LI+L+P
Sbjct  317  GTRALIELYP  326



>emb|CAH05084.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 95/119 (80%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+AIPPA  V LKWI+HDWND++CVKILK+ + AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAIPPANTVLLKWILHDWNDEECVKILKRSRVAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++LD+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65603.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 95/119 (80%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA AV LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65607.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+SR+K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSRDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65602.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 95/119 (80%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA AV LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65609.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 95/119 (80%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA AV LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_007142077.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
 gb|ESW14071.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
Length=357

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            +GL+G++NL YV G+MF+AIPPA A+ LKWI+HDW+D+D V ILKKCKEA+S + K GKV
Sbjct  229  SGLQGSENLKYVGGDMFEAIPPADAILLKWILHDWSDEDSVNILKKCKEALSRKGKEGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQ-I  358
            II+DM++D  +  D+ES + Q++ D+ MMV+  G+ER  KEWVK+F  AGF +YK T  +
Sbjct  289  IIIDMVVD-KEMKDDESFETQLFFDMLMMVFFTGKERNKKEWVKLFSSAGFNNYKITPVV  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEIYP  357



>gb|KHN08846.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=263

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            +GL+G++NL YVAG+MF+AIPPA A+ LKWI+HDWND++CV ILKKCKEAI+ + K GKV
Sbjct  135  SGLKGSENLKYVAGDMFEAIPPADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKV  194

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  +  D+ES++ Q++ D+ MMV   G+ER+ KEW K+   AG+ +YK T + 
Sbjct  195  IIIDMVVE-DEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVL  253

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  254  GLRSLIEIYP  263



>emb|CAJ65601.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ANLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65661.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   158 bits (400),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CDP21787.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLE +KNLAYV GNMF+AIPPA AV +KWI+ DW+DD+CV+ILKKCKEA  S+EKGGKVI
Sbjct  234  GLESSKNLAYVGGNMFEAIPPADAVLMKWILIDWSDDECVQILKKCKEAFPSKEKGGKVI  293

Query  185  IVDMILDVTQNGDE--ESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            IVDM     Q GD+  E+I+ Q++ D+ +MV   G++R  K+W K+F +AGF+DYK T +
Sbjct  294  IVDMFCKSLQKGDDDHETIETQLFFDMEVMVLLKGRQRNEKDWAKLFTEAGFSDYKITAV  353

Query  359  -GTSSLIQLF  385
             G  S+I+++
Sbjct  354  LGLRSIIEVY  363



>ref|XP_011002666.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 102/130 (78%), Gaps = 3/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G++NL YV G+MF+AIPPA  + LKWI+HDWND++CVKILKKCKEAI  RE GGKV
Sbjct  230  ADLQGSENLKYVGGDMFEAIPPADGIVLKWILHDWNDEECVKILKKCKEAIKDRE-GGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            +I++M+++  Q G+++SI+ QI+ D+ MM+   GQER  KEW K+F DA F++YK T I 
Sbjct  289  MIIEMMME-NQKGEDDSIETQIFFDMLMMILVTGQERNEKEWAKLFSDASFSNYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  S+I++FP
Sbjct  348  GLRSIIEVFP  357



>emb|CAH05080.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALLTGKERNKKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65665.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKSGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>gb|KHN08844.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=329

 Score =   157 bits (398),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            +GL+G++NL YVAG+MF+AIPPA A+ LKWI+HDWND++CV ILKKCKEAI+ + K GKV
Sbjct  201  SGLKGSENLKYVAGDMFEAIPPADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKV  260

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  +  D+ES++ Q++ D+ MMV   G+ER+ KEW K+   AG+ +YK T + 
Sbjct  261  IIIDMVVE-NEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVL  319

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  320  GLRSLIEIYP  329



>emb|CAH05081.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAJ65644.1| putative orcinol O-methyltransferase [Rosa phoenicia]
Length=346

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALLTGKERNKKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65622.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65635.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+AIPPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05090.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+AIPPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05087.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+AIPPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65621.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05083.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKIL++ KEAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILQRSKEAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DMI+   Q GDEESI+ Q++ D+ MMV   G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMIMG-NQKGDEESIEMQLFFDMLMMVLLKGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65628.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+AIPPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65632.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
 emb|CAJ65658.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+AIPPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65610.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65648.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGRERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65606.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_011091578.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=360

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGLEGT+NL YV G+MF+ IPP+ AV  KWI+HDW+D+ CV+ILKKCKEA++  EK GKV
Sbjct  232  AGLEGTRNLKYVEGDMFEFIPPSDAVLCKWILHDWSDEKCVQILKKCKEAVTRDEKKGKV  291

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQI  358
            II+DM++D  Q  D +S++ +++ D+ MM   GG+ER  KEW K+F DAGF+DY+ ++ +
Sbjct  292  IIIDMVID-DQKCDHKSVETKLFFDMLMMTIVGGRERNEKEWAKLFSDAGFSDYRISSLL  350

Query  359  GTSSLIQLFP  388
            G  S+I+++P
Sbjct  351  GLRSIIEVYP  360



>emb|CAJ65641.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65608.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A PPA AV LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAAPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65640.1| putative orcinol O-methyltransferase [Rosa majalis]
 emb|CAJ65650.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65651.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65652.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65653.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65654.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65597.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+ ++K GKV
Sbjct  228  ANLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    GQER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65605.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>gb|ACU19152.1| unknown [Glycine max]
Length=282

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            +GL+G++NL YV+G+MF+AIPPA A+ LKWI+HDWND++CV ILKKCKEAI+ + K GKV
Sbjct  154  SGLKGSENLKYVSGDMFEAIPPAYAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKV  213

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  +  D+ES++ Q++ D+ MMV   G+ER+ KEW K+   AG+ +YK T + 
Sbjct  214  IIIDMVVE-NEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVF  272

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  273  GLRSLIEIYP  282



>ref|XP_003615966.1| O-methyltransferase [Medicago truncatula]
 gb|AES98924.1| orcinol O-methyltransferase [Medicago truncatula]
Length=360

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GL+G++NL YV G+MF+ IPP  A+ LKWI+HDWND++CVKILK CK+AIS + K GKVI
Sbjct  232  GLQGSENLNYVGGDMFKEIPPTDAILLKWILHDWNDEECVKILKNCKDAISKKGKQGKVI  291

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            ++DM+L+  +    ES++ Q++ D+ MMV   G+ER  KEW+K+   AGF+DYK T I G
Sbjct  292  VIDMVLESEKESINESVETQLFFDMLMMVVLAGKERNKKEWIKLISSAGFSDYKITPILG  351

Query  362  TSSLIQLFP  388
              SLI+++P
Sbjct  352  LRSLIEIYP  360



>ref|XP_002278316.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 104/131 (79%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y+AG+MF+AIPPA A+ LKWI+HDW+D++C+KIL++C+ AI S+EKGGKV
Sbjct  229  ADLQGSKNLTYLAGDMFEAIPPADAILLKWILHDWSDEECLKILEQCRGAIPSKEKGGKV  288

Query  182  IIVDM-ILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            +I+DM IL+   + DE  ++ Q+++D+ MMV + G+ER  KEW K+F D+GF+ YK T I
Sbjct  289  MIIDMAILNKKGDEDESKVETQLFMDMLMMVLYPGREREEKEWKKLFLDSGFSGYKITPI  348

Query  359  -GTSSLIQLFP  388
             G  SLI+++P
Sbjct  349  LGLRSLIEVYP  359



>emb|CAJ65623.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S+ K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKAKNGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_003544912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
Length=358

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            +GL+G++NL YVAG+MF+AIPPA A+ LKWI+HDWND++CV ILKKCKEAI+ + K GKV
Sbjct  230  SGLKGSENLKYVAGDMFEAIPPADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKV  289

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  +  D+ES++ Q++ D+ MMV   G+ER+ KEW K+   AG+ +YK T + 
Sbjct  290  IIIDMVVE-NEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVL  348

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  349  GLRSLIEIYP  358



>ref|XP_006376388.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54185.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=365

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 100/129 (78%), Gaps = 4/129 (3%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSR--EKGGKV  181
            L+G KNL YV G+MFQA+PPA+A+ LKWI+HDW+D+DCVKIL++C++AI S+  +K GKV
Sbjct  237  LQGCKNLKYVGGDMFQAVPPAEAILLKWILHDWSDEDCVKILRRCRQAIMSKGQQKAGKV  296

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ +   NGDE SI+ Q++ DL MMV   G ER  KEW K+F+DAGF +YK   + 
Sbjct  297  IIIDMVRE-NLNGDEGSIETQLFFDLLMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVL  355

Query  359  GTSSLIQLF  385
            GT +LI+L+
Sbjct  356  GTRALIELY  364



>emb|CAJ65630.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G++NL Y  G+MF+AIPPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSRNLKYTGGDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65633.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVII  187
            L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++C+KILK+ + AI+S++K GKVII
Sbjct  230  LQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVII  289

Query  188  VDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            +DM+++  Q GDEESI+ Q++LD+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  290  IDMMME-NQKGDEESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_006376381.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54178.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSR--EKGGKV  181
            L+G KNL YV G+MF+A+PPA A+ LKWI+HDW+D+DCVKILK+CK+AI+S+  +K GKV
Sbjct  231  LQGGKNLKYVGGDMFEAVPPADALLLKWILHDWSDEDCVKILKRCKQAIASKGQQKVGKV  290

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ +  QN DE SI+ Q+  DL MMV   G ER  KEW K+F+DAGF +YK   + 
Sbjct  291  IIIDMVRE-NQNRDEGSIETQLLFDLEMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVL  349

Query  359  GTSSLIQLFP  388
            GT +LI+L+P
Sbjct  350  GTRALIELYP  359



>emb|CDP15886.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 100/130 (77%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AG EGT+NL +VAG+M + +P A A+ LKWI+HDW+D+DCVKILK CKEAI  R+KGGKV
Sbjct  220  AGQEGTENLDFVAGDMLEKVPAADAILLKWILHDWSDEDCVKILKNCKEAIPGRDKGGKV  279

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKT-TQI  358
            II+DMIL+ +Q  D++S++ Q+ +D+ M++ +G +ER  KEW K+F DAGF+DYK    +
Sbjct  280  IIIDMILE-SQVKDDDSVETQVGVDMQMLMCYGAKERTEKEWAKLFQDAGFSDYKILPAL  338

Query  359  GTSSLIQLFP  388
            G   LI ++P
Sbjct  339  GVCCLIAVYP  348



>emb|CAD29556.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVII  187
            L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++C+KILK+ + AI+S++K GKVII
Sbjct  231  LQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVII  290

Query  188  VDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            +DM+++  Q GDEESI+ Q++LD+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  291  IDMMME-NQKGDEESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  346



>emb|CAJ65664.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVII  187
            L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++C+KILK+ + AI+S++K GKVII
Sbjct  230  LQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVII  289

Query  188  VDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            +DM+++  Q GDEESI+ Q++LD+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  290  IDMMME-NQKGDEESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65634.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVII  187
            L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++C+KILK+ + AI+S++K GKVII
Sbjct  230  LQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVII  289

Query  188  VDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            +DM+++  Q GDEESI+ Q++LD+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  290  IDMMME-NQKGDEESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65663.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+AIPPA  V LKWI+HDWND++CVKILK+ +EAI+S +K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSEDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_006376386.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 ref|XP_006376390.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54183.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 gb|ERP54187.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 101/132 (77%), Gaps = 4/132 (3%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISS--REKGG  175
            + L+G+KNL YV G+MF+A+PPA A+ LKWI+HDW+D+DCVKIL++CK+AI S  ++K G
Sbjct  229  SDLQGSKNLKYVGGDMFEAVPPADAILLKWILHDWSDEDCVKILRRCKQAIMSTGQQKAG  288

Query  176  KVIIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQ  355
            KVII+DM+ +   NGDE SI+ Q+  DL +MV   G ER  KEW K+F+DAGF +YK   
Sbjct  289  KVIIIDMVRE-NLNGDEGSIETQLLFDLQLMVGFSGMERNEKEWAKLFFDAGFLNYKIHP  347

Query  356  I-GTSSLIQLFP  388
            + GT +LI+L+P
Sbjct  348  VLGTRALIELYP  359



>emb|CAJ65618.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+ ++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQIG  361
            II+DM+++  Q G+EESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I 
Sbjct  288  IIIDMMME-NQKGEEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIS  346



>emb|CAH05082.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM ++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMTME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_002278398.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 emb|CBI21930.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 102/131 (78%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L G+KNL Y+AG++F+AIPPA A+ LKWI+HDW+D++C+KILK+C+EAI S+EKGGKV
Sbjct  228  ADLRGSKNLTYLAGDLFEAIPPADAILLKWILHDWSDEECLKILKQCREAIPSKEKGGKV  287

Query  182  IIVDMILDVTQNGDEES-IQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            +I+DM +   +  D+ES ++ Q++ D+ MMV   G+ER  KEW K+F D+GF+ YK T I
Sbjct  288  MIIDMAIQNKKGDDDESNVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFSGYKITPI  347

Query  359  -GTSSLIQLFP  388
             G  SLI+++P
Sbjct  348  LGLRSLIEVYP  358



>emb|CDP21583.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 101/130 (78%), Gaps = 4/130 (3%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLE +KNLAYV G+MF+AIPPA  V LKWI+HDW+D++CV+IL+KCKEAI S+EKGGKVI
Sbjct  177  GLE-SKNLAYVGGDMFEAIPPADTVLLKWILHDWSDEECVQILRKCKEAIPSKEKGGKVI  235

Query  185  IVDMILDVTQNGDE--ESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQ  355
            I+D++L   Q GD+  E+I+ Q+  D+ MMV   G+ER  K+W K+F+ AGF DYK T  
Sbjct  236  IIDILLKSQQKGDDDHEAIETQLLFDMLMMVLLKGRERNEKDWAKLFFGAGFNDYKITAA  295

Query  356  IGTSSLIQLF  385
            +G  S+I+++
Sbjct  296  LGLRSIIEVY  305



>emb|CAJ65656.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVII  187
            L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++C+K+LK+ + AI+S++K GKVII
Sbjct  230  LQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECIKVLKRSRVAITSKDKKGKVII  289

Query  188  VDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            +DM+++  Q GDEESI+ Q++LD+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  290  IDMMME-NQKGDEESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65598.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+ ++K GKV
Sbjct  228  ANLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65626.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G++NL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSRNLKYTGGDMFEAVPPAGTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65642.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+ +  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMRE-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_003544914.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Glycine max]
Length=358

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            +GL+G++NL YVAG+MF+AIPPA A+ LKWI+HDWND +CV ILKKCKEAI+ + K GKV
Sbjct  230  SGLKGSENLKYVAGDMFEAIPPADAILLKWILHDWNDKECVDILKKCKEAITRKGKEGKV  289

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  +  D+ES++ Q++ D+ MMV   G+ER+ KEW K+   AG+ +YK T + 
Sbjct  290  IIIDMVVE-NEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVL  348

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  349  GLRSLIEIYP  358



>emb|CAH05086.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND +C+KILK+ + AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_003557042.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Glycine 
max]
Length=358

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            +GL+G++NL YV+G+MF+AIPPA A+ LKWI+HDWND++CV ILKKCKEAI+ + K GKV
Sbjct  230  SGLKGSENLKYVSGDMFEAIPPADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKV  289

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  +  D+ES++ Q++ D+ MMV   G+ER+ KEW K+   AG+ +YK T + 
Sbjct  290  IIIDMVVE-NEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVF  348

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  349  GLRSLIEIYP  358



>ref|XP_008229109.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 100/130 (77%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL YVAG+MF A+P A A+FLKWI+HDW+D++CVKIL++CKEAI+   K GKV
Sbjct  226  ADLKGSKNLEYVAGDMFDAVPAADAIFLKWILHDWSDEECVKILERCKEAITREGKKGKV  285

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQI  358
            IIVDM ++  +N D+ES + Q++ D+ MMV   G+ER  KEW K+F DAGF+ YK T  +
Sbjct  286  IIVDMTVE-DKNTDKESGETQLFFDMEMMVLATGKERNEKEWAKLFSDAGFSHYKITPSL  344

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  345  GLRSLIEVYP  354



>emb|CAJ65636.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND +C+KILK+ + AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65647.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWN+++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNNEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMTLVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65612.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+ +PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFETVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05085.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND +C+KILK+ + AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65660.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++C+KILK+ + AI+S++K GKV
Sbjct  227  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKV  286

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    GQER  KEW K+F DAGF+DYK T I
Sbjct  287  IIIDMMME-NQKGDEESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPI  344



>emb|CAJ65627.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND +C+KILK+ + AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65659.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND +C+KILK+ + AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>gb|AAB71213.1| methyltransferase [Prunus armeniaca]
Length=354

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL YVAG+MF+A+P A A+FLKWI+HDW+D++CVKIL++CK A++   K GKV
Sbjct  226  ADLKGSKNLEYVAGDMFEAVPAADAIFLKWILHDWSDEECVKILERCKAAVTREGKKGKV  285

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            IIV+M ++  +N D+ES + Q++ D+HMMV   G+ER  KEW K+F DAGF+ YK T + 
Sbjct  286  IIVEMTVE-NKNTDKESGETQLFFDMHMMVMSTGKERNEKEWAKLFSDAGFSQYKITPLF  344

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  345  GFKSLIEVYP  354



>emb|CAD29555.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND +C+KILK+ + AI+S++K GKV
Sbjct  229  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  289  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  346



>emb|CAJ65614.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y+ G+MF+A+PPA  V LKWI+HDWND++C+KIL++ + AI+ +EK GKV
Sbjct  228  ADLQGSKNLKYIGGDMFEAVPPADTVLLKWILHDWNDEECIKILERSRVAITGKEKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQIG  361
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I 
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIS  346



>ref|XP_006469135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=402

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 97/130 (75%), Gaps = 3/130 (2%)
 Frame = +2

Query  5    GLEG-TKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            GLE    NL Y+ G+MF+AIPPA AV  KWI+HDWND++CVKILKKCKEAI+S  K GKV
Sbjct  274  GLESDLANLKYIGGDMFEAIPPADAVLFKWILHDWNDEECVKILKKCKEAITSDGKKGKV  333

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ +  + GD ESI+ Q++ D+ MMV   G ER  KEW K+F DAGF+DYK T I 
Sbjct  334  IIIDMMRE-NKKGDSESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITPIL  392

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  393  GLRSLIEVYP  402



>emb|CAJ65611.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EA +S+ K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREATTSKAKNGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65657.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++C+KILK+ + AI+S++K GKV
Sbjct  227  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKV  286

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    GQER  KEW K+F DAGF+DYK T I
Sbjct  287  IIIDMMME-NQKGDEESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPI  344



>emb|CAJ65625.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G++NL Y  G+MF+A+PPA  V LKWI HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSRNLKYTGGDMFEAVPPADTVLLKWISHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65624.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+ NL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSTNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65615.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y+ G+MF+A+PPA  V LKWI+HDWND++C+KIL++ + AI+ +EK GKV
Sbjct  228  ADLQGSKNLKYIGGDMFEAVPPADTVLLKWILHDWNDEECIKILERSRVAITGKEKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05079.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAG +DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGLSDYKITPI  345



>emb|CAJ65620.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+ ++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65613.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
 emb|CAJ65619.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+ ++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAH05088.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND +C+KILK+ + AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTRGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_004235335.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=445

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLEG KNL Y+AG+MF+ +P A A+ LKWI+HDW+D DCVKILKKCKEAI S+E GGKVI
Sbjct  318  GLEGGKNLTYIAGDMFKFVPSADAILLKWILHDWSDKDCVKILKKCKEAIPSKENGGKVI  377

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            ++D+++D  Q  D +S + Q++ D+ MMV+  G+ER  +EW K+F +AGF+DYK + I G
Sbjct  378  VIDIVID-NQKRDNKSFETQLFSDVLMMVHVSGKERNEQEWAKLFSNAGFSDYKISPILG  436

Query  362  TSSLIQLFP  388
              S+I+++P
Sbjct  437  LRSVIEVYP  445



>emb|CAJ65662.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   155 bits (392),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V L+WI+HDWND +C+KILK+ + AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLRWILHDWNDQECIKILKRSRVAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGRERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_002278517.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 102/131 (78%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G K+L Y+AG+MF+AIPPA A+ LKWI+HDW+D++C+KILK+C+EAI S+EKGGKV
Sbjct  229  ADLQGGKSLTYLAGDMFEAIPPADAILLKWILHDWSDEECLKILKQCREAIPSKEKGGKV  288

Query  182  IIVDMILDVTQNGDEES-IQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            +I+DM +   +  D+ES ++ Q++ D+ MMV   G+ER  KEW K+F D+GF+ YK T I
Sbjct  289  MIIDMAIQNKKGDDDESNVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFSGYKITPI  348

Query  359  -GTSSLIQLFP  388
             G  SLI+++P
Sbjct  349  LGLRSLIEVYP  359



>gb|KDP24057.1| hypothetical protein JCGZ_25714 [Jatropha curcas]
Length=307

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+   NL +V G+MF+ IPPA A+ LKWI+HDW+D++C+KILKKCKEAI  R KGGK+
Sbjct  180  AGLQDGNNLKFVGGSMFEEIPPADAILLKWILHDWSDEECIKILKKCKEAIKGR-KGGKL  238

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTT-QI  358
            IIVDM++  TQ  + +SI+ Q++ D+ MMV   G+ER  +EW K+F DAGF+DYK T ++
Sbjct  239  IIVDMVMG-TQKQNNDSIETQLFFDMMMMVLFNGKERNKEEWAKLFSDAGFSDYKITHKL  297

Query  359  GTSSLIQLFP  388
            G  S+I+++P
Sbjct  298  GLRSVIEVYP  307



>ref|XP_006446726.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
 gb|ESR59966.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
Length=362

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 97/130 (75%), Gaps = 3/130 (2%)
 Frame = +2

Query  5    GLEG-TKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            GLE    NL YV G+MF+AIPPA AV LKWI+HDWND++CVKILKKCKEAI+S  K GKV
Sbjct  234  GLESDLANLKYVGGDMFEAIPPADAVVLKWILHDWNDEECVKILKKCKEAITSDGKKGKV  293

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ +  + G++ES + Q++ D+ MMV   G ER  KEW K+F DAGF+DYK T I 
Sbjct  294  IIIDMMRE-NKKGNDESTETQLFFDMLMMVLATGTERDEKEWAKLFADAGFSDYKITSIL  352

Query  359  GTSSLIQLFP  388
            G  SLI++ P
Sbjct  353  GLRSLIEVCP  362



>emb|CAJ65604.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ + AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSRGAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65596.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=345

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++C+KILK+ + AI+S++K GKV
Sbjct  227  ANLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKV  286

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q + D+ MM    GQER  KEW K+F DAGF+DYK T I
Sbjct  287  IIIDMMME-NQKGDEESIETQPFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPI  344



>emb|CAJ65646.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++C+KILK+ + AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKVTPI  345



>ref|XP_008229108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=355

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL YVAG+MF+A+P A A+FLKWI+HDW+D++CVKIL++CKEAI+   K GKV
Sbjct  227  ADLKGSKNLEYVAGDMFEAVPEADAIFLKWILHDWSDEECVKILERCKEAITREGKKGKV  286

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQ-I  358
            IIVDM ++  +N D+ES + Q++ D+ MMV   G+ER  KEW K+F DAGF+ YK T  +
Sbjct  287  IIVDMTVE-NKNTDKESGETQLFFDMLMMVLVKGKERNEKEWAKLFSDAGFSHYKITPCL  345

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  346  GLRSLIEVYP  355



>emb|CAJ65655.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CV+ILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVEILKRSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFGDYKITPI  345



>ref|XP_006446728.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
 gb|ESR59968.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
Length=362

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 97/130 (75%), Gaps = 3/130 (2%)
 Frame = +2

Query  5    GLEG-TKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            GLE    NL YV G++F+AIPPA AV  KWI+HDWND++CVKIL+KCKEAI+S  K GKV
Sbjct  234  GLESDLANLKYVGGDVFEAIPPADAVLFKWILHDWNDEECVKILQKCKEAITSDVKKGKV  293

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ +  + GD ESI+ Q++ D+ MMV   G ER  KEW K+F DAGF+DYK T I 
Sbjct  294  IIIDMMRE-NKKGDSESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITPIL  352

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  353  GLRSLIEVYP  362



>emb|CAJ65645.1| putative orcinol O-methyltransferase [Rosa roxburghii]
Length=346

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKIL++  EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILERSGEAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAA11131.1| O-methyltransferase [Prunus dulcis]
Length=356

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G++NL +  G+MF+AIPP  A+ +KWI+HDW+D++C+KIL++ KEAI+ +EK GKV
Sbjct  229  ADLKGSENLKFFGGDMFEAIPPTDAILMKWILHDWSDEECIKILQRSKEAITRKEKKGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            IIVDM++   Q GD++SI+ Q++ D+ MMV   G+ER  KEW K+F DAGF+DYK T I 
Sbjct  289  IIVDMVM--KQKGDDQSIETQLFFDMLMMVLFTGKERTEKEWAKLFSDAGFSDYKITPIC  346

Query  359  GTSSLIQLFP  388
            G   LI+++P
Sbjct  347  GLRYLIEVYP  356



>emb|CDP21661.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 97/130 (75%), Gaps = 3/130 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLE TKNL YV GNMF+AIPPA AV +KWI+ DW+DD+CV+ILKKCKEAI S+EKGGKVI
Sbjct  234  GLESTKNLGYVGGNMFEAIPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVI  293

Query  185  IVDMILDVTQNGDE--ESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            IVD      Q GD+  E+I+ Q++ D+  MV   G++R  K+W K+F +AGF DYK T +
Sbjct  294  IVDTFCKSLQKGDDDHEAIETQLFYDMGAMVLVKGRQRNEKDWAKLFSEAGFCDYKITAV  353

Query  359  -GTSSLIQLF  385
             G  S+I+++
Sbjct  354  LGLRSIIEVY  363



>emb|CDP21836.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 99/130 (76%), Gaps = 3/130 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLE +KNL YV GNMF+AIPPA AV +KWI+ DW+DD+CV+ILKKCKEAI S+EKGGKVI
Sbjct  234  GLESSKNLGYVGGNMFEAIPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVI  293

Query  185  IVDMILDVTQNGDE--ESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            IVDM     Q GD+  E+I+ Q++ D+ +MV    ++R  K+W K+F +AGF+DYK T +
Sbjct  294  IVDMFCKSLQKGDDDHEAIETQLFFDMVVMVLLKRRQRNEKDWAKLFTEAGFSDYKITAV  353

Query  359  -GTSSLIQLF  385
             G  S+I+++
Sbjct  354  LGLRSIIEVY  363



>ref|XP_006388573.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
 gb|ERP47487.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
Length=359

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 97/130 (75%), Gaps = 4/130 (3%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSR--EKGGKV  181
            L+G KNL Y  G+MF+A+PP  A+ LKWI+HDW+D+DCVKILK+CK+AI+S+  +K GKV
Sbjct  231  LQGGKNLKYAGGDMFEAVPPVDALLLKWILHDWSDEDCVKILKRCKQAITSKGQQKVGKV  290

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ D  +NGDE SI  Q+  DL MMV   G ER  KEW K+F+DAGF +YK   + 
Sbjct  291  IIIDMVRD-NRNGDEGSIGTQLLFDLEMMVALSGMERNEKEWAKLFFDAGFLNYKIHPVL  349

Query  359  GTSSLIQLFP  388
            GT +L +L+P
Sbjct  350  GTRALFELYP  359



>ref|XP_006376392.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
 gb|ERP54189.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
Length=355

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISS--REKGGKV  181
            L+G+KNL YV G+MF+A+PPA  + LKWI+H W+D+DCVKILK+CK+AI S  ++K GKV
Sbjct  227  LQGSKNLKYVGGDMFEAVPPADVILLKWILHAWSDEDCVKILKRCKQAIMSEGQQKAGKV  286

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ +   NGD  SI+ Q++ DL MMV   G ER  KEW K+F+DAGF +YK   + 
Sbjct  287  IIIDMVRE-NLNGDGGSIETQLFFDLQMMVAATGMERNEKEWAKLFFDAGFLNYKIHPVL  345

Query  359  GTSSLIQLFP  388
            GT +LI+L+P
Sbjct  346  GTRALIELYP  355



>ref|XP_003615962.1| O-methyltransferase [Medicago truncatula]
 gb|AES98920.1| orcinol O-methyltransferase [Medicago truncatula]
Length=341

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GL G++NL YV G+MF+ IPP  A+ LKWI+HDWND++CVKILK CK+AIS + K GKV+
Sbjct  213  GLLGSENLNYVGGDMFKEIPPTAAILLKWILHDWNDEECVKILKNCKDAISKKGKEGKVV  272

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            I D + D  +    ES++ Q++ D+ MMV   G+ER  KEW+K+   AGF+DYK T I G
Sbjct  273  IFDKVFDSEKGNINESVETQLFFDMFMMVVFAGKERNEKEWIKLISSAGFSDYKITPILG  332

Query  362  TSSLIQLFP  388
            ++S+I+++P
Sbjct  333  STSMIEIYP  341



>ref|XP_003615973.1| O-methyltransferase [Medicago truncatula]
 gb|AES98931.1| orcinol O-methyltransferase [Medicago truncatula]
Length=363

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GL+G++NL+YV G+MF+ IPP  A+ LKWI+HDWND++CVKILK CK+AIS + K GKV+
Sbjct  232  GLQGSENLSYVGGDMFKEIPPTDAILLKWILHDWNDEECVKILKNCKDAISKKGKEGKVV  291

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            I+DM+LD  +  + ES++ +++ D+ MMV   G+ER  KEWVK+   AGF DYK T I G
Sbjct  292  IIDMVLDCEKGDNNESVETKLFFDMLMMVTLTGKERTKKEWVKLISSAGFCDYKITPILG  351

Query  362  TSSLIQLF  385
              ++I+++
Sbjct  352  LRAVIEIY  359



>emb|CBI21932.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 102/131 (78%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G K+L Y+AG+MF+AIPPA A+ LKWI+HDW+D++C+KILK+C+EAI S+EKGGKV
Sbjct  306  ADLQGGKSLTYLAGDMFEAIPPADAILLKWILHDWSDEECLKILKQCREAIPSKEKGGKV  365

Query  182  IIVDMILDVTQNGDEES-IQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            +I+DM +   +  D+ES ++ Q++ D+ MMV   G+ER  KEW K+F D+GF+ YK T I
Sbjct  366  MIIDMAIQNKKGDDDESNVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFSGYKITPI  425

Query  359  -GTSSLIQLFP  388
             G  SLI+++P
Sbjct  426  LGLRSLIEVYP  436


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 8/76 (11%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKG---  172
            AGL+G+KNL Y AG+MF+AIP A A  LKWI+HDW+D     + +K +E  S+ E+G   
Sbjct  119  AGLQGSKNLNYSAGDMFEAIPLADASLLKWILHDWSDVGKQFLARKREE--SADEEGYVL  176

Query  173  ---GKVIIVDMILDVT  211
                ++++ D  L VT
Sbjct  177  ANASRLLLKDHPLSVT  192



>emb|CAJ65599.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDW+D++C+KIL++ + AI+ +EK GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQIG  361
            IIVDM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I 
Sbjct  288  IIVDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIS  346



>ref|XP_011091583.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AG++GTKNL Y+ GNMF+ IPP+ AV LKWI+HDW+D+  V+ILKKCKEAI+S  K GKV
Sbjct  231  AGMDGTKNLKYIEGNMFEYIPPSDAVLLKWILHDWSDEKSVEILKKCKEAITSNGKRGKV  290

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            I+++M++D  +  + ES++ Q+  D+ MM   GG+ER  KEW K+FYDAGF DY+   + 
Sbjct  291  ILIEMVVD-DERSNTESVETQLLFDMLMMTLVGGKERKEKEWAKLFYDAGFQDYRIYPVL  349

Query  359  GTSSLIQLFP  388
            G  S+I+++P
Sbjct  350  GLRSIIEVYP  359



>emb|CAH05089.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+AIPPA  V LKWI+HDWND++CVKILK+ ++AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAIPPANTVLLKWILHDWNDEECVKILKRSRKAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q  DEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IILDMMME-NQKRDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_011100233.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 98/130 (75%), Gaps = 3/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AG EGT++L +VAG+MF  IPPA AVF+KWI+HDW D+ C+KILKKCK+AIS+++KGGKV
Sbjct  232  AGCEGTESLTFVAGDMFDYIPPADAVFMKWILHDWPDEQCLKILKKCKQAISNKDKGGKV  291

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQI  358
            IIVDM++D  +  + ++I+ Q++ D+ M+    G ER  K+W K+F  AGFT YK T   
Sbjct  292  IIVDMVVDFKK--EHKAIETQLFFDMLMINLTSGIERTEKDWAKLFSAAGFTSYKITPAF  349

Query  359  GTSSLIQLFP  388
            G  SLI+LFP
Sbjct  350  GLRSLIELFP  359



>emb|CDP19840.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 98/130 (75%), Gaps = 3/130 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLE +KNLAYV GNMF+AIPPA AV +KWI+ DW+DD+CV+ILKKCKEAI S+EKGGKVI
Sbjct  234  GLESSKNLAYVGGNMFEAIPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVI  293

Query  185  IVDMILDVTQNGDE--ESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            IVD      Q GD+  E+I+ Q++ D+  MV   G++R   +W K+F +AGF+DYK T +
Sbjct  294  IVDTFCKSQQKGDDDHEAIETQLFYDMGAMVLVKGRQRNETDWAKLFSEAGFSDYKITAV  353

Query  359  -GTSSLIQLF  385
             G  S+I+++
Sbjct  354  LGLRSIIEVY  363



>emb|CAJ65631.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDW+D +C+KIL++ + AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWSDQECIKILRRSRVAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_011091736.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=560

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 100/130 (77%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+GT+NL YV G+MF+ IPPA AV LKWI+HDW+D++CV ILKKCK AI+S  K GKV
Sbjct  432  AGLQGTRNLEYVEGDMFEYIPPADAVVLKWILHDWSDEECVGILKKCKAAITSNGKRGKV  491

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            +I++M+LD  QN D +S++ Q+++D+ MM    G+ER   EW K+F DAGFT+YK + I 
Sbjct  492  VIIEMVLD-DQNADHKSVETQLFIDMLMMTILRGRERKEIEWAKLFSDAGFTNYKISPIL  550

Query  359  GTSSLIQLFP  388
            G  S+I+++P
Sbjct  551  GLRSIIEVYP  560



>emb|CAJ65666.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND +C+KILK+ + AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+ YK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSGYKITPI  345



>emb|CAJ65643.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++C+KILK+ + AI+S++K G+V
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGEV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKVTPI  345



>emb|CAJ65616.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=345

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ +EAI+ ++K GKV
Sbjct  227  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKV  286

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAG +DYK T I
Sbjct  287  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGISDYKITPI  344



>ref|XP_011037442.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   153 bits (386),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 99/130 (76%), Gaps = 4/130 (3%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSR--EKGGKV  181
            L+G+KNL YV G+MFQA+PPA A+ LK I+H W D+DCVKIL++CK+AI S+  +K GKV
Sbjct  227  LQGSKNLKYVGGDMFQAVPPADAILLKLILHCWRDEDCVKILRRCKQAIMSKGQQKAGKV  286

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKT-TQI  358
            II+DM+ +   NGDE SI+ Q++ DL +MV   G ER  KEW K+F+DAGF +YK  + +
Sbjct  287  IIIDMVRE-NLNGDEGSIETQLFFDLQLMVAASGIERNEKEWAKLFFDAGFLNYKIHSVL  345

Query  359  GTSSLIQLFP  388
            GT +LI+L+P
Sbjct  346  GTRALIELYP  355



>ref|XP_004505627.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=389

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 97/129 (75%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GL+G++N  YVAG+MF++IPP Q++ LK ++HDWND++C+KILKKCKEAI S+ K GKVI
Sbjct  262  GLQGSENFKYVAGDMFESIPPTQSILLKGVLHDWNDEECLKILKKCKEAIKSKGKEGKVI  321

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQ-IG  361
            I+D ++   +  D ES + Q++ DL MMV   G+ER  KEW K+F+ AGF +YK T  +G
Sbjct  322  IIDAVMG-NEKADNESFEAQLFYDLEMMVLVNGKERNEKEWSKLFFSAGFNNYKITHGLG  380

Query  362  TSSLIQLFP  388
              SLI++FP
Sbjct  381  FKSLIEVFP  389



>emb|CAH05091.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+P A  V LKWI+HDWND++CVKILK+ +EAI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPLADTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  345



>emb|CAJ65637.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=341

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDWND++CVKILK+ ++AI+S++K GKV
Sbjct  223  ADLQGSKNLKYTRGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSRKAITSKDKKGKV  282

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q  DEESI+ Q++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  283  IILDMMME-NQKRDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPI  340



>gb|KDO41475.1| hypothetical protein CISIN_1g0225151mg, partial [Citrus sinensis]
Length=227

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 93/123 (76%), Gaps = 2/123 (2%)
 Frame = +2

Query  23   NLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVIIVDMIL  202
            NL YV G+MF+AI PA AV LKWI+HDWND++CVKILKKCKEAI+S  K GKVII+DMI 
Sbjct  106  NLKYVGGDMFEAISPADAVLLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMIR  165

Query  203  DVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-GTSSLIQ  379
            +  + GD++SI+ Q++ D+ MMV   G ER  KEW K+F  AGF+DYK   I G  SLI+
Sbjct  166  E-NKKGDDKSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIE  224

Query  380  LFP  388
            ++P
Sbjct  225  VYP  227



>ref|XP_008245137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+ NL YVAG+MF+AIP A A+FLKWI+HDW+D++CVKIL++CKEAI+   K GKV
Sbjct  226  ADLKGSNNLEYVAGDMFEAIPGADAIFLKWILHDWSDEECVKILERCKEAITRDGKKGKV  285

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQ-I  358
            IIVDM ++  +N D+ES + Q++ D+ MMV   G+ER  KEW  +F DAGF+ YK T  +
Sbjct  286  IIVDMTVE-NKNTDKESGETQLFFDMEMMVLATGKERNEKEWAMLFSDAGFSHYKITPGL  344

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  345  GLRSLIEVYP  354



>ref|XP_006469137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +2

Query  5    GLEG-TKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            GLE    NL YV G+MF+AIPPA AV LKWI+HDWND++CVKILKKCKEAI+S  K GKV
Sbjct  234  GLESDLANLKYVGGDMFEAIPPADAVVLKWILHDWNDEECVKILKKCKEAITSNSKIGKV  293

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ +  + GD+ES + Q++  + MMV   G ER  KEW K+  D GF+DYK T I 
Sbjct  294  IIIDMMRE-NKKGDDESTETQLFFYMLMMVLATGTERDEKEWAKLLADVGFSDYKITSIL  352

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  353  GLRSLIEVYP  362



>ref|XP_006346269.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=364

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GL+G+KNL++V G+MF +IP A A+ LKWI+HDW+D DC+KILKKCKEAI S+E GGKVI
Sbjct  237  GLKGSKNLSFVGGDMFNSIPSANAILLKWILHDWSDGDCIKILKKCKEAIPSKENGGKVI  296

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            ++++++D  ++ D++S + Q+ +D+ MM+   G+ER+ +EW K+F+DAG++DYK   I G
Sbjct  297  LIEIVMDQNKD-DDKSYETQLLIDILMMILLSGKERSQQEWAKLFFDAGYSDYKIIPILG  355

Query  362  TSSLIQLFP  388
               +I+++P
Sbjct  356  LRCVIEVYP  364



>ref|XP_003615967.1| O-methyltransferase [Medicago truncatula]
 gb|AES98925.1| orcinol O-methyltransferase [Medicago truncatula]
Length=359

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GL+G++ L YV G+MF+ IPPA A+ LKWI+HDWND+ C+KILK CK+AIS + K GKV+
Sbjct  231  GLQGSEKLRYVGGDMFKEIPPADAILLKWILHDWNDEQCLKILKNCKDAISKKGKEGKVV  290

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            I+DM+LD  +  + ES++ Q++ D+ MM    G+ER  KEW+K+   AGF DYK T I G
Sbjct  291  IIDMVLDCEKGDNNESVETQLFFDMLMMALLTGKERNEKEWMKLISLAGFNDYKITPILG  350

Query  362  TSSLIQLFP  388
              S+I+++P
Sbjct  351  LRSMIEIYP  359



>ref|XP_008778505.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Phoenix 
dactylifera]
Length=303

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A +  +  +  +AGNMF+ IPPAQAVFLK I+HDW D+ CVKILK CKEAI  RE GGKV
Sbjct  175  ATVPKSPRVEAIAGNMFEHIPPAQAVFLKLILHDWTDEQCVKILKLCKEAIPEREDGGKV  234

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQIG  361
            +I+DM+++V+        Q Q + D+ M+    G+ER   EW KIF++AGFT+YK + +G
Sbjct  235  LILDMVMNVSSESSAAMTQVQRFWDIAMLCSTPGKERQEHEWRKIFFEAGFTNYKISSLG  294

Query  362  TSSLIQLFP  388
            T SLI++FP
Sbjct  295  TRSLIEVFP  303



>ref|XP_011085377.1| PREDICTED: chavicol O-methyltransferase-like [Sesamum indicum]
Length=368

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 95/130 (73%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
             GLEGT N  YVAG+MF+ IP A AVFLKWI+HDWND+DCVKILKKCKEAI+   +GGKV
Sbjct  242  GGLEGTNNFTYVAGDMFENIPSADAVFLKWILHDWNDEDCVKILKKCKEAIAV--EGGKV  299

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQI  358
            II+DM+LDV    D    +  + LD+ ++ Y+ G+ER  KE+ K+ +DAGFT YK T   
Sbjct  300  IIIDMVLDV-HGTDSGVRETHLLLDMAVLGYYNGKERTEKEFAKLLFDAGFTSYKITPAF  358

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  359  GMRSLIEIYP  368



>emb|CAJ65629.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+P A  V LKWI+HDWND +C+KILK+ + AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPLADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPI  345



>dbj|BAF36052.1| O-methyltransferase [Iris x hollandica]
Length=369

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 90/127 (71%), Gaps = 9/127 (7%)
 Frame = +2

Query  35   VAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVIIVDMILDVT-  211
            V G+MF  IP A AVF+K ++HDW D+DCVKILK CKEAI SRE+GGKV+IVD+++D   
Sbjct  243  VGGSMFDHIPRADAVFMKVVLHDWVDEDCVKILKLCKEAIPSREEGGKVMIVDIVMDAAG  302

Query  212  --------QNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQIGTS  367
                    + GDE   + Q++ DL MMVY GG+ER   EW KIF DAGFTDYK T +G  
Sbjct  303  AGAGAGQREVGDEMKTETQLFFDLTMMVYMGGKEREEDEWKKIFRDAGFTDYKITPLGLR  362

Query  368  SLIQLFP  388
            SLI+LFP
Sbjct  363  SLIELFP  369



>emb|CAJ65617.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y+ G+MF+A+PPA  V LKWI+HD ND++C+KIL++ + AI+ +EK GKV
Sbjct  228  ADLQGSKNLKYIGGDMFEAVPPADTVLLKWILHDRNDEECIKILERSRVAITGKEKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQIG  361
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAGF+DYK T I 
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIS  346



>ref|XP_002305103.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|EEE85614.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
              LEGTKNL YV G+MFQ IP A AV LK I H W+D+DC+KILKKCKEAISS+EKGGKV
Sbjct  231  TNLEGTKNLNYVGGDMFQHIPSADAVLLKLIFHGWSDEDCLKILKKCKEAISSKEKGGKV  290

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            IIVD+++D  ++ ++E  + ++  D+ MMV   G+ER++KEW K+F +AGF+ YK T + 
Sbjct  291  IIVDVVIDEKKD-EKELTETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFSHYKITPLF  349

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  350  GLRSLIEVYP  359



>gb|AEQ94124.1| putative O-methyltransferase [Elaeis guineensis]
Length=186

 Score =   147 bits (370),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 94/129 (73%), Gaps = 2/129 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A  E ++ +  VAG+MFQ +PPA AV LKW++HDW+DDDCVKILK+CKEAI S+E+GGKV
Sbjct  58   ASSEASEAVQLVAGDMFQYVPPADAVLLKWVLHDWSDDDCVKILKRCKEAIPSKEEGGKV  117

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQI  358
            II+DM++D+   G  E  + Q+  DL MMV   G+ER   EW KIF DAGFTDYK    +
Sbjct  118  IIIDMVVDL-DIGFPELGETQLLFDLEMMVQTTGKERNECEWKKIFMDAGFTDYKIIPAL  176

Query  359  GTSSLIQLF  385
            G  S+I+++
Sbjct  177  GLRSIIEVY  185



>ref|XP_003615968.1| O-methyltransferase [Medicago truncatula]
 gb|AES98926.1| flavonoid O-methyltransferase-like protein [Medicago truncatula]
Length=326

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 96/129 (74%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GL+G  NL YV G+MF+ IPPA A+ LKWI+HDWND++CVKIL+ CK+AI+ + K GKVI
Sbjct  199  GLQGGDNLNYVGGDMFKRIPPADAILLKWILHDWNDEECVKILRNCKDAIAKKGKEGKVI  258

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            I+DM+++  + G+ ES + Q++ D+ MMV   G+ER  KEWVK+   AGF DYK T + G
Sbjct  259  IIDMVVE-KEKGNSESAKTQLFFDMLMMVLATGKERTKKEWVKLISSAGFNDYKITPVLG  317

Query  362  TSSLIQLFP  388
              S+I+++P
Sbjct  318  LRSVIEIYP  326



>ref|XP_004490686.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=358

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 97/130 (75%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+ T+NL YV G+MF+ IP A A+ LKWI+HDWNDD+CVKILK CK+AI+ + K GKV
Sbjct  230  AGLQETENLKYVGGDMFKEIPSADAILLKWILHDWNDDECVKILKNCKDAIAKKGKEGKV  289

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  + G  ES+Q Q++ D+ MMV   G+ER  KEWV +   +GF++YK T I 
Sbjct  290  IIIDMVME-NEKGKNESLQTQLFFDMLMMVLVTGKERTKKEWVNLISSSGFSNYKITPIL  348

Query  359  GTSSLIQLFP  388
            G  S+I+++P
Sbjct  349  GLRSVIEIYP  358



>gb|AGQ21572.1| flavone 8-O-methyltransferase [Ocimum basilicum]
Length=359

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 99/132 (75%), Gaps = 4/132 (3%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSRE--KGG  175
            +GL+G+ NL YV G+MF ++PPA AVFLKWI+H+W+DD+C+KIL+KCKEAI++ +  KGG
Sbjct  229  SGLKGSGNLRYVGGDMFHSVPPADAVFLKWILHNWSDDECIKILEKCKEAITTSKNMKGG  288

Query  176  KVIIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKT-T  352
            KVIIVDMIL   +  D E+++ Q++ D+ MM    G+ER  +EW KIF+ AGF  YK   
Sbjct  289  KVIIVDMILGYEKQQD-EAVETQLFFDMMMMTTLTGKERTEQEWAKIFFAAGFKTYKIYP  347

Query  353  QIGTSSLIQLFP  388
             +G  SLI++FP
Sbjct  348  LLGLRSLIEVFP  359



>emb|CDP19839.1| unnamed protein product [Coffea canephora]
Length=334

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 97/130 (75%), Gaps = 3/130 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLE +KNLAYV GNMF+AIPPA AV +KWI+ DW+DD+CV+ILKKCKEAI S+EKGGKVI
Sbjct  203  GLESSKNLAYVGGNMFEAIPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVI  262

Query  185  IVDMILDVTQNGDE--ESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            IV+M     Q GD+  E+I+ Q+  D+ +M    G++   K+W K+F +AGF DYK T +
Sbjct  263  IVEMFCKSQQKGDDDHEAIETQLCYDMEVMALGKGRQINEKDWAKLFSEAGFCDYKITAV  322

Query  359  -GTSSLIQLF  385
             G  S+I+++
Sbjct  323  LGLRSIIEVY  332



>emb|CAJ65600.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 92/120 (77%), Gaps = 1/120 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+PPA  V LKWI+HDW+D++C+KIL++ + AI+ +EK GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQIG  361
            II+DM+++  Q GDEESI+ Q++ D+ MM   GG+ER  KEW K+F DAG +DYK T I 
Sbjct  288  IIIDMMME-NQKGDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGLSDYKITPIS  346



>gb|KHN07780.1| Tabersonine 16-O-methyltransferase [Glycine soja]
Length=323

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 99/130 (76%), Gaps = 7/130 (5%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G++NL YV G+MF++IP A A+ LKWI+HDWND+ CVKILKKCKEAI S     KV
Sbjct  200  ATLQGSENLKYVGGDMFESIPSADAILLKWILHDWNDEQCVKILKKCKEAIKS-----KV  254

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  + GD+ESI+ Q+++D+ +MV + G+ER  KEW K+ +  GF+DYK T + 
Sbjct  255  IIIDMVVE-NEKGDDESIETQLFIDMVVMVLYPGKERTEKEWAKLIFSTGFSDYKITPVL  313

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  314  GLRSLIEIYP  323



>emb|CBI22002.3| unnamed protein product [Vitis vinifera]
Length=114

 Score =   144 bits (362),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 89/115 (77%), Gaps = 2/115 (2%)
 Frame = +2

Query  47   MFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVIIVDMILDVTQNGDE  226
            MF+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E GGKVII+DMI+ +   GD 
Sbjct  1    MFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIM-MKNQGDY  59

Query  227  ESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-GTSSLIQLFP  388
            +S + Q++ D+ MM++  G+ER   EW K+F DAGF+ YK T I G  SLI+++P
Sbjct  60   KSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  114



>ref|XP_009612081.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=350

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 99/128 (77%), Gaps = 2/128 (2%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVII  187
            L+G+ NL +V G+MF+ IP A A+ LKWI+H+W D+DCVKILKKCKE+I SREKGGKVII
Sbjct  224  LKGSGNLEFVGGSMFEKIPNANAILLKWILHNWGDEDCVKILKKCKESIPSREKGGKVII  283

Query  188  VDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQIGT  364
            +D++L+  +  D +S++ Q  +DL MMV  G +ER  KEW K+F +AGF++Y+ T  +GT
Sbjct  284  IDIVLENPKQKD-DSVRAQHNMDLVMMVLFGAKERTKKEWEKLFTEAGFSEYEITPTLGT  342

Query  365  SSLIQLFP  388
             SLI+++P
Sbjct  343  RSLIEIYP  350



>ref|XP_004241914.1| PREDICTED: myricetin O-methyltransferase-like [Solanum lycopersicum]
Length=355

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = +2

Query  11   EGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVIIV  190
            +GT+NL +VAGNMF  IP A A+ LKWI+HDWND+DCVKILKKCKE+I S+E GGKVII+
Sbjct  229  KGTQNLEFVAGNMFDKIPHANAILLKWILHDWNDEDCVKILKKCKESIPSKENGGKVIII  288

Query  191  DMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQIGTS  367
            D++++   + +E+ +Q+Q  +DL + + +  +ER+ KEW K+F DAGF+ YK  T +G  
Sbjct  289  DIVMEDNCSNNEQLVQSQHLMDLLVRITYDSKERSNKEWEKLFLDAGFSGYKIITSLGLR  348

Query  368  SLIQLFP  388
            SL++++P
Sbjct  349  SLMEVYP  355



>ref|XP_011016237.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   150 bits (379),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSR--EKGGKV  181
            L+G KNL YV G+MF+A+PPA A+ LKW++HDW+D+ CVKILK+CK+A+ S+  +K GKV
Sbjct  231  LQGGKNLKYVGGDMFEAVPPADALLLKWVLHDWSDEYCVKILKRCKQAVVSKGQQKAGKV  290

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ +   +GDE SI+ Q+  DL +MV   G ER  KEW K+F+DAGF +YK   + 
Sbjct  291  IIIDMVRE-NLSGDEGSIETQLLFDLEIMVAASGMERNEKEWAKLFFDAGFLNYKIHSVL  349

Query  359  GTSSLIQLFP  388
            GT +LI+L+P
Sbjct  350  GTRALIELYP  359



>ref|XP_002326036.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
 gb|EEF00418.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
Length=357

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGLEG++NL Y++G+MF+AIP A A+ LKWI+HDWND++CVKILK+CKEAI  RE GGK+
Sbjct  230  AGLEGSENLKYLSGDMFEAIPQADAILLKWILHDWNDEECVKILKQCKEAIKGRE-GGKL  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  +   E S + Q++ D+ MM+   G+ER  KEW K+F DAGF++YK   + 
Sbjct  289  IIIDMVVENNKE-VEGSTETQLFFDMLMMILVTGKERNEKEWAKLFTDAGFSNYKINPVL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>ref|XP_011100228.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=367

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 98/130 (75%), Gaps = 3/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AG EGT NL +VAG+MF+ IPPA AVF+KWI+HDW D+ C+KIL+KCK+AIS ++K GKV
Sbjct  240  AGCEGTANLVFVAGDMFEYIPPADAVFMKWILHDWPDEKCLKILEKCKQAISDKDKEGKV  299

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            IIVDM++D  +  + ++I+ Q++ D+ +M    G++R  K+W ++F  AGFT YK T + 
Sbjct  300  IIVDMVVDFQK--EHKAIETQLFFDMLIMNLASGRQRTEKDWAELFSAAGFTSYKITPVL  357

Query  359  GTSSLIQLFP  388
            G  SLI+LFP
Sbjct  358  GLRSLIELFP  367



>ref|XP_006356529.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=357

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 97/127 (76%), Gaps = 1/127 (1%)
 Frame = +2

Query  11   EGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVIIV  190
             GT+NL +VAGNMF  IP A A+FLKWI+H W+D DCVKILKKCKE+I S+EKGGKVII+
Sbjct  231  RGTENLEFVAGNMFDKIPHANAIFLKWILHSWSDHDCVKILKKCKESIPSKEKGGKVIII  290

Query  191  DMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQIGTS  367
            D++++   + +E+ +Q+Q  +D+ M + +  +ER+ KEW K+F +AGF+ YK  T +G  
Sbjct  291  DIVMEDNCSNNEQLVQSQHLMDVLMRISYASKERSKKEWEKLFLEAGFSGYKIITSLGLR  350

Query  368  SLIQLFP  388
            SLI+++P
Sbjct  351  SLIEVYP  357



>ref|XP_003527407.1| PREDICTED: trans-resveratrol di-O-methyltransferase isoform 1 
[Glycine max]
Length=352

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 99/130 (76%), Gaps = 7/130 (5%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G++NL YV G+MF++IP A A+ LKWI+HDWND+ CVKILKKCKEAI S     KV
Sbjct  229  ATLQGSENLKYVGGDMFESIPSADAILLKWILHDWNDEQCVKILKKCKEAIKS-----KV  283

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++  + GD+ESI+ Q+++D+ +MV + G+ER  KEW K+ +  GF+DYK T + 
Sbjct  284  IIIDMVVE-NEKGDDESIETQLFIDMVVMVLYPGKERTEKEWAKLIFSTGFSDYKITPVL  342

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  343  GLRSLIEIYP  352



>ref|XP_011100227.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 99/130 (76%), Gaps = 3/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AG EGT+NL +VAG+MF+ IP A AVF+KWI+HDW D+ C+KIL+KCK+A+S ++K GKV
Sbjct  232  AGCEGTENLVFVAGDMFEYIPSADAVFMKWILHDWPDEKCLKILEKCKQAVSDKDKKGKV  291

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            IIVD+++D  +  + ++I+ Q++ D+ MM    G+ER  K+W ++F+ AGFT YK T + 
Sbjct  292  IIVDIVVDFQK--EHKAIETQLFFDMLMMNVASGRERTEKDWAELFFAAGFTSYKITPVL  349

Query  359  GTSSLIQLFP  388
            G  SLI+LFP
Sbjct  350  GLRSLIELFP  359



>ref|XP_009605623.1| PREDICTED: myricetin O-methyltransferase-like [Nicotiana tomentosiformis]
Length=364

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 95/129 (74%), Gaps = 2/129 (2%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVII  187
            L+G+ NL +V G+MF  IP A A+ LKWI+HDW+D+DCVKILKKCKEAI  REKGGKVII
Sbjct  236  LKGSGNLDFVGGSMFDKIPNANAILLKWILHDWSDEDCVKILKKCKEAIPCREKGGKVII  295

Query  188  VDMIL-DVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQIG  361
            +DM++ D     DEE ++ Q  +DL MM+    +ER  KEW K+F ++GFT YK T  +G
Sbjct  296  IDMVMEDPKLISDEEFVRTQHNMDLLMMLLFAAKERTKKEWEKLFTESGFTQYKITPSLG  355

Query  362  TSSLIQLFP  388
            + SLI+++P
Sbjct  356  SRSLIEIYP  364



>emb|CAN83014.1| hypothetical protein VITISV_029725 [Vitis vinifera]
Length=357

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF+ IPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+EKGGKV
Sbjct  229  AGLQGSKNLNYFAGDMFEXIPPADAILLKWILHDWSDEECVKILKRCREAIPSKEKGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM++   Q GD +S + Q++ D+ MMV   G+ER  KEW K+F DAGF+ YK T I 
Sbjct  289  IIIDMMMK-NQKGDXKSRETQLFFDMLMMVXVTGKEREEKEWEKLFLDAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>ref|XP_010088036.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB31255.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=373

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 99/129 (77%), Gaps = 3/129 (2%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSR-EKGGKVI  184
            L+G  NL +V G+MFQ +PPA A+ LKWI+HDW+DD+CVKILKKCKEAI+S+  K GKVI
Sbjct  246  LQGKDNLKFVGGDMFQQVPPADAILLKWILHDWSDDECVKILKKCKEAITSKGSKKGKVI  305

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            I+D++++  ++ D++S + Q++ D+ MMV   GQER  KEW K+F D+GF+DYK   I G
Sbjct  306  IIDIMIE-NKDEDDKSYETQLFFDMMMMVLATGQERNEKEWAKLFQDSGFSDYKIIPILG  364

Query  362  TSSLIQLFP  388
              SLI+++P
Sbjct  365  LRSLIEVYP  373



>emb|CAG27621.1| putative O-methyltransferase [Populus deltoides x Populus maximowiczii]
Length=119

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 93/120 (78%), Gaps = 4/120 (3%)
 Frame = +2

Query  38   AGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISS--REKGGKVIIVDMILDVT  211
            AG+MFQA+PPA+A+ LK I+HDW+D+DCVKILK+CK+AI S  ++K GKVII+DM+ +  
Sbjct  1    AGDMFQAVPPAEAILLKCILHDWSDEDCVKILKRCKQAIMSEGQQKAGKVIIIDMVRE-N  59

Query  212  QNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-GTSSLIQLFP  388
            QNGDE SI+ Q+  DL MMV   G ER  KEW K+F+D+GF +YK   + GT ++I+L+P
Sbjct  60   QNGDEGSIETQLIFDLAMMVVVSGVERNEKEWAKLFFDSGFLNYKIHPVPGTRAVIELYP  119



>emb|CAJ65649.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G+KNL Y  G+MF+A+P A  V LKWI+HDWND++C+KILK+ + AI+S++K GKV
Sbjct  228  ADLQGSKNLKYTGGDMFEAVPLADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DMI++  Q GDEESI+ +++ D+ MM    G+ER  KEW K+F DAGF+DYK T I
Sbjct  288  IIIDMIME-NQKGDEESIETELFFDMLMMAILTGKERNEKEWAKLFTDAGFSDYKITPI  345



>ref|XP_004490696.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=359

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
             GL+GT NL YV G+MF+ IPPA A+ LKWI+HDWNDD+CVKILKKCKE++  +   GKV
Sbjct  230  VGLQGTDNLKYVGGDMFKEIPPADAILLKWILHDWNDDECVKILKKCKESLLKKGNEGKV  289

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+LD  +    ES + Q++ D+ M V   G+ER  KEW+K+   AGF+DYK   I 
Sbjct  290  IIIDMVLDTKKGDINESGKTQLFFDMLMTVLVKGKERNDKEWIKLISLAGFSDYKIIPIL  349

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  350  GLRSLIEVYP  359



>ref|XP_006428632.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
 gb|ESR41872.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
Length=362

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 93/123 (76%), Gaps = 2/123 (2%)
 Frame = +2

Query  23   NLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVIIVDMIL  202
            NL YV G+MF+AI PA AV LKWI+HDWND++CVKILKKCKEAI+S  K GKVII+DMI 
Sbjct  241  NLKYVGGDMFEAISPADAVLLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMIR  300

Query  203  DVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-GTSSLIQ  379
            +  + GD++SI+ Q++ D+ MMV   G ER  KEW K+F  AGF+DYK   I G  SLI+
Sbjct  301  E-NKKGDDKSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIE  359

Query  380  LFP  388
            ++P
Sbjct  360  VYP  362



>ref|XP_002278057.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF+ IPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+EKGGKV
Sbjct  229  AGLQGSKNLNYFAGDMFEPIPPADAILLKWILHDWSDEECVKILKRCREAIPSKEKGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM++   Q GD +S + Q++ D+ MMV   G+ER  KEW K+F DAGF+ YK T I 
Sbjct  289  IIIDMMMK-NQKGDCKSRETQLFFDMLMMVLVTGKEREEKEWEKLFLDAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>ref|XP_006480453.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 93/123 (76%), Gaps = 2/123 (2%)
 Frame = +2

Query  23   NLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVIIVDMIL  202
            NL YV G+MF+AI PA AV LKWI+HDWND++CVKILKKCKEAI+S  K GKVII+DMI 
Sbjct  241  NLKYVGGDMFEAISPADAVLLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMIR  300

Query  203  DVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-GTSSLIQ  379
            +  + GD++SI+ Q++ D+ MMV   G ER  KEW K+F  AGF+DYK   I G  SLI+
Sbjct  301  E-NKKGDDKSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIE  359

Query  380  LFP  388
            ++P
Sbjct  360  VYP  362



>ref|XP_011037437.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSR--EKGGKV  181
            L+G KNL YV G+MF+A+PPA A+ LKW++HDW+D+ CVKILK+CK+A+ S+  +K GKV
Sbjct  231  LQGGKNLKYVGGDMFEAVPPADALLLKWVLHDWSDEYCVKILKRCKQAVVSKGQQKAGKV  290

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ +   +GDE SI+ Q+  DL +MV   G ER  +EW K+F+DAGF +YK   + 
Sbjct  291  IIIDMVRE-NLSGDEGSIETQLLFDLEIMVAASGMERNEEEWAKLFFDAGFLNYKIHSVL  349

Query  359  GTSSLIQLFP  388
            GT +LI+L+P
Sbjct  350  GTRALIELYP  359



>ref|XP_006377432.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP55229.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=372

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A LEGT+NL YV G+MFQ IP A AV LK I H W+D+DCVKILKKCKEAISS+EKGGKV
Sbjct  244  ANLEGTENLKYVGGDMFQHIPSADAVLLKLIFHGWSDEDCVKILKKCKEAISSKEKGGKV  303

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            IIVD++++  ++ + E  + ++  D+ MMV   G+ER+++EW ++F +AGF+ YK T + 
Sbjct  304  IIVDVVINEKKD-EHELTETKLLFDMLMMVVAAGKERSVEEWERLFLEAGFSHYKITSLF  362

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  363  GLRSLIEVYP  372



>ref|XP_011001214.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=373

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A LEGT+NL YV G+MFQ IP A AV LK I H W+D+DCVKILKKCKEAISS+EKGGKV
Sbjct  245  ANLEGTENLKYVGGDMFQHIPSADAVLLKLIFHGWSDEDCVKILKKCKEAISSKEKGGKV  304

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            IIVD++++  ++ + E  + ++  D+ MMV   G+ER+++EW ++F +AGF+ YK T + 
Sbjct  305  IIVDVVINKKKD-EHELTETKLLFDMLMMVVAAGKERSVEEWERLFLEAGFSHYKITSLF  363

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  364  GLRSLIEVYP  373



>emb|CAN69333.1| hypothetical protein VITISV_003273 [Vitis vinifera]
Length=350

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E+GGKV
Sbjct  222  AGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKV  281

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM++   Q GD +S + Q++ D+ MMV   G+ER  KEW K+F +AGF+ YK T I 
Sbjct  282  IIIDMMVK-NQKGDCKSRETQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPIL  340

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  341  GLRSLIEVYP  350



>ref|XP_011077108.1| PREDICTED: chavicol O-methyltransferase-like [Sesamum indicum]
Length=361

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 97/132 (73%), Gaps = 5/132 (4%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREK-GGK  178
             GL+GT NL Y+AG+MF+AIP   AV  KW+MHDW+D+ C+K+LKK KEAI  ++K GGK
Sbjct  232  GGLKGTNNLTYIAGDMFEAIPSVDAVLFKWVMHDWDDESCLKMLKKSKEAIGGKDKTGGK  291

Query  179  VIIVDMILDVTQNG-DEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TT  352
            V+IVDM+LDV  NG D + ++   + D+ +M Y  G+ER  KEW K+F+DAGFT+YK T 
Sbjct  292  VMIVDMVLDV--NGRDNKEMETCFFFDIALMPYLTGRERTEKEWAKLFFDAGFTNYKITP  349

Query  353  QIGTSSLIQLFP  388
              G  SLI+++P
Sbjct  350  AFGLRSLIEVYP  361



>ref|XP_006351391.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=355

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 98/130 (75%), Gaps = 5/130 (4%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G++NL +VAG+MFQ IPPA AV LK I+HDWND++CVKILK CKEA   +   GKV
Sbjct  230  ANLQGSENLEFVAGDMFQKIPPANAVLLKSILHDWNDEECVKILKNCKEA---KTGSGKV  286

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTT-QI  358
            II+DM+++     D+ES+Q Q+++D+ MMV+ G +ER  KEW K+F D+GFT YK T  +
Sbjct  287  IIIDMVME-NPELDDESVQAQLFIDMLMMVFVGSKERNKKEWEKLFLDSGFTSYKITLTL  345

Query  359  GTSSLIQLFP  388
            G  S+I+L+P
Sbjct  346  GLKSIIELYP  355



>ref|XP_002277927.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E+GGKV
Sbjct  229  AGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM++   Q GD +S + Q++ D+ MMV   G+ER  KEW K+F +AGF+ YK T I 
Sbjct  289  IIIDMMVK-NQKGDCKSRETQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>gb|AES89720.2| orcinol O-methyltransferase [Medicago truncatula]
Length=355

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 96/129 (74%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GL+G++NL YV G+MF+AIPP  ++ LK ++HDWND++C+KILKKCKEAI ++ K GKVI
Sbjct  228  GLQGSENLKYVGGDMFEAIPPTHSILLKGVLHDWNDEECLKILKKCKEAIGNKGKEGKVI  287

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQ-IG  361
            I+D ++   +  D ESI+ Q++ DL MMV   G+ER  KEW  +F  AGF++YK T  +G
Sbjct  288  IIDAVMG-NEKEDNESIEAQLFYDLEMMVLVNGKERNEKEWSNLFLSAGFSNYKITHGLG  346

Query  362  TSSLIQLFP  388
              SLI++FP
Sbjct  347  FKSLIEVFP  355



>ref|XP_008788394.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Phoenix 
dactylifera]
Length=370

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 95/129 (74%), Gaps = 2/129 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A  E ++ +  VAG+MFQ +PPA AV LKWI+HDW D++CVKILK+CKEA+ S+E+GGKV
Sbjct  242  ASSEASETVQLVAGDMFQYVPPADAVLLKWILHDWGDEECVKILKRCKEAVPSKEEGGKV  301

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQI  358
            II++M++D    G  E ++ Q+  D+HMMV+  G++R   EW KIF DAGFTDYK    +
Sbjct  302  IIIEMVVDF-DIGRPELVETQLLFDMHMMVHTAGKQRNEGEWRKIFTDAGFTDYKIIPAL  360

Query  359  GTSSLIQLF  385
            G  S+I+++
Sbjct  361  GLRSVIEVY  369



>ref|XP_002274019.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+G+KNL Y AG+MF+AIPPA A+ LKWI+HDW+D++CVKILK+C+EAI S+E+GGKV
Sbjct  229  AGLQGSKNLNYFAGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM++   Q GD +S + Q++ D+ MMV   G+ER  KEW K+F +AGF+ YK T I 
Sbjct  289  IIIDMMVK-NQKGDCKSRETQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPIL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>ref|XP_007043718.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOX99549.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=364

 Score =   148 bits (373),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+   NL YV G+MF+A+P A AV LKWI+HDWND++CVKILK+CKEAIS   KGGK 
Sbjct  234  AGLQDRGNLKYVGGDMFEAVPAADAVLLKWILHDWNDEECVKILKRCKEAISRGGKGGKA  293

Query  182  IIVDMIL-DVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            II+DM+L +     ++ SI+ Q++ D+ MMV   G+ER  +EW  +F  AGF+DYK T I
Sbjct  294  IIIDMVLTEKNHKVNDASIETQLFFDMLMMVLVTGKERNEEEWATLFLAAGFSDYKITPI  353

Query  359  -GTSSLIQLFP  388
             G  SLI+++P
Sbjct  354  MGLRSLIEVYP  364



>ref|XP_010938927.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Elaeis 
guineensis]
Length=362

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +2

Query  32   YVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVIIVDMILDVT  211
            +V G+MF+ +PPA    LKWI+HDW+DDDCVKIL++CKEAI S+E GGK+IIVD ++   
Sbjct  243  FVGGDMFERVPPADVALLKWILHDWSDDDCVKILRRCKEAIPSKENGGKLIIVDAVVKAG  302

Query  212  QNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-GTSSLIQLFP  388
             +G  ++ + Q++ D+ MMV  GG +R  KEW KIF+DAGF++YK   + G  S+I+++P
Sbjct  303  DDGSNKTTETQLFFDMLMMVNSGGMQREEKEWSKIFFDAGFSNYKINPVMGLRSIIEVYP  362



>ref|XP_008807987.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Phoenix 
dactylifera]
 ref|XP_008777171.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Phoenix 
dactylifera]
Length=357

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A +  +  +  +AGNMF+ IPPAQA FLK I+HDW D+ CVKILK CKEAI  RE GGKV
Sbjct  229  ATVPKSPRVEAIAGNMFEHIPPAQAAFLKLILHDWTDEQCVKILKLCKEAIPEREDGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQIG  361
            +I+D++++ +        + Q++ D+ M+    G+ER   EW KIF++AGFT+YK + +G
Sbjct  289  LILDIVMNASSENSATMTEMQLFWDIQMLCIAAGKERQEHEWRKIFFEAGFTNYKISSLG  348

Query  362  TSSLIQLFP  388
            T SLI++FP
Sbjct  349  TRSLIEVFP  357



>emb|CDP19708.1| unnamed protein product [Coffea canephora]
Length=212

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 99/148 (67%), Gaps = 20/148 (14%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLK-----------------WIMHDWNDDDCVKI  130
            A  EG +NL ++AG+MFQ++P A A+ LK                 WI+HDWND++CV+I
Sbjct  64   ANQEGAENLEFLAGDMFQSVPRANAILLKVTKAILKSSITIFPANAWILHDWNDEECVQI  123

Query  131  LKKCKEAISSREKGGKVIIVDMILDVTQNG--DEESIQNQIYLDLHMMVYHGGQERALKE  304
            L+KCKEAI S+E GGKVII+DM+L   Q G  D E+I+ Q++ D+ MMV   G++R  +E
Sbjct  124  LRKCKEAIPSKENGGKVIIIDMVLSDQQKGADDHEAIETQLFSDMLMMVLLRGKQRNERE  183

Query  305  WVKIFYDAGFTDYKTTQI-GTSSLIQLF  385
            W K+F +AGF DYK T + G  SL++++
Sbjct  184  WAKLFSEAGFNDYKITPVLGLRSLVEVY  211



>gb|AFK40900.1| unknown [Lotus japonicus]
Length=357

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G++NL Y+ G+MF+ IPPA A+ LKWI+HDW+D++C+KILK CKEAI S+ K GKV
Sbjct  229  ADLQGSENLEYIGGDMFKEIPPADAILLKWILHDWSDEECLKILKNCKEAIKSKGKEGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+++    GD++S++ Q+  D+ MMV   G+ER++KEW  +   AGF+DYK + + 
Sbjct  289  IIIDMVIE-EDKGDDKSVETQLLFDMGMMVLTTGKERSMKEWGILISSAGFSDYKISPVL  347

Query  359  GTSSLIQLFP  388
            G  S+++++P
Sbjct  348  GLRSVVEIYP  357



>ref|XP_008778275.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Phoenix 
dactylifera]
Length=357

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A +  +  +  +AGNMF+ IPPAQAVFLK I+HDW D+ CVKILK CKEAI  RE GGKV
Sbjct  229  ATVPKSPRVEALAGNMFEHIPPAQAVFLKLILHDWTDEQCVKILKLCKEAIPEREDGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQIG  361
            +I+D++++ +        + Q++ D+ M+    G+ER   EW KIF+ AGFT+YK + +G
Sbjct  289  LILDIVMNASSENSATMTELQLFCDIDMLCITAGKERQEHEWRKIFFAAGFTNYKISSLG  348

Query  362  TSSLIQLFP  388
            T SLI++FP
Sbjct  349  TRSLIEVFP  357



>ref|XP_010920172.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Elaeis 
guineensis]
Length=362

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 94/129 (73%), Gaps = 2/129 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A  E ++ +  VAG+MFQ +PPA AV LKW++HDW+DDDCVKILK+CKEAI S+E+GGKV
Sbjct  234  ASPEASEEVQLVAGDMFQYVPPADAVLLKWVLHDWSDDDCVKILKRCKEAIPSKEEGGKV  293

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQI  358
            II+DM++D+   G  E  + Q+  DL MMV   G+ER   EW KIF DAGFTDYK    +
Sbjct  294  IIIDMVVDL-DIGFPELGETQLLFDLEMMVQTTGKERNECEWKKIFMDAGFTDYKIIPAL  352

Query  359  GTSSLIQLF  385
            G  S+I+++
Sbjct  353  GLRSIIEVY  361



>emb|CBI21921.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A LE  +NL  V GN+F+AIPPA A+ LKWI+HDW+D++CVKILKKCK AI +  KGGKV
Sbjct  180  ANLEVGENLEIVGGNIFEAIPPADAILLKWILHDWSDEECVKILKKCKGAIPN--KGGKV  237

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQI  358
            II+DM+++ +  GD ++++ Q+++D+ MMV   G+ER  KEW K+F  AGFT YK T  +
Sbjct  238  IIIDMVVE-SNKGDNKAVETQLFIDMLMMVVVAGKERNEKEWEKLFLAAGFTHYKITPAL  296

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  297  GLRSLIEVYP  306



>ref|XP_002538902.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF23481.1| o-methyltransferase, putative [Ricinus communis]
Length=228

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 96/129 (74%), Gaps = 2/129 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL+ + NL YV GNMF+ +PPA A+ LKWIMHDW+D++C+KIL++ KEAI  + KGGK+
Sbjct  100  AGLQSSANLKYVGGNMFEGVPPADAILLKWIMHDWSDEECLKILQRSKEAIKGK-KGGKL  158

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+ +  Q  D++ ++ Q++ D+ MM    G+ER  KEW K+F DAGF++YK T I 
Sbjct  159  IIIDMVSENQQVIDDQYVETQLFFDMLMMALQTGKERNNKEWGKLFLDAGFSNYKITPIL  218

Query  359  GTSSLIQLF  385
            G  S+I+++
Sbjct  219  GLRSVIEVY  227



>ref|XP_009780812.1| PREDICTED: myricetin O-methyltransferase-like [Nicotiana sylvestris]
Length=353

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 93/129 (72%), Gaps = 2/129 (2%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVII  187
            L+G+ NL +V G+MF  IP A A+ LKWI+HDW+D+DCVKILKKCKEAI  REKGGKVII
Sbjct  225  LKGSGNLEFVRGSMFDKIPKANAILLKWILHDWSDEDCVKILKKCKEAIPCREKGGKVII  284

Query  188  VDMIL-DVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQIG  361
            +DM++ D     DEE ++ Q  +DL M V    +ER  KEW K+F ++GFT Y  T  +G
Sbjct  285  IDMVMEDPKLISDEEFVRAQHNMDLLMTVLCAAKERTKKEWEKLFTESGFTQYNITPSLG  344

Query  362  TSSLIQLFP  388
            + SLI+++P
Sbjct  345  SRSLIEIYP  353



>ref|XP_002525159.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37286.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 97/130 (75%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGL G++NL YVAG+MF+ +PPA A+ LKWIMH W+D++C+K+LK  KEAI    K GK+
Sbjct  228  AGLAGSENLKYVAGDMFEGVPPADAILLKWIMHVWSDEECLKLLKLSKEAIKGN-KEGKL  286

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+DM+L+  Q  D +SI++Q++ D+ MM    G++R  KEW K+F DAGF+DYK T I 
Sbjct  287  IIIDMVLENRQVTDHQSIESQLFFDMLMMTLQTGKQRNKKEWGKLFLDAGFSDYKITPIL  346

Query  359  GTSSLIQLFP  388
            G  S+I+++P
Sbjct  347  GLRSVIEVYP  356



>ref|XP_011027757.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 97/128 (76%), Gaps = 2/128 (2%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVII  187
            LEGTKNL YV G+MFQ IP A AV LK I H W+D+DC+KILKKCKEAISS+ KGGKVII
Sbjct  233  LEGTKNLNYVGGDMFQHIPSADAVLLKLIFHGWSDEDCLKILKKCKEAISSKGKGGKVII  292

Query  188  VDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-GT  364
            VD+++D  ++ ++E  + ++  D+ MMV   G+ER++KEW K+F +AGF+ Y  T + G 
Sbjct  293  VDVVIDEKKD-EKELTETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFSHYMITPLFGL  351

Query  365  SSLIQLFP  388
             SLI+++P
Sbjct  352  RSLIEVYP  359



>ref|XP_003633245.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A LE  +NL  V GN+F+AIPPA A+ LKWI+HDW+D++CVKILKKCK AI +  KGGKV
Sbjct  231  ANLEVGENLEIVGGNIFEAIPPADAILLKWILHDWSDEECVKILKKCKGAIPN--KGGKV  288

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQI  358
            II+DM+++ +  GD ++++ Q+++D+ MMV   G+ER  KEW K+F  AGFT YK T  +
Sbjct  289  IIIDMVVE-SNKGDNKAVETQLFIDMLMMVVVAGKERNEKEWEKLFLAAGFTHYKITPAL  347

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  348  GLRSLIEVYP  357



>ref|XP_010920173.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Elaeis 
guineensis]
Length=362

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 95/129 (74%), Gaps = 2/129 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A  E  + +  VAG+MFQ +PPA AV LKW++HDW+D++CVKILK+CKEA+ S+EKGGKV
Sbjct  234  ASSEAGETVQLVAGDMFQYVPPADAVLLKWVLHDWSDEECVKILKRCKEAVPSKEKGGKV  293

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQI  358
            II++M++D+   G  E  + Q+  D+HMMV   G++R   EW KIF DAGFTDYK T  +
Sbjct  294  IIIEMVVDL-DIGFPELAETQLLFDMHMMVQTTGKQRNKCEWKKIFIDAGFTDYKITPAL  352

Query  359  GTSSLIQLF  385
            G  S+I+++
Sbjct  353  GLRSIIEVY  361



>ref|XP_007132751.1| hypothetical protein PHAVU_011G1221001g, partial [Phaseolus vulgaris]
 gb|ESW04745.1| hypothetical protein PHAVU_011G1221001g, partial [Phaseolus vulgaris]
Length=214

 Score =   142 bits (357),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 95/130 (73%), Gaps = 7/130 (5%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G +NL YV G+MF+++PPA AV LKWI+HDWND+ CVKILKKCKE I       KV
Sbjct  91   ANLKGCENLKYVGGDMFESVPPADAVLLKWILHDWNDEQCVKILKKCKEGIKR-----KV  145

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQ-I  358
            I++DM+++ ++  D ES + ++ +D+ +MV + G+ER  KEW KI + AGF+DYK T  +
Sbjct  146  IVIDMVVE-SEEEDFESTETKLLVDMVVMVLYPGKERTEKEWAKIIFSAGFSDYKITPVV  204

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  205  GLRSLIEIYP  214



>ref|XP_006366911.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=188

 Score =   141 bits (355),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 95/130 (73%), Gaps = 4/130 (3%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GLEG+KNL++V G+MF +IP A A+ LKW++H+W+D+DC+KILKKCKEAI S+E GGKVI
Sbjct  61   GLEGSKNLSFVGGDMFNSIPSANAILLKWVLHNWSDEDCIKILKKCKEAIPSKENGGKVI  120

Query  185  IVDMIL-DVT-QNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            I+DM+L D   + G+ +S + Q++ D+ MMV   G++R+ + W  +F DAGF        
Sbjct  121  IIDMVLMDYNLEKGNHKSYETQLFFDMLMMVAVSGKQRSQQNWANLFSDAGFNIIPIP--  178

Query  359  GTSSLIQLFP  388
            G  S+I+++P
Sbjct  179  GLRSIIEVYP  188



>gb|AJD20223.1| norcoclaurine 6-O-methyltransferase [Podophyllum peltatum]
Length=373

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVII  187
            L+G+KNL +V+G+MF++IP A    LK IMHDW+DD+CV ILK+CKEAI S+E GGKVII
Sbjct  246  LQGSKNLEFVSGDMFESIPSADVALLKSIMHDWSDDECVMILKRCKEAIPSKEAGGKVII  305

Query  188  VDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-GT  364
            +DM++D       ES + Q++ D+ MMV   G+ER   EW K+F DAGFT Y  T I G 
Sbjct  306  IDMVVDDKNKNHYESTETQLFFDMLMMVLITGKERTETEWKKLFSDAGFTGYTITPILGL  365

Query  365  SSLIQLFP  388
             S I++ P
Sbjct  366  RSFIEVLP  373



>ref|XP_002454762.1| hypothetical protein SORBIDRAFT_04g036900 [Sorghum bicolor]
 gb|EES07738.1| hypothetical protein SORBIDRAFT_04g036900 [Sorghum bicolor]
Length=391

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 91/123 (74%), Gaps = 3/123 (2%)
 Frame = +2

Query  23   NLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVIIVDMIL  202
            ++ YVAG+MFQ+IPPA AVFLKWI+HDWNDDDCVKILK CK+AI  R+ GGKVII+DM++
Sbjct  271  SVQYVAGDMFQSIPPADAVFLKWILHDWNDDDCVKILKNCKQAIPPRDVGGKVIIIDMVV  330

Query  203  DVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-GTSSLIQ  379
              +++ D   ++ Q+  DL +M   G  ER  +EW KIF +AGF DYK   + G  S+I+
Sbjct  331  G-SESSDNRHVETQVLFDLLVMTIDGA-ERDEQEWKKIFLEAGFEDYKIIPVLGVRSIIE  388

Query  380  LFP  388
            L+P
Sbjct  389  LYP  391



>ref|XP_009779391.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=351

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 95/129 (74%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
              +G  N+ +V G+MF+ IP A A+  KWI+H+W+D+DCVKILKKCK++I SRE+GGKVI
Sbjct  224  NFKGNGNVEFVGGSMFEKIPNANAILFKWILHNWSDEDCVKILKKCKDSIPSREEGGKVI  283

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQIG  361
            I+D++L+   N   E ++ Q Y+D+ MMV++  ++R   EW ++F DAGF +YK T  +G
Sbjct  284  IIDIVLE-NPNTSNEFVRAQHYMDMLMMVFYAAKQRTKMEWERLFTDAGFNEYKITPTLG  342

Query  362  TSSLIQLFP  388
            T SLI+++P
Sbjct  343  TRSLIEIYP  351



>ref|XP_004249745.2| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=304

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 98/130 (75%), Gaps = 5/130 (4%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+G++NL +VAG+MFQ IPPA AV LK I+HDWND++CVKILK CKEA+      GKV
Sbjct  179  ANLQGSENLEFVAGDMFQKIPPANAVLLKSILHDWNDEECVKILKNCKEALRG---SGKV  235

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTT-QI  358
            II+DM+++ T+  D+ES+Q Q+++D+ MMV+ G +ER  KEW K+F  +GFT YK    +
Sbjct  236  IIIDMVMENTE-LDDESVQAQLFIDMLMMVFVGSKERNEKEWEKLFSISGFTSYKIVLTL  294

Query  359  GTSSLIQLFP  388
            G  S+I+L+P
Sbjct  295  GLRSVIELYP  304



>gb|ADZ76434.1| myricetin O-methyltransferase 2 [Solanum habrochaites]
Length=355

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A  +G+ NL +VAG+MF  IP A A+ LKWI+H+W+D+DCVK+LKKCKE+ISSRE GGKV
Sbjct  227  ADRKGSGNLEFVAGSMFDKIPHANAILLKWILHNWDDEDCVKLLKKCKESISSRENGGKV  286

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQI  358
            II+DMI++   N +++ +Q+Q  +DL M + +  +ER  KEW K+F +AGF+ YK  T +
Sbjct  287  IIIDMIMEDNYN-NKQLVQSQHLMDLIMRITYASKERTEKEWEKLFLEAGFSGYKIITSL  345

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  346  GLRSLIEIYP  355



>ref|XP_004241912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=356

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A  +G+ NL +VAG+MF  IP A A+ LKWI+H+W+D+DCVK+LKKCKE+ISSRE GGKV
Sbjct  228  ADRKGSGNLEFVAGSMFDKIPHANAILLKWILHNWDDEDCVKLLKKCKESISSRENGGKV  287

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYK-TTQI  358
            II+DMI++   N +++ +Q+Q  +DL M + +  +ER  KEW K+F +AGF+ YK  T +
Sbjct  288  IIIDMIMEDNYN-NKQLVQSQHLMDLIMRITYASKERTEKEWEKLFLEAGFSGYKIITSL  346

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  347  GLRSLIEIYP  356



>ref|XP_010052388.1| PREDICTED: isoflavone 4'-O-methyltransferase-like [Eucalyptus 
grandis]
Length=139

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            AGLEGT+NL +V G+MF A+P A AV LKWI+HDW+D++ VKILK+CKEA+ S +K GKV
Sbjct  10   AGLEGTRNLKFVGGDMFNAVPSADAVLLKWILHDWSDEESVKILKRCKEAVLSNDKKGKV  69

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            +I+D+++      DE S+  ++  D+ M     G+ER  KEW  +F +AGFT+Y+ T + 
Sbjct  70   MIIDIVIGDESEEDEASMGIKLCFDIMMATLVLGKERNEKEWANLFQEAGFTEYRITPLE  129

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  130  GFRSLIEVYP  139



>gb|KDP24061.1| hypothetical protein JCGZ_25718 [Jatropha curcas]
Length=367

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 101/136 (74%), Gaps = 9/136 (7%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLK------WIMHDWNDDDCVKILKKCKEAISSR  163
            AGL+   NL +V G+MF+ IPPA A+ LK      WIMHDW+D+ C+KILK CKEAI  R
Sbjct  234  AGLQDGDNLKFVGGDMFEEIPPADAILLKACYYIYWIMHDWHDEKCIKILKNCKEAIKGR  293

Query  164  EKGGKVIIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDY  343
             KGGK+II+DM+++ TQ  D+++ + +++LD+ M+V + G+ER  KEW K+F+DAGF+D+
Sbjct  294  -KGGKLIIIDMVME-TQKEDKDATETELFLDMLMIVLYNGKERNKKEWAKLFFDAGFSDF  351

Query  344  KTTQI-GTSSLIQLFP  388
            K T + G  S+++++P
Sbjct  352  KITPVLGLRSVVEVYP  367



>gb|ABZ89567.1| O-methyltransferase 3 [Humulus lupulus]
Length=377

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 96/131 (73%), Gaps = 2/131 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAIS-SREKGGK  178
            A L+G  NL +V G+MF  +P  + V LKWI+HDWND++ VKILKKCKEAIS S +KGGK
Sbjct  247  ADLQGGNNLNFVGGDMFVDVPATEVVLLKWILHDWNDEESVKILKKCKEAISKSNKKGGK  306

Query  179  VIIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI  358
            VII+DM ++  ++ D+ES + Q++ D+ MM    G+ER  KEW K+F DAGF++YK T I
Sbjct  307  VIIIDMKVENEKDEDDESYETQLFFDMLMMALVTGRERNEKEWAKLFKDAGFSNYKITPI  366

Query  359  -GTSSLIQLFP  388
             G  SLI+++P
Sbjct  367  LGLRSLIEVYP  377



>ref|XP_008455549.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like, partial 
[Cucumis melo]
Length=266

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 94/127 (74%), Gaps = 2/127 (2%)
 Frame = +2

Query  11   EGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVIIV  190
            E   N  YV G+MF+ IPPA  + LKWI+HDW+D++CVKILK CKEAI+S  K GKV+++
Sbjct  141  EDQPNFKYVEGDMFKLIPPADTILLKWILHDWSDEECVKILKNCKEAITSNGKKGKVMVI  200

Query  191  DMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-GTS  367
            D++L  T+N D++SI++Q++ D+ MMV  GG+ER  KEW K+  +AGF+ YK   I G  
Sbjct  201  DLVLFNTKN-DQDSIESQLFFDMLMMVEVGGKEREEKEWAKLVKEAGFSAYKIFPILGLR  259

Query  368  SLIQLFP  388
            SLI+++P
Sbjct  260  SLIEIYP  266



>ref|XP_002525160.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37287.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 93/129 (72%), Gaps = 2/129 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVI  184
            GL+GT+NL YVAG+MF+AIPPA AV LKWIMH W  + CVK+LK CKEAI  + KGGK+I
Sbjct  229  GLQGTENLKYVAGDMFEAIPPADAVLLKWIMHGWTHEGCVKLLKLCKEAIKGK-KGGKLI  287

Query  185  IVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-G  361
            IVD++L+     D + ++ Q + D+ +M    G+E+  K+W K+F DAGF+DYK   I G
Sbjct  288  IVDLVLESQHVTDHQDVETQFFFDILLMTLQTGKEKNNKDWGKLFMDAGFSDYKINPILG  347

Query  362  TSSLIQLFP  388
              S+I+++P
Sbjct  348  LRSVIEVYP  356



>ref|XP_010110665.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27580.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 98/143 (69%), Gaps = 14/143 (10%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSR-EKGGK  178
            A L+G+KNL +V G+MF  IPPA A+F+KWI+HDW+D+DCVK+L++CK AI+ +  K GK
Sbjct  242  ADLQGSKNLKFVGGDMFDEIPPADAIFVKWILHDWSDEDCVKLLERCKVAITCKGNKNGK  301

Query  179  VIIVDMILDVTQNGDE------------ESIQNQIYLDLHMMVYHGGQERALKEWVKIFY  322
            VI+VDM++   QN  +            +S + Q++ D+ MMV   G+ER   EW K+F+
Sbjct  302  VILVDMVIVEEQNNKDIGHDHHAHDHDHQSYETQLFFDMLMMVLLSGRERKETEWAKLFF  361

Query  323  DAGFTDYKTTQI-GTSSLIQLFP  388
            DAGF+ YK T I G  SLI++FP
Sbjct  362  DAGFSTYKITPILGVRSLIEVFP  384



>ref|XP_006474725.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=365

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 97/130 (75%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+   NL YV GNMF+AIPPA AV +K ++H+WND++CVKILK CK+AI+   K GKV
Sbjct  237  ADLKSNGNLKYVGGNMFEAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKV  296

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+D+ ++ ++  D ++ + Q+++D+ MMV   G+ER  KEW K+F++AGF+DYK T + 
Sbjct  297  IIIDIKME-SEKADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVL  355

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  356  GVRSLIEVYP  365



>gb|KDO73905.1| hypothetical protein CISIN_1g017835mg [Citrus sinensis]
Length=365

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 97/130 (75%), Gaps = 2/130 (2%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            A L+   NL YV GNMF+AIPPA AV +K ++H+WND++CVKILK CK+AI+   K GKV
Sbjct  237  ADLKSNGNLKYVGGNMFEAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKV  296

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            II+D+ ++ ++  D ++ + Q+++D+ MMV   G+ER  KEW K+F++AGF+DYK T + 
Sbjct  297  IIIDIKME-SEKADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVL  355

Query  359  GTSSLIQLFP  388
            G  SLI+++P
Sbjct  356  GVRSLIEVYP  365



>emb|CDP21212.1| unnamed protein product [Coffea canephora]
Length=324

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 95/129 (74%), Gaps = 3/129 (2%)
 Frame = +2

Query  8    LEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSREKGGKVII  187
             EG  +L  V GNMF+AIPPA AV +KWI+ DW+DD+CV+ILKKCKEAI S+EK GKVII
Sbjct  194  FEGLNSLVDVGGNMFEAIPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKRGKVII  253

Query  188  VDMILDVTQNGDE--ESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQI-  358
            V+M     Q GD+  E+I+ Q++ D+ +MV   G++R  K+W K+F +AGF+DYK T + 
Sbjct  254  VEMFCKSQQKGDDDHEAIETQLFFDMAVMVLVKGRQRNEKDWAKLFTEAGFSDYKITAVL  313

Query  359  GTSSLIQLF  385
            G  S+I+++
Sbjct  314  GLRSIIEVY  322



>ref|XP_003607523.1| O-methyltransferase [Medicago truncatula]
Length=370

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 96/130 (74%), Gaps = 3/130 (2%)
 Frame = +2

Query  5    GLEGTKNLAYVAGNMFQAIPPAQAVFLK-WIMHDWNDDDCVKILKKCKEAISSREKGGKV  181
            GL+G++NL YV G+MF+AIPP  ++ LK  ++HDWND++C+KILKKCKEAI ++ K GKV
Sbjct  242  GLQGSENLKYVGGDMFEAIPPTHSILLKVGVLHDWNDEECLKILKKCKEAIGNKGKEGKV  301

Query  182  IIVDMILDVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFTDYKTTQ-I  358
            II+D ++   +  D ESI+ Q++ DL MMV   G+ER  KEW  +F  AGF++YK T  +
Sbjct  302  IIIDAVMG-NEKEDNESIEAQLFYDLEMMVLVNGKERNEKEWSNLFLSAGFSNYKITHGL  360

Query  359  GTSSLIQLFP  388
            G  SLI++FP
Sbjct  361  GFKSLIEVFP  370



>ref|XP_010110664.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27579.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=377

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 95/138 (69%), Gaps = 9/138 (7%)
 Frame = +2

Query  2    AGLEGTKNLAYVAGNMFQAIPPAQAVFLKWIMHDWNDDDCVKILKKCKEAISSR-EKGGK  178
            A L+G+ NL +V G+MF  IPPA A+F+KWI+HDW+D+DCVK+LK+CK AI+ +  K GK
Sbjct  240  ADLQGSTNLKFVGGDMFDEIPPADAIFMKWILHDWSDEDCVKLLKRCKVAITCKGNKNGK  299

Query  179  VIIVDMIL-------DVTQNGDEESIQNQIYLDLHMMVYHGGQERALKEWVKIFYDAGFT  337
            VI+VDM++       D+  + D +  + QI  D+ MMV   G+ER   EW K+F DAGF+
Sbjct  300  VILVDMVIVEKQNNKDIGHDHDHQLYETQILFDMLMMVSFPGRERKETEWAKLFSDAGFS  359

Query  338  DYKTTQI-GTSSLIQLFP  388
             YK T I G  SLI++FP
Sbjct  360  TYKITPILGVRSLIEVFP  377



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 910113435382