BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23955_g1_i2 len=1500 path=[249:0-325 572:326-326 179:327-352
597:353-380 @158@!:381-1101 1345:1102-1150 1394:1151-1240
1483:1241-1241 224:1242-1259 1501:1260-1353 1595:1354-1499]

Length=1500
                                                                      Score     E

ref|XP_009623248.1|  PREDICTED: protein trichome birefringence-li...    528   0.0      
ref|XP_006338288.1|  PREDICTED: uncharacterized protein LOC102586...    507   3e-173   
ref|XP_009801263.1|  PREDICTED: protein trichome birefringence-li...    506   7e-173   
ref|XP_010316194.1|  PREDICTED: protein trichome birefringence-li...    499   5e-170   
ref|XP_004232104.1|  PREDICTED: protein trichome birefringence-li...    492   3e-167   
ref|XP_002279418.3|  PREDICTED: protein trichome birefringence-li...    484   9e-164   Vitis vinifera
emb|CBI16874.3|  unnamed protein product                                485   1e-159   
ref|XP_002305967.2|  hypothetical protein POPTR_0004s10520g             468   5e-158   Populus trichocarpa [western balsam poplar]
ref|XP_002305968.1|  hypothetical protein POPTR_0004s10530g             463   6e-157   Populus trichocarpa [western balsam poplar]
ref|XP_011046773.1|  PREDICTED: protein trichome birefringence-li...    464   1e-156   
ref|XP_007033403.1|  Trichome birefringence-like 21, putative           464   3e-156   
ref|XP_006373480.1|  hypothetical protein POPTR_0017s14160g             462   7e-156   
ref|XP_007217577.1|  hypothetical protein PRUPE_ppa019350mg             461   3e-155   
ref|XP_011021178.1|  PREDICTED: protein trichome birefringence-li...    461   6e-155   
ref|XP_002533953.1|  conserved hypothetical protein                     459   7e-155   Ricinus communis
emb|CDP02388.1|  unnamed protein product                                473   1e-154   
ref|XP_009371026.1|  PREDICTED: protein trichome birefringence-li...    457   1e-153   
ref|XP_008341845.1|  PREDICTED: protein trichome birefringence-li...    456   1e-153   
gb|KDP24359.1|  hypothetical protein JCGZ_25655                         456   2e-153   
ref|XP_011046774.1|  PREDICTED: protein trichome birefringence-li...    457   2e-153   
ref|XP_008379493.1|  PREDICTED: protein trichome birefringence-li...    456   3e-153   
ref|XP_008230368.1|  PREDICTED: protein trichome birefringence-li...    455   6e-153   
ref|XP_010257818.1|  PREDICTED: protein trichome birefringence-li...    454   3e-152   
ref|XP_006430841.1|  hypothetical protein CICLE_v10011798mg             453   4e-152   
gb|KDO58902.1|  hypothetical protein CISIN_1g014192mg                   452   5e-152   
ref|XP_006482315.1|  PREDICTED: protein YLS7-like                       452   1e-151   
ref|XP_010660516.1|  PREDICTED: protein trichome birefringence-li...    450   4e-151   
ref|XP_009357005.1|  PREDICTED: protein trichome birefringence-li...    449   1e-150   
gb|KDO58901.1|  hypothetical protein CISIN_1g014192mg                   447   7e-150   
gb|KDO58899.1|  hypothetical protein CISIN_1g013284mg                   448   7e-150   
ref|XP_008230365.1|  PREDICTED: protein trichome birefringence-li...    446   2e-149   
ref|XP_010660517.1|  PREDICTED: protein trichome birefringence-li...    444   5e-149   
emb|CDP02390.1|  unnamed protein product                                444   6e-149   
ref|XP_006430842.1|  hypothetical protein CICLE_v10011721mg             445   1e-148   
ref|XP_006482316.1|  PREDICTED: protein YLS7-like                       444   3e-148   
ref|XP_004306034.1|  PREDICTED: uncharacterized protein LOC101310633    443   1e-147   
ref|XP_007216034.1|  hypothetical protein PRUPE_ppa017420mg             441   1e-147   
ref|XP_002305969.2|  hypothetical protein POPTR_0004s10540g             442   2e-147   Populus trichocarpa [western balsam poplar]
ref|XP_009371024.1|  PREDICTED: protein trichome birefringence-li...    440   7e-147   
ref|XP_004507246.1|  PREDICTED: uncharacterized protein LOC101494718    437   5e-146   
ref|XP_011046772.1|  PREDICTED: protein trichome birefringence-li...    437   1e-145   
ref|XP_002533952.1|  conserved hypothetical protein                     432   1e-145   Ricinus communis
ref|XP_010029470.1|  PREDICTED: protein trichome birefringence-li...    437   2e-145   
ref|XP_010100920.1|  hypothetical protein L484_009690                   432   1e-143   
ref|XP_007151467.1|  hypothetical protein PHAVU_004G049000g             431   1e-143   
ref|XP_007033404.1|  Trichome birefringence-like 19                     431   2e-143   
emb|CBI16875.3|  unnamed protein product                                447   8e-143   
ref|XP_003555087.1|  PREDICTED: protein YLS7-like                       429   8e-143   
gb|KHN13805.1|  hypothetical protein glysoja_016089                     432   9e-143   
gb|ACU18746.1|  unknown                                                 428   4e-142   Glycine max [soybeans]
ref|XP_003551794.1|  PREDICTED: protein YLS7-like                       432   5e-142   
gb|KDP24358.1|  hypothetical protein JCGZ_25654                         426   6e-142   
gb|ADN34288.1|  hypothetical protein                                    425   2e-141   
ref|XP_008783107.1|  PREDICTED: protein trichome birefringence-li...    426   3e-141   
ref|XP_008459429.1|  PREDICTED: protein trichome birefringence-li...    425   5e-141   
ref|XP_010100921.1|  hypothetical protein L484_009691                   424   6e-141   
gb|AGV54842.1|  hypothetical protein                                    424   8e-141   
ref|XP_008459430.1|  PREDICTED: protein trichome birefringence-li...    424   2e-140   
ref|XP_002279300.3|  PREDICTED: protein trichome birefringence-li...    424   3e-140   Vitis vinifera
ref|XP_010265350.1|  PREDICTED: protein trichome birefringence-li...    422   4e-140   
gb|KGN52558.1|  hypothetical protein Csa_5G643370                       422   5e-140   
ref|XP_010040297.1|  PREDICTED: protein trichome birefringence-li...    423   5e-140   
ref|XP_010929090.1|  PREDICTED: protein trichome birefringence-li...    423   7e-140   
ref|XP_004141489.1|  PREDICTED: uncharacterized protein LOC101210919    422   8e-140   
gb|KHN28369.1|  hypothetical protein glysoja_029630                     419   3e-139   
ref|XP_003555082.1|  PREDICTED: protein YLS7-like                       420   3e-139   
ref|XP_009395507.1|  PREDICTED: protein trichome birefringence-li...    421   4e-139   
ref|XP_007151463.1|  hypothetical protein PHAVU_004G048700g             419   5e-139   
ref|XP_006593718.1|  PREDICTED: protein YLS7-like                       419   6e-139   
gb|KEH25274.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    419   9e-139   
ref|XP_007139339.1|  hypothetical protein PHAVU_008G021100g             418   1e-138   
ref|XP_003554973.1|  PREDICTED: protein YLS7-like                       419   1e-138   
gb|ACU23707.1|  unknown                                                 417   3e-138   Glycine max [soybeans]
ref|XP_004156230.1|  PREDICTED: uncharacterized LOC101210676            416   3e-138   
ref|XP_004141488.1|  PREDICTED: uncharacterized protein LOC101210676    417   5e-138   
ref|XP_003543902.1|  PREDICTED: protein YLS7-like                       417   7e-138   
ref|XP_004491779.1|  PREDICTED: uncharacterized protein LOC101494653    417   7e-138   
gb|AFK44713.1|  unknown                                                 416   1e-137   
ref|XP_009357003.1|  PREDICTED: protein trichome birefringence-li...    417   1e-137   
ref|XP_008357813.1|  PREDICTED: protein trichome birefringence-li...    417   1e-137   
gb|KEH21842.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    416   2e-137   
ref|XP_010029464.1|  PREDICTED: protein trichome birefringence-li...    416   2e-137   
ref|XP_003555085.1|  PREDICTED: protein YLS7-like                       414   5e-137   
gb|KHG26986.1|  putative C7orf58                                        414   2e-136   
ref|XP_006844211.1|  hypothetical protein AMTR_s00006p00266110          414   2e-136   
ref|XP_004304156.1|  PREDICTED: uncharacterized protein LOC101297564    413   5e-136   
gb|KHN28370.1|  hypothetical protein glysoja_029631                     410   7e-136   
ref|XP_008230367.1|  PREDICTED: protein trichome birefringence-li...    412   1e-135   
gb|KEH25275.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    410   3e-135   
ref|XP_007139340.1|  hypothetical protein PHAVU_008G021200g             410   4e-135   
emb|CDP02387.1|  unnamed protein product                                407   2e-134   
ref|XP_009768257.1|  PREDICTED: protein trichome birefringence-li...    409   2e-134   
gb|KHN28371.1|  hypothetical protein glysoja_029632                     407   3e-134   
ref|XP_006601780.1|  PREDICTED: uncharacterized protein LOC100527...    408   3e-134   
gb|KHG26987.1|  putative C7orf58                                        407   4e-134   
ref|XP_009371027.1|  PREDICTED: protein trichome birefringence-li...    407   5e-134   
emb|CDP02386.1|  unnamed protein product                                410   6e-134   
ref|XP_008341846.1|  PREDICTED: protein trichome birefringence-li...    406   1e-133   
ref|XP_006844210.1|  hypothetical protein AMTR_s00006p00266030          406   1e-133   
ref|XP_010262152.1|  PREDICTED: protein trichome birefringence-li...    405   2e-133   
ref|XP_010100922.1|  hypothetical protein L484_009692                   404   7e-133   
ref|XP_010257817.1|  PREDICTED: protein trichome birefringence-li...    404   9e-133   
ref|XP_009775178.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    401   3e-132   
ref|XP_011099297.1|  PREDICTED: protein trichome birefringence-li...    402   4e-132   
gb|KHN14479.1|  hypothetical protein glysoja_029741                     402   6e-132   
ref|XP_009801267.1|  PREDICTED: protein trichome birefringence-li...    405   1e-131   
ref|XP_010692278.1|  PREDICTED: protein trichome birefringence-li...    401   1e-131   
ref|XP_009594677.1|  PREDICTED: protein trichome birefringence-li...    401   2e-131   
emb|CDP19314.1|  unnamed protein product                                398   1e-130   
ref|XP_006338761.1|  PREDICTED: uncharacterized protein LOC102597459    400   7e-130   
ref|XP_006400116.1|  hypothetical protein EUTSA_v10013629mg             396   7e-130   
ref|XP_009623245.1|  PREDICTED: protein trichome birefringence-li...    400   1e-129   
ref|XP_009395269.1|  PREDICTED: protein trichome birefringence-li...    397   2e-129   
ref|XP_004233652.1|  PREDICTED: protein trichome birefringence-li...    399   2e-129   
emb|CDY34729.1|  BnaA01g32960D                                          396   3e-129   
ref|XP_009118032.1|  PREDICTED: protein trichome birefringence-li...    396   5e-129   
ref|XP_009605806.1|  PREDICTED: protein trichome birefringence-li...    393   1e-128   
ref|XP_006365644.1|  PREDICTED: uncharacterized protein LOC102595520    394   1e-128   
ref|XP_011099299.1|  PREDICTED: protein trichome birefringence-li...    394   2e-128   
ref|XP_006300170.1|  hypothetical protein CARUB_v10016401mg             392   4e-128   
ref|XP_004233404.1|  PREDICTED: protein trichome birefringence-li...    392   5e-128   
ref|XP_009623683.1|  PREDICTED: protein trichome birefringence-li...    391   7e-128   
ref|XP_009801264.1|  PREDICTED: protein trichome birefringence-li...    391   7e-128   
ref|XP_010549949.1|  PREDICTED: protein trichome birefringence-li...    390   2e-127   
ref|XP_009774615.1|  PREDICTED: protein trichome birefringence-li...    390   3e-127   
ref|XP_009767997.1|  PREDICTED: protein trichome birefringence-li...    389   5e-127   
ref|XP_009623247.1|  PREDICTED: protein trichome birefringence-li...    388   8e-127   
ref|XP_003541704.1|  PREDICTED: protein YLS7-like                       387   1e-126   
ref|XP_011085560.1|  PREDICTED: protein trichome birefringence-li...    385   2e-126   
ref|XP_010549950.1|  PREDICTED: protein trichome birefringence-li...    387   3e-126   
ref|XP_002873749.1|  hypothetical protein ARALYDRAFT_488438             386   6e-126   
ref|XP_010262140.1|  PREDICTED: protein trichome birefringence-li...    386   8e-126   
emb|CAN73683.1|  hypothetical protein VITISV_016120                     383   8e-126   Vitis vinifera
ref|XP_006338290.1|  PREDICTED: uncharacterized protein LOC102586...    386   8e-126   
ref|XP_009623246.1|  PREDICTED: protein trichome birefringence-li...    385   2e-125   
ref|XP_010467973.1|  PREDICTED: protein trichome birefringence-li...    386   2e-125   
ref|XP_004233405.1|  PREDICTED: protein trichome birefringence-li...    384   3e-125   
ref|XP_004514421.1|  PREDICTED: uncharacterized protein LOC101496510    384   3e-125   
ref|NP_197094.1|  protein trichome birefringence-like 19                382   1e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008461577.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    383   1e-124   
ref|XP_004232107.1|  PREDICTED: protein trichome birefringence-li...    382   2e-124   
emb|CDP02551.1|  unnamed protein product                                397   3e-124   
ref|XP_010692310.1|  PREDICTED: protein trichome birefringence-li...    381   3e-124   
gb|EYU39365.1|  hypothetical protein MIMGU_mgv1a004599mg                385   4e-124   
gb|KHN09539.1|  hypothetical protein glysoja_049688                     378   4e-124   
gb|EPS57802.1|  hypothetical protein M569_17015                         378   4e-124   
emb|CDP02553.1|  unnamed protein product                                397   4e-124   
ref|XP_009121537.1|  PREDICTED: protein trichome birefringence-li...    382   5e-124   
ref|XP_006286845.1|  hypothetical protein CARUB_v10003873mg             380   7e-124   
ref|XP_006346862.1|  PREDICTED: uncharacterized protein LOC102584725    380   1e-123   
gb|EYU44284.1|  hypothetical protein MIMGU_mgv1a006950mg                380   1e-123   
ref|XP_007148050.1|  hypothetical protein PHAVU_006G176300g             379   2e-123   
ref|XP_004145657.1|  PREDICTED: uncharacterized protein LOC101212650    380   2e-123   
ref|XP_009801265.1|  PREDICTED: protein trichome birefringence-li...    379   4e-123   
ref|XP_010029461.1|  PREDICTED: protein trichome birefringence-li...    376   6e-123   
sp|Q9M896.2|TBL20_ARATH  RecName: Full=Protein trichome birefring...    379   1e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004234695.1|  PREDICTED: protein trichome birefringence-li...    377   3e-122   
gb|KHN15257.1|  hypothetical protein glysoja_046990                     373   3e-122   
ref|XP_004232106.1|  PREDICTED: protein trichome birefringence-li...    376   5e-122   
ref|XP_007215656.1|  hypothetical protein PRUPE_ppa008330mg             372   7e-122   
gb|AFK43919.1|  unknown                                                 372   9e-122   
ref|XP_010692289.1|  PREDICTED: protein trichome birefringence-li...    375   9e-122   
ref|XP_009121535.1|  PREDICTED: protein trichome birefringence-li...    375   1e-121   
gb|KHN28368.1|  hypothetical protein glysoja_029629                     370   2e-121   
gb|EPS67152.1|  hypothetical protein M569_07623                         377   3e-121   
ref|XP_010525312.1|  PREDICTED: protein trichome birefringence-li...    377   3e-121   
ref|XP_010492443.1|  PREDICTED: protein trichome birefringence-li...    372   1e-120   
ref|XP_010097815.1|  hypothetical protein L484_009121                   369   2e-120   
emb|CDP02547.1|  unnamed protein product                                372   4e-120   
ref|XP_006400115.1|  hypothetical protein EUTSA_v10015268mg             374   5e-120   
ref|XP_006338291.1|  PREDICTED: uncharacterized protein LOC102586...    370   1e-119   
gb|EYU44283.1|  hypothetical protein MIMGU_mgv1a005621mg                371   2e-119   
gb|EYU44282.1|  hypothetical protein MIMGU_mgv1a007070mg                368   4e-119   
emb|CDX69489.1|  BnaA10g18380D                                          380   4e-119   
ref|XP_006365643.1|  PREDICTED: uncharacterized protein LOC102595198    369   5e-119   
gb|KEH36591.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    367   8e-119   
ref|XP_009411154.1|  PREDICTED: uncharacterized protein LOC103992946    381   2e-118   
gb|EYU44288.1|  hypothetical protein MIMGU_mgv1a006956mg                367   2e-118   
ref|XP_011099298.1|  PREDICTED: protein trichome birefringence-li...    370   4e-118   
emb|CDY69475.1|  BnaCnng63710D                                          365   4e-118   
ref|XP_010420267.1|  PREDICTED: protein trichome birefringence-li...    365   9e-118   
ref|XP_010453740.1|  PREDICTED: protein trichome birefringence-li...    365   1e-117   
emb|CDY26474.1|  BnaC09g41940D                                          366   4e-117   
ref|XP_010492444.1|  PREDICTED: protein trichome birefringence-li...    366   9e-117   
ref|XP_006289546.1|  hypothetical protein CARUB_v10003090mg             365   1e-116   
ref|XP_010420269.1|  PREDICTED: protein trichome birefringence-li...    366   1e-116   
ref|XP_010453739.1|  PREDICTED: protein trichome birefringence-li...    365   1e-116   
ref|XP_010041154.1|  PREDICTED: protein trichome birefringence-li...    360   4e-116   
gb|KCW44585.1|  hypothetical protein EUGRSUZ_L01896                     359   4e-116   
ref|XP_010549948.1|  PREDICTED: protein trichome birefringence-li...    361   6e-116   
ref|XP_010029465.1|  PREDICTED: protein trichome birefringence-li...    360   3e-115   
gb|KCW56388.1|  hypothetical protein EUGRSUZ_I02116                     353   9e-114   
ref|XP_010030809.1|  PREDICTED: protein trichome birefringence-li...    355   2e-113   
gb|KHN15256.1|  hypothetical protein glysoja_046989                     349   3e-113   
ref|XP_009391262.1|  PREDICTED: protein trichome birefringence-li...    351   3e-112   
ref|NP_197093.1|  protein trichome birefringence-like 21                354   4e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007148049.1|  hypothetical protein PHAVU_006G176200g             349   6e-112   
ref|NP_001057369.1|  Os06g0273500                                       347   4e-111   Oryza sativa Japonica Group [Japonica rice]
gb|AFW86321.1|  hypothetical protein ZEAMMB73_999343                    347   1e-110   
gb|KFK25826.1|  hypothetical protein AALP_AA8G166300                    343   1e-109   
gb|KHN08438.1|  hypothetical protein glysoja_014203                     343   2e-109   
ref|XP_003547168.1|  PREDICTED: protein YLS7-like                       342   3e-109   
gb|EEC80380.1|  hypothetical protein OsI_22500                          342   4e-109   Oryza sativa Indica Group [Indian rice]
dbj|BAK06440.1|  predicted protein                                      342   5e-109   
ref|NP_001057366.1|  Os06g0272900                                       341   3e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002458240.1|  hypothetical protein SORBIDRAFT_03g029740          339   5e-108   Sorghum bicolor [broomcorn]
gb|EMS53497.1|  hypothetical protein TRIUR3_18620                       338   2e-107   
ref|XP_004969337.1|  PREDICTED: uncharacterized protein LOC101767478    337   2e-107   
ref|XP_002438227.1|  hypothetical protein SORBIDRAFT_10g009930          337   2e-106   Sorghum bicolor [broomcorn]
ref|NP_001144354.1|  uncharacterized protein LOC100277263               334   5e-106   Zea mays [maize]
emb|CDM83559.1|  unnamed protein product                                334   5e-106   
gb|ACG34463.1|  hypothetical protein                                    333   2e-105   Zea mays [maize]
ref|XP_006644448.1|  PREDICTED: protein YLS7-like                       331   8e-105   
gb|EMT28803.1|  hypothetical protein F775_32535                         330   2e-104   
ref|NP_001172486.1|  Os01g0652800                                       330   2e-104   
ref|XP_006644449.1|  PREDICTED: protein YLS7-like                       329   2e-104   
ref|XP_003569468.1|  PREDICTED: protein trichome birefringence-li...    330   2e-104   
ref|NP_001043741.1|  Os01g0653100                                       328   4e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80379.1|  hypothetical protein OsI_22498                          325   4e-102   Oryza sativa Indica Group [Indian rice]
gb|EAZ36599.1|  hypothetical protein OsJ_20944                          325   4e-102   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001174709.1|  Os06g0273200                                       324   1e-101   
gb|EMS60648.1|  hypothetical protein TRIUR3_31576                       322   2e-101   
gb|ACF88461.1|  unknown                                                 322   3e-101   Zea mays [maize]
tpg|DAA49901.1|  TPA: putative DUF231 domain containing family pr...    323   3e-101   
ref|XP_009344545.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       323   4e-101   
dbj|BAJ85800.1|  predicted protein                                      321   5e-101   
ref|XP_003569471.1|  PREDICTED: protein trichome birefringence-li...    320   7e-101   
ref|XP_004156178.1|  PREDICTED: uncharacterized protein LOC101226868    318   2e-100   
emb|CDM83560.1|  unnamed protein product                                320   2e-100   
dbj|BAD68438.1|  leaf senescence protein-like                           319   5e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007215434.1|  hypothetical protein PRUPE_ppa006176mg             319   5e-100   
ref|XP_008379275.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like...    317   9e-100   
ref|NP_001143774.1|  uncharacterized protein LOC100276538               318   9e-100   Zea mays [maize]
ref|XP_008230649.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       319   1e-99    
gb|EEC80378.1|  hypothetical protein OsI_22495                          318   2e-99    Oryza sativa Indica Group [Indian rice]
gb|EEE65487.1|  hypothetical protein OsJ_20907                          316   5e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002467212.1|  hypothetical protein SORBIDRAFT_01g021430          317   5e-99    Sorghum bicolor [broomcorn]
ref|XP_008379274.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like...    318   5e-99    
ref|XP_009348027.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       316   1e-98    
ref|XP_009349865.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       316   2e-98    
ref|XP_008341734.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       315   3e-98    
emb|CDX69491.1|  BnaA10g18400D                                          312   3e-97    
ref|XP_010262165.1|  PREDICTED: protein trichome birefringence-li...    307   5e-97    
ref|XP_002456067.1|  hypothetical protein SORBIDRAFT_03g029760          309   1e-96    Sorghum bicolor [broomcorn]
ref|XP_004966894.1|  PREDICTED: uncharacterized protein LOC101775275    322   2e-96    
ref|XP_008675270.1|  PREDICTED: protein trichome birefringence-li...    306   2e-95    
ref|XP_002454344.1|  hypothetical protein SORBIDRAFT_04g029130          308   3e-95    Sorghum bicolor [broomcorn]
ref|NP_001048004.1|  Os02g0729100                                       305   1e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004953787.1|  PREDICTED: uncharacterized protein LOC101785560    305   3e-94    
ref|XP_004969338.1|  PREDICTED: uncharacterized protein LOC101767878    303   3e-94    
emb|CDP08706.1|  unnamed protein product                                305   3e-94    
gb|EAY87385.1|  hypothetical protein OsI_08790                          307   4e-94    Oryza sativa Indica Group [Indian rice]
ref|XP_006649011.1|  PREDICTED: protein YLS7-like                       303   5e-94    
dbj|BAD16346.1|  leaf senescence protein-like                           306   7e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656873.1|  PREDICTED: protein YLS7-like                       301   1e-93    
gb|EMT09594.1|  hypothetical protein F775_11955                         300   6e-93    
ref|XP_010266458.1|  PREDICTED: protein trichome birefringence-li...    301   1e-92    
ref|XP_002324017.2|  hypothetical protein POPTR_0017s11000g             300   1e-92    Populus trichocarpa [western balsam poplar]
ref|XP_004306329.1|  PREDICTED: uncharacterized protein LOC101313633    300   1e-92    
ref|XP_010029215.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       300   1e-92    
ref|NP_001136770.1|  uncharacterized protein LOC100216912               301   1e-92    Zea mays [maize]
ref|XP_010272016.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       300   2e-92    
ref|XP_002517379.1|  conserved hypothetical protein                     299   2e-92    Ricinus communis
ref|XP_007151466.1|  hypothetical protein PHAVU_004G0489000g            293   4e-92    
ref|XP_009781636.1|  PREDICTED: protein trichome birefringence-li...    298   8e-92    
ref|XP_010928573.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       295   8e-92    
gb|AFW86320.1|  hypothetical protein ZEAMMB73_404173                    297   9e-92    
ref|XP_008364824.1|  PREDICTED: protein trichome birefringence-li...    298   1e-91    
gb|EMT27413.1|  hypothetical protein F775_21598                         298   1e-91    
gb|KFK25820.1|  hypothetical protein AALP_AA8G165600                    304   1e-91    
ref|XP_009377275.1|  PREDICTED: protein trichome birefringence-li...    298   1e-91    
ref|XP_009377274.1|  PREDICTED: protein trichome birefringence-li...    298   2e-91    
ref|XP_010660953.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       297   2e-91    
dbj|BAK02120.1|  predicted protein                                      297   2e-91    
ref|XP_011014642.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       296   2e-91    
ref|XP_007031385.1|  Trichome birefringence-like 22, putative           297   2e-91    
ref|XP_011093049.1|  PREDICTED: protein trichome birefringence-li...    297   2e-91    
dbj|BAD16347.1|  leaf senescence protein-like                           296   3e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003563965.2|  PREDICTED: uncharacterized protein LOC100832533    307   3e-91    
ref|XP_007051604.1|  Trichome birefringence-like 25 isoform 2           297   3e-91    
gb|KHG05355.1|  Poly (U)-specific endoribonuclease                      297   3e-91    
gb|EAY87386.1|  hypothetical protein OsI_08791                          296   3e-91    
gb|EAZ24488.1|  hypothetical protein OsJ_08246                          296   3e-91    
gb|EMT32337.1|  hypothetical protein F775_52454                         296   4e-91    
gb|EMS49529.1|  hypothetical protein TRIUR3_05712                       295   1e-90    
ref|XP_004503639.1|  PREDICTED: uncharacterized protein LOC101504184    295   1e-90    
ref|XP_004139657.1|  PREDICTED: uncharacterized protein LOC101209033    294   3e-90    
ref|XP_006836712.1|  hypothetical protein AMTR_s00088p00114920          293   5e-90    
ref|XP_010667526.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       294   5e-90    
gb|KDP25324.1|  hypothetical protein JCGZ_20480                         293   6e-90    
ref|XP_009614680.1|  PREDICTED: protein trichome birefringence-li...    292   9e-90    
ref|XP_006395376.1|  hypothetical protein EUTSA_v10005387mg             292   9e-90    
ref|XP_003570452.1|  PREDICTED: protein trichome birefringence-li...    292   1e-89    
ref|XP_006343880.1|  PREDICTED: uncharacterized protein LOC102595082    293   1e-89    
ref|XP_007051603.1|  Trichome birefringence-like 25 isoform 1           293   2e-89    
dbj|BAJ95300.1|  predicted protein                                      291   2e-89    
gb|EPS73359.1|  hypothetical protein M569_01397                         286   3e-89    
ref|XP_004154454.1|  PREDICTED: uncharacterized LOC101209033            291   4e-89    
emb|CAN70903.1|  hypothetical protein VITISV_028215                     290   5e-89    
ref|XP_004308318.1|  PREDICTED: uncharacterized protein LOC101298841    292   5e-89    
ref|XP_010659042.1|  PREDICTED: protein trichome birefringence-li...    290   7e-89    
ref|XP_008349994.1|  PREDICTED: protein trichome birefringence-li...    291   7e-89    
ref|XP_002454343.1|  hypothetical protein SORBIDRAFT_04g029120          290   8e-89    
ref|XP_010053104.1|  PREDICTED: protein trichome birefringence-li...    290   1e-88    
ref|XP_011073699.1|  PREDICTED: protein trichome birefringence-li...    290   1e-88    
gb|KHG11383.1|  Integrator complex subunit 9                            289   1e-88    
ref|XP_002877090.1|  predicted protein                                  289   1e-88    
ref|XP_007151116.1|  hypothetical protein PHAVU_004G019300g             290   1e-88    
ref|XP_006584756.1|  PREDICTED: protein YLS7-like                       290   1e-88    
ref|XP_002533910.1|  conserved hypothetical protein                     290   1e-88    
dbj|BAK07124.1|  predicted protein                                      289   2e-88    
ref|XP_003572982.1|  PREDICTED: protein trichome birefringence-li...    289   2e-88    
ref|XP_010104979.1|  hypothetical protein L484_012063                   290   2e-88    
ref|XP_010261504.1|  PREDICTED: protein trichome birefringence-li...    289   3e-88    
ref|XP_002301401.1|  hypothetical protein POPTR_0002s16980g             289   3e-88    
emb|CDP12131.1|  unnamed protein product                                289   4e-88    
ref|XP_002320186.2|  hypothetical protein POPTR_0014s09150g             288   5e-88    
gb|KEH21199.1|  trichome birefringence-like protein                     288   5e-88    
ref|NP_001057365.1|  Os06g0272800                                       298   6e-88    
ref|XP_004245535.1|  PREDICTED: protein trichome birefringence-li...    288   6e-88    
ref|XP_003525351.1|  PREDICTED: protein YLS7-like                       288   8e-88    
ref|XP_010261503.1|  PREDICTED: protein trichome birefringence-li...    290   1e-87    
gb|EAZ36596.1|  hypothetical protein OsJ_20940                          298   1e-87    
ref|XP_010425598.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       286   1e-87    
ref|XP_006470397.1|  PREDICTED: protein YLS7-like                       286   2e-87    
ref|XP_004489478.1|  PREDICTED: uncharacterized protein LOC101514313    284   2e-87    
ref|XP_011023213.1|  PREDICTED: protein trichome birefringence-li...    286   2e-87    
ref|XP_011037821.1|  PREDICTED: protein trichome birefringence-li...    287   2e-87    
gb|EPS71517.1|  hypothetical protein M569_03240                         284   2e-87    
ref|XP_011023212.1|  PREDICTED: protein trichome birefringence-li...    286   3e-87    
gb|KHG16129.1|  Transmembrane protein                                   286   3e-87    
ref|NP_189454.1|  protein trichome birefringence-like 22                286   3e-87    
gb|KHN13296.1|  hypothetical protein glysoja_016473                     284   4e-87    
ref|XP_008461516.1|  PREDICTED: protein trichome birefringence-li...    285   4e-87    
ref|XP_010055039.1|  PREDICTED: protein trichome birefringence-li...    286   5e-87    
emb|CDP07155.1|  unnamed protein product                                286   5e-87    
gb|KDP45397.1|  hypothetical protein JCGZ_09646                         285   6e-87    
ref|XP_009599660.1|  PREDICTED: protein trichome birefringence-li...    285   6e-87    
ref|XP_006405539.1|  hypothetical protein EUTSA_v10028055mg             285   7e-87    
gb|AFK39752.1|  unknown                                                 285   7e-87    
emb|CBI40485.3|  unnamed protein product                                285   9e-87    
ref|XP_008233209.1|  PREDICTED: protein trichome birefringence-li...    285   1e-86    
ref|XP_002276755.2|  PREDICTED: protein trichome birefringence-li...    285   2e-86    
ref|XP_002299487.1|  hypothetical protein POPTR_0001s10400g             284   2e-86    
ref|XP_006291239.1|  hypothetical protein CARUB_v10017371mg             283   2e-86    
ref|XP_002884319.1|  hypothetical protein ARALYDRAFT_477478             282   2e-86    
emb|CDX85188.1|  BnaC07g24990D                                          283   3e-86    
ref|XP_010502815.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like...    283   3e-86    
ref|XP_008239061.1|  PREDICTED: protein trichome birefringence-li...    285   3e-86    
ref|XP_003543831.2|  PREDICTED: protein YLS7-like                       285   3e-86    
ref|XP_011093517.1|  PREDICTED: protein trichome birefringence-li...    283   4e-86    
ref|XP_001768862.1|  predicted protein                                  281   4e-86    
ref|XP_002960119.1|  hypothetical protein SELMODRAFT_75504              280   5e-86    
ref|XP_007147289.1|  hypothetical protein PHAVU_006G111300g             283   6e-86    
ref|XP_002984022.1|  hypothetical protein SELMODRAFT_119110             280   7e-86    
ref|XP_007209974.1|  hypothetical protein PRUPE_ppa005023mg             284   7e-86    
ref|XP_011026917.1|  PREDICTED: protein trichome birefringence-li...    283   7e-86    
ref|XP_010528272.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       282   7e-86    
ref|XP_009759126.1|  PREDICTED: protein trichome birefringence-li...    283   7e-86    
ref|XP_002993955.1|  hypothetical protein SELMODRAFT_137923             280   8e-86    
ref|XP_002303634.1|  hypothetical protein POPTR_0003s13760g             283   8e-86    
ref|XP_009596471.1|  PREDICTED: protein trichome birefringence-li...    283   1e-85    
ref|XP_010544427.1|  PREDICTED: protein trichome birefringence-li...    282   1e-85    
ref|XP_009599996.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       282   1e-85    
emb|CDX86449.1|  BnaA06g31660D                                          281   1e-85    
ref|XP_002509933.1|  conserved hypothetical protein                     283   1e-85    
ref|XP_003553780.1|  PREDICTED: protein YLS7-like isoform X1            282   2e-85    
ref|XP_009151894.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       281   2e-85    
gb|KHN43112.1|  hypothetical protein glysoja_001695                     282   2e-85    
ref|XP_009395506.1|  PREDICTED: protein trichome birefringence-li...    276   2e-85    
gb|EEE52401.1|  hypothetical protein OsJ_34506                          291   3e-85    
emb|CDY04008.1|  BnaC02g37230D                                          280   3e-85    
ref|XP_011022527.1|  PREDICTED: protein trichome birefringence-li...    282   4e-85    
ref|XP_011022528.1|  PREDICTED: protein trichome birefringence-li...    282   4e-85    
ref|XP_011098515.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       281   4e-85    
ref|XP_004987391.1|  PREDICTED: uncharacterized protein LOC101757316    280   5e-85    
emb|CAN82134.1|  hypothetical protein VITISV_002644                     299   5e-85    
ref|XP_006833503.1|  hypothetical protein AMTR_s00093p00042400          281   5e-85    
ref|XP_006439387.1|  hypothetical protein CICLE_v10020137mg             279   5e-85    
ref|XP_006307480.1|  hypothetical protein CARUB_v10009105mg             281   8e-85    
ref|XP_010514526.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       279   8e-85    
ref|XP_002962985.1|  hypothetical protein SELMODRAFT_404468             280   9e-85    
ref|XP_010095796.1|  hypothetical protein L484_017604                   280   1e-84    
ref|XP_004233698.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       280   1e-84    
ref|XP_006476408.1|  PREDICTED: protein YLS7-like                       280   1e-84    
ref|XP_009415701.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       278   2e-84    
gb|KDO76478.1|  hypothetical protein CISIN_1g014796mg                   279   2e-84    
ref|XP_008346301.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    271   2e-84    
ref|XP_007218018.1|  hypothetical protein PRUPE_ppa005866mg             279   2e-84    
ref|XP_011101018.1|  PREDICTED: protein trichome birefringence-li...    279   2e-84    
ref|XP_008793879.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       276   2e-84    
ref|XP_009781635.1|  PREDICTED: protein trichome birefringence-li...    278   4e-84    
ref|XP_006439388.1|  hypothetical protein CICLE_v10020137mg             278   5e-84    
ref|XP_006603831.1|  PREDICTED: protein YLS7-like                       279   5e-84    
ref|XP_009789730.1|  PREDICTED: protein trichome birefringence-li...    278   6e-84    
gb|KDP28513.1|  hypothetical protein JCGZ_14284                         278   8e-84    
ref|XP_009795537.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       278   8e-84    
emb|CAN76813.1|  hypothetical protein VITISV_044114                     279   1e-83    
ref|XP_010326903.1|  PREDICTED: protein trichome birefringence-li...    278   1e-83    
ref|XP_010480310.1|  PREDICTED: protein trichome birefringence-li...    277   1e-83    
emb|CDM81389.1|  unnamed protein product                                278   1e-83    
ref|XP_002974751.1|  hypothetical protein SELMODRAFT_414834             275   2e-83    
ref|XP_006338534.1|  PREDICTED: uncharacterized protein LOC102583117    276   2e-83    
gb|KEH24899.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    278   2e-83    
ref|NP_171650.2|  protein trichome birefringence-like 25                277   2e-83    
ref|XP_010457131.1|  PREDICTED: protein trichome birefringence-li...    277   2e-83    
ref|XP_010676328.1|  PREDICTED: protein trichome birefringence-li...    276   2e-83    
gb|KFK42531.1|  hypothetical protein AALP_AA1G006400                    276   2e-83    
ref|XP_002973054.1|  hypothetical protein SELMODRAFT_98686              274   2e-83    
ref|XP_002317022.2|  hypothetical protein POPTR_0011s14730g             275   2e-83    
ref|XP_010556586.1|  PREDICTED: protein trichome birefringence-li...    276   2e-83    
ref|XP_002984523.1|  hypothetical protein SELMODRAFT_120292             274   3e-83    
ref|XP_006444879.1|  hypothetical protein CICLE_v10020140mg             276   3e-83    
gb|KDO86414.1|  hypothetical protein CISIN_1g013245mg                   276   3e-83    
ref|XP_006396304.1|  hypothetical protein EUTSA_v10028675mg             276   3e-83    
ref|XP_010436825.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       275   3e-83    
ref|XP_001782289.1|  predicted protein                                  273   4e-83    
ref|XP_011030941.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       274   5e-83    
gb|EYU23382.1|  hypothetical protein MIMGU_mgv1a006445mg                276   5e-83    
ref|NP_186893.1|  protein trichome birefringence-like 20                273   7e-83    
ref|XP_004298884.1|  PREDICTED: uncharacterized protein LOC101308674    275   7e-83    
ref|XP_004143876.1|  PREDICTED: uncharacterized protein LOC101211100    275   7e-83    
gb|KHG25867.1|  Elongation factor 4                                     275   7e-83    
ref|XP_008793840.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like...    275   8e-83    
ref|XP_008793841.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like...    275   8e-83    
ref|XP_006446438.1|  hypothetical protein CICLE_v10015360mg             275   8e-83    
ref|XP_006339685.1|  PREDICTED: uncharacterized protein LOC102602318    275   8e-83    
gb|KFK42530.1|  hypothetical protein AALP_AA1G006400                    274   1e-82    
ref|XP_006850929.1|  hypothetical protein AMTR_s00025p00185280          281   1e-82    
ref|XP_010541514.1|  PREDICTED: protein trichome birefringence-li...    274   1e-82    
ref|XP_010111733.1|  hypothetical protein L484_008391                   274   1e-82    
gb|EPS71271.1|  hypothetical protein M569_03487                         274   1e-82    
ref|XP_010445676.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       275   2e-82    
ref|XP_002963663.1|  hypothetical protein SELMODRAFT_80675              271   2e-82    
emb|CDM81390.1|  unnamed protein product                                272   2e-82    
ref|XP_004147443.1|  PREDICTED: uncharacterized protein LOC101218871    274   2e-82    
ref|XP_001784790.1|  predicted protein                                  271   2e-82    
ref|XP_002889368.1|  hypothetical protein ARALYDRAFT_470137             274   2e-82    
ref|XP_009129381.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       273   2e-82    
ref|XP_003519542.1|  PREDICTED: protein YLS7-like isoform X1            273   4e-82    
ref|XP_008776772.1|  PREDICTED: protein trichome birefringence-li...    273   4e-82    
ref|XP_002513423.1|  conserved hypothetical protein                     270   5e-82    
gb|KFK30684.1|  hypothetical protein AALP_AA6G014500                    273   5e-82    
ref|XP_002992733.1|  hypothetical protein SELMODRAFT_2086               270   5e-82    
ref|XP_002993717.1|  hypothetical protein SELMODRAFT_2088               270   5e-82    
gb|EMT28904.1|  hypothetical protein F775_19702                         273   6e-82    
ref|XP_002868669.1|  hypothetical protein ARALYDRAFT_330485             271   6e-82    
ref|XP_006491241.1|  PREDICTED: protein YLS7-like                       274   7e-82    
ref|XP_009781634.1|  PREDICTED: protein trichome birefringence-li...    273   8e-82    
ref|XP_002266929.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4            272   9e-82    
ref|XP_007160144.1|  hypothetical protein PHAVU_002G296400g             273   1e-81    
gb|EYU38907.1|  hypothetical protein MIMGU_mgv1a006182mg                273   1e-81    
emb|CDX90031.1|  BnaA10g00510D                                          272   1e-81    
ref|XP_004516393.1|  PREDICTED: uncharacterized protein LOC101499...    272   1e-81    
ref|XP_004516394.1|  PREDICTED: uncharacterized protein LOC101499...    272   1e-81    
ref|XP_004514981.1|  PREDICTED: uncharacterized protein LOC101511...    274   1e-81    
ref|XP_004965209.1|  PREDICTED: uncharacterized protein LOC101763378    272   1e-81    
ref|XP_010928570.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like...    272   1e-81    
ref|XP_010928572.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like...    272   1e-81    
gb|KHN28653.1|  hypothetical protein glysoja_025387                     272   1e-81    
ref|XP_004489877.1|  PREDICTED: uncharacterized protein LOC101514084    271   2e-81    
emb|CDP00200.1|  unnamed protein product                                271   2e-81    
ref|XP_010471019.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       271   2e-81    
ref|XP_004228546.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4            270   2e-81    
ref|XP_007044609.1|  Trichome birefringence-like 27                     271   3e-81    
ref|XP_003613305.1|  hypothetical protein MTR_5g035090                  271   3e-81    
ref|NP_001140539.1|  putative DUF231 domain containing family pro...    271   3e-81    
ref|XP_002988591.1|  hypothetical protein SELMODRAFT_128209             268   4e-81    
ref|XP_004248450.1|  PREDICTED: protein trichome birefringence-li...    270   4e-81    
ref|XP_009393476.1|  PREDICTED: protein YLS7                            273   4e-81    
gb|AES96263.2|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    270   4e-81    
ref|XP_008660794.1|  PREDICTED: protein trichome birefringence-li...    270   5e-81    
ref|XP_003517820.1|  PREDICTED: protein YLS7-like                       270   5e-81    
gb|AFW86836.1|  putative DUF231 domain containing family protein        270   5e-81    
ref|XP_009421084.1|  PREDICTED: protein trichome birefringence-li...    269   5e-81    
ref|XP_008437379.1|  PREDICTED: protein trichome birefringence-li...    271   6e-81    
gb|KEH18694.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    274   6e-81    
ref|XP_006348526.1|  PREDICTED: uncharacterized protein LOC102598278    270   6e-81    
ref|XP_011021650.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       270   7e-81    
ref|XP_008806495.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like...    270   7e-81    
ref|XP_008806496.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like...    270   7e-81    
ref|XP_010913528.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       267   7e-81    
gb|ABA94458.1|  hypothetical protein LOC_Os11g37630                     280   7e-81    
gb|KDO66283.1|  hypothetical protein CISIN_1g041432mg                   269   8e-81    
ref|XP_002979283.1|  hypothetical protein SELMODRAFT_110577             267   9e-81    
ref|XP_007157485.1|  hypothetical protein PHAVU_002G073600g             270   9e-81    
ref|XP_003630916.1|  hypothetical protein MTR_8g104970                  271   1e-80    
dbj|BAD68437.1|  leaf senescence protein-like                           269   1e-80    
ref|XP_002872911.1|  hypothetical protein ARALYDRAFT_490462             269   2e-80    
ref|XP_010474739.1|  PREDICTED: protein trichome birefringence-li...    270   2e-80    
ref|XP_009391742.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4            269   2e-80    
ref|XP_003568734.1|  PREDICTED: protein trichome birefringence-li...    270   2e-80    
ref|XP_010529632.1|  PREDICTED: protein trichome birefringence-li...    268   2e-80    
ref|XP_007157488.1|  hypothetical protein PHAVU_002G073800g             268   3e-80    
ref|XP_010910814.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like...    268   3e-80    
ref|XP_010910815.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like...    268   3e-80    
ref|XP_006446439.1|  hypothetical protein CICLE_v10017850mg             268   3e-80    
ref|XP_008806514.1|  PREDICTED: protein ALTERED XYLOGLUCAN 4-like       265   3e-80    
ref|NP_001045183.1|  Os01g0914800                                       270   3e-80    
ref|XP_007040465.1|  Trichome birefringence-like 23                     268   4e-80    



>ref|XP_009623248.1| PREDICTED: protein trichome birefringence-like 19 [Nicotiana 
tomentosiformis]
Length=441

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/437 (59%), Positives = 311/437 (71%), Gaps = 45/437 (10%)
 Frame = +3

Query  51    GAESPRRR----VLGAFRKAVLPISTTLVIFATFCFTSYNIS-DSLLQSFNLFPGGE---  206
             GAE PR +    +L +FRK VLPI  TLV+     F+SYN + DSLLQ+           
Sbjct  6     GAELPRWKYIYMLLESFRKVVLPI-LTLVLLVKITFSSYNTTTDSLLQNLETTLNKSVPF  64

Query  207   -------------------------------CNIFKGNWVPFPEGPYYTNATKCDIEDRQ  293
                                            CNIF G WV +P GPYYTN T C I+DRQ
Sbjct  65    DQQKHEAITQLQSVGITSINHSEKVGKKQQTCNIFVGKWVSYPNGPYYTNETNCAIDDRQ  124

Query  294   NCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLL  473
             NCMKFGRPD  F+ WRW+PD CELPLFD  QFLELVR KT+AFVGDS+ARNQMQSL CLL
Sbjct  125   NCMKFGRPDRDFIHWRWKPDDCELPLFDAMQFLELVRDKTLAFVGDSLARNQMQSLVCLL  184

Query  474   ASVADPVKVS---DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDE  644
             AS A PV VS   DA   RW+YK+YNF +++ WSP ++K+ ++DP   S +SLM+LY DE
Sbjct  185   ASAAIPVDVSETKDARFRRWLYKDYNFAIIALWSPQLIKSYESDPNGYSYNSLMDLYLDE  244

Query  645   PDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFR  824
              D +WA ++  AD VI S GQWFFRPF YY+NG+++GCH+CNE    K +HY+GY +AFR
Sbjct  245   ADHVWASQVHKADTVIISGGQWFFRPFLYYENGQLIGCHKCNEKNTTKLSHYYGYRMAFR  304

Query  825   TAFKTLLDHEKFRG-LVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYL  1001
             TAFKTLL+ ++ +  LVILR FSP HFENGEWN GGNC RTRPFT + +KL+GYTL+MYL
Sbjct  305   TAFKTLLNLKRLKSRLVILRPFSPQHFENGEWNKGGNCNRTRPFTNQDIKLDGYTLQMYL  364

Query  1002  TQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPG  1181
             TQ+ EF AA+REG+K+GV+FRLLDT+E+M+LRPDGHPNHYGHW +E K  ADCVHWCMPG
Sbjct  365   TQLEEFKAAQREGNKRGVKFRLLDTSEAMLLRPDGHPNHYGHWPNEKK-LADCVHWCMPG  423

Query  1182  PIDTWNEFLLQVLKMET  1232
             P+DTWNE LL +LKME 
Sbjct  424   PVDTWNELLLSILKMEA  440



>ref|XP_006338288.1| PREDICTED: uncharacterized protein LOC102586193 isoform X1 [Solanum 
tuberosum]
 ref|XP_006338289.1| PREDICTED: uncharacterized protein LOC102586193 isoform X2 [Solanum 
tuberosum]
Length=433

 Score =   507 bits (1305),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 239/424 (56%), Positives = 304/424 (72%), Gaps = 36/424 (8%)
 Frame = +3

Query  75    VLGAFRKAVLPISTTLVIFATFCFTSYNISDSLLQSFNLFPGGE----------------  206
             +  +FRK VLPI+T L++      +  + +DSLLQ+      G                 
Sbjct  8     LFDSFRKVVLPIATLLLLLKISYSSFDSTTDSLLQNLESSQNGSLPLDQPEQVSPGITGT  67

Query  207   --------------CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRW  344
                           CNIF G WV +P+GPYYTN T C I+DRQNCMK+GRPD+ F+ WRW
Sbjct  68    STNYSAKTGIRQQTCNIFVGKWVQYPKGPYYTNETNCVIDDRQNCMKYGRPDSDFIHWRW  127

Query  345   QPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAV  515
             +P+ CELPLFD  QFL++VRGKT+AFVGDS+ARNQMQSL CLLA+ + PV VS   D   
Sbjct  128   KPNDCELPLFDANQFLQIVRGKTLAFVGDSLARNQMQSLVCLLANASIPVDVSETTDTRY  187

Query  516   GRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIF  695
              RW+YK+YNFT+++ WSP ++K+ D+DP      SLMNLY D+ D +WA ++  AD+VI 
Sbjct  188   RRWLYKDYNFTIMALWSPQLIKSIDSDPTGDPYYSLMNLYLDKADDVWASQVDKADIVII  247

Query  696   SAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG-LV  872
             S GQWFFRPF YYKN +++GCH+CN+  + K  HY+GY +AFRTAFKTLL  +K +G LV
Sbjct  248   SGGQWFFRPFLYYKNDQLIGCHKCNQKNVTKHTHYYGYRMAFRTAFKTLLSMKKLKGRLV  307

Query  873   ILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKG  1052
             +LR FSPAHFENG+WN+GGNC RTRPF  ++MKL+GY L+MY+TQ+ EF AA++EG K+G
Sbjct  308   MLRPFSPAHFENGDWNNGGNCNRTRPFNNQEMKLDGYELKMYMTQLEEFKAAEKEGRKRG  367

Query  1053  -VRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
              V+F+LLDTTE+MV+RPDGHPNHYGHW HE K   DCVHWCMPGP+DTWNE LL  LKME
Sbjct  368   SVKFKLLDTTEAMVMRPDGHPNHYGHWPHEKK-LPDCVHWCMPGPVDTWNELLLATLKME  426

Query  1230  TPEY  1241
               E+
Sbjct  427   GDEF  430



>ref|XP_009801263.1| PREDICTED: protein trichome birefringence-like 19 [Nicotiana 
sylvestris]
Length=432

 Score =   506 bits (1303),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 248/424 (58%), Positives = 306/424 (72%), Gaps = 41/424 (10%)
 Frame = +3

Query  75    VLGAFRKAVLPISTTLVIFATFCFTSYNIS-DSLLQSFNL--------------------  191
             +L +FRK VLPI  TLV+     F+SYN + DSLLQ+                       
Sbjct  9     LLESFRKVVLPI-LTLVLLVKITFSSYNTTTDSLLQNLESTLNKSVPFDQQKHEAITQLQ  67

Query  192   --------------FPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGF  329
                                CN+F+G W+PFP GPYYTN T C I+DRQNCMKFGR D  F
Sbjct  68    SVGITSINHSEKVGIKQQTCNLFEGKWIPFPYGPYYTNETNCAIDDRQNCMKFGRLDRDF  127

Query  330   LKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS--  503
             + WRW+PD CELPLFD  QFLELVRGKT+AFVGDS+ARNQMQSL CLLAS A PV VS  
Sbjct  128   IHWRWKPDDCELPLFDAMQFLELVRGKTLAFVGDSLARNQMQSLVCLLASAAIPVDVSET  187

Query  504   -DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANA  680
              D    RW++K+YNFT+++ WSP ++K+ ++DP   S +SLM+LY D+ D +WA ++  A
Sbjct  188   KDTRFRRWLFKDYNFTIIALWSPQLIKSYESDPNGYSYNSLMDLYLDKADDVWASQVDKA  247

Query  681   DVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKF  860
              ++I S GQWFFRPF YY+NG+++GCH+CNE    K +HY+GY +AFRTAFKTLL  +K 
Sbjct  248   HIIIISGGQWFFRPFLYYENGQLIGCHKCNEKNTTKLSHYYGYRMAFRTAFKTLLSLKKL  307

Query  861   RG-LVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKRE  1037
             +  LVILR FSP HFENGEWN GGNC RTRPFT + +KL+GYTL+MYLTQ++EF AA++E
Sbjct  308   KSRLVILRPFSPQHFENGEWNKGGNCNRTRPFTNQDIKLDGYTLQMYLTQLQEFKAAQKE  367

Query  1038  GSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQV  1217
             G KKGV+FRLLDTTE+M+LRPDGHPN+YGHW +E K  ADCVHWCMPGP+DTWNE LL +
Sbjct  368   GKKKGVKFRLLDTTEAMLLRPDGHPNNYGHWPNEKK-LADCVHWCMPGPVDTWNELLLSI  426

Query  1218  LKME  1229
             LKME
Sbjct  427   LKME  430



>ref|XP_010316194.1| PREDICTED: protein trichome birefringence-like 19 isoform X2 
[Solanum lycopersicum]
Length=432

 Score =   499 bits (1284),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 231/426 (54%), Positives = 304/426 (71%), Gaps = 38/426 (9%)
 Frame = +3

Query  72    RVLGAFRKAVLPISTTLVIFATFCFTSYNISDSLLQSFNLFPGGE---------------  206
              +  +FRK +LPI+T L++      +  + +DSLLQ+      G                
Sbjct  7     ELFDSFRKVILPIATLLLLLKISYSSFDSTTDSLLQNLESSQNGSLPLDQPEQVSPGITS  66

Query  207   -----------------CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLK  335
                              CNIF G W+P+P+GPYYTN + C I+DRQNCMK+GRPD+ F+ 
Sbjct  67    ASPSTNYSAKTGIRQQTCNIFVGKWIPYPKGPYYTNESNCVIDDRQNCMKYGRPDSDFIH  126

Query  336   WRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---D  506
             WRW+P+ CELPLFD  QFL++VRGKT+AFVGDS+ARNQMQSL C+L++ + PV VS   D
Sbjct  127   WRWKPNDCELPLFDATQFLQIVRGKTLAFVGDSLARNQMQSLVCILSNASIPVDVSETTD  186

Query  507   AAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADV  686
                 RW+YK+YNFT+++ WSP ++K+ D+DP      SLMNLY D+ D +WA ++  AD+
Sbjct  187   TKFRRWLYKDYNFTIMALWSPQLIKSYDSDPTGDPYYSLMNLYLDKADDVWASQVEKADI  246

Query  687   VIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG  866
             +I S GQWFFRPF YY+N +++GCH+CN+  + +  HY+GY +AFRTAFKTLL+ +K +G
Sbjct  247   IIISGGQWFFRPFLYYENDQLIGCHKCNQKNVTEHTHYYGYRMAFRTAFKTLLNLQKLKG  306

Query  867   -LVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGS  1043
              LV+LR FSPAHFENG+WN+GGNC RTRPF   +MKL+GY L+MY+TQ+ EF AA++EG 
Sbjct  307   RLVMLRPFSPAHFENGDWNNGGNCNRTRPFKNEEMKLDGYELKMYMTQLEEFKAAEKEGR  366

Query  1044  KKG-VRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVL  1220
             K+G V+F+LLDTTE+MV+RPDGHPNHYGHW +E K   DCVHWCMPGP+DTWNE LL  L
Sbjct  367   KRGSVKFKLLDTTEAMVMRPDGHPNHYGHWPNEKK-LPDCVHWCMPGPVDTWNELLLATL  425

Query  1221  KMETPE  1238
             KME  E
Sbjct  426   KMEGDE  431



>ref|XP_004232104.1| PREDICTED: protein trichome birefringence-like 19 isoform X1 
[Solanum lycopersicum]
Length=447

 Score =   492 bits (1267),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 231/441 (52%), Positives = 305/441 (69%), Gaps = 53/441 (12%)
 Frame = +3

Query  72    RVLGAFRKAVLPISTTLVIFATFCFTSYNISDSLLQSFNLFPGGE---------------  206
              +  +FRK +LPI+T L++      +  + +DSLLQ+      G                
Sbjct  7     ELFDSFRKVILPIATLLLLLKISYSSFDSTTDSLLQNLESSQNGSLPLDQPEQVSPGITS  66

Query  207   -----------------CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLK  335
                              CNIF G W+P+P+GPYYTN + C I+DRQNCMK+GRPD+ F+ 
Sbjct  67    ASPSTNYSAKTGIRQQTCNIFVGKWIPYPKGPYYTNESNCVIDDRQNCMKYGRPDSDFIH  126

Query  336   WRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVAD---------  488
             WRW+P+ CELPLFD  QFL++VRGKT+AFVGDS+ARNQMQSL C+L+++ +         
Sbjct  127   WRWKPNDCELPLFDATQFLQIVRGKTLAFVGDSLARNQMQSLVCILSNITELAKSSANMF  186

Query  489   ------PVKVS---DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTD  641
                   PV VS   D    RW+YK+YNFT+++ WSP ++K+ D+DP      SLMNLY D
Sbjct  187   ISQASIPVDVSETTDTKFRRWLYKDYNFTIMALWSPQLIKSYDSDPTGDPYYSLMNLYLD  246

Query  642   EPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAF  821
             + D +WA ++  AD++I S GQWFFRPF YY+N +++GCH+CN+  + +  HY+GY +AF
Sbjct  247   KADDVWASQVEKADIIIISGGQWFFRPFLYYENDQLIGCHKCNQKNVTEHTHYYGYRMAF  306

Query  822   RTAFKTLLDHEKFRG-LVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMY  998
             RTAFKTLL+ +K +G LV+LR FSPAHFENG+WN+GGNC RTRPF   +MKL+GY L+MY
Sbjct  307   RTAFKTLLNLQKLKGRLVMLRPFSPAHFENGDWNNGGNCNRTRPFKNEEMKLDGYELKMY  366

Query  999   LTQVREFMAAKREGSKKG-VRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCM  1175
             +TQ+ EF AA++EG K+G V+F+LLDTTE+MV+RPDGHPNHYGHW +E K   DCVHWCM
Sbjct  367   MTQLEEFKAAEKEGRKRGSVKFKLLDTTEAMVMRPDGHPNHYGHWPNEKK-LPDCVHWCM  425

Query  1176  PGPIDTWNEFLLQVLKMETPE  1238
             PGP+DTWNE LL  LKME  E
Sbjct  426   PGPVDTWNELLLATLKMEGDE  446



>ref|XP_002279418.3| PREDICTED: protein trichome birefringence-like 19 [Vitis vinifera]
Length=472

 Score =   484 bits (1247),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 231/371 (62%), Positives = 276/371 (74%), Gaps = 13/371 (4%)
 Frame = +3

Query  156   NISDSLLQSFNLFPGG--------ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFG  311
             N S + +QS  +  GG        +C++F G WVP+P GPYYTNAT  +I  +QNC+KFG
Sbjct  88    NRSPTPVQSPKIHTGGSTSLAIKKKCDMFSGRWVPYPNGPYYTNATCREIIPQQNCIKFG  147

Query  312   RPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADP  491
             RPDT FLKWRW+PD CELP FD  QFLELVRGK++ FVGDSV RNQMQSL CLLA+V  P
Sbjct  148   RPDTEFLKWRWKPDGCELPRFDPVQFLELVRGKSIGFVGDSVGRNQMQSLLCLLANVTYP  207

Query  492   VKVS-----DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRL  656
             V +S     D    RW Y +Y FTL +FWSP +VKAKDADP   S ++LMNL+ D  D  
Sbjct  208   VDISYKYTSDTNFRRWFYTDYKFTLATFWSPFLVKAKDADPKGHSFNNLMNLHLDTVDEA  267

Query  657   WADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFK  836
             WA ++ N D VI SAGQWFFRP  +Y+ G++VGCH CNE  I +   ++GY  AFRT+F+
Sbjct  268   WAAQIENFDYVIISAGQWFFRPLIFYEKGQVVGCHGCNEKNITEVTKFYGYRKAFRTSFR  327

Query  837   TLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVRE  1016
             TL + + ++GL  LRTFSPAHFENG WN GGNCVRTRPFTK++MKL+ Y LE YLTQV E
Sbjct  328   TLQNLKNYKGLTFLRTFSPAHFENGAWNEGGNCVRTRPFTKQEMKLDDYNLEFYLTQVEE  387

Query  1017  FMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTW  1196
               AA+REG K+G+ FRLLD TE+MVLRPDGHPNHY H  H+N T ADCVHWC PGPIDTW
Sbjct  388   LRAAEREGRKRGLEFRLLDVTEAMVLRPDGHPNHYEHSPHKNVTIADCVHWCTPGPIDTW  447

Query  1197  NEFLLQVLKME  1229
             NEFLLQ+LKME
Sbjct  448   NEFLLQMLKME  458



>emb|CBI16874.3| unnamed protein product [Vitis vinifera]
Length=795

 Score =   485 bits (1249),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 232/374 (62%), Positives = 277/374 (74%), Gaps = 13/374 (3%)
 Frame = +3

Query  156   NISDSLLQSFNLFPGG--------ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFG  311
             N S + +QS  +  GG        +C++F G WVP+P GPYYTNAT  +I  +QNC+KFG
Sbjct  418   NRSPTPVQSPKIHTGGSTSLAIKKKCDMFSGRWVPYPNGPYYTNATCREIIPQQNCIKFG  477

Query  312   RPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADP  491
             RPDT FLKWRW+PD CELP FD  QFLELVRGK++ FVGDSV RNQMQSL CLLA+V  P
Sbjct  478   RPDTEFLKWRWKPDGCELPRFDPVQFLELVRGKSIGFVGDSVGRNQMQSLLCLLANVTYP  537

Query  492   VKVS-----DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRL  656
             V +S     D    RW Y +Y FTL +FWSP +VKAKDADP   S ++LMNL+ D  D  
Sbjct  538   VDISYKYTSDTNFRRWFYTDYKFTLATFWSPFLVKAKDADPKGHSFNNLMNLHLDTVDEA  597

Query  657   WADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFK  836
             WA ++ N D VI SAGQWFFRP  +Y+ G++VGCH CNE  I +   ++GY  AFRT+F+
Sbjct  598   WAAQIENFDYVIISAGQWFFRPLIFYEKGQVVGCHGCNEKNITEVTKFYGYRKAFRTSFR  657

Query  837   TLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVRE  1016
             TL + + ++GL  LRTFSPAHFENG WN GGNCVRTRPFTK++MKL+ Y LE YLTQV E
Sbjct  658   TLQNLKNYKGLTFLRTFSPAHFENGAWNEGGNCVRTRPFTKQEMKLDDYNLEFYLTQVEE  717

Query  1017  FMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTW  1196
               AA+REG K+G+ FRLLD TE+MVLRPDGHPNHY H  H+N T ADCVHWC PGPIDTW
Sbjct  718   LRAAEREGRKRGLEFRLLDVTEAMVLRPDGHPNHYEHSPHKNVTIADCVHWCTPGPIDTW  777

Query  1197  NEFLLQVLKMETPE  1238
             NEFLLQ+LKME  E
Sbjct  778   NEFLLQMLKMEASE  791


 Score =   426 bits (1094),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 203/383 (53%), Positives = 264/383 (69%), Gaps = 14/383 (4%)
 Frame = +3

Query  63    PRRRVLGAFRKAVLPISTTLVIFATFCFTSYNISDSLLQSFNLFPGGECNIFKGNWVPFP  242
             P +  +  F  A++P++    +F+ F       S       +  PG +C+IF+G WV +P
Sbjct  8     PSKLTIALFLLAMIPLN----LFSHF-------SSPWPSPVSTKPGKKCDIFRGKWVQYP  56

Query  243   EGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAF  422
             +GPYYTN T   I + QNCMKFGRPDT FLKWRW+PD CELPLFD  QFLELVRGK+MAF
Sbjct  57    KGPYYTNVTCRHIFEHQNCMKFGRPDTEFLKWRWKPDECELPLFDAAQFLELVRGKSMAF  116

Query  423   VGDSVARNQMQSLKCLLASVADPVKVSDAAV---GRWVYKEYNFTLLSFWSPHIVKAKDA  593
             +GDS+ARNQM+SL CLLAS  DP+ V +         +Y +YNFT+ SFWSP++VK  DA
Sbjct  117   IGDSLARNQMESLVCLLASEGDPIAVYNIKYPLSKSCLYTDYNFTVASFWSPYLVKDIDA  176

Query  594   DPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNE  773
             +P   + +SLMN++ DE    W  ++   D VI SAG WF +P  YY+NG IVGCH C+ 
Sbjct  177   NPTAGTANSLMNVFVDEAHEAWMSQIEKFDYVIVSAGIWFLKPQVYYENGDIVGCHLCHT  236

Query  774   TAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPF  953
               +       GY  AF+T F+TLL  + F+G+  LRT SP+HFENGEW +GG+CVRT+P 
Sbjct  237   KKVTNLTPLHGYRKAFQTTFRTLLRLKNFKGVTFLRTVSPSHFENGEWYTGGHCVRTKPV  296

Query  954   TKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWA  1133
             + ++M+LEG   EMY TQV E  AA++ G K+G++FRLLDTTE+MV+RPDGHP++Y    
Sbjct  297   SSKEMRLEGLYPEMYSTQVEELKAAEKLGRKRGLKFRLLDTTEAMVVRPDGHPSYYAKRV  356

Query  1134  HENKTTADCVHWCMPGPIDTWNE  1202
              EN T ADCVHWC+PGPIDTWNE
Sbjct  357   DENVTRADCVHWCLPGPIDTWNE  379



>ref|XP_002305967.2| hypothetical protein POPTR_0004s10520g [Populus trichocarpa]
 gb|EEE86478.2| hypothetical protein POPTR_0004s10520g [Populus trichocarpa]
Length=429

 Score =   468 bits (1204),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 226/405 (56%), Positives = 281/405 (69%), Gaps = 11/405 (3%)
 Frame = +3

Query  42    RDSGAESPRRRVLGAFRKAVLPISTTLVIFATFC--FTSYNISDSLLQSFNLFPGGECNI  215
             ++S   + ++ +L AF    L I   L +F+T     +S  I  S L++  +    EC+I
Sbjct  12    KNSQHGTSKKLLLLAFSLVFLTI-IPLYLFSTSHSPLSSPKIDVSDLRNIGMVK--ECDI  68

Query  216   FKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLE  395
             F G W+P+P+GPYYT+AT   I D+ NCMK GRPDT F+KWRW+PD CELP F+ + FLE
Sbjct  69    FSGKWIPYPKGPYYTDATCSLIIDQHNCMKSGRPDTEFMKWRWRPDECELPFFNAKLFLE  128

Query  396   LVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD------AAVGRWVYKEYNFTLLS  557
             LV+GK MAFVGDSV RNQMQSL CLLASV  PV +S       A   RW Y +Y FTL +
Sbjct  129   LVKGKKMAFVGDSVGRNQMQSLLCLLASVTYPVDISHRYAVDTAYFKRWFYADYRFTLAT  188

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
              WSP +VK++DADP   S +SLM+LY D+ D  WA E+ N D VI SAGQWFFRP  YY 
Sbjct  189   LWSPFLVKSRDADPSGHSLNSLMSLYLDQADEAWASEIENFDYVIISAGQWFFRPLIYYM  248

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             NG++VGCH C    I     YFGY +AFRTAFKTL   + ++G+  LRTFSP+HFENG W
Sbjct  249   NGQVVGCHNCYMDNITAITKYFGYRMAFRTAFKTLQSLKNYKGITFLRTFSPSHFENGAW  308

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GGNC+RT PFT  + KL+GY LE YLTQV E   A+++G K+G +F LL TTE+M+LR
Sbjct  309   NEGGNCIRTMPFTTEEKKLDGYELEFYLTQVEELRKAQKKGRKRGSKFELLPTTEAMLLR  368

Query  1098  PDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             PDGHPNHYG   H N T ADCVHWC+PGPIDTWNEFLL +++ E 
Sbjct  369   PDGHPNHYGRSPHSNVTVADCVHWCLPGPIDTWNEFLLYMMRREA  413



>ref|XP_002305968.1| hypothetical protein POPTR_0004s10530g [Populus trichocarpa]
 gb|EEE86479.1| hypothetical protein POPTR_0004s10530g [Populus trichocarpa]
Length=371

 Score =   463 bits (1192),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 214/362 (59%), Positives = 263/362 (73%), Gaps = 4/362 (1%)
 Frame = +3

Query  156   NISDSLLQSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLK  335
             NIS  +   +      +C+IF+G W+ +   PYY NAT  +I D+QNCMKFGRPDT F+K
Sbjct  8     NISSPIWLPYKSSESRKCDIFRGTWISYQNMPYYNNATCREIFDQQNCMKFGRPDTDFMK  67

Query  336   WRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKV----S  503
             W+W+PD CELP FD  QFLELVRGK+MAFVGDS+ RNQMQSL+CLLA V  P  +     
Sbjct  68    WKWKPDECELPRFDAEQFLELVRGKSMAFVGDSLGRNQMQSLQCLLARVVYPEDIISYTE  127

Query  504   DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANAD  683
             D    RW Y  YNFTL S W+PH+V+  D DP   + + L+NLY DE D  WA ++   D
Sbjct  128   DKRFKRWFYVNYNFTLASSWAPHLVRTIDTDPNGPTNNRLLNLYLDEADDAWAAQIETYD  187

Query  684   VVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFR  863
              VI SAG+WF+ P  +Y+NGK+VGCHRC +  IK    ++GY  AFRT+FKTLL   +F 
Sbjct  188   YVIISAGRWFYGPQVFYENGKVVGCHRCLKNTIKNLTMFYGYRKAFRTSFKTLLSLARFS  247

Query  864   GLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGS  1043
             G+  LRT SPAHFENGEWN GGNCVRT+P +  +MKLEG  LE+YLT+V+EF  AKREG 
Sbjct  248   GVTFLRTLSPAHFENGEWNKGGNCVRTQPVSNGEMKLEGGDLELYLTEVKEFRRAKREGK  307

Query  1044  KKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             ++G+ FRLLD + +MV+RPDGHPNHYGHW HEN T ADCVHWC+PGPIDTWNE LLQ+LK
Sbjct  308   RRGLDFRLLDISAAMVVRPDGHPNHYGHWPHENVTIADCVHWCLPGPIDTWNELLLQMLK  367

Query  1224  ME  1229
              E
Sbjct  368   RE  369



>ref|XP_011046773.1| PREDICTED: protein trichome birefringence-like 19 [Populus euphratica]
Length=403

 Score =   464 bits (1193),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 214/362 (59%), Positives = 263/362 (73%), Gaps = 4/362 (1%)
 Frame = +3

Query  156   NISDSLLQSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLK  335
             NIS  +   +      +C+IF+G W+ +   PYY NAT  +I D+QNCMKFGRPDT F+K
Sbjct  40    NISSPIWLPYKSSKSRKCDIFRGTWISYQNMPYYNNATCREIFDQQNCMKFGRPDTDFMK  99

Query  336   WRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKV----S  503
             W+W+PD CELP FD  QFLELVRGK+MAFVGDS+ RNQMQSL+CLLA V  P  +     
Sbjct  100   WKWKPDECELPRFDAEQFLELVRGKSMAFVGDSLGRNQMQSLQCLLARVVYPEDIISYTE  159

Query  504   DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANAD  683
             D +  RW Y  YNFTL S W+PH+V+  D DP   + +S +NLY DE D  WA ++    
Sbjct  160   DKSFKRWFYVNYNFTLASSWAPHLVRTIDTDPNGPTNNSFLNLYLDEADDAWAAQIETYG  219

Query  684   VVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFR  863
              VI SAG+WF+ P  +Y+NGK+VGCHRC +  IK    ++GY  AFRT+FKTLL   +F 
Sbjct  220   YVIISAGRWFYGPQVFYENGKVVGCHRCLKNTIKNLTMFYGYRKAFRTSFKTLLSLARFS  279

Query  864   GLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGS  1043
             G+  LRT SPAHFENGEWN GGNCVRT+P +  +MKLEG  LE+YLTQV+EF  AKREG 
Sbjct  280   GVTFLRTLSPAHFENGEWNKGGNCVRTQPVSNGEMKLEGGDLELYLTQVKEFRRAKREGK  339

Query  1044  KKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             ++G+ FRLLD + +MV+RPDGHPNHYGHW HEN T ADCVHWC+PGPIDTWNE LLQ+LK
Sbjct  340   RRGLDFRLLDISAAMVMRPDGHPNHYGHWPHENVTIADCVHWCLPGPIDTWNELLLQMLK  399

Query  1224  ME  1229
              E
Sbjct  400   RE  401



>ref|XP_007033403.1| Trichome birefringence-like 21, putative [Theobroma cacao]
 gb|EOY04329.1| Trichome birefringence-like 21, putative [Theobroma cacao]
Length=425

 Score =   464 bits (1193),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 220/366 (60%), Positives = 266/366 (73%), Gaps = 8/366 (2%)
 Frame = +3

Query  150   SYNISDSLLQSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGF  329
             S  I+ S L+S  L    +C++F G WVP P+GPYYTN T   I D+QNCMKFGRPD+ F
Sbjct  49    SPKINISSLRSIEL--EKKCDVFNGKWVPHPQGPYYTNETCRLIIDQQNCMKFGRPDSEF  106

Query  330   LKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDA  509
             +KWRW+PD CELPLFD   FLE+VRGK+MAFVGDSV RNQMQSL CLLA VA P  +S  
Sbjct  107   MKWRWKPDDCELPLFDAVHFLEIVRGKSMAFVGDSVGRNQMQSLLCLLADVAYPEDISHK  166

Query  510   AVG------RWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEM  671
                      RW Y +Y FTL +FWSP +VK++DADP   + +SLMN+Y DE D  WA+E+
Sbjct  167   YSSDIDYFKRWFYADYQFTLAAFWSPFLVKSRDADPDGHTYNSLMNVYLDEVDEAWANEI  226

Query  672   ANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDH  851
              N D VI SAGQWFFRP F+Y+ G++VGCH+CNE  I     Y+GY +AFRTAF+TLL  
Sbjct  227   ENFDYVIISAGQWFFRPLFFYEKGELVGCHKCNENNITSLTRYYGYKMAFRTAFRTLLGL  286

Query  852   EKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAK  1031
             + ++G   LRTFS +HFENG+W+ GGNCVRTRPFT ++MKLE Y LE YLTQ  E   A+
Sbjct  287   KNYKGTTFLRTFSASHFENGDWDKGGNCVRTRPFTSQEMKLEEYNLEFYLTQAEELRKAE  346

Query  1032  REGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLL  1211
              EG K G+ F LL+TTE M LRPDGHPN YGH  + N T  DCVHWC+PGPIDTWNEFLL
Sbjct  347   EEGKKIGLTFGLLNTTEIMWLRPDGHPNSYGHSMNRNATVNDCVHWCLPGPIDTWNEFLL  406

Query  1212  QVLKME  1229
              ++K E
Sbjct  407   YLMKRE  412



>ref|XP_006373480.1| hypothetical protein POPTR_0017s14160g [Populus trichocarpa]
 gb|ERP51277.1| hypothetical protein POPTR_0017s14160g [Populus trichocarpa]
Length=426

 Score =   462 bits (1190),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 210/348 (60%), Positives = 256/348 (74%), Gaps = 6/348 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             EC+IF G W+P+P GPYYT+AT   I D+ NCMKFGRPDT F+KWRW+P++CELP F+ +
Sbjct  65    ECDIFSGKWIPYPNGPYYTDATCSLIIDQHNCMKFGRPDTEFMKWRWRPEKCELPFFNAK  124

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKEYNF  545
             QFLELVRGK MAFVGDSV RNQMQSL CLL+SV  P  +S           RW Y +Y F
Sbjct  125   QFLELVRGKMMAFVGDSVGRNQMQSLLCLLSSVTHPEDISHRYTADTTYFKRWFYADYGF  184

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             TL + WSP +VK++DADP   S +SLM+LY D+ D  WA ++ N D VI SAGQWFFRP 
Sbjct  185   TLATLWSPFLVKSRDADPNGHSLNSLMSLYLDQADEAWASQIENFDYVIISAGQWFFRPL  244

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              YY NG+IVGCH C    I     Y+GY +AFRTAF+TL   + ++G+  LRTFSP+HFE
Sbjct  245   IYYINGQIVGCHNCYMENITAVTKYYGYRMAFRTAFETLRRLKNYKGITFLRTFSPSHFE  304

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
             NG WN GGNC+RT PFT  +MK +GY LE YLTQV E   A++EG K G++F LL TTE+
Sbjct  305   NGAWNEGGNCIRTMPFTSEEMKFDGYYLEFYLTQVEELRKAQKEGRKGGLKFELLATTEA  364

Query  1086  MVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             M+LRPDGHPN+YG   H N T ADCVHWC+PGPIDTWNEFLL +++ E
Sbjct  365   MLLRPDGHPNYYGRSPHSNVTVADCVHWCLPGPIDTWNEFLLYMMRKE  412



>ref|XP_007217577.1| hypothetical protein PRUPE_ppa019350mg [Prunus persica]
 gb|EMJ18776.1| hypothetical protein PRUPE_ppa019350mg [Prunus persica]
Length=420

 Score =   461 bits (1186),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 218/371 (59%), Positives = 269/371 (73%), Gaps = 15/371 (4%)
 Frame = +3

Query  156   NISDSLLQSFNLFPGG--------ECNIFKGNWVPFPEGP-YYTNATKCDIEDRQNCMKF  308
             NIS+S L S     GG        +C IF GNWVP P+GP YYTN T   I D QNCMKF
Sbjct  42    NISNSPLPSPKNNAGGSKSIEKEDQCQIFSGNWVPCPDGPAYYTNETCNLIIDEQNCMKF  101

Query  309   GRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVAD  488
             GRPDT F+KWRW+PD CELPLFD  QFLELVRGK++AF+GDSV +NQMQSL CLLA VA 
Sbjct  102   GRPDTEFMKWRWKPDACELPLFDAAQFLELVRGKSLAFLGDSVGKNQMQSLLCLLAIVAY  161

Query  489   PVKVSDAAVG------RWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPD  650
             P  +S           R+VY +YNFT+ + WSP++VK++DADP     +SLMNLY DEPD
Sbjct  162   PEDISHKYSSNTDYFKRYVYNDYNFTIATLWSPYLVKSRDADPSGHDINSLMNLYLDEPD  221

Query  651   RLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTA  830
             + W  ++   D VI SAGQWFFRP  Y++NG+++GCH+C +  +      +GY  AF+T 
Sbjct  222   QAWLTQVEQFDYVIVSAGQWFFRPLMYHENGRVIGCHKCEQDNMTSFVTSYGYRKAFQTV  281

Query  831   FKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQV  1010
             F+TL   + ++G+  LRTFSP+HFENG WN GGNCVRT PFTK + KL+GY LEMYLTQV
Sbjct  282   FRTLRSLKNYKGVTFLRTFSPSHFENGAWNEGGNCVRTSPFTKEETKLDGYVLEMYLTQV  341

Query  1011  REFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPID  1190
              E  AA+ +G ++G++FRL+DTTE+M+LRPDGHPN YGH  H N T ADCVHWC+PGPID
Sbjct  342   EELKAAEEQGLQRGLQFRLMDTTEAMLLRPDGHPNFYGHSPHRNMTLADCVHWCLPGPID  401

Query  1191  TWNEFLLQVLK  1223
             TWNE LL +LK
Sbjct  402   TWNEILLSMLK  412



>ref|XP_011021178.1| PREDICTED: protein trichome birefringence-like 19 [Populus euphratica]
Length=435

 Score =   461 bits (1185),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 209/348 (60%), Positives = 255/348 (73%), Gaps = 6/348 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             EC+IF G W+P P GPYYT+AT   I D+ NCMKFGRPDT F+KWRW+P++CELP F+ +
Sbjct  74    ECDIFSGKWIPDPNGPYYTDATCSLIIDQHNCMKFGRPDTEFMKWRWRPEKCELPFFNAK  133

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKEYNF  545
             QFLELVRGK MAFVGDSV RNQMQSL CLL+SV  P  +S           RW Y +Y F
Sbjct  134   QFLELVRGKMMAFVGDSVGRNQMQSLLCLLSSVTHPEDISRRYTADTTYFKRWFYADYGF  193

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             TL + WSP +VK++DADP   S +SLM+LY D+ D  WA ++ + D VI SAGQWFFRP 
Sbjct  194   TLATLWSPFLVKSRDADPNGHSLNSLMSLYLDQADEAWASQIESFDYVIISAGQWFFRPL  253

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              YY NG+IVGCH C    I     Y+GY +AFRTAF+TL   + ++G+  LRTFSP+HFE
Sbjct  254   IYYINGQIVGCHNCYMENITAVTKYYGYRMAFRTAFETLRSLKNYKGITFLRTFSPSHFE  313

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
             NG WN GGNC+RT PFT  +MK +GY LE YLTQV E   A++EG K G++F LL TTE+
Sbjct  314   NGAWNEGGNCIRTTPFTSEEMKFDGYNLEFYLTQVEELRKAQKEGRKGGLKFELLATTEA  373

Query  1086  MVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             M+LRPDGHPN+YG   H N T ADCVHWC+PGPIDTWNEFLL +++ E
Sbjct  374   MLLRPDGHPNYYGRSPHSNVTVADCVHWCLPGPIDTWNEFLLYMIRKE  421



>ref|XP_002533953.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28439.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score =   459 bits (1182),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 209/345 (61%), Positives = 264/345 (77%), Gaps = 3/345 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF+G W+ +P+  YYTNAT  +I D+QNC+KFGR DT FLKWRW+PDRCELPLFD R
Sbjct  60    KCDIFRGKWIWYPDNSYYTNATCREIFDQQNCIKFGRIDTDFLKWRWKPDRCELPLFDAR  119

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             +FLELVRGK++AFVGDSV RNQMQSL CLLASV  PV VS   D+   +W Y  YNFTL 
Sbjct  120   KFLELVRGKSLAFVGDSVGRNQMQSLLCLLASVVYPVDVSYTTDSRFKKWFYVSYNFTLA  179

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             SFWSPH+VKA D +P   + + LMNL+ DE + +W+ ++ + D VI SAG+WF+ P  + 
Sbjct  180   SFWSPHLVKAIDTEPNGPTYNRLMNLHLDEANDVWSTQIESFDYVIISAGRWFYGPQVFI  239

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +NGK+VGCH C    IK    ++GY   FRTAFKTL+  + + G+  LRT SPAHFENGE
Sbjct  240   ENGKVVGCHLCFRNNIKNLTMFYGYKRVFRTAFKTLIGLKNYNGVTFLRTLSPAHFENGE  299

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNC RTRP  + +MKL+G  L+MYLT+V E   A+REG K+G++FRL+D  E+M++
Sbjct  300   WNKGGNCNRTRPVLRGEMKLDGDELKMYLTEVEELKRAEREGKKRGLKFRLIDVNEAMIV  359

Query  1095  RPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHPNHYGHW HEN + +DCVHWC+PGP+DTWN FLLQ+LKME
Sbjct  360   RPDGHPNHYGHWPHENVSISDCVHWCLPGPVDTWNHFLLQMLKME  404



>emb|CDP02388.1| unnamed protein product [Coffea canephora]
Length=828

 Score =   473 bits (1218),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 217/353 (61%), Positives = 263/353 (75%), Gaps = 3/353 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F GNWVP  +GPYYTNATKC I+DRQNCMKFGRPDT FLKWRW+P+ CELP FD  
Sbjct  65    QCDLFSGNWVPVSKGPYYTNATKCVIDDRQNCMKFGRPDTEFLKWRWKPNECELPSFDAT  124

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLELVRGK+MAFVGDS+ARNQMQSL CLLASVADPV VS   D    RW Y EYNFT+ 
Sbjct  125   QFLELVRGKSMAFVGDSLARNQMQSLVCLLASVADPVDVSYGEDTRFRRWFYAEYNFTVA  184

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             +FWS ++V++++ADP   S  SLM LY DE D  WA  + N   +I SAGQWF RP  YY
Sbjct  185   AFWSTYLVRSEEADPKGYSLTSLMKLYLDEVDESWAAHVQNFRYIIISAGQWFLRPLLYY  244

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             + GKIVGC+ CN+  +     Y+GY + FRT+F+TLL+ + F+G+  LRTFSP H+ENGE
Sbjct  245   EKGKIVGCYICNKKNVTSLTRYYGYKMVFRTSFRTLLNLDGFKGITFLRTFSPQHYENGE  304

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNC+R RP  K+ M +E Y LE Y TQ+ E  AAKREG  +G++F+ LD T  M+L
Sbjct  305   WNKGGNCMRRRPIGKQGMGMEEYILEFYWTQLAELTAAKREGRNRGLKFKPLDATRLMML  364

Query  1095  RPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKMETPEYNPLR  1253
             RPDGHP+HYGH   EN T ADCVHWC+PGPIDTWNE LLQ+ K   P+ +  R
Sbjct  365   RPDGHPSHYGHGPRENVTIADCVHWCLPGPIDTWNEALLQIGKRTCPDVSSKR  417


 Score =   437 bits (1123),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 200/345 (58%), Positives = 252/345 (73%), Gaps = 4/345 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G+WVP  + PYYTN TKC I+DRQNC+KFGRPDT F+KWRW+P +CELP F+  
Sbjct  467   QCDMFSGDWVPQVKAPYYTNETKCQIDDRQNCIKFGRPDTEFMKWRWKPSQCELPPFNAT  526

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLL  554
              FLELVRGK++AF+GDS+ARNQMQSL CLLAS ADPV  S  A  R   W Y EYNFTL 
Sbjct  527   LFLELVRGKSLAFIGDSLARNQMQSLVCLLASAADPVDNSYTADPRFRLWFYAEYNFTLA  586

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              FWS H+VK++DAD   + P +   LY DE D +WA+ +   + VI SAGQWF RP  YY
Sbjct  587   IFWSVHLVKSEDADAN-IYPLTSQTLYLDEVDEIWANHIEKFNYVIISAGQWFLRPLVYY  645

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             + GK++GC+ CN+  I   + Y+GY +AFRT+F+TLL+ E F+G   LRT SP H+ENG 
Sbjct  646   RKGKLIGCYACNKRKITGLSMYYGYQMAFRTSFRTLLNLENFKGTTFLRTISPQHYENGG  705

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN+GG CVRTRP  K +++ E Y L++Y TQV E +AA  +G K+G++FR+LD T+ M  
Sbjct  706   WNTGGTCVRTRPIAKDEIRFEEYFLKLYSTQVAELIAADGKGKKRGLKFRILDPTDMMAE  765

Query  1095  RPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             R DGHPNHY H    N T ADCVHWC+PGPID WNE LLQVL+ E
Sbjct  766   RADGHPNHYAHGPGANFTNADCVHWCLPGPIDAWNEILLQVLQSE  810



>ref|XP_009371026.1| PREDICTED: protein trichome birefringence-like 19 [Pyrus x bretschneideri]
Length=419

 Score =   457 bits (1175),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 208/347 (60%), Positives = 260/347 (75%), Gaps = 7/347 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGP-YYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C IF G+W+P+P+GP YYTN T   I D+QNCMKF RPDT F+KWRW+P+ CELPLFD 
Sbjct  67    QCQIFSGSWIPYPDGPAYYTNETCNLIIDQQNCMKFERPDTEFMKWRWKPEDCELPLFDA  126

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA------VGRWVYKEYN  542
              QFLELVRGK++AF+GDSV RNQMQSL CLL++V  P  +S           R+VY +YN
Sbjct  127   AQFLELVRGKSLAFLGDSVGRNQMQSLLCLLSNVTYPEDISHVYSTNTDYFKRYVYHDYN  186

Query  543   FTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRP  722
             FT+ + W+P++VK++DADP     +SLM+LY DEPD  W  E+ N D VI SAGQWFFRP
Sbjct  187   FTMATLWAPYLVKSRDADPKNHDVNSLMSLYLDEPDEGWETEVENFDYVIVSAGQWFFRP  246

Query  723   FFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHF  902
               YY+NG ++GCH+C    +K    Y+GY  AFRT F+TL + + ++G+  LRTFSP+HF
Sbjct  247   LIYYENGSVIGCHKCGRDDMKSFLTYYGYKKAFRTVFRTLRNLKNYKGVTFLRTFSPSHF  306

Query  903   ENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTE  1082
             ENG WN GGNC RTRPF K +MKL+GY LEMYL QV E  AA+++G K+G+ FRL+DT E
Sbjct  307   ENGAWNEGGNCPRTRPFRKEEMKLDGYILEMYLAQVEELKAAEKKGMKRGLEFRLMDTNE  366

Query  1083  SMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             +M+LRPDGHPN YGH  H N T ADCVHWC+PGPIDTWNE LL +LK
Sbjct  367   AMLLRPDGHPNFYGHSPHRNMTIADCVHWCLPGPIDTWNEILLYMLK  413



>ref|XP_008341845.1| PREDICTED: protein trichome birefringence-like 19 [Malus domestica]
Length=419

 Score =   456 bits (1174),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 208/347 (60%), Positives = 262/347 (76%), Gaps = 7/347 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGP-YYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C IF G+W+P+P+GP YYTN T   I D+QNC+KFGRPD  F+KWRW+P  CELPLFD 
Sbjct  67    QCQIFSGSWIPYPDGPAYYTNETCNLILDQQNCLKFGRPDXEFMKWRWKPQDCELPLFDA  126

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA------VGRWVYKEYN  542
              QFLELVRGK++AF+GDSV RNQMQSL CLL++V  P  VS           R+VY +YN
Sbjct  127   AQFLELVRGKSLAFLGDSVGRNQMQSLLCLLSNVTYPEDVSHKYSTNTDYFKRYVYHDYN  186

Query  543   FTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRP  722
             FT+ + W+P++VK++DADP     +SLM+LY DEPD  W  E+ N D VI SAGQWFFRP
Sbjct  187   FTMATLWAPYLVKSRDADPNGHGINSLMSLYLDEPDEGWETEVENFDYVIVSAGQWFFRP  246

Query  723   FFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHF  902
               YY+NG+++GCH+C    +K    Y+GY  AFRT F+TL + + ++G+  LRTFSP+HF
Sbjct  247   LIYYENGRVIGCHKCGRDDMKSFLTYYGYKKAFRTVFRTLRNLKNYKGVTFLRTFSPSHF  306

Query  903   ENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTE  1082
             ENG WN GGNC RTRPF+K +MKL+GY LEM+LTQV E  AA+++G K+G+ FRL+DTTE
Sbjct  307   ENGAWNEGGNCPRTRPFSKEEMKLDGYILEMHLTQVEELKAAEKKGMKRGLEFRLMDTTE  366

Query  1083  SMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             +M+LRPDGHPN YG   H N T ADCVHWC+PGPIDTWNE LL +LK
Sbjct  367   AMLLRPDGHPNFYGQSPHRNMTIADCVHWCLPGPIDTWNEILLYMLK  413



>gb|KDP24359.1| hypothetical protein JCGZ_25655 [Jatropha curcas]
Length=426

 Score =   456 bits (1174),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/350 (61%), Positives = 258/350 (74%), Gaps = 8/350 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             EC+IF G WVP+ +GPYYTNAT   + D+QNCMKFGRPDT F+KWRW+PD CELPLF+ +
Sbjct  63    ECDIFTGKWVPYSKGPYYTNATCNLMIDQQNCMKFGRPDTEFMKWRWRPDGCELPLFNAK  122

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR------WVYKEYNF  545
             QFLELVRGK+MAF+GDSV RNQMQSL CLLASV  P  VS            W Y +Y F
Sbjct  123   QFLELVRGKSMAFLGDSVGRNQMQSLLCLLASVTHPEDVSHVYTSDTTYFKYWFYADYGF  182

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             TL + WSP +VK+ DADP   S +S+M+LY D+ D  WA ++ + D VI SAGQWFFRP 
Sbjct  183   TLATLWSPFLVKSYDADPDGHSLNSIMSLYLDQADDAWATQVESFDYVIISAGQWFFRPL  242

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              Y    +IVGCH CN   I   + Y+GY +AFRT FKTLL  + ++G+ ILRTFSP+HFE
Sbjct  243   IYNIKNQIVGCHNCNNQNITALSKYYGYRMAFRTVFKTLLKLKGYKGMTILRTFSPSHFE  302

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
             NGEWN+GGNC R +PFT  +M+L+GY LE YLTQV E   A+++G KKG+ FRLL TTE+
Sbjct  303   NGEWNAGGNCGRIKPFTSEEMRLDGYNLEFYLTQVEELRKAEKQGRKKGLSFRLLATTEA  362

Query  1086  MVLRPDGHPNHYGHW--AHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             M+LRPDGHPNHYG       N T ADCVHWC+PGPIDTWNEFLL ++K E
Sbjct  363   MLLRPDGHPNHYGQSLRTRRNVTIADCVHWCLPGPIDTWNEFLLYMMKRE  412



>ref|XP_011046774.1| PREDICTED: protein trichome birefringence-like 19 [Populus euphratica]
Length=438

 Score =   457 bits (1175),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 217/393 (55%), Positives = 271/393 (69%), Gaps = 14/393 (4%)
 Frame = +3

Query  93    KAVLPISTTLVIFATFCFTSYNISDSLLQS--------FNLFPGGECNIFKGNWVPFPEG  248
             K +L ++ +LV   T     ++ S S L S         N+    EC+IF G W+P+P+G
Sbjct  29    KRLLLLAFSLVFLTTIPLYLFSTSHSPLSSPKIDVSDLRNVGMVKECDIFSGKWIPYPKG  88

Query  249   PYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVG  428
             PYYT+AT   I D+ NC+K GRPDT F+KWRW+PD CELP F+ + FLELV+GK MAFVG
Sbjct  89    PYYTDATCSLIIDQHNCVKSGRPDTEFMKWRWRPDECELPFFNAKLFLELVKGKKMAFVG  148

Query  429   DSVARNQMQSLKCLLASVADPVKVSD------AAVGRWVYKEYNFTLLSFWSPHIVKAKD  590
             DSV RNQMQSL CLLASV     +S       A   RW Y +Y FTL + WSP +VK++D
Sbjct  149   DSVGRNQMQSLLCLLASVTHSEDISHRYAVDTAYFKRWFYADYRFTLATLWSPFLVKSRD  208

Query  591   ADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCN  770
             ADP   S +SLM+LY D+ D  WA ++ + D VI SAGQWFFRP  YY NG++VGCH C 
Sbjct  209   ADPSGHSLNSLMSLYLDQADEAWASQIESFDYVIISAGQWFFRPLIYYMNGQVVGCHNCY  268

Query  771   ETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRP  950
                I     YFGY +AF TAFKTL   + ++G+  LRTFSP+HFENG WN GGNC+RT P
Sbjct  269   MDNITAITKYFGYRMAFGTAFKTLQSLKNYKGITFLRTFSPSHFENGAWNEGGNCIRTVP  328

Query  951   FTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHW  1130
             FT  + KL+GY LE YLTQV E   A+++G K+G++F LL TTE+M+LRPDGHPNHYG  
Sbjct  329   FTTEEKKLDGYELEFYLTQVEELRKAQKKGRKRGLKFELLATTEAMLLRPDGHPNHYGRS  388

Query  1131  AHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
              H N T ADCVHWC+PGPIDTWNEFLL +++ E
Sbjct  389   PHSNVTVADCVHWCLPGPIDTWNEFLLYMMRRE  421



>ref|XP_008379493.1| PREDICTED: protein trichome birefringence-like 19 [Malus domestica]
Length=419

 Score =   456 bits (1172),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 215/395 (54%), Positives = 276/395 (70%), Gaps = 15/395 (4%)
 Frame = +3

Query  84    AFRKAVLPISTTLVI-FATFCFTSYNISDSLLQSFNLFPG-------GECNIFKGNWVPF  239
              ++K +L   T L++     C  +   S  L  S N+  G        +C IF GNW+P+
Sbjct  19    TYKKGILLALTFLMLTIIPLCINNSTTSPLLSPSSNITSGLKTIENEDQCQIFTGNWIPY  78

Query  240   PEGP-YYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTM  416
             P+GP YYTN T   I D+QNCMKFGRPDT F+KWRW+P+ CELPLFD  QFLELVRGK++
Sbjct  79    PDGPAYYTNETCNLIIDQQNCMKFGRPDTEFMKWRWKPENCELPLFDAAQFLELVRGKSL  138

Query  417   AFVGDSVARNQMQSLKCLLASVADPVKVSDAA------VGRWVYKEYNFTLLSFWSPHIV  578
             AF+GDSV  NQM+SL CLL+SV  P  VS           R+VY +YNFT+ + W+P++V
Sbjct  139   AFLGDSVGMNQMRSLLCLLSSVTYPEDVSHKYSTNTDYFKRYVYHDYNFTMANLWAPYLV  198

Query  579   KAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGC  758
             K+++ADP   + +S+  LY DEPD+ W  E+ N D VI SAGQWFF P  YY+NG+++GC
Sbjct  199   KSREADPNGHNINSIRTLYLDEPDKAWETEVENFDYVIVSAGQWFFLPLIYYENGRVIGC  258

Query  759   HRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCV  938
             H+C    +K    ++GY  AF+T F+TL + + ++G+  LRTFSPAHFENG WN GGNC 
Sbjct  259   HKCGRDNMKSFLTHYGYKKAFQTVFRTLQNLKNYKGVTFLRTFSPAHFENGAWNEGGNCA  318

Query  939   RTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNH  1118
             RTRPF K +MKL G  LEMYL QV E  AA+++G K+G+ FRL+DTTE+M+LRPDGHPN 
Sbjct  319   RTRPFCKEEMKLAGRILEMYLAQVEELKAAEKKGMKRGLEFRLMDTTEAMLLRPDGHPNF  378

Query  1119  YGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             YGH  H N T ADCVHWC+PGPIDTWNE LL +LK
Sbjct  379   YGHSPHRNMTVADCVHWCLPGPIDTWNEILLYMLK  413



>ref|XP_008230368.1| PREDICTED: protein trichome birefringence-like 19 [Prunus mume]
Length=418

 Score =   455 bits (1170),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 216/371 (58%), Positives = 265/371 (71%), Gaps = 15/371 (4%)
 Frame = +3

Query  156   NISDSLLQSFNLFPGG--------ECNIFKGNWVPFPEGP-YYTNATKCDIEDRQNCMKF  308
             NI +S L S    P G        +C IF GNWVP+P+GP YYTN T   I D QNCMKF
Sbjct  41    NIPNSPLPSPKSNPSGSKSIEKEDQCQIFSGNWVPYPDGPAYYTNETCNLIIDEQNCMKF  100

Query  309   GRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVAD  488
             GRPDT F+KWRW+PD CELPLFD  QFLELVRGK++AF+GDSV +NQMQSL CLLA VA 
Sbjct  101   GRPDTEFMKWRWKPDACELPLFDAAQFLELVRGKSLAFLGDSVGKNQMQSLLCLLAIVAY  160

Query  489   PVKVSDAAVG------RWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPD  650
             P  +S           R+VY +YNFT+ + WSP +VK++DAD      +SLM+LY DEPD
Sbjct  161   PEDISHKYSSNTDYFKRYVYNDYNFTIATLWSPFLVKSRDADHRGHDINSLMSLYLDEPD  220

Query  651   RLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTA  830
               W  ++   D VI SAGQWFFRP  Y++NG ++GCH+C +  +      +GY  AFRT 
Sbjct  221   EAWLTQVEQFDYVIVSAGQWFFRPLIYHENGGVIGCHKCEQDNMTSFVTSYGYRKAFRTV  280

Query  831   FKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQV  1010
             F+TL   + ++G+  LRTFSP+HFENG WN GGNCVRT PFTK + KL+GY LEMYLTQV
Sbjct  281   FRTLRSLKNYKGVTFLRTFSPSHFENGAWNEGGNCVRTSPFTKEETKLDGYVLEMYLTQV  340

Query  1011  REFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPID  1190
              E  AA+ +G ++G++FRL+DTTE+M+LRPDGHPN YGH  H N T ADCVHWC+PGPID
Sbjct  341   EELKAAEEQGLQRGLQFRLMDTTEAMLLRPDGHPNFYGHSPHRNMTLADCVHWCLPGPID  400

Query  1191  TWNEFLLQVLK  1223
             TWNE LL +LK
Sbjct  401   TWNEILLYMLK  411



>ref|XP_010257818.1| PREDICTED: protein trichome birefringence-like 19 [Nelumbo nucifera]
Length=451

 Score =   454 bits (1168),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 210/345 (61%), Positives = 259/345 (75%), Gaps = 4/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WVP PE PYYTN+T   I D QNCMK+G+PDTGF+KWRW+P+ CELP+F+  Q
Sbjct  88    CDIFNGEWVPNPEAPYYTNSTCWAIHDHQNCMKYGKPDTGFMKWRWKPNDCELPIFNPAQ  147

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPV---KVSDAAVGRWVYKEYNFTLLS  557
             FL++VRGK+MAFVGDSV RNQMQSL CLL+ V  PV   K SD    RW Y  YNFT+ S
Sbjct  148   FLKIVRGKSMAFVGDSVGRNQMQSLICLLSRVEYPVDVSKTSDQQFKRWRYVSYNFTIAS  207

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FW+P++VKAK ADP       L NLY DE +  WA ++   D VIFSAG WFFRP  +Y+
Sbjct  208   FWAPYLVKAKQADPNSPLYTGLYNLYLDEFNDEWASQIDEFDYVIFSAGHWFFRPTMFYE  267

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             NG++VGC+ C +  +      + Y  AFRTAF+ +   E F+G+  LRTFSP+HFENGEW
Sbjct  268   NGQLVGCYYCFKENVTDLTMSYSYRKAFRTAFRVINSLENFKGITFLRTFSPSHFENGEW  327

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GG+CVRTRPF   + +LEG TLE+YLTQ+ EF  A+REG K+G+RFRLLD T++M+LR
Sbjct  328   NKGGDCVRTRPFMNNETRLEGITLELYLTQIEEFKYAEREGRKRGLRFRLLDATQAMLLR  387

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGHWAHEN T   DCVHWC+PGPIDTWN+FLL++LKME
Sbjct  388   PDGHPSRYGHWAHENVTLYNDCVHWCLPGPIDTWNDFLLEMLKME  432



>ref|XP_006430841.1| hypothetical protein CICLE_v10011798mg [Citrus clementina]
 gb|ESR44081.1| hypothetical protein CICLE_v10011798mg [Citrus clementina]
Length=425

 Score =   453 bits (1165),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 206/347 (59%), Positives = 255/347 (73%), Gaps = 6/347 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WVP P+GPYY+N +   I D+QNCMKFGRPDT F+ WRW+P  CELPLF+  Q
Sbjct  66    CDIFSGEWVPNPKGPYYSNESCRLIIDQQNCMKFGRPDTEFMNWRWKPHECELPLFNPVQ  125

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKEYNFT  548
             FLE+VRGK++AFVGDSV RNQM+SL CLLAS A+P  +S           RW Y EY FT
Sbjct  126   FLEIVRGKSLAFVGDSVGRNQMESLLCLLASEANPEDISHKYTSETDYFKRWYYTEYKFT  185

Query  549   LLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFF  728
             + + WSP +VK+ DADP   S ++LMNLY DE D  W  ++ N D VI SAGQWFFRP  
Sbjct  186   VATLWSPFLVKSSDADPNGHSANNLMNLYLDEADESWVSQIENFDYVIISAGQWFFRPLV  245

Query  729   YYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFEN  908
             YY NG+ VGCH CN   +     Y  Y +AFRTAF+TL   + ++G+  LRTFSP+HFEN
Sbjct  246   YYANGQPVGCHNCNINNMTALTKYHAYRMAFRTAFRTLQRLKNYKGITFLRTFSPSHFEN  305

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G+W+ GGNC RTRPFT ++++L+GYT+E YLTQV E  AA+++G   G++F LLDTTE M
Sbjct  306   GDWDKGGNCGRTRPFTSQEVELDGYTMEFYLTQVEELRAAEKQGMDMGLKFSLLDTTEIM  365

Query  1089  VLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             +LRPDGHPN YGH  H+NKT  DCVHWC+PGPIDTWNEFL  +LK+E
Sbjct  366   LLRPDGHPNQYGHSMHKNKTVNDCVHWCLPGPIDTWNEFLFYMLKIE  412



>gb|KDO58902.1| hypothetical protein CISIN_1g014192mg [Citrus sinensis]
Length=425

 Score =   452 bits (1164),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 206/347 (59%), Positives = 255/347 (73%), Gaps = 6/347 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WVP P+GPYY+N +   I D+QNCMKFGRPDT F+ WRW+P  CELPLF+  Q
Sbjct  66    CDIFSGEWVPNPKGPYYSNESCRLIIDQQNCMKFGRPDTEFMNWRWKPHECELPLFNPVQ  125

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKEYNFT  548
             FLE+VRGK++AFVGDSV RNQM+SL CLLAS A+P  +S           RW Y EY FT
Sbjct  126   FLEIVRGKSLAFVGDSVGRNQMESLLCLLASEANPEDISHKYTSETDYFKRWYYTEYKFT  185

Query  549   LLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFF  728
             + + WSP +VK+ DADP   S ++LMNLY DE D  W  ++ N D VI SAGQWFFRP  
Sbjct  186   VATLWSPFLVKSSDADPNGHSANNLMNLYLDEADESWVSQIENFDYVIISAGQWFFRPLV  245

Query  729   YYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFEN  908
             YY NG+ VGCH CN   +     Y  Y +AFRTAF+TL   + ++G+  LRTFSP+HFEN
Sbjct  246   YYANGQPVGCHNCNINNMTALTKYHAYRMAFRTAFRTLQRLKNYKGITFLRTFSPSHFEN  305

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G+W+ GGNC RTRPFT ++++L+GYT+E YLTQV E  AA+++G   G++F LLDTTE M
Sbjct  306   GDWDKGGNCGRTRPFTSQEVELDGYTMEFYLTQVEELRAAEKQGMDMGLKFSLLDTTEIM  365

Query  1089  VLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             +LRPDGHPN YGH  H+NKT  DCVHWC+PGPIDTWNEFL  +LK+E
Sbjct  366   LLRPDGHPNQYGHSMHKNKTVNDCVHWCLPGPIDTWNEFLFYMLKIE  412



>ref|XP_006482315.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=425

 Score =   452 bits (1162),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 206/347 (59%), Positives = 255/347 (73%), Gaps = 6/347 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WVP P+GPYY+N +   I D+QNCMKFGRPDT F+ WRW+P  CELPLF+  Q
Sbjct  66    CDIFSGEWVPNPKGPYYSNESCRLIIDQQNCMKFGRPDTEFMNWRWKPHECELPLFNPVQ  125

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKEYNFT  548
             FLE+VRGK++AFVGDSV RNQM+SL CLLAS A+P  +S           RW Y EY FT
Sbjct  126   FLEIVRGKSLAFVGDSVGRNQMESLLCLLASEANPEDISHKYTSETDYFKRWYYTEYKFT  185

Query  549   LLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFF  728
             + + WSP +VK+ DADP   S ++LMNLY DE D  W  ++ N D VI SAGQWFFRP  
Sbjct  186   VATLWSPFLVKSSDADPNGHSRNNLMNLYLDEADESWVSQIENFDYVIISAGQWFFRPLV  245

Query  729   YYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFEN  908
             YY NG+ VGCH CN   +     Y  Y +AFRTAF+TL   + ++G+  LRTFSP+HFEN
Sbjct  246   YYANGQPVGCHNCNINNMTALTKYHAYRMAFRTAFRTLQRLKNYKGITFLRTFSPSHFEN  305

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G+W+ GGNC RTRPFT ++++L+GYT+E YLTQV E  AA+++G   G++F LLDTTE M
Sbjct  306   GDWDKGGNCGRTRPFTSQEVELDGYTMEFYLTQVEELRAAEKQGMDMGLKFSLLDTTEIM  365

Query  1089  VLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             +LRPDGHPN YGH  H+NKT  DCVHWC+PGPIDTWNEFL  +LK+E
Sbjct  366   LLRPDGHPNQYGHSMHKNKTVNDCVHWCLPGPIDTWNEFLFYMLKIE  412



>ref|XP_010660516.1| PREDICTED: protein trichome birefringence-like 19 [Vitis vinifera]
Length=409

 Score =   450 bits (1157),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 212/391 (54%), Positives = 271/391 (69%), Gaps = 4/391 (1%)
 Frame = +3

Query  69    RRVLGAFRKAVLPISTTLVIFATFCFTSYN-ISDSLLQSFNLFPGGECNIFKGNWVPFPE  245
             +++L      ++ ++  L++ A      +N  S       +   G +C+IF+G WV FP+
Sbjct  12    KKLLHNATMKLILVTIALILLAMIPLNLFNNFSSPWPSPVSTKLGKKCDIFRGRWVQFPK  71

Query  246   GPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFV  425
             GPYYTN T   I D+ NCMKFGRPDT FLKWRW+PD CELP FD  QFLELVRGK+MAF+
Sbjct  72    GPYYTNVTCHHILDQHNCMKFGRPDTEFLKWRWKPDECELPFFDAAQFLELVRGKSMAFM  131

Query  426   GDSVARNQMQSLKCLLASVADPVKVSDAAV---GRWVYKEYNFTLLSFWSPHIVKAKDAD  596
             GDS+ARNQM+SL CLLAS  DP+ VS+         +Y +YNFT+ SFWSP++VK  DA 
Sbjct  132   GDSLARNQMESLLCLLASEGDPIAVSNIKYPLSKSCLYTDYNFTVASFWSPYLVKDIDAK  191

Query  597   PLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNET  776
             P   + +SLMN++ DE    W  ++     VI SAG WFFRP  YY+NG IVGC  C++ 
Sbjct  192   PTAGTANSLMNVFVDEAHEAWMSQIEKFSYVIVSAGIWFFRPQVYYENGNIVGCRLCHKK  251

Query  777   AIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFT  956
              +      +GY  AF+T F+TLL  + F+G+  LRT SP+HFENGEWN+GGNCVRT+P +
Sbjct  252   NVTNHTALYGYRKAFQTTFRTLLRLKNFKGVTFLRTVSPSHFENGEWNTGGNCVRTKPVS  311

Query  957   KRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAH  1136
              ++MKLEG   EMY TQV E   A R G K+G++FRLLDTTE+MV+RPDGHP++YG    
Sbjct  312   SKEMKLEGLYREMYSTQVEELKTAARLGRKRGLKFRLLDTTEAMVMRPDGHPSYYGKRVD  371

Query  1137  ENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             EN T  DCVHWC+PGPIDTWNEFLLQ+LKME
Sbjct  372   ENVTITDCVHWCLPGPIDTWNEFLLQMLKME  402



>ref|XP_009357005.1| PREDICTED: protein trichome birefringence-like 19 [Pyrus x bretschneideri]
 ref|XP_009378328.1| PREDICTED: protein trichome birefringence-like 19 [Pyrus x bretschneideri]
Length=419

 Score =   449 bits (1154),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 204/347 (59%), Positives = 256/347 (74%), Gaps = 7/347 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGP-YYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C IF GNW+P+P+GP YYTN T   I D+QNCMKFGRPDT F+KWRW+P  CELPLFD 
Sbjct  67    QCQIFTGNWIPYPDGPAYYTNETCNFIIDQQNCMKFGRPDTEFMKWRWKPKNCELPLFDA  126

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA------VGRWVYKEYN  542
              QFLELVRGK++AF+GDSV  NQM+SL CLL+SV  P  VS           R+VY +YN
Sbjct  127   AQFLELVRGKSLAFLGDSVGMNQMRSLLCLLSSVTYPEDVSHKYSTNTNYFKRYVYHDYN  186

Query  543   FTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRP  722
             FT+ + W+P++VK++D DP   + +S+  LY DEPD  W  E+ N D VI SAGQWFF P
Sbjct  187   FTMANLWAPYLVKSRDVDPNGHNINSIKTLYLDEPDEAWETEVENFDYVIVSAGQWFFLP  246

Query  723   FFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHF  902
               YY+NG+++GCH+C    +K    ++GY  AF T F+TL + + ++G+  LRTFSPAHF
Sbjct  247   LIYYENGRVIGCHKCGRDNMKSFLTHYGYKKAFETVFRTLQNLKNYKGVTFLRTFSPAHF  306

Query  903   ENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTE  1082
             ENG WN GGNC RTRPF+K +MKL G  LEMYL QV E  AA+++G K+G+ FRL+DTT+
Sbjct  307   ENGAWNEGGNCARTRPFSKEEMKLAGRILEMYLAQVEELKAAEKKGMKRGLEFRLMDTTQ  366

Query  1083  SMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             +M+LRPDGHPN YGH  H N T ADCVHWC+PGPIDTWNE LL +LK
Sbjct  367   AMLLRPDGHPNFYGHSPHRNMTVADCVHWCLPGPIDTWNEILLYMLK  413



>gb|KDO58901.1| hypothetical protein CISIN_1g014192mg [Citrus sinensis]
Length=429

 Score =   447 bits (1151),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 206/351 (59%), Positives = 255/351 (73%), Gaps = 10/351 (3%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WVP P+GPYY+N +   I D+QNCMKFGRPDT F+ WRW+P  CELPLF+  Q
Sbjct  66    CDIFSGEWVPNPKGPYYSNESCRLIIDQQNCMKFGRPDTEFMNWRWKPHECELPLFNPVQ  125

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASV----ADPVKVSDAAVG------RWVYKE  536
             FLE+VRGK++AFVGDSV RNQM+SL CLLAS     A+P  +S           RW Y E
Sbjct  126   FLEIVRGKSLAFVGDSVGRNQMESLLCLLASYMLQEANPEDISHKYTSETDYFKRWYYTE  185

Query  537   YNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFF  716
             Y FT+ + WSP +VK+ DADP   S ++LMNLY DE D  W  ++ N D VI SAGQWFF
Sbjct  186   YKFTVATLWSPFLVKSSDADPNGHSANNLMNLYLDEADESWVSQIENFDYVIISAGQWFF  245

Query  717   RPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPA  896
             RP  YY NG+ VGCH CN   +     Y  Y +AFRTAF+TL   + ++G+  LRTFSP+
Sbjct  246   RPLVYYANGQPVGCHNCNINNMTALTKYHAYRMAFRTAFRTLQRLKNYKGITFLRTFSPS  305

Query  897   HFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDT  1076
             HFENG+W+ GGNC RTRPFT ++++L+GYT+E YLTQV E  AA+++G   G++F LLDT
Sbjct  306   HFENGDWDKGGNCGRTRPFTSQEVELDGYTMEFYLTQVEELRAAEKQGMDMGLKFSLLDT  365

Query  1077  TESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             TE M+LRPDGHPN YGH  H+NKT  DCVHWC+PGPIDTWNEFL  +LK+E
Sbjct  366   TEIMLLRPDGHPNQYGHSMHKNKTVNDCVHWCLPGPIDTWNEFLFYMLKIE  416



>gb|KDO58899.1| hypothetical protein CISIN_1g013284mg [Citrus sinensis]
Length=446

 Score =   448 bits (1152),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 212/363 (58%), Positives = 261/363 (72%), Gaps = 5/363 (1%)
 Frame = +3

Query  156   NISDSLLQSFNLFPGGE-CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFL  332
             N +DS   S     G E C+IF G WVP PEGPYYTN T   I + QNCMK+GRPDT F+
Sbjct  65    NNNDSDQGSIKEVEGSEKCDIFSGEWVPNPEGPYYTNTTCWAIHEHQNCMKYGRPDTDFM  124

Query  333   KWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---  503
             KWRW+PD CELP+F+  QFLE+VRGK+MAFVGDSVARNQMQSL CLL+ V  PV VS   
Sbjct  125   KWRWKPDGCELPIFNPSQFLEIVRGKSMAFVGDSVARNQMQSLICLLSRVEYPVDVSYTP  184

Query  504   DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANAD  683
             +    RW Y  YNFTL +FW+PH+VK+K+AD    +   L NLY DE D  W  ++ + D
Sbjct  185   EERFKRWRYTSYNFTLATFWTPHLVKSKEADSDGPTNTGLFNLYLDEFDEEWTTQIDDFD  244

Query  684   VVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFR  863
              +I SAG WFFRP  YY+N KIVGC  C    +     ++GY  AFRTAFK +   E ++
Sbjct  245   FLIISAGHWFFRPMVYYENNKIVGCKYCLLDNVTDMKMFYGYRSAFRTAFKAIYSLENYK  304

Query  864   GLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGS  1043
             G+  LRTF+P+HFENG WN GGNCVRTRPF   +  LEG  LE+Y+ Q+ EF AA++EG 
Sbjct  305   GITFLRTFAPSHFENGLWNQGGNCVRTRPFKSNETTLEGDNLELYMIQIEEFKAAEKEGQ  364

Query  1044  KKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVL  1220
             ++G RFRLLDTT++M+LRPDGHP+ YGHW HEN T   DCVHWC+PGPIDTW++FLL++L
Sbjct  365   RRGKRFRLLDTTQAMLLRPDGHPSRYGHWPHENVTLYNDCVHWCLPGPIDTWSDFLLEML  424

Query  1221  KME  1229
             KME
Sbjct  425   KME  427



>ref|XP_008230365.1| PREDICTED: protein trichome birefringence-like 19 [Prunus mume]
Length=418

 Score =   446 bits (1146),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 212/371 (57%), Positives = 264/371 (71%), Gaps = 15/371 (4%)
 Frame = +3

Query  156   NISDSLLQSFNLFPGG--------ECNIFKGNWVPFPEGP-YYTNATKCDIEDRQNCMKF  308
             NIS+S L S     G         +C IF GNWVP+P+GP YYTN T   I D+QNCMKF
Sbjct  42    NISNSPLPSPKSNAGSSKSIEKEDQCQIFSGNWVPYPDGPAYYTNETCNLIIDQQNCMKF  101

Query  309   GRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVAD  488
             GRPDT F+ WRW+PD CELPLFD  QFLELVRGK++AF+GDSV RNQMQSL CLLA+V  
Sbjct  102   GRPDTEFMTWRWKPDACELPLFDAAQFLELVRGKSLAFLGDSVGRNQMQSLLCLLATVTY  161

Query  489   PVKVSDAAVG------RWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPD  650
             P  +S           R+VY ++NFT+ + WSP++VK++D DP     +SLM+LY DEPD
Sbjct  162   PEDISHKYSSNTDYFKRYVYNDHNFTIANLWSPYLVKSRDVDPSGHDFNSLMSLYLDEPD  221

Query  651   RLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTA  830
               W   +   D VI S G WFFRP  Y++NG+++GCH+C++  +      +GY  AFRT 
Sbjct  222   EAWLTLVEQFDYVIVSVGHWFFRPLIYHENGRVIGCHKCHQDNMTLFVTSYGYRKAFRTL  281

Query  831   FKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQV  1010
             F+TL   + ++G+  LRTFSP+HFENG WN GGNCVRT+PFTK + KL+GY LEMYLTQV
Sbjct  282   FRTLGSLKNYKGVTFLRTFSPSHFENGAWNEGGNCVRTKPFTKEETKLDGYVLEMYLTQV  341

Query  1011  REFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPID  1190
              E  AA+  G ++G +FRL+DTTE+M+LRPDGHPN YGH  H N T ADCVHWC+PGPID
Sbjct  342   EELKAAEEPGLQRGPQFRLMDTTEAMLLRPDGHPNFYGHSPHRNMTLADCVHWCLPGPID  401

Query  1191  TWNEFLLQVLK  1223
             TWNE LL +LK
Sbjct  402   TWNEILLYMLK  412



>ref|XP_010660517.1| PREDICTED: protein trichome birefringence-like 19 [Vitis vinifera]
Length=405

 Score =   444 bits (1142),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 209/393 (53%), Positives = 272/393 (69%), Gaps = 4/393 (1%)
 Frame = +3

Query  63    PRRRVLGAFRKAVLPISTTLVIFATFCFTSYN-ISDSLLQSFNLFPGGECNIFKGNWVPF  239
             P +R+L      ++ ++  L + A      ++  S       +  PG +C+IF+G WV +
Sbjct  6     PGKRLLSNATMKIILVTIALFLLAMIPLNLFSHFSSPWPSPVSTKPGKKCDIFRGKWVQY  65

Query  240   PEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMA  419
             P+GPYYTN T   I + QNCMKFGRPDT FLKWRW+PD CELPLFD  QFLELVRGK+MA
Sbjct  66    PKGPYYTNVTCRHIFEHQNCMKFGRPDTEFLKWRWKPDECELPLFDAAQFLELVRGKSMA  125

Query  420   FVGDSVARNQMQSLKCLLASVADPVKVSDAAV---GRWVYKEYNFTLLSFWSPHIVKAKD  590
             F+GDS+ARNQM+SL CLLAS  DP+ V +         +Y +YNFT+ SFWSP++VK  D
Sbjct  126   FIGDSLARNQMESLVCLLASEGDPIAVYNIKYPLSKSCLYTDYNFTVASFWSPYLVKDID  185

Query  591   ADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCN  770
             A+P   + +SLMN++ DE    W  ++   D VI SAG WF +P  YY+NG IVGCH C+
Sbjct  186   ANPTAGTANSLMNVFVDEAHEAWMSQIEKFDYVIVSAGIWFLKPQVYYENGDIVGCHLCH  245

Query  771   ETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRP  950
                +       GY  AF+T F+TLL  + F+G+  LRT SP+HFENGEW +GG+CVRT+P
Sbjct  246   TKKVTNLTPLHGYRKAFQTTFRTLLRLKNFKGVTFLRTVSPSHFENGEWYTGGHCVRTKP  305

Query  951   FTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHW  1130
              + ++M+LEG   EMY TQV E  AA++ G K+G++FRLLDTTE+MV+RPDGHP++Y   
Sbjct  306   VSSKEMRLEGLYPEMYSTQVEELKAAEKLGRKRGLKFRLLDTTEAMVVRPDGHPSYYAKR  365

Query  1131  AHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
               EN T ADCVHWC+PGPIDTWNE LLQ+LKME
Sbjct  366   VDENVTRADCVHWCLPGPIDTWNELLLQMLKME  398



>emb|CDP02390.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   444 bits (1143),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 209/401 (52%), Positives = 280/401 (70%), Gaps = 24/401 (6%)
 Frame = +3

Query  90    RKAVLPISTTLVIFATFCFTSYNIS---DSLLQSFNLFPGG-------------ECNIFK  221
             +  +L IS++L++   FC  +Y+ S     ++  ++  P               +CN F 
Sbjct  18    KPLILFISSSLLLTTLFCLYNYSFSPGQQGIIVYYSFLPSSGNVGNSTGTSSKSQCNFFS  77

Query  222   GNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELV  401
             G+WVP  EGPYYTNAT C+++DRQNCMKFGRPDT F+KWRW+P  CELPLFD  +FLEL+
Sbjct  78    GDWVPCAEGPYYTNATNCEMDDRQNCMKFGRPDTEFMKWRWKPYECELPLFDATEFLELM  137

Query  402   RGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLLSFWSPH  572
             RGK+MAF+GDS+ARNQ+QSL C+LASVADP KV+ A   +   W Y EYNFTL  +WS H
Sbjct  138   RGKSMAFIGDSLARNQLQSLLCMLASVADPTKVAHAPFAKIRLWFYAEYNFTLAFYWSFH  197

Query  573   IVKAKDADPLWVSPD-SLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKI  749
             +V+++DA+   V+ + + MN+Y DE D  WA ++ N + ++ S+GQWF RP  YY+ GK+
Sbjct  198   LVRSEDAE---VNVNLTRMNVYLDEVDETWATQVENFNFLVISSGQWFLRPLMYYEKGKL  254

Query  750   VGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGG  929
             VGC+ C +  I   + ++GY +AFRT+F+TLL+ EKF+G+  LRTF+P+H+ENG WN GG
Sbjct  255   VGCYLCKKENITDLDVFYGYKMAFRTSFRTLLNLEKFKGITFLRTFTPSHYENGYWNEGG  314

Query  930   NCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSK-KGVRFRLLDTTESMVLRPDG  1106
              C RTRP  K +MKL  Y  E++ TQV E  AA+ E  K +G +FR+L+ TE M LRPDG
Sbjct  315   TCSRTRPTPKHEMKLSDYFSELHSTQVAELTAAETEARKTRGPKFRMLEVTEMMTLRPDG  374

Query  1107  HPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             HP+HYGH A  N    DC HWC+PGPIDTWNE LLQ+LK E
Sbjct  375   HPSHYGHPASANIKNPDCAHWCLPGPIDTWNEALLQMLKTE  415



>ref|XP_006430842.1| hypothetical protein CICLE_v10011721mg [Citrus clementina]
 gb|ESR44082.1| hypothetical protein CICLE_v10011721mg [Citrus clementina]
Length=446

 Score =   445 bits (1144),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 211/363 (58%), Positives = 261/363 (72%), Gaps = 5/363 (1%)
 Frame = +3

Query  156   NISDSLLQSFNLFPGGE-CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFL  332
             N +DS   S     G E C+IF G WVP PEGPYYTN T   I + QNCMK+GRPDT F+
Sbjct  65    NNNDSDQVSIKEVEGSEKCDIFSGEWVPNPEGPYYTNTTCWAIHEHQNCMKYGRPDTDFM  124

Query  333   KWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---  503
             KWRW+PD CELP+F+  QFLE+VRGK+MAFVGDSVARNQMQSL CLL+ V  PV VS   
Sbjct  125   KWRWKPDGCELPIFNPSQFLEIVRGKSMAFVGDSVARNQMQSLICLLSRVEYPVDVSYTP  184

Query  504   DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANAD  683
             +    RW Y  YNFTL +FW+PH+VK+K+AD    +   L NLY DE D  W  ++ + D
Sbjct  185   EERFKRWRYTSYNFTLATFWTPHLVKSKEADSDGPTNTGLFNLYLDEFDEEWTTQIDDFD  244

Query  684   VVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFR  863
              +I SAG WFFRP  YY+N KIVGC  C    +     ++GY  AFRTAFK +   E ++
Sbjct  245   FLIISAGHWFFRPMVYYENNKIVGCKYCLLDNVTDMKMFYGYRSAFRTAFKGINSLENYK  304

Query  864   GLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGS  1043
             G+  LRTF+P+HFENG WN GGNCVRTRPF   +  LEG  LE+Y+ Q+ EF AA++EG 
Sbjct  305   GITFLRTFAPSHFENGLWNQGGNCVRTRPFKSNETTLEGDNLELYMIQIEEFKAAEKEGQ  364

Query  1044  KKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVL  1220
             ++G RFRLLDTT++++LRPDGHP+ YGHW HEN T   DCVHWC+PGPIDTW++FLL++L
Sbjct  365   RRGKRFRLLDTTQAVLLRPDGHPSRYGHWPHENVTLYNDCVHWCLPGPIDTWSDFLLEML  424

Query  1221  KME  1229
             KME
Sbjct  425   KME  427



>ref|XP_006482316.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=446

 Score =   444 bits (1142),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 209/363 (58%), Positives = 261/363 (72%), Gaps = 5/363 (1%)
 Frame = +3

Query  156   NISDSLLQSFNLFPGGE-CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFL  332
             N +D+   S     G E C+IF G WVP PEGPYYTN T   I + QNCMK+GRPDT F+
Sbjct  65    NNNDADQGSIKEVEGSEKCDIFSGEWVPNPEGPYYTNTTCWAIHEHQNCMKYGRPDTDFM  124

Query  333   KWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---  503
             KWRW+PD CELP+F+  QFLE+VRGK+MAFVGDSVARNQMQSL CLL+ V  PV VS   
Sbjct  125   KWRWKPDGCELPIFNPSQFLEIVRGKSMAFVGDSVARNQMQSLICLLSRVEYPVDVSYTP  184

Query  504   DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANAD  683
             +    RW Y  YNFTL +FW+PH+VK+K+AD    +   L NLY DE D  W  ++ + +
Sbjct  185   EERFKRWRYTSYNFTLATFWTPHLVKSKEADSDGPTNTGLFNLYLDEFDEEWTTQIDDFN  244

Query  684   VVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFR  863
              +I SAG WFFRP  YY+N KIVGC  C    +     ++GY  AFRTAFK +   E ++
Sbjct  245   FLIISAGHWFFRPMVYYENNKIVGCKYCLLDNVTDMKMFYGYRSAFRTAFKAIYSLENYK  304

Query  864   GLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGS  1043
             G+  LRTF+P+HFENG WN GGNCVRTRPF   +  LEG  LE+Y+ Q+ EF AA++EG 
Sbjct  305   GITFLRTFAPSHFENGLWNQGGNCVRTRPFKSNETTLEGDNLELYMIQIEEFKAAEKEGQ  364

Query  1044  KKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVL  1220
             ++G +FRLLDTT++M+LRPDGHP+ YGHW HEN T   DCVHWC+PGPIDTW++FLL++L
Sbjct  365   RRGKKFRLLDTTQAMLLRPDGHPSRYGHWPHENVTLYNDCVHWCLPGPIDTWSDFLLEML  424

Query  1221  KME  1229
             KME
Sbjct  425   KME  427



>ref|XP_004306034.1| PREDICTED: uncharacterized protein LOC101310633 [Fragaria vesca 
subsp. vesca]
Length=470

 Score =   443 bits (1140),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 199/347 (57%), Positives = 255/347 (73%), Gaps = 7/347 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGP-YYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C +F GNW+P+P+GP YYTN T   I  +QNCMKFGRPD+ F+KWRW+PD CELPLFD 
Sbjct  118   QCQLFSGNWIPYPDGPAYYTNETCEWIIPQQNCMKFGRPDSEFMKWRWKPDGCELPLFDA  177

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKEYN  542
              +FLE+ RGK++AF+GDSV RNQMQSL C+L +V  P  +SD           +VY +YN
Sbjct  178   AEFLEIFRGKSLAFIGDSVGRNQMQSLLCILGNVTYPEDISDQYSNNTDYFKHYVYTDYN  237

Query  543   FTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRP  722
             FT+++ W+P++++   ADP   S DSLMNLY DEPD  W  ++ N D VIFSAGQWF RP
Sbjct  238   FTMVTLWAPYLIRYSYADPSVHSGDSLMNLYLDEPDEAWTSQVENFDYVIFSAGQWFLRP  297

Query  723   FFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHF  902
               +Y+NG  +GC  C    + K +  +GY  AFRT F+TL   E ++G+  LRTFSPAHF
Sbjct  298   LIFYENGGSIGCLWCKLDNMTKMSESYGYRKAFRTMFRTLQSLENYKGVTFLRTFSPAHF  357

Query  903   ENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTE  1082
             ENG+WN+GGNC RT+PF+K +MKLEGY L+MY  QV EF AA+ +  +KG+ FRL++TTE
Sbjct  358   ENGDWNAGGNCGRTKPFSKEEMKLEGYNLDMYTAQVEEFKAAQVQAQQKGLDFRLMETTE  417

Query  1083  SMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             +M+LRPD HPN+YG   H N TTADCVHWC+PGPIDTWNE LL +LK
Sbjct  418   AMLLRPDAHPNYYGGSHHRNTTTADCVHWCLPGPIDTWNEILLHMLK  464



>ref|XP_007216034.1| hypothetical protein PRUPE_ppa017420mg [Prunus persica]
 gb|EMJ17233.1| hypothetical protein PRUPE_ppa017420mg [Prunus persica]
Length=422

 Score =   441 bits (1135),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 211/375 (56%), Positives = 263/375 (70%), Gaps = 19/375 (5%)
 Frame = +3

Query  156   NISDSLLQSFNLFPGG--------ECNIFKGNWVPFPEGP-YYTNATKCDIEDRQNCMKF  308
             NIS+S L S     G         +C IF GNWVP+P+GP YYTN T   I D+QNCMKF
Sbjct  42    NISNSPLPSPKSNAGSSKSIEKEDQCQIFTGNWVPYPDGPAYYTNETCNLIIDQQNCMKF  101

Query  309   GRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVAD  488
             GRPDT F+ WRW+PD CELPLFD  QFLELVRGK++AF+GDSV RNQMQSL CLLA+V  
Sbjct  102   GRPDTEFMTWRWKPDACELPLFDAAQFLELVRGKSLAFLGDSVGRNQMQSLLCLLATVTY  161

Query  489   PVKVSDAAVG------RWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPD  650
             P  +S           R+VY ++NFT+ + WSP++VK++D DP     +SLM+LY DEPD
Sbjct  162   PEDISHKYSSNTDYFKRYVYNDHNFTIANLWSPYLVKSRDVDPRGNDFNSLMSLYLDEPD  221

Query  651   RLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTA  830
               W   +   D VI S G WFFRP  Y++NG+++GCH+C +  +      +GY  AFRT 
Sbjct  222   EAWLTLVEQFDYVIVSVGHWFFRPLIYHENGRVIGCHKCEQDNMTSFVTSYGYRKAFRTL  281

Query  831   FKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQV  1010
             FKTL   + ++G+  LRTFSP+HFENG WN GGNC RT+PFTK + KL+GY LEMYLTQV
Sbjct  282   FKTLGSLKNYKGVTFLRTFSPSHFENGAWNEGGNCARTKPFTKEETKLDGYVLEMYLTQV  341

Query  1011  REFMAAKRE----GSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMP  1178
              E  AA+ +    G ++G++FRL+DTTE+M+LRPDGHPN YGH  H N T ADCVHWC+P
Sbjct  342   EELKAAEEQGLQRGLQRGLQFRLMDTTEAMLLRPDGHPNFYGHSPHRNMTLADCVHWCLP  401

Query  1179  GPIDTWNEFLLQVLK  1223
             GPID WNE LL +LK
Sbjct  402   GPIDAWNEILLYMLK  416



>ref|XP_002305969.2| hypothetical protein POPTR_0004s10540g [Populus trichocarpa]
 gb|EEE86480.2| hypothetical protein POPTR_0004s10540g [Populus trichocarpa]
Length=446

 Score =   442 bits (1136),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 202/346 (58%), Positives = 251/346 (73%), Gaps = 4/346 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G W+P P  PYYTN T   I + QNCMK+GRPDTGF+KWRWQPD CELP+F+  
Sbjct  82    KCDIFTGEWIPNPHAPYYTNTTCWAIHEHQNCMKYGRPDTGFMKWRWQPDGCELPVFNPA  141

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLE+V+GK+MAFVGDSV RNQMQSL CLL+ V  P+ VS   D    RW Y  YNFTL 
Sbjct  142   QFLEIVKGKSMAFVGDSVGRNQMQSLICLLSRVEYPIDVSYTPDEHFKRWRYPSYNFTLA  201

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             +FW+PH+VKA++ D    +   L NLY DE D  W  ++   D VI +AG WF+RP  YY
Sbjct  202   TFWTPHLVKAEETDAYGPTHTGLFNLYLDEFDEGWTTQIEEFDYVIINAGHWFYRPCVYY  261

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N ++VGC  C    +     YFGY  AFRTAF+ L   E ++G+  LRTF+P+HFENGE
Sbjct  262   ENRQVVGCRFCLLENVTDLPMYFGYRKAFRTAFRALNSLENYKGITFLRTFAPSHFENGE  321

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNCVR RPF   +  LEG   E+Y+TQ+ EF  A++EG K+G+RFRLLDTT++M+L
Sbjct  322   WNKGGNCVRRRPFRSNETSLEGINFELYMTQLEEFKLAEKEGKKRGLRFRLLDTTQAMLL  381

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGHW HEN T   DCVHWC+PGPIDTWN+FLL++LKME
Sbjct  382   RPDGHPSRYGHWPHENVTLYNDCVHWCLPGPIDTWNDFLLEMLKME  427



>ref|XP_009371024.1| PREDICTED: protein trichome birefringence-like 19 [Pyrus x bretschneideri]
Length=440

 Score =   440 bits (1132),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 201/349 (58%), Positives = 258/349 (74%), Gaps = 7/349 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGP-YYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C I  G+W+P+P+GP YYTN T   I D+QNCMKFGRPD  F+KWRW+P+ CELPLFD 
Sbjct  67    QCQILSGSWIPYPDGPAYYTNETCNFIIDQQNCMKFGRPDAEFMKWRWKPEDCELPLFDS  126

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAV------GRWVYKEYN  542
              QFLELVRGK++AF+GDSV  NQMQSL CLL++V  P  +S           R+VY +YN
Sbjct  127   AQFLELVRGKSLAFLGDSVGGNQMQSLLCLLSNVTYPEDISGKYSTNTDYSKRYVYHDYN  186

Query  543   FTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRP  722
             FT+  FW+P++VK++DAD      +SL +LY DEPD  W  E+ N D VI S GQWFF+P
Sbjct  187   FTMAYFWAPYLVKSRDADLNGHGLNSLTSLYLDEPDERWETEVENFDYVIVSGGQWFFQP  246

Query  723   FFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHF  902
               YY+NG+++GCH+C    +K    Y+GY  AFRT F+TL + + ++G+  LRTFSP+HF
Sbjct  247   LIYYENGRVIGCHKCGRDDMKSFLPYYGYKKAFRTVFRTLRNLKNYKGVTFLRTFSPSHF  306

Query  903   ENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTE  1082
             ENG  N GGNC RTRPF+K ++KL+GYTLEMYLTQV E  AA+++G K+G+ FRL+D TE
Sbjct  307   ENGARNEGGNCPRTRPFSKEEIKLDGYTLEMYLTQVEELKAAEKKGMKRGLEFRLMDPTE  366

Query  1083  SMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             +M+LRPDGHPN YGH    N T ADCVHWC+PGPIDTWNE LL +++ E
Sbjct  367   AMLLRPDGHPNFYGHSPRRNITIADCVHWCLPGPIDTWNEILLYIMQRE  415



>ref|XP_004507246.1| PREDICTED: uncharacterized protein LOC101494718 [Cicer arietinum]
Length=430

 Score =   437 bits (1125),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 194/348 (56%), Positives = 255/348 (73%), Gaps = 6/348 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF GNW+P+ E PYY N T   I D+QNC+KFGR D  +L WRW+P+ C+LPLF+  Q
Sbjct  73    CDIFSGNWIPYLEEPYYNNETCNLITDQQNCLKFGRDDKEYLHWRWKPNECDLPLFNATQ  132

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKEYNFT  548
             FL+LVRGK +AFVGDSV RN MQSL CLL+ V+    +S           R+ + +YNFT
Sbjct  133   FLKLVRGKKIAFVGDSVGRNHMQSLLCLLSQVSQYEDISHKYTSDVIYFRRYFFADYNFT  192

Query  549   LLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFF  728
             L + WSP+ V++ DADP   S DS+M LY DE D  W+ ++ N D++I SAG WFFRP  
Sbjct  193   LGNLWSPYFVRSIDADPNGHSYDSIMKLYVDEVDEAWSSKVENFDIIIISAGHWFFRPLL  252

Query  729   YYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFEN  908
             YY+ G++VGC++C    + +  HY+GY +AFRTAF+TL + E ++G+  LRTFSP+HFEN
Sbjct  253   YYEKGQLVGCNKCGMENVTELGHYYGYKMAFRTAFRTLTNLENYKGVTFLRTFSPSHFEN  312

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G+WN GGNCVRT+PF K +MKL+GY  E YLTQV EF  A+ EGSKKG++F +++TTE M
Sbjct  313   GDWNKGGNCVRTKPFDKEEMKLDGYIKETYLTQVNEFNVAQEEGSKKGLKFFMINTTEIM  372

Query  1089  VLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             + RPDGHPN+YGH   +N T  DCVHWC+PGP+DTWNEFLL +L +E+
Sbjct  373   LWRPDGHPNNYGHSKEQNVTFNDCVHWCLPGPVDTWNEFLLYMLNVES  420



>ref|XP_011046772.1| PREDICTED: protein trichome birefringence-like 19 [Populus euphratica]
Length=446

 Score =   437 bits (1124),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 200/346 (58%), Positives = 251/346 (73%), Gaps = 4/346 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G W+P P  PYYTN T   I + QNCMK+GRPDTGF+KWRWQPD C+LP+F+  
Sbjct  82    KCDIFTGEWIPNPHAPYYTNTTCWAIHEHQNCMKYGRPDTGFMKWRWQPDGCQLPVFNPA  141

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLE+V+GK+MAFVGDSV RNQMQSL CLL+ V  P+ VS   D    RW Y  YNFTL 
Sbjct  142   QFLEIVKGKSMAFVGDSVGRNQMQSLICLLSRVEYPIDVSYTPDEHFKRWRYPSYNFTLA  201

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             +FW+PH+VKA++ D    +   L NLY DE D  W  ++   D VI +AG WF+RP  YY
Sbjct  202   TFWTPHLVKAEETDANGPTHTGLFNLYLDEFDEGWTTQIEEFDYVIINAGHWFYRPCIYY  261

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N K+VGC  C    +     YFGY  AFRT F+ L   + ++G+  LRTFSP+HFENGE
Sbjct  262   ENRKVVGCRFCLLENVTDLPMYFGYRKAFRTTFRALNSLKNYKGITFLRTFSPSHFENGE  321

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN+GG+CVR RPF   +  LEG   E+Y+TQ+ EF  A++EG K+G+RFRLLDTT++M+L
Sbjct  322   WNNGGDCVRRRPFRSNETSLEGINFELYMTQLEEFKLAEKEGKKRGLRFRLLDTTQAMLL  381

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGHW HEN T   DCVHWC+PGPIDTWN+FLL++LKME
Sbjct  382   RPDGHPSRYGHWPHENVTLYNDCVHWCLPGPIDTWNDFLLEMLKME  427



>ref|XP_002533952.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28438.1| conserved hypothetical protein [Ricinus communis]
Length=329

 Score =   432 bits (1112),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 204/317 (64%), Positives = 239/317 (75%), Gaps = 6/317 (2%)
 Frame = +3

Query  300   MKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLAS  479
             MKFGRPDT F+KWRW+P+ CELP F+  QFLELVRGK+MAFVGDSV RNQMQSL CLLAS
Sbjct  1     MKFGRPDTDFMKWRWRPEECELPFFNAGQFLELVRGKSMAFVGDSVGRNQMQSLLCLLAS  60

Query  480   VADPVKVS-----DAAVGR-WVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTD  641
             VA P  VS     D    R W Y +Y FTL + WSP +VK+ DADP   S +SLMNLY D
Sbjct  61    VAHPEDVSHIYATDTTYFRYWFYSDYKFTLATLWSPFLVKSCDADPNGHSLNSLMNLYLD  120

Query  642   EPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAF  821
             + D  WA+++ N D VI SAGQWFFRP  YY NG+IVGCH C    I     Y+G+ +AF
Sbjct  121   QADEAWANQVENFDYVIISAGQWFFRPLIYYMNGQIVGCHNCYNENITSVTKYYGFRMAF  180

Query  822   RTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYL  1001
             RTAFKTL   + ++G+  LRTFSP+HFENGEWN+GG+C RTRPFT  +MKL+GYTLE YL
Sbjct  181   RTAFKTLQSLKGYKGITFLRTFSPSHFENGEWNAGGHCARTRPFTSEEMKLDGYTLEFYL  240

Query  1002  TQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPG  1181
             TQV E   A+REG K+G +FRLL TTE+MVLRPDGHPN+YGH  H N T ADCVHWC+PG
Sbjct  241   TQVEELRKAEREGKKRGPKFRLLATTEAMVLRPDGHPNYYGHSPHRNMTIADCVHWCLPG  300

Query  1182  PIDTWNEFLLQVLKMET  1232
             PIDTWNEFLL ++K E 
Sbjct  301   PIDTWNEFLLYMMKREA  317



>ref|XP_010029470.1| PREDICTED: protein trichome birefringence-like 19 [Eucalyptus 
grandis]
 gb|KCW56391.1| hypothetical protein EUGRSUZ_I02119 [Eucalyptus grandis]
Length=444

 Score =   437 bits (1123),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 210/403 (52%), Positives = 266/403 (66%), Gaps = 12/403 (3%)
 Frame = +3

Query  60    SPRRRVLGAFRKAVLPISTTLVIFATF------CFTSYNISDSLLQSFNLFPGGECNIFK  221
             S  ++VL      VL  +  L +F T        F    IS  + +         C++FK
Sbjct  20    SSTKKVLVLASTPVLLAAIPLYLFITGTHLGAPSFQELEISTGISKGIERVDRRRCDVFK  79

Query  222   GNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELV  401
             G WV  P   YYTN T   I D+ NC+KFGRPDT FLKWRW+PD CELP F   +FLE+ 
Sbjct  80    GQWVHHPNAAYYTNVTCPLIIDQHNCLKFGRPDTEFLKWRWKPDECELPRFHAGRFLEMA  139

Query  402   RGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD------AAVGRWVYKEYNFTLLSFW  563
             RGK++AFVGDSV RNQMQSL CLLA V  P ++S           RW +  + FTL +FW
Sbjct  140   RGKSLAFVGDSVGRNQMQSLLCLLAKVEVPEEISHRYSIDTTYFKRWYFSVHKFTLATFW  199

Query  564   SPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNG  743
             +P +VK++DADP   S +++M+LY DEPD  WA E+A+ D V+ SAGQWFFRP  YY+  
Sbjct  200   APFLVKSRDADPDSHSFNNIMSLYLDEPDLSWASEIADFDFVVISAGQWFFRPLMYYEKR  259

Query  744   KIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNS  923
             K++GC  C    +     ++GY +AFRTAF+ LL+ + ++G+  LRTFSPAHFENG WN+
Sbjct  260   KVIGCGSCEVNNVTDLTRFYGYRMAFRTAFRELLNQKAYKGMTFLRTFSPAHFENGAWNT  319

Query  924   GGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPD  1103
             GG+C RTRPF   + KLEG  LE YLTQV EF AA++EG K+G+ FRLLDTTE+M+ RPD
Sbjct  320   GGSCARTRPFASGEAKLEGEDLEFYLTQVEEFRAAQKEGIKRGLTFRLLDTTEAMIQRPD  379

Query  1104  GHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             GHPN  GH A  N+T ADCVHWCMPGPID WNEFL  V+  E+
Sbjct  380   GHPNRLGHLALRNETMADCVHWCMPGPIDLWNEFLFHVMWSES  422



>ref|XP_010100920.1| hypothetical protein L484_009690 [Morus notabilis]
 gb|EXB85844.1| hypothetical protein L484_009690 [Morus notabilis]
Length=446

 Score =   432 bits (1111),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 200/394 (51%), Positives = 270/394 (69%), Gaps = 16/394 (4%)
 Frame = +3

Query  96    AVLPISTTLVIFATFCFTSYN------------ISDSLLQSFNLFPGGECNIFKGNWVPF  239
               +P+    + +++F FTS+N             SD    +       +C+IF G WVP 
Sbjct  34    TTVPLYYPSLTYSSFIFTSFNSDHESSSPNSSERSDEYDGAIPTSSTHKCDIFSGEWVPN  93

Query  240   PEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMA  419
             P+ P+YTN T   I + QNCMK+GRPDT F+KWRW+PD CELP+F+  QFLELVR K++A
Sbjct  94    PDAPFYTNKTCWAIHEHQNCMKYGRPDTEFMKWRWKPDGCELPVFNPAQFLELVRDKSLA  153

Query  420   FVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLSFWSPHIVKAKD  590
             FVGDSVARNQMQSL CLL+ V  P+ VS   D    RW Y  YNFT+ +FW+PH+VKA++
Sbjct  154   FVGDSVARNQMQSLICLLSKVEYPIDVSYTSDQRFARWKYTTYNFTMATFWTPHLVKAEE  213

Query  591   ADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCN  770
             +D    +   L +LY DE D  W  ++++ D ++ S G WF+RP  +Y+N ++VGCH C 
Sbjct  214   SDSNGPTHTGLFSLYLDEFDENWTTQVSDFDYILISGGHWFYRPAVFYENRRVVGCHYCL  273

Query  771   ETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRP  950
                +     Y+GY  AFRTAFK +   + ++G+  LRT +P+HFE G WN GGNC+RTRP
Sbjct  274   LPNVTDLGMYYGYRKAFRTAFKAINSLKNYKGVTYLRTLAPSHFEGGLWNDGGNCIRTRP  333

Query  951   FTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHW  1130
             F   +  LEG ++E+Y+TQ+ EF AA+REG K+G++FRLLDTT++M+LRPDGHP+ YGHW
Sbjct  334   FRSNETLLEGQSMELYMTQIEEFRAAEREGKKRGLKFRLLDTTQAMLLRPDGHPSRYGHW  393

Query  1131  AHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
              HEN T   DCVHWC+PGPIDTWN+FLL++LK E
Sbjct  394   PHENVTLYNDCVHWCLPGPIDTWNDFLLEMLKTE  427



>ref|XP_007151467.1| hypothetical protein PHAVU_004G049000g [Phaseolus vulgaris]
 gb|ESW23461.1| hypothetical protein PHAVU_004G049000g [Phaseolus vulgaris]
Length=427

 Score =   431 bits (1109),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 195/352 (55%), Positives = 250/352 (71%), Gaps = 6/352 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G W+     PYYTN T   I D+QNCMKFGRPD  +L WRW+PD CELPLF+  
Sbjct  67    QCDIFSGRWMHTSAAPYYTNETCHWIIDQQNCMKFGRPDREYLHWRWKPDECELPLFNAS  126

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKEYNF  545
              FL L+RGK M FVGDSV RNQMQSL CLL+ V++P   S           R++Y +YNF
Sbjct  127   HFLNLLRGKKMVFVGDSVGRNQMQSLLCLLSHVSEPEDASHRYYSDVMYFKRYIYHDYNF  186

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             TL + WSP+ V++ DADP   S +S+M LY DE D  W  ++ + D+VI S+GQWFFRP 
Sbjct  187   TLANLWSPYFVRSSDADPKGHSFNSIMRLYVDEADEAWTSQVEDFDIVIISSGQWFFRPL  246

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              +Y+ G++VGC++C    +    H FGY  AFRTAF+ L D E ++G+   RTFSPAHFE
Sbjct  247   LFYEEGQLVGCNKCGMENVTDLTHLFGYRKAFRTAFRALNDLEGYKGVTFFRTFSPAHFE  306

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
             NG+WN GG CVRTRPFTK++MK E Y L+MY+TQV EFM A+R  +K+G++F +++TTE 
Sbjct  307   NGDWNKGGKCVRTRPFTKQEMKPEEYILDMYMTQVEEFMEAQRVATKRGLQFLMMNTTEI  366

Query  1086  MVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKMETPEY  1241
             M LRPDGHPN+YGH   +N T  DCVHWC+PGP+DTWNEFLL +L  E+  Y
Sbjct  367   MFLRPDGHPNNYGHSRDKNVTLNDCVHWCLPGPVDTWNEFLLHMLDRESEAY  418



>ref|XP_007033404.1| Trichome birefringence-like 19 [Theobroma cacao]
 gb|EOY04330.1| Trichome birefringence-like 19 [Theobroma cacao]
Length=444

 Score =   431 bits (1109),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 197/364 (54%), Positives = 255/364 (70%), Gaps = 4/364 (1%)
 Frame = +3

Query  150   SYNISDSLLQSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGF  329
             +Y+IS+ L  S  +  G  C+IF G WV  P+ PYYTN T   I + QNCMK+G+PDT +
Sbjct  62    TYDISEELQASIRISEGENCDIFSGEWVRNPDAPYYTNTTCWAIHEHQNCMKYGKPDTEY  121

Query  330   LKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS--  503
             +KW+W+PD CELP+F+  QFLE+VRGK++AFVGDSV RNQMQSL CLL+ V  P+ VS  
Sbjct  122   MKWKWKPDGCELPVFNPAQFLEIVRGKSLAFVGDSVGRNQMQSLICLLSRVEYPIDVSYT  181

Query  504   -DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANA  680
              D    RW Y  YNFT+  FW+PH+VK+K+ +    +   L NLY DE D  W  ++   
Sbjct  182   PDEKFKRWKYTSYNFTIAYFWTPHLVKSKEREANGPTQTGLFNLYLDELDEEWTTQIEEF  241

Query  681   DVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKF  860
             D +I S G WF+RP  +Y+N +IVGCH C    +     ++GY  AFRTAF+ +   E F
Sbjct  242   DYLIISGGHWFYRPSVFYENNQIVGCHFCLIENVTDLTKFYGYRKAFRTAFRAINSLENF  301

Query  861   RGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREG  1040
             +G+  LRTF+P+HFENG WN GGNCVRT+PF   +  L+G  LE+Y+ Q+ EF  A+REG
Sbjct  302   KGITFLRTFAPSHFENGMWNQGGNCVRTKPFRSNETALDGENLELYMIQMEEFRTAEREG  361

Query  1041  SKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQV  1217
              KKG R+RL+DTT + +LRPDGHP+ YGHW HEN T   DCVHWC+PGPIDTWN+FLLQ+
Sbjct  362   RKKGKRYRLMDTTLATLLRPDGHPSRYGHWPHENVTLYNDCVHWCLPGPIDTWNDFLLQM  421

Query  1218  LKME  1229
             LKME
Sbjct  422   LKME  425



>emb|CBI16875.3| unnamed protein product [Vitis vinifera]
Length=988

 Score =   447 bits (1150),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 207/347 (60%), Positives = 255/347 (73%), Gaps = 3/347 (1%)
 Frame = +3

Query  198   GGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFD  377
             G +C+IF+G WV FP+GPYYTN T   I D+ NCMKFGRPDT FLKWRW+PD CELP FD
Sbjct  635   GKKCDIFRGRWVQFPKGPYYTNVTCHHILDQHNCMKFGRPDTEFLKWRWKPDECELPFFD  694

Query  378   GRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAV---GRWVYKEYNFT  548
               QFLELVRGK+MAF+GDS+ARNQM+SL CLLAS  DP+ VS+         +Y +YNFT
Sbjct  695   AAQFLELVRGKSMAFMGDSLARNQMESLLCLLASEGDPIAVSNIKYPLSKSCLYTDYNFT  754

Query  549   LLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFF  728
             + SFWSP++VK  DA P   + +SLMN++ DE    W  ++     VI SAG WFFRP  
Sbjct  755   VASFWSPYLVKDIDAKPTAGTANSLMNVFVDEAHEAWMSQIEKFSYVIVSAGIWFFRPQV  814

Query  729   YYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFEN  908
             YY+NG IVGC  C++  +      +GY  AF+T F+TLL  + F+G+  LRT SP+HFEN
Sbjct  815   YYENGNIVGCRLCHKKNVTNHTALYGYRKAFQTTFRTLLRLKNFKGVTFLRTVSPSHFEN  874

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             GEWN+GGNCVRT+P + ++MKLEG   EMY TQV E   A R G K+G++FRLLDTTE+M
Sbjct  875   GEWNTGGNCVRTKPVSSKEMKLEGLYREMYSTQVEELKTAARLGRKRGLKFRLLDTTEAM  934

Query  1089  VLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             V+RPDGHP++YG    EN T  DCVHWC+PGPIDTWNEFLLQ+LKME
Sbjct  935   VMRPDGHPSYYGKRVDENVTITDCVHWCLPGPIDTWNEFLLQMLKME  981


 Score =   390 bits (1003),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 185/350 (53%), Positives = 238/350 (68%), Gaps = 15/350 (4%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G W+  P+ PYYTN T   I + QNCMK+GRPD  F+KWRW+PD CELP+F+  
Sbjct  136   KCDIFSGEWIRNPKAPYYTNTTCWAIHEHQNCMKYGRPDLDFMKWRWKPDGCELPIFNPA  195

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLEL+R KT+AFVGDSVARN MQSL CLL+ V  P+ VS   D    RW Y +YNFT+ 
Sbjct  196   QFLELMRDKTLAFVGDSVARNHMQSLMCLLSRVVYPIDVSYTTDENFKRWRYTDYNFTMA  255

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             SFW+P ++K K ADP   +   L NLY DE D  W ++M   D +I SAGQWF+RP  +Y
Sbjct  256   SFWTPFLIKTKLADPGGPTQTGLFNLYLDELDEAWTNQMEEFDYLIISAGQWFYRPTMFY  315

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N ++ GC+ C +  +     Y+GY  AFRT FK +  ++ F+G+ ILRTFSPAHFENG 
Sbjct  316   ENRRVSGCYYCLQENVTDLTVYYGYRKAFRTVFKAINSNKNFKGMTILRTFSPAHFENGL  375

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNCVRTRPF   +  +EG  LE+Y+TQ+ E+ AA+R   K+G++FRLLDTT++M L
Sbjct  376   WNKGGNCVRTRPFMSNESTMEGPNLELYMTQIEEYRAAERVALKRGLKFRLLDTTQAMWL  435

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKMETPEY  1241
             RPDGHP+ YGHW + N T   DCVHW           F+L VLK  +  Y
Sbjct  436   RPDGHPSRYGHWPNANVTLYNDCVHW-----------FMLSVLKRPSHVY  474



>ref|XP_003555087.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN28373.1| hypothetical protein glysoja_029634 [Glycine soja]
Length=432

 Score =   429 bits (1104),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 250/351 (71%), Gaps = 10/351 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +CNIF G WV  PE PYY+N T   I D+QNC+KFGRPD  +L WRW+PD CELP F+  
Sbjct  67    QCNIFSGRWVHNPEAPYYSNETCHWIIDQQNCLKFGRPDREYLHWRWKPDECELPFFNAT  126

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD------AAVGRWVYKEYNF  545
             QFL LVRGK MAFVGDSV RNQMQSL CLL+ V++P  VS           R+ Y +YNF
Sbjct  127   QFLNLVRGKKMAFVGDSVGRNQMQSLLCLLSHVSEPEDVSHKYSSDVVYFKRYFYHDYNF  186

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             TL + WSP+ V++ DADP   + +S+M LY DE D  W  ++ N D+VI S+GQWFFRP 
Sbjct  187   TLGNLWSPYFVRSSDADPRGHTYNSIMKLYVDEADEAWTSQVENFDIVIISSGQWFFRPL  246

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              +Y+ GK+VGC++C    +    H +GY  AFRTAF+ L   E ++G+  LRTFSPAHFE
Sbjct  247   LFYEKGKLVGCNKCGMDNVTDLTHLYGYKKAFRTAFRALNSLENYKGVTFLRTFSPAHFE  306

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEG----YTLEMYLTQVREFMAAKREGSKKGVRFRLLD  1073
             NG+WN GG CVRT PFTK++M+LE     Y LEMY+TQV EF  A+R  +K+G+ F +++
Sbjct  307   NGDWNKGGKCVRTMPFTKQEMRLEDGAVEYILEMYVTQVEEFREAQRVATKRGLEFLMMN  366

Query  1074  TTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKM  1226
             TTE M+LRPDGHPN+YGH   +N T  DCVHWC+PGP+DTWNEFLL +L +
Sbjct  367   TTEIMLLRPDGHPNNYGHAKDKNVTLNDCVHWCLPGPVDTWNEFLLYMLDI  417



>gb|KHN13805.1| hypothetical protein glysoja_016089 [Glycine soja]
Length=496

 Score =   432 bits (1110),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 246/350 (70%), Gaps = 15/350 (4%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIE-DRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             CNIF G W+P+ +GPYY N T CD+  D+QNCMKFGRPD  FLKWRW+PD CELPLFD  
Sbjct  4     CNIFSGEWIPYSKGPYYDNET-CDLMIDQQNCMKFGRPDREFLKWRWKPDECELPLFDAT  62

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKEYNF  545
              FLELVRGK+MAFVGDSV RNQM SL CLL+ VA P  ++           RW Y +YNF
Sbjct  63    LFLELVRGKSMAFVGDSVGRNQMNSLLCLLSHVAHPEDITKRYATDPIYFRRWFYADYNF  122

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             T+++ WSP +V+  D D      +SL  LY D+ D  W  E+   D VI SAGQWFFRP 
Sbjct  123   TVVTLWSPFLVRTSDID------NSLTKLYLDKADESWTSEVETFDFVIISAGQWFFRPA  176

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              YY+ G+IVGCH+C    IK  ++Y+GY  AFRTA +T+   E +RG+  LRTFSPAHFE
Sbjct  177   LYYEKGQIVGCHKCERRKIKDLSYYYGYRKAFRTALRTIASLEGYRGVTFLRTFSPAHFE  236

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
             N EWN GG+C RTRP++K QM+ +GY  E Y TQV EF  A++   K+G++F ++DTTE 
Sbjct  237   NAEWNKGGSCERTRPYSKEQMRFDGYIFETYKTQVEEFRTARKVARKRGLKFLMMDTTEI  296

Query  1086  MVLRPDGHP-NHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             M+ RPDGHP NH  H  ++N T +DCVHWC+PGPIDTWNEFL  +LKM +
Sbjct  297   MLRRPDGHPNNHVWHAVNQNVTHSDCVHWCLPGPIDTWNEFLFHMLKMHS  346



>gb|ACU18746.1| unknown [Glycine max]
Length=432

 Score =   428 bits (1100),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 249/351 (71%), Gaps = 10/351 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +CNIF G WV  PE PYY+N T   I D+QNC+KFGRPD  +L WRW+PD CELP F+  
Sbjct  67    QCNIFSGRWVHNPEAPYYSNETCHWIIDQQNCLKFGRPDREYLHWRWKPDECELPFFNAT  126

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD------AAVGRWVYKEYNF  545
             QFL LVRGK MAFVGDSV RNQMQSL CLL+ V++P  VS           R+ Y +YNF
Sbjct  127   QFLNLVRGKKMAFVGDSVGRNQMQSLLCLLSHVSEPEDVSHKYSSDVVYFKRYFYHDYNF  186

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             TL + WSP+ V++ DADP   + +S+M LY DE D  W  ++ N D+VI S+GQWFFRP 
Sbjct  187   TLGNLWSPYFVRSSDADPRGHTYNSIMKLYVDEADEAWTSQVENFDIVIISSGQWFFRPL  246

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              +Y+ GK+VGC++C    +    H +GY  AFRTAF+ L   E ++G+  LRTFSPAHFE
Sbjct  247   LFYEKGKLVGCNKCGMDNVTDLTHLYGYKKAFRTAFRALNSLENYKGVTFLRTFSPAHFE  306

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEG----YTLEMYLTQVREFMAAKREGSKKGVRFRLLD  1073
             NG+WN GG CVRT PFTK++M+LE     Y LEMY+ QV EF  A+R  +K+G+ F +++
Sbjct  307   NGDWNKGGKCVRTMPFTKQEMRLEDGAVEYILEMYVAQVEEFREAQRVATKRGLEFLMMN  366

Query  1074  TTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKM  1226
             TTE M+LRPDGHPN+YGH   +N T  DCVHWC+PGP+DTWNEFLL +L +
Sbjct  367   TTEIMLLRPDGHPNNYGHAKDKNVTLNDCVHWCLPGPVDTWNEFLLYMLDI  417



>ref|XP_003551794.1| PREDICTED: protein YLS7-like [Glycine max]
Length=562

 Score =   432 bits (1111),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 200/359 (56%), Positives = 250/359 (70%), Gaps = 15/359 (4%)
 Frame = +3

Query  180   SFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIE-DRQNCMKFGRPDTGFLKWRWQPDR  356
             +FN+     CNIF G W+P+ +GPYY N T CD+  D+QNCMKFGRPD  FLKWRW+PD 
Sbjct  205   NFNITQMKRCNIFSGEWIPYSKGPYYDNET-CDLMIDQQNCMKFGRPDREFLKWRWKPDE  263

Query  357   CELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------  518
             CELPLFD   FLELVRGK+MAFVGDSV RNQM SL CLL+ VA P  ++           
Sbjct  264   CELPLFDATLFLELVRGKSMAFVGDSVGRNQMNSLLCLLSHVAHPEDITKRYATDPIYFR  323

Query  519   RWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFS  698
             RW Y +YNFT+++ WSP +V+  D D      +SL  LY D+ D  W  E+   D VI S
Sbjct  324   RWFYADYNFTVVTLWSPFLVRTSDID------NSLTKLYLDKADESWTSEVETFDFVIIS  377

Query  699   AGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVIL  878
             AGQWFFRP  YY+ G+IVGCH+C    IK  ++Y+GY  AFRTA +T+   E +RG+  L
Sbjct  378   AGQWFFRPALYYEKGQIVGCHKCERRKIKDLSYYYGYRKAFRTALRTIASLEGYRGVTFL  437

Query  879   RTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVR  1058
             RTFSPAHFEN EWN GG+C RTRP++K QM+ +GY  E Y TQV EF  A++   K+G++
Sbjct  438   RTFSPAHFENAEWNKGGSCERTRPYSKEQMRFDGYIFETYKTQVEEFRTARKVARKRGLK  497

Query  1059  FRLLDTTESMVLRPDGHP-NHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             F ++DTTE M+ RPDGHP NH  H  ++N T +DCVHWC+PGPIDTWNEFL  +LKM +
Sbjct  498   FLMMDTTEIMLRRPDGHPNNHVWHAVNQNVTHSDCVHWCLPGPIDTWNEFLFHMLKMHS  556



>gb|KDP24358.1| hypothetical protein JCGZ_25654 [Jatropha curcas]
Length=391

 Score =   426 bits (1095),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 200/381 (52%), Positives = 263/381 (69%), Gaps = 4/381 (1%)
 Frame = +3

Query  99    VLPISTTLVIFATFCFTSYNISDSLLQSFNLFP-GGECNIFKGNWVPFPE-GPYYTNATK  272
             ++ +S  LV         Y+ S        L   G ECNIF G W+ +P  G +YTN T 
Sbjct  7     LVAVSLILVTVIPLHILKYSRSSQWPSPAKLIKVGKECNIFHGKWIWYPNTGSHYTNTTC  66

Query  273   CDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQM  452
               I D QNC+KFGR DT FLKWRW+P++CEL LF+  QFLELVRGK+MAFVGDS+ RN M
Sbjct  67    RGISDHQNCIKFGRLDTDFLKWRWKPEQCELSLFNATQFLELVRGKSMAFVGDSLGRNHM  126

Query  453   QSLKCLLASVADPVKV--SDAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLM  626
             +SL CLLA+V  P+ V  SD +  +WV+  YNFTL SFWSPH+VKA D +P   + + LM
Sbjct  127   ESLLCLLATVGYPLDVNTSDPSFKKWVFVNYNFTLASFWSPHLVKAIDTEPNGPTYNRLM  186

Query  627   NLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFG  806
             NLY DE +  WA ++   D VI SAG+WF+ P  +++ GK VGC+ C +  IK    ++G
Sbjct  187   NLYLDEANEAWAAQIEAFDYVIISAGRWFYGPQVFFEKGKTVGCYLCLKNNIKNLTMFYG  246

Query  807   YGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYT  986
             Y   FRTAFKTL+  + F G+  LRT SP+HFENGEW+ GGNC+RTRP +  ++KL+   
Sbjct  247   YRRVFRTAFKTLMGLKNFNGVTFLRTLSPSHFENGEWDKGGNCIRTRPISSGEVKLDEND  306

Query  987   LEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVH  1166
             + +Y+TQ+ E   A+REG K+G++FRLLD  E+M++R DGHPN++GHW  EN   +DCVH
Sbjct  307   MRLYVTQIEELKRAEREGKKRGLKFRLLDIMEAMIVRADGHPNNFGHWEDENVRISDCVH  366

Query  1167  WCMPGPIDTWNEFLLQVLKME  1229
             WC+PGP+DTWNEFLL +LKME
Sbjct  367   WCLPGPVDTWNEFLLHMLKME  387



>gb|ADN34288.1| hypothetical protein [Cucumis melo subsp. melo]
Length=417

 Score =   425 bits (1093),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 194/348 (56%), Positives = 255/348 (73%), Gaps = 9/348 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIE-DRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C++F+G WVP  E PYY N T CD+  + QNC+K+GRPD  FLKWRW+PD CELPLFD 
Sbjct  65    KCDVFRGAWVPKSEQPYYMNDT-CDMMFEYQNCLKYGRPDREFLKWRWKPDECELPLFDS  123

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYKEYNF  545
              QFLE+V+GK++AFVGDSVARN MQSL CLL++V+ P+ VS          RW + +YNF
Sbjct  124   AQFLEIVKGKSLAFVGDSVARNHMQSLLCLLSNVSHPMDVSLKYNLTYDFKRWFFPDYNF  183

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             T+  FWSP++VK++DAD    S +SLMNLY DE D  W   +   D VIFSAGQWFFRP 
Sbjct  184   TVARFWSPYLVKSRDADQNGFSSNSLMNLYLDEADETWTSAVETFDYVIFSAGQWFFRPQ  243

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              YY+NG++ GC  C ++ + +  +++GYG  F+TAF+ L+  + ++G+  +RTFSP+HFE
Sbjct  244   VYYENGQMKGCFNCQQSNVTQILNFYGYGKVFQTAFRKLMGLKGYKGMTFMRTFSPSHFE  303

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
             NG+WN GGNC RTRPFTK +M  + +  E++  QV EF AA+ EG ++G++FRLLDTTE+
Sbjct  304   NGDWNKGGNCARTRPFTKEEMNWKSFVFELHKAQVEEFRAAEEEGLRRGLQFRLLDTTEA  363

Query  1086  MVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             M++RPDGHPNHY      N   ADCVHWC+PGPIDTWNEFL  +LK E
Sbjct  364   MLMRPDGHPNHYS--PPRNGNIADCVHWCLPGPIDTWNEFLFYILKQE  409



>ref|XP_008783107.1| PREDICTED: protein trichome birefringence-like 19 [Phoenix dactylifera]
Length=438

 Score =   426 bits (1095),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 205/347 (59%), Positives = 249/347 (72%), Gaps = 6/347 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IFKG WVP P+ PYYTNAT   I D QNCMK+GRPDT F+KWRW+P+ CELP+F+  Q
Sbjct  79    CDIFKGEWVPNPKAPYYTNATCWAIHDHQNCMKYGRPDTDFMKWRWKPNDCELPIFNPAQ  138

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG----RWVYKEYNFTLL  554
             FLELVRGK++AFVGDSV RNQMQSL CLL+ V   V VS A       R+ Y  +NFTL 
Sbjct  139   FLELVRGKSLAFVGDSVGRNQMQSLVCLLSKVTYLVDVSPATSDDKSRRYFYPTHNFTLA  198

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             + WSP++VK++DADP   S   L NL  DEPD  W  ++   D VI SAG WFFRP  YY
Sbjct  199   NIWSPYLVKSEDADPSGPSLSGLYNLNLDEPDANWTTKIEEFDYVIVSAGHWFFRPTMYY  258

Query  735   -KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
              K+  +VGC  C    I     Y+GY  AFRT F+ LL+ E ++G+  LRTF+PAHFENG
Sbjct  259   EKDHHLVGCFYCKTENITDLTMYYGYRKAFRTTFQALLNLEGYKGMTFLRTFAPAHFENG  318

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
             EW+ GG+CVR RPF   + +LEG  LE+YLTQV EF AA+REG +KG++FRLLDTTE M 
Sbjct  319   EWDKGGDCVRKRPFGSNETRLEGMNLELYLTQVEEFKAAEREGREKGLKFRLLDTTEVMF  378

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+ YGH  + N T   DCVHWC+PGP+D WN+FLL +LKME
Sbjct  379   LRPDGHPSRYGHLPNANVTLYNDCVHWCLPGPVDAWNDFLLHMLKME  425



>ref|XP_008459429.1| PREDICTED: protein trichome birefringence-like 19 [Cucumis melo]
Length=432

 Score =   425 bits (1092),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 194/348 (56%), Positives = 255/348 (73%), Gaps = 9/348 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIE-DRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C++F+G WVP  E PYY N T CD+  + QNC+K+GRPD  FLKWRW+PD CELPLFD 
Sbjct  80    KCDVFRGAWVPKSEQPYYMNDT-CDMMFEYQNCLKYGRPDREFLKWRWKPDECELPLFDS  138

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYKEYNF  545
              QFLE+V+GK++AFVGDSVARN MQSL CLL++V+ P+ VS          RW + +YNF
Sbjct  139   AQFLEIVKGKSLAFVGDSVARNHMQSLLCLLSNVSHPMDVSLKYNLTYDFKRWFFPDYNF  198

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             T+  FWSP++VK++DAD    S +SLMNLY DE D  W   +   D VIFSAGQWFFRP 
Sbjct  199   TVARFWSPYLVKSRDADQNGFSSNSLMNLYLDEADETWTSAVETFDYVIFSAGQWFFRPQ  258

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              YY+NG++ GC  C ++ + +  +++GYG  F+TAF+ L+  + ++G+  +RTFSP+HFE
Sbjct  259   VYYENGQMKGCFNCQQSNVTQILNFYGYGKVFQTAFRKLMGLKGYKGMTFMRTFSPSHFE  318

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
             NG+WN GGNC RTRPFTK +M  + +  E++  QV EF AA+ EG ++G++FRLLDTTE+
Sbjct  319   NGDWNKGGNCARTRPFTKEEMNWKSFVFELHKAQVEEFRAAEEEGLRRGLQFRLLDTTEA  378

Query  1086  MVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             M++RPDGHPNHY      N   ADCVHWC+PGPIDTWNEFL  +LK E
Sbjct  379   MLMRPDGHPNHYS--PPRNGNIADCVHWCLPGPIDTWNEFLFYILKQE  424



>ref|XP_010100921.1| hypothetical protein L484_009691 [Morus notabilis]
 gb|EXB85845.1| hypothetical protein L484_009691 [Morus notabilis]
Length=408

 Score =   424 bits (1089),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 204/362 (56%), Positives = 253/362 (70%), Gaps = 10/362 (3%)
 Frame = +3

Query  168   SLLQSFNLFPGGECNIFKGNWVPFPEG-PYYTNATKCDIEDRQNCMKFGRPDTGFLKWRW  344
             S + S +L  G +C++F+G W+  P   P+YTN T  +I D+QNCMKFGRPD  FLKWRW
Sbjct  48    SYINSLSL--GKKCDMFRGEWIYHPNRMPFYTNFTCPEIYDQQNCMKFGRPDLDFLKWRW  105

Query  345   QPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAV  515
             +P  CELP FD  QFLELV+GK+MAFVGDSVARNQMQSL CLLA+V  P  VS    +  
Sbjct  106   KPVGCELPPFDAAQFLELVKGKSMAFVGDSVARNQMQSLLCLLATVEYPADVSYTTSSKF  165

Query  516   GRWVYKEYNFTLLSFWSPHIVKAKDADP----LWVSPDSLMNLYTDEPDRLWADEMANAD  683
              RW+Y  YNFTL +FWSP +VKA D  P       +   L NLY +E D  W  ++   D
Sbjct  166   KRWLYTNYNFTLAAFWSPFLVKATDTKPKNGLTKSNTTRLTNLYLNEADINWTSQIGAFD  225

Query  684   VVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFR  863
              VI SAG+WFF P  YY+NG +VGCH C     K+    +GY  AF+TAF+ LL  E F+
Sbjct  226   YVIISAGRWFFGPKMYYENGHVVGCHFCKRNDTKELTMSYGYKRAFKTAFEALLRLESFK  285

Query  864   GLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGS  1043
             G+VILRT SPAHFENGEWN GG C RT P ++ +MK+    LE+YL+Q+    A +REG 
Sbjct  286   GVVILRTLSPAHFENGEWNEGGECKRTEPVSRSEMKMNWGDLELYLSQIEVMRAVEREGK  345

Query  1044  KKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             K+GV+FRLLD T++M +RPDGHPNH+GHW HEN T ADCVHWC+PGPID+WNE LL +LK
Sbjct  346   KRGVKFRLLDITKAMEVRPDGHPNHFGHWPHENVTIADCVHWCLPGPIDSWNELLLHMLK  405

Query  1224  ME  1229
              +
Sbjct  406   QD  407



>gb|AGV54842.1| hypothetical protein [Phaseolus vulgaris]
Length=435

 Score =   424 bits (1091),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 191/345 (55%), Positives = 248/345 (72%), Gaps = 4/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WVP P+ PYYTN T   I + QNCMK+GRPD+ F+KWRW+P  CELP+F+  Q
Sbjct  84    CDIFTGEWVPNPKAPYYTNKTCWAIHEHQNCMKYGRPDSEFMKWRWKPSDCELPIFNPFQ  143

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FLE+V+GK+MAFVGDSV RNQMQS+ CLL+ V  P+ VS   D    RW Y  YNF + +
Sbjct  144   FLEIVKGKSMAFVGDSVGRNQMQSMICLLSRVEWPIDVSYTTDEYFKRWKYPSYNFPMAT  203

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FW+PH+V++K AD    S   L NLY DE D  W  ++ + D +I   G WF+RP  +Y+
Sbjct  204   FWTPHLVRSKVADSNGPSNTGLFNLYLDEHDEKWTTQVQDFDYIILDGGHWFYRPMVFYE  263

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
               KIVGCH C    +     ++GY  AFRTAF+ +   E F+G V LRTF+P+HFENG W
Sbjct  264   RKKIVGCHFCLMENVPDLTMFYGYRKAFRTAFRAINSLEDFKGTVFLRTFAPSHFENGIW  323

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GGNCVRT+PF   + +LEG  LE+Y+ Q+ EF  A++EG KKG++ +L+DTT++M++R
Sbjct  324   NQGGNCVRTKPFRSSEAQLEGTNLELYMIQLEEFKKAEKEGRKKGLKLKLIDTTQAMLMR  383

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGHWAHEN T   DCVHWC+PGPIDTW++FLLQ+LKME
Sbjct  384   PDGHPSRYGHWAHENVTLYNDCVHWCLPGPIDTWSDFLLQILKME  428



>ref|XP_008459430.1| PREDICTED: protein trichome birefringence-like 19 [Cucumis melo]
 gb|ADN34286.1| hypothetical protein [Cucumis melo subsp. melo]
Length=442

 Score =   424 bits (1089),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 191/347 (55%), Positives = 251/347 (72%), Gaps = 4/347 (1%)
 Frame = +3

Query  201   GECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
              EC++F G W+P P  PYY++++   I + QNCMK+GRPD GF++WRW+PD CELP+F+ 
Sbjct  84    AECDMFVGEWIPNPNAPYYSSSSCWAIHEHQNCMKYGRPDGGFMQWRWKPDGCELPIFNP  143

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTL  551
              QFLE++R K++AFVGDSV RNQMQSL CLL+ V  PV  S   D    RW YK YNFT+
Sbjct  144   SQFLEIMRDKSLAFVGDSVGRNQMQSLICLLSRVEYPVDESYTADENFKRWKYKTYNFTM  203

Query  552   LSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
              SFW+PH++KA   D    +   L NLY DE D+ W  ++   D +I SAG WFFRP  +
Sbjct  204   ASFWTPHLIKANMGDANGPTKTGLFNLYLDEHDQEWTTQIDEFDYIIISAGHWFFRPMVF  263

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+N +IVGCH C    +     Y+GY  AFRTAFKT+   + F+G+ ILRTF+P+HFENG
Sbjct  264   YENHRIVGCHYCLLPNVTDLGMYYGYRKAFRTAFKTINSLKNFKGITILRTFAPSHFENG  323

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              WN GGNC+RT+PF   + +LEG+ LE+Y+ Q+ E+  A++EG +KG +FRLLDTT++M+
Sbjct  324   LWNEGGNCLRTQPFRSNETQLEGHNLELYMIQMEEYRIAEKEGRRKGKKFRLLDTTQAML  383

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+ YGH A EN T   DCVHWC+PGPID W++FLLQ+LKME
Sbjct  384   LRPDGHPSRYGHLASENVTLYNDCVHWCLPGPIDAWSDFLLQMLKME  430



>ref|XP_002279300.3| PREDICTED: protein trichome birefringence-like 19 [Vitis vinifera]
Length=459

 Score =   424 bits (1089),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 194/346 (56%), Positives = 250/346 (72%), Gaps = 4/346 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G W+  P+ PYYTN T   I + QNCMK+GRPD  F+KWRW+PD CELP+F+  
Sbjct  95    KCDIFSGEWIRNPKAPYYTNTTCWAIHEHQNCMKYGRPDLDFMKWRWKPDGCELPIFNPA  154

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLEL+R KT+AFVGDSVARN MQSL CLL+ V  P+ VS   D    RW Y +YNFT+ 
Sbjct  155   QFLELMRDKTLAFVGDSVARNHMQSLMCLLSRVVYPIDVSYTTDENFKRWRYTDYNFTMA  214

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             SFW+P ++K K ADP   +   L NLY DE D  W ++M   D +I SAGQWF+RP  +Y
Sbjct  215   SFWTPFLIKTKLADPGGPTQTGLFNLYLDELDEAWTNQMEEFDYLIISAGQWFYRPTMFY  274

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N ++ GC+ C +  +     Y+GY  AFRT FK +  ++ F+G+ ILRTFSPAHFENG 
Sbjct  275   ENRRVSGCYYCLQENVTDLTVYYGYRKAFRTVFKAINSNKNFKGMTILRTFSPAHFENGL  334

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNCVRTRPF   +  +EG  LE+Y+TQ+ E+ AA+R   K+G++FRLLDTT++M L
Sbjct  335   WNKGGNCVRTRPFMSNESTMEGPNLELYMTQIEEYRAAERVALKRGLKFRLLDTTQAMWL  394

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGHW + N T   DCVHWC+PGPIDTW++FLL++LKME
Sbjct  395   RPDGHPSRYGHWPNANVTLYNDCVHWCLPGPIDTWSDFLLEMLKME  440



>ref|XP_010265350.1| PREDICTED: protein trichome birefringence-like 19 [Nelumbo nucifera]
Length=425

 Score =   422 bits (1085),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 194/347 (56%), Positives = 253/347 (73%), Gaps = 7/347 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+I  G W+P  +GPYYTN T   I D+QNCM  GRPDTG+L WRW+P  CELP FD R
Sbjct  72    KCDISSGEWIPQTQGPYYTNMTCKHIHDQQNCMLHGRPDTGYLYWRWKPGDCELPRFDAR  131

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLAS-VADPVKVS----DAAVGRWVYKEYNFT  548
             QFL++VRGK+MAFVGDSVARNQMQSL C+L++ V +PV VS    D    RW++ +YNFT
Sbjct  132   QFLDIVRGKSMAFVGDSVARNQMQSLLCMLSTTVGEPVDVSENSWDGKFKRWLFTDYNFT  191

Query  549   LLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFF  728
             + +FWSP +VKAKD  P   +   LM+LY DEPD  W  ++   D VI SAGQWF+RP  
Sbjct  192   IATFWSPQLVKAKDTWPKETT--GLMHLYVDEPDEAWITKIDKFDYVIISAGQWFWRPLL  249

Query  729   YYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFEN  908
             +Y++GK+VGCH C +  +K    Y+GY  AFRTAFK +   ++F+G+V LRTFS  HFE+
Sbjct  250   FYEHGKVVGCHICFDKKMKDLTMYYGYRRAFRTAFKAISKRKEFKGVVFLRTFSTGHFED  309

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G W +GG C RT+PF   + +L+ + LE YLTQ+ E+ AA+R+  K+G++ RLLDTT++ 
Sbjct  310   GTWKTGGTCPRTKPFKSSEKRLKEFDLEFYLTQMEEYRAAERKARKRGLKLRLLDTTQAT  369

Query  1089  VLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             +LRPDGHP  YGH+  EN+   DCVHWC+PGPIDTWNEFLLQ+LK +
Sbjct  370   LLRPDGHPGPYGHFPQENRIVHDCVHWCLPGPIDTWNEFLLQMLKTD  416



>gb|KGN52558.1| hypothetical protein Csa_5G643370 [Cucumis sativus]
Length=414

 Score =   422 bits (1084),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 192/346 (55%), Positives = 255/346 (74%), Gaps = 9/346 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIE-DRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C++F+G WV   E PYYTN T CD+  + QNC+K+GRPD  FLKWRW+PD CELPLFD 
Sbjct  65    KCDVFRGAWVSKSEQPYYTNDT-CDMMFEYQNCLKYGRPDKEFLKWRWKPDECELPLFDS  123

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYKEYNF  545
              QFLE+V+GK++AFVGDSVARN MQSL CLL++V+ PV VS          RW + +YNF
Sbjct  124   AQFLEIVKGKSLAFVGDSVARNHMQSLLCLLSNVSHPVDVSLKYNLTYDFKRWFFPDYNF  183

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             T+  FWSP++VK++DAD    S +SLMNLY DE D  W   +   D VIFSAGQWFFRP 
Sbjct  184   TVARFWSPYLVKSRDADQNGFSSNSLMNLYLDEADETWISAVETFDYVIFSAGQWFFRPQ  243

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              YY+NG++ GC  C ++ + +  +++GYG  F+T+F+ L+  + ++G+  +RTFSP+HFE
Sbjct  244   VYYENGQMKGCFNCQQSNVTQILNFYGYGKVFQTSFRKLMALKGYKGMTFMRTFSPSHFE  303

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
             NG+WN GGNC RTRPFTK +M+ + +  E++  QV EF AA+ EG ++G++F+LLDTTE+
Sbjct  304   NGDWNKGGNCARTRPFTKEEMEWKSFVFELHKAQVEEFRAAEEEGLRRGLQFKLLDTTEA  363

Query  1086  MVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             M++RPDGHPNHY      N   ADCVHWC+PGPIDTWNEFL  +LK
Sbjct  364   MLMRPDGHPNHYS--PPRNGNIADCVHWCLPGPIDTWNEFLFYILK  407



>ref|XP_010040297.1| PREDICTED: protein trichome birefringence-like 19 [Eucalyptus 
grandis]
 gb|KCW45324.1| hypothetical protein EUGRSUZ_L01011 [Eucalyptus grandis]
Length=443

 Score =   423 bits (1087),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 203/403 (50%), Positives = 265/403 (66%), Gaps = 13/403 (3%)
 Frame = +3

Query  60    SPRRRVLGAFRKAVLPISTTLVIFATF------CFTSYNISDSLLQSFNLFPGGECNIFK  221
             S  ++VL      VL  +  L +F T        F    I + + +   L     C++FK
Sbjct  20    SSTKKVLVLASTPVLLAAIPLYLFITGTHLGAPSFQELEIGNGISKGIELVDRRRCDVFK  79

Query  222   GNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELV  401
             G WV  P   YYTN T   I D+ NC+KFGRP+T FLKW W+P+ CELP F   +FLE+ 
Sbjct  80    GQWVHHPNAAYYTNVTCPLIIDQHNCLKFGRPNTEFLKWWWKPE-CELPQFHAGRFLEMA  138

Query  402   RGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD------AAVGRWVYKEYNFTLLSFW  563
             RGK++AFVGDSV RNQMQSL CLLA V  P ++S           RW +  + FTL +FW
Sbjct  139   RGKSLAFVGDSVGRNQMQSLLCLLAKVEVPEEISHRYSIDTTYFKRWYFSVHKFTLATFW  198

Query  564   SPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNG  743
             +P +VK++DA+P   S +++M+LY DEPD  WA E+ + D V+ SAGQWFFRP  YY+  
Sbjct  199   APFLVKSRDAEPDGHSFNNIMSLYLDEPDLSWASEITDFDSVVISAGQWFFRPLMYYEKR  258

Query  744   KIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNS  923
             +++GC  C    +     ++GY +AFR AF+ LL+ + ++G+  LRTFSPAHFENG WN+
Sbjct  259   EVIGCGSCEVNNVTDLTRFYGYRMAFRAAFRELLNRKAYKGMTFLRTFSPAHFENGRWNT  318

Query  924   GGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPD  1103
             GG+C RTRPF   + KLEG  LE YLTQV EF AA+REG K+G+ FRLLDTTE+M+ RPD
Sbjct  319   GGSCARTRPFASGEAKLEGEDLEFYLTQVEEFRAAQREGIKRGLTFRLLDTTEAMIQRPD  378

Query  1104  GHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             GHPN +GH A  N+T ADCVHWCMPGPID WNEFL  ++  E+
Sbjct  379   GHPNRFGHLALRNETMADCVHWCMPGPIDLWNEFLFHIMWSES  421



>ref|XP_010929090.1| PREDICTED: protein trichome birefringence-like 19 [Elaeis guineensis]
Length=455

 Score =   423 bits (1087),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 198/347 (57%), Positives = 250/347 (72%), Gaps = 5/347 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IFKG WVP P+ PYYTNAT   I + QNCMK+GRPDT F+KWRW+P+ CELP+F+  
Sbjct  90    KCDIFKGEWVPNPKAPYYTNATCWAIHEHQNCMKYGRPDTDFMKWRWKPNDCELPIFNPA  149

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS----DAAVGRWVYKEYNFTL  551
             QFLELVRGK++AFVGDSV RNQMQSL CLL+ V     VS    D    R+ Y  +NFTL
Sbjct  150   QFLELVRGKSLAFVGDSVGRNQMQSLVCLLSRVTYLEDVSPATFDGKSRRYFYPTHNFTL  209

Query  552   LSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
              + WSP++VKA DADP       L +LY DEPD  W  ++   D VI SAG WFFRP  Y
Sbjct  210   ANIWSPYLVKAYDADPNGPLLTGLYDLYLDEPDTNWTTKIEEFDYVIVSAGHWFFRPTMY  269

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+N ++VGC  C +  I     Y+GY +AFRT F+ LL+ + ++G+  LRTF+PAHFENG
Sbjct  270   YENNQLVGCFYCKKENITDLTMYYGYRMAFRTTFQALLNLKGYKGMTFLRTFAPAHFENG  329

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
             EW+ GG+C+R RPF   + +LE + LE+YLTQ+ EF AA++EG +KG++FRLLDTTE M+
Sbjct  330   EWDKGGDCIRKRPFRSNETRLETFNLELYLTQMEEFKAAEKEGREKGLKFRLLDTTEVML  389

Query  1092  LRPDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP  YGH  +       DCVHWC+PGPIDTWN+FLL +LKME
Sbjct  390   LRPDGHPGRYGHLPNAKVALNNDCVHWCLPGPIDTWNDFLLHMLKME  436



>ref|XP_004141489.1| PREDICTED: uncharacterized protein LOC101210919 [Cucumis sativus]
Length=429

 Score =   422 bits (1084),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 192/346 (55%), Positives = 255/346 (74%), Gaps = 9/346 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIE-DRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C++F+G WV   E PYYTN T CD+  + QNC+K+GRPD  FLKWRW+PD CELPLFD 
Sbjct  80    KCDVFRGAWVSKSEQPYYTNDT-CDMMFEYQNCLKYGRPDKEFLKWRWKPDECELPLFDS  138

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYKEYNF  545
              QFLE+V+GK++AFVGDSVARN MQSL CLL++V+ PV VS          RW + +YNF
Sbjct  139   AQFLEIVKGKSLAFVGDSVARNHMQSLLCLLSNVSHPVDVSLKYNLTYDFKRWFFPDYNF  198

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             T+  FWSP++VK++DAD    S +SLMNLY DE D  W   +   D VIFSAGQWFFRP 
Sbjct  199   TVARFWSPYLVKSRDADQNGFSSNSLMNLYLDEADETWISAVETFDYVIFSAGQWFFRPQ  258

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              YY+NG++ GC  C ++ + +  +++GYG  F+T+F+ L+  + ++G+  +RTFSP+HFE
Sbjct  259   VYYENGQMKGCFNCQQSNVTQILNFYGYGKVFQTSFRKLMALKGYKGMTFMRTFSPSHFE  318

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
             NG+WN GGNC RTRPFTK +M+ + +  E++  QV EF AA+ EG ++G++F+LLDTTE+
Sbjct  319   NGDWNKGGNCARTRPFTKEEMEWKSFVFELHKAQVEEFRAAEEEGLRRGLQFKLLDTTEA  378

Query  1086  MVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             M++RPDGHPNHY      N   ADCVHWC+PGPIDTWNEFL  +LK
Sbjct  379   MLMRPDGHPNHYS--PPRNGNIADCVHWCLPGPIDTWNEFLFYILK  422



>gb|KHN28369.1| hypothetical protein glysoja_029630 [Glycine soja]
Length=408

 Score =   419 bits (1078),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 194/390 (50%), Positives = 267/390 (68%), Gaps = 9/390 (2%)
 Frame = +3

Query  75    VLGAFRKAVLPISTTLVIFATFCFTSYNISDSLL-QSFNLFPGGECNIFKGNWVPFPEGP  251
             +L     ++L   + L I   +   S+   D ++ +S    P  +C+IF G+WVP PE P
Sbjct  11    ILTTISCSLLSYHSLLKINDEYKEPSFEFDDLIVPESLPSTPVNKCDIFTGDWVPNPEAP  70

Query  252   YYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGD  431
             YYTN T  +I + QNCMK+GRPDT F+KWRW+P+ CELP+F+  QFL+++RGK++AFVGD
Sbjct  71    YYTNTTCWEIHEHQNCMKYGRPDTDFMKWRWKPNECELPIFNPFQFLQIMRGKSLAFVGD  130

Query  432   SVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPL  602
             S+ RN MQS+ CLL+ V  P+ VS   D +  RW Y  YNFT+ +FWSP++V+AK  D  
Sbjct  131   SIGRNHMQSMICLLSKVEWPIDVSYTDDFSFKRWKYSSYNFTMTTFWSPYLVRAKQVD--  188

Query  603   WVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAI  782
               S   L N+Y DE D  W  ++   D VI + GQWF RP  +Y+  KIVGC  C+   +
Sbjct  189   --SNGGLYNVYLDEFDEKWTTQIKEFDYVIINVGQWFLRPMVFYEKQKIVGCQYCSLENV  246

Query  783   KKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKR  962
                + ++GY  AF T FK +++ E F+G+  LRTF+P+HFENG W+ GGNCVRT+PF   
Sbjct  247   THLSWHYGYKKAFGTTFKAIINLENFKGVTFLRTFAPSHFENGVWDKGGNCVRTKPFKSN  306

Query  963   QMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHEN  1142
             + +LEG  LE++  Q+ +F  A++E  KKG++F LLDTT++M+LRPDGHPN YGHW HEN
Sbjct  307   ETRLEGNNLELHTIQLEQFKIAEKEARKKGLKFMLLDTTQAMLLRPDGHPNKYGHWPHEN  366

Query  1143  KTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
              T   DCVHWC+PGPIDTW++FLL++LKME
Sbjct  367   VTLFNDCVHWCLPGPIDTWSDFLLEMLKME  396



>ref|XP_003555082.1| PREDICTED: protein YLS7-like [Glycine max]
Length=431

 Score =   420 bits (1080),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 194/390 (50%), Positives = 267/390 (68%), Gaps = 9/390 (2%)
 Frame = +3

Query  75    VLGAFRKAVLPISTTLVIFATFCFTSYNISDSLL-QSFNLFPGGECNIFKGNWVPFPEGP  251
             +L     ++L   + L I   +   S+   D ++ +S    P  +C+IF G+WVP PE P
Sbjct  34    ILTTISCSLLSYHSLLKINDEYKEPSFEFDDLIVPESLPSTPVNKCDIFTGDWVPNPEAP  93

Query  252   YYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGD  431
             YYTN T  +I + QNCMK+GRPDT F+KWRW+P+ CELP+F+  QFL+++RGK++AFVGD
Sbjct  94    YYTNTTCWEIHEHQNCMKYGRPDTDFMKWRWKPNECELPIFNPFQFLQIMRGKSLAFVGD  153

Query  432   SVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPL  602
             S+ RN MQS+ CLL+ V  P+ VS   D +  RW Y  YNFT+ +FWSP++V+AK  D  
Sbjct  154   SIGRNHMQSMICLLSKVEWPIDVSYTDDFSFKRWKYSSYNFTMTTFWSPYLVRAKQVD--  211

Query  603   WVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAI  782
               S   L N+Y DE D  W  ++   D VI + GQWF RP  +Y+  KIVGC  C+   +
Sbjct  212   --SNGGLYNVYLDEFDEKWTTQIKEFDYVIINVGQWFLRPMVFYEKQKIVGCQYCSLENV  269

Query  783   KKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKR  962
                + ++GY  AF T FK +++ E F+G+  LRTF+P+HFENG W+ GGNCVRT+PF   
Sbjct  270   THLSWHYGYKKAFGTTFKAIINLENFKGVTFLRTFAPSHFENGVWDKGGNCVRTKPFKSN  329

Query  963   QMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHEN  1142
             + +LEG  LE++  Q+ +F  A++E  KKG++F LLDTT++M+LRPDGHPN YGHW HEN
Sbjct  330   ETRLEGNNLELHTIQLEQFKIAEKEARKKGLKFMLLDTTQAMLLRPDGHPNKYGHWPHEN  389

Query  1143  KTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
              T   DCVHWC+PGPIDTW++FLL++LKME
Sbjct  390   VTLFNDCVHWCLPGPIDTWSDFLLEMLKME  419



>ref|XP_009395507.1| PREDICTED: protein trichome birefringence-like 19 [Musa acuminata 
subsp. malaccensis]
Length=444

 Score =   421 bits (1081),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 198/343 (58%), Positives = 243/343 (71%), Gaps = 4/343 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF+G WVP P  PYYTN +   I D QNCM FGRPDTGF+KWRW+P  CELP+F+  Q
Sbjct  85    CDIFRGEWVPNPNAPYYTNESCWAIHDHQNCMMFGRPDTGFMKWRWKPTHCELPVFNPAQ  144

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FLELVRGK++AFVGDSV RNQMQSL CLL  V   V  S   D    R+ +  +NFT+ S
Sbjct  145   FLELVRGKSLAFVGDSVGRNQMQSLICLLHRVTYVVDASLTQDEKFRRYHFPTHNFTVAS  204

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP +V+A +ADP   +   L NLY DEPD  W  +M   D VI SAG WFFRP  +++
Sbjct  205   FWSPFLVRAHEADPNGPTHTGLFNLYLDEPDTNWTTKMTEFDYVIVSAGHWFFRPAMFFE  264

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
              G++VGCH C +  +     Y+ Y  AFR AF+     E FRG V LRT++P+HFENGEW
Sbjct  265   GGQLVGCHYCLDPNVTDLTMYYSYRRAFRAAFRVFNSLEGFRGTVFLRTYAPSHFENGEW  324

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             + GGNCVR +PF   + +L+G  LEMY+TQV EF  A+ EG +KGVRFRLLDTT++M+LR
Sbjct  325   DKGGNCVRQQPFRSDETRLDGINLEMYMTQVEEFREAEMEGREKGVRFRLLDTTDAMLLR  384

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLK  1223
             PDGHP+ YGH  HEN T   DCVHWC+PGPIDTWN+FLL +LK
Sbjct  385   PDGHPSRYGHRPHENVTMYNDCVHWCLPGPIDTWNDFLLHMLK  427



>ref|XP_007151463.1| hypothetical protein PHAVU_004G048700g [Phaseolus vulgaris]
 gb|ESW23457.1| hypothetical protein PHAVU_004G048700g [Phaseolus vulgaris]
Length=417

 Score =   419 bits (1077),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 247/346 (71%), Gaps = 8/346 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G WVP PE PYYTN T   I + QNCMK GRPD+ F+KWRW+P+ CELP+F+  
Sbjct  64    KCDIFSGEWVPNPEAPYYTNTTCWAIHEHQNCMKHGRPDSEFMKWRWKPNECELPMFNPF  123

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLE++RGK+MAFVGDS+ARN MQS+ CLL+ V  P+ VS   D +  RW Y  YNFT+ 
Sbjct  124   QFLEIMRGKSMAFVGDSIARNHMQSMICLLSRVERPIDVSHMNDFSFKRWKYSSYNFTMA  183

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             ++W+PH+V+AK  D    S  +L N+Y DE D  W  ++ + D VI + GQWF  P  +Y
Sbjct  184   NYWTPHLVRAKKMD----SNSALFNVYIDELDETWTTQIKDFDHVIINGGQWFLGPIVFY  239

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +  K+VGC  C+   +   N Y+GY   FRT F+++L  E F+G   LRTFSP+HFENG 
Sbjct  240   EKQKVVGCQYCDLANMTHSNLYYGYRKVFRTTFRSILSLENFKGTTFLRTFSPSHFENGL  299

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GG CVRT+PF   + KLEGY LE++  ++ EF  A +EG KKG++  LLDTT++M+L
Sbjct  300   WNKGGKCVRTKPFRSNETKLEGYDLELHKIRLEEFKVAMKEGRKKGLKLMLLDTTQAMLL  359

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHPN YG+W +EN T   DCVHWC+PGPIDTW++FLLQ+LKME
Sbjct  360   RPDGHPNKYGYWPNENMTLYNDCVHWCLPGPIDTWSDFLLQMLKME  405



>ref|XP_006593718.1| PREDICTED: protein YLS7-like [Glycine max]
Length=432

 Score =   419 bits (1078),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 193/349 (55%), Positives = 248/349 (71%), Gaps = 10/349 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +CNIF G W+  P  PYY+N T   I D+QNC+KFGRPD  +L WRW+PD CELPLF+  
Sbjct  67    QCNIFSGRWMHNPAAPYYSNETCHWIIDQQNCLKFGRPDREYLHWRWKPDECELPLFNAT  126

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD------AAVGRWVYKEYNF  545
             +FL LVRGK MAFVGDSV RNQMQSL CLL+ V++P  VS           R+ Y +YNF
Sbjct  127   RFLNLVRGKKMAFVGDSVGRNQMQSLLCLLSHVSEPEDVSHKYSSDVVYFKRYFYHDYNF  186

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             TL + WSP+ V++ DADP   + +S+M LY DE D  W   + N D+VI S+GQWFFRP 
Sbjct  187   TLGNLWSPYFVRSSDADPRGHTYNSIMKLYVDEADEAWTSLVENFDIVIISSGQWFFRPL  246

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              +Y+ GK+VGC++C    +    + +GY  AFRTAF+ L   E ++G+  LRTFSPAHFE
Sbjct  247   LFYEEGKLVGCNKCRIDNVTDLTYLYGYKKAFRTAFRALSSLENYKGVTFLRTFSPAHFE  306

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEG----YTLEMYLTQVREFMAAKREGSKKGVRFRLLD  1073
             NG+WN GG CVRT PFTK++M+LE     Y LEMY+TQV EF  A+R  +K+G+ F +++
Sbjct  307   NGDWNKGGRCVRTMPFTKQEMRLEDGAVEYILEMYVTQVEEFREAQRVATKRGLEFLMMN  366

Query  1074  TTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVL  1220
             TTE M+LRPDGHPN+YG+   +N T  DCVHWC+PGP+DTWNEFLL +L
Sbjct  367   TTEIMLLRPDGHPNNYGYSKDKNMTLNDCVHWCLPGPVDTWNEFLLYML  415



>gb|KEH25274.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=424

 Score =   419 bits (1076),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 198/349 (57%), Positives = 253/349 (72%), Gaps = 7/349 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G+W+P  EGPYY N T   + D QNCMKFGRPD  +L WRW+P+ CELPLF+  Q
Sbjct  64    CDIFSGSWIPHSEGPYYNNETCKWMIDEQNCMKFGRPDDEYLHWRWKPNECELPLFNATQ  123

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKEYNFT  548
             FLE+VRGK M FVGDSV RNQ+QSL CLL+ V+ P  VS           R+ + +YNFT
Sbjct  124   FLEIVRGKKMVFVGDSVGRNQLQSLLCLLSQVSQPEDVSHKYTTNVIYFKRYFFADYNFT  183

Query  549   LLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFF  728
             L + WSP+ V++KDAD    S +S+M LY DE D  W+ ++ N D+VI SAG WFFRP  
Sbjct  184   LGNLWSPYFVRSKDADKNGHSYNSIMELYVDEVDEAWSSQVENFDIVIISAGHWFFRPLL  243

Query  729   YYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFEN  908
             +Y+ GK+VGC++C    +    HY+GY +AFRTAFKTL + E F+G+   RTFSP+HFEN
Sbjct  244   FYEKGKLVGCNKCGMENVTDLAHYYGYKMAFRTAFKTLTNLENFKGVTFFRTFSPSHFEN  303

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G+WN GGNCVR +PF+K +M L GY LE YLTQV EF  A+ E SKKG++F +L+TTE M
Sbjct  304   GDWNKGGNCVRKKPFSKEEMNLNGYILETYLTQVNEFKVAQEEASKKGLKFLMLNTTEIM  363

Query  1089  VLRPDGHPNHYGHWAHENKT-TADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             +LRPDGHPN+YGH   +N T   DCVHWC+PGP+DTWNE LL +LK+++
Sbjct  364   LLRPDGHPNNYGHAMVKNVTFYNDCVHWCLPGPVDTWNELLLYMLKVQS  412



>ref|XP_007139339.1| hypothetical protein PHAVU_008G021100g [Phaseolus vulgaris]
 gb|ESW11333.1| hypothetical protein PHAVU_008G021100g [Phaseolus vulgaris]
Length=414

 Score =   418 bits (1074),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 202/391 (52%), Positives = 260/391 (66%), Gaps = 16/391 (4%)
 Frame = +3

Query  75    VLGAFRKAVLPISTTLVIFATFCFTSYNISDSLLQSFNLFPGGECNIFKGNWVPFPEGPY  254
             +L  F   +L +  +L I ++F   +          FN+     CN+F G WVP+ +G Y
Sbjct  23    ILLPFTLLILMLPFSLTINSSFSSPNEVYVSRSSYDFNVTEIKRCNVFSGEWVPYSKGAY  82

Query  255   YTNATKCD-IEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGD  431
             Y N T CD I D+QNCMKFGRPD  FLKWRW+PD CELPLFD   FLE+VRGK+MAFVGD
Sbjct  83    YDNET-CDLIIDQQNCMKFGRPDREFLKWRWKPDECELPLFDATLFLEIVRGKSMAFVGD  141

Query  432   SVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKEYNFTLLSFWSPHIVKAKDA  593
             SV RNQM SL CLL  VA P  +S           RW Y +YNFT+++ WSP +V++ D 
Sbjct  142   SVGRNQMNSLLCLLNPVARPEDISSRYATDPIYFRRWFYADYNFTVVTLWSPFLVRSSDV  201

Query  594   DPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNE  773
                     SL NLY D+ D  W+ E+ N D VI SAGQWFFRP  +Y+ G++VGCH+C +
Sbjct  202   H------SSLTNLYLDKADESWSGEVKNFDFVIISAGQWFFRPALFYEKGQVVGCHKCEQ  255

Query  774   TAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPF  953
               I + +HY+GY  AFRTA +T++  + ++G+  LRTFSPAHFEN EWN GG+C R +P+
Sbjct  256   RNITELSHYYGYRKAFRTALRTMVKMKGYKGVTFLRTFSPAHFENSEWNKGGSCERRKPY  315

Query  954   TKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWA  1133
              K +MK +GY  E Y  QV EF  A+REG K+G++F +L+TTE M+ RPDGHPN++  W 
Sbjct  316   GKEEMKFDGYIFETYKVQVEEFRGARREGRKRGLKFLMLNTTEMMLRRPDGHPNNHV-WG  374

Query  1134  HENKTT-ADCVHWCMPGPIDTWNEFLLQVLK  1223
             HE K T +DCVHWC+PGPIDTWNE L   LK
Sbjct  375   HEMKNTHSDCVHWCLPGPIDTWNELLFYQLK  405



>ref|XP_003554973.1| PREDICTED: protein YLS7-like [Glycine max]
Length=433

 Score =   419 bits (1076),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 190/349 (54%), Positives = 246/349 (70%), Gaps = 8/349 (2%)
 Frame = +3

Query  195   PGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLF  374
             P  +CNIF G WVP PE PYYTN T   I + QNCMK GRPD+ F+KWRW+P+ CELP+F
Sbjct  74    PVKKCNIFSGEWVPNPEAPYYTNTTCWAIHEHQNCMKHGRPDSEFMKWRWKPNECELPIF  133

Query  375   DGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNF  545
             +  QFLE++RGK+MAF+GDS +RN MQS+ CLL+ V  P+ VS   D +  RW Y  YNF
Sbjct  134   NPLQFLEIMRGKSMAFIGDSTSRNHMQSMICLLSRVEWPIDVSQVNDLSFKRWKYLSYNF  193

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             T+ +FW+PH+V+AK  D    S   L N+Y DE D  W  ++   D VI + GQWF  P 
Sbjct  194   TIANFWTPHLVRAKKTD----SNSVLFNVYLDEFDETWTTQIKEFDYVIINGGQWFLGPM  249

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              +Y+  KIVGC  C+   +   N  +G    FRTAFK ++  E F+G+  LRTFSP+HFE
Sbjct  250   VFYEKQKIVGCQYCDIENVTHLNLNYGIRKVFRTAFKAIISLENFKGITFLRTFSPSHFE  309

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
             NG WN GGNCVRT+PF   + KLEG+ LE+++ Q+ EF  AK+EG KKG++F LLDTT++
Sbjct  310   NGLWNKGGNCVRTKPFRNNETKLEGHNLELHMIQLEEFKIAKKEGIKKGLKFMLLDTTQA  369

Query  1086  MVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             M+LRPDGHPN YG+W +EN T   DCVHWC+PG ID W++FLL++LKME
Sbjct  370   MLLRPDGHPNRYGYWPNENMTLYNDCVHWCLPGAIDIWSDFLLEMLKME  418



>gb|ACU23707.1| unknown [Glycine max]
Length=413

 Score =   417 bits (1072),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 193/390 (49%), Positives = 265/390 (68%), Gaps = 9/390 (2%)
 Frame = +3

Query  75    VLGAFRKAVLPISTTLVIFATFCFTSYNISDSLL-QSFNLFPGGECNIFKGNWVPFPEGP  251
             +L     ++L   + L I   +   S+   D ++ +S    P  +C+IF G+WVP PE P
Sbjct  16    ILTTISCSLLSYHSLLKINDEYKEPSFEFDDLIVPESLPSTPVNKCDIFTGDWVPNPEAP  75

Query  252   YYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGD  431
             YYTN T  +I + QNCMK+GRPDT F+KWRW+P+ CELP+F+  QFL+++RGK++AFVGD
Sbjct  76    YYTNTTCWEIHEHQNCMKYGRPDTDFMKWRWKPNECELPIFNPFQFLQIMRGKSLAFVGD  135

Query  432   SVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPL  602
             S+ RN MQS+ CLL+ V  P+ VS   D +  RW Y  YNFT+ +FWSP++V+AK  D  
Sbjct  136   SIGRNHMQSMICLLSKVEWPIDVSYTDDFSFKRWKYSSYNFTMTTFWSPYLVRAKQVD--  193

Query  603   WVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAI  782
               S   L N+Y DE D  W  ++   D VI + GQWF RP  +Y+  KIVGC  C+   +
Sbjct  194   --SNGGLYNVYLDEFDEKWTTQIKEFDYVIINVGQWFLRPMVFYEKQKIVGCQYCSLENV  251

Query  783   KKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKR  962
                + ++GY  AF T FK +++ E F+G+  LRTF+P+HFENG W+ GGNCVR +PF   
Sbjct  252   THLSWHYGYKKAFGTTFKAIINLENFKGVTFLRTFAPSHFENGVWDKGGNCVRIKPFKSN  311

Query  963   QMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHEN  1142
             + +LEG  LE++  Q+ +F  A++E  KKG+ F LLDTT++M+LRPDGHPN YGHW HEN
Sbjct  312   ETRLEGNNLELHTIQLEQFKIAEKEARKKGLNFMLLDTTQAMLLRPDGHPNKYGHWPHEN  371

Query  1143  KTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
              T   DCVHWC+PGPIDTW++FLL++LKME
Sbjct  372   VTLFNDCVHWCLPGPIDTWSDFLLEMLKME  401



>ref|XP_004156230.1| PREDICTED: uncharacterized LOC101210676 [Cucumis sativus]
Length=378

 Score =   416 bits (1068),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 248/346 (72%), Gaps = 4/346 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             EC++F G W+P P  PYY++++   I + QNCMK+GRPD GF++WRW+PD CELP+F+  
Sbjct  21    ECDMFVGEWIPNPNAPYYSSSSCWAIHEHQNCMKYGRPDGGFMQWRWKPDGCELPIFNPS  80

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLE++R K++AFVGDSV RNQMQSL CLL+ V  PV  S   D    RW YK YNFTL 
Sbjct  81    QFLEIMRDKSLAFVGDSVGRNQMQSLICLLSRVEYPVDESYTADENFKRWKYKTYNFTLA  140

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             SFW+PH++KA   D    +   L NLY DE D+ W  ++   D +I SAG WFFRP  ++
Sbjct  141   SFWTPHLIKANMGDANGPTKTGLFNLYLDEHDQEWTTQIDEFDYIIISAGHWFFRPMVFH  200

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N +IVGCH C    +     Y+GY  AFRTA K +   + F+G  ILRTF+P+HFENG 
Sbjct  201   ENHRIVGCHYCLLPNVTDLGMYYGYRKAFRTALKAINSLKNFKGTTILRTFAPSHFENGL  260

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNC+RT+PF   + +LEG+ LE+Y+ Q+ E+  A++EG +KG +FRLLDTT++M+L
Sbjct  261   WNEGGNCLRTQPFRSNETQLEGHNLELYMIQMEEYRVAEKEGRRKGKKFRLLDTTQAMLL  320

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGH A EN T   DCVHWC+PGPID W++FLLQ+LKME
Sbjct  321   RPDGHPSRYGHLASENVTLYNDCVHWCLPGPIDAWSDFLLQMLKME  366



>ref|XP_004141488.1| PREDICTED: uncharacterized protein LOC101210676 [Cucumis sativus]
 gb|KGN52557.1| hypothetical protein Csa_5G643360 [Cucumis sativus]
Length=441

 Score =   417 bits (1073),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 248/346 (72%), Gaps = 4/346 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             EC++F G W+P P  PYY++++   I + QNCMK+GRPD GF++WRW+PD CELP+F+  
Sbjct  84    ECDMFVGEWIPNPNAPYYSSSSCWAIHEHQNCMKYGRPDGGFMQWRWKPDGCELPIFNPS  143

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLE++R K++AFVGDSV RNQMQSL CLL+ V  PV  S   D    RW YK YNFTL 
Sbjct  144   QFLEIMRDKSLAFVGDSVGRNQMQSLICLLSRVEYPVDESYTADENFKRWKYKTYNFTLA  203

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             SFW+PH++KA   D    +   L NLY DE D+ W  ++   D +I SAG WFFRP  ++
Sbjct  204   SFWTPHLIKANMGDANGPTKTGLFNLYLDEHDQEWTTQIDEFDYIIISAGHWFFRPMVFH  263

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N +IVGCH C    +     Y+GY  AFRTA K +   + F+G  ILRTF+P+HFENG 
Sbjct  264   ENHRIVGCHYCLLPNVTDLGMYYGYRKAFRTALKAINSLKNFKGTTILRTFAPSHFENGL  323

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNC+RT+PF   + +LEG+ LE+Y+ Q+ E+  A++EG +KG +FRLLDTT++M+L
Sbjct  324   WNEGGNCLRTQPFRSNETQLEGHNLELYMIQMEEYRVAEKEGRRKGKKFRLLDTTQAMLL  383

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGH A EN T   DCVHWC+PGPID W++FLLQ+LKME
Sbjct  384   RPDGHPSRYGHLASENVTLYNDCVHWCLPGPIDAWSDFLLQMLKME  429



>ref|XP_003543902.1| PREDICTED: protein YLS7-like [Glycine max]
Length=433

 Score =   417 bits (1071),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 201/401 (50%), Positives = 262/401 (65%), Gaps = 24/401 (6%)
 Frame = +3

Query  99    VLPISTTLVIFATFCFT----SYNISDSLLQSFN-------LFPGGE---------CNIF  218
             +LP  T L I A   F      Y +S S L   N        + G E         C+IF
Sbjct  18    MLPKVTLLAILAILIFAITPMCYPLSYSSLLKINKYKQPSTTYDGTESLPSTSVKKCDIF  77

Query  219   KGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLEL  398
              G WVP P+ PYYTN T   I + QNCMK+GRPD+ F+KWRW+P+ CELP+F+   FLE+
Sbjct  78    SGEWVPNPKAPYYTNTTCWAIHEHQNCMKYGRPDSEFMKWRWKPNECELPIFNPFHFLEI  137

Query  399   VRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA---VGRWVYKEYNFTLLSFWSP  569
             +RGK+MAFVGDSV RN MQSL CLL+ V  P+ VS        +W Y  YNFT+ +FW+P
Sbjct  138   MRGKSMAFVGDSVGRNHMQSLICLLSRVEWPIDVSPTTNDYFRQWKYPSYNFTVAAFWTP  197

Query  570   HIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKI  749
             ++VK+K  D +  S + L NL+ D+ D  WA ++   D +I +AG WFFRP  +Y+   I
Sbjct  198   YLVKSKMVDSIGPSHNGLFNLHLDQVDVTWATQIQKFDYIIMNAGHWFFRPMIFYEKQNI  257

Query  750   VGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGG  929
             VGC  C    +     Y+GY   FRTAFK +   + F+G+  LRTF+P+HFENG WN GG
Sbjct  258   VGCCDCLLKNVTDLTTYYGYRQVFRTAFKAINSLQNFKGITFLRTFAPSHFENGTWNKGG  317

Query  930   NCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGH  1109
             +CVRT+PF   +++LEG  LE+Y+ Q+ EF  AK+EG KKG+ FRL DTT++M+LRPDGH
Sbjct  318   HCVRTKPFKSNEIRLEGTNLELYMIQLEEFKIAKKEGRKKGLEFRLFDTTQAMLLRPDGH  377

Query  1110  PNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             P+ YGHW HE  T   DCVHWC+PGPIDTWN+FLL++LKME
Sbjct  378   PSIYGHWPHEKVTLYNDCVHWCLPGPIDTWNDFLLEMLKME  418



>ref|XP_004491779.1| PREDICTED: uncharacterized protein LOC101494653 [Cicer arietinum]
Length=439

 Score =   417 bits (1072),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 204/409 (50%), Positives = 265/409 (65%), Gaps = 30/409 (7%)
 Frame = +3

Query  93    KAVLPISTTLVIFATFCFTSYNIS------------------------DSLLQSFNLFPG  200
             K ++P  T L +FA   FT   +S                        D L +S +L   
Sbjct  16    KQMIPKVTLLAVFAILVFTITPLSYPLFRYSSSMKNINKDSKQPSSAFDDLNESSSLPST  75

Query  201   G--ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLF  374
                +C+IF G WVP  +GPYYTN T   I + QNCMK+GRPD+ FLKW+W+P+ C+LP+F
Sbjct  76    SIKKCDIFSGEWVPNSKGPYYTNKTCWAIHEHQNCMKYGRPDSEFLKWKWKPNGCDLPIF  135

Query  375   DGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNF  545
             +  QFLE+VRGK+MAFVGDSV RNQMQS+ CLL+ V  P+ VS   D    RW Y  YNF
Sbjct  136   NPFQFLEIVRGKSMAFVGDSVGRNQMQSMICLLSRVEWPIDVSYTSDDYFMRWNYPTYNF  195

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             T+ SFW+PH+V++K++D        L NLY DEPD  W  ++ + D VI + G WF R  
Sbjct  196   TMASFWTPHLVRSKESDIKGPGSTGLFNLYIDEPDEKWITQIQDFDYVILNGGHWFTRSM  255

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              +Y+  KIVGCH C    +     Y GY  AFRTA K + + E F+G+  LRTFSP+HFE
Sbjct  256   VFYEKQKIVGCHYCLLENVPDLTMYHGYRRAFRTALKAINNLENFKGITFLRTFSPSHFE  315

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
             NG WN GGNCVRT+PF   + +LEG  LE Y+ Q+ EF  A++E  KKG++FRL DTT++
Sbjct  316   NGLWNQGGNCVRTKPFRSNETQLEGINLEFYMIQLEEFKIAEKEARKKGMKFRLYDTTQA  375

Query  1086  MVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
              +LRPDGHP++YGHW +EN T   DCVHWC+PGPIDTW++FLL +LKME
Sbjct  376   SLLRPDGHPSNYGHWPNENVTLYNDCVHWCLPGPIDTWSDFLLDMLKME  424



>gb|AFK44713.1| unknown [Lotus japonicus]
Length=436

 Score =   416 bits (1070),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 263/407 (65%), Gaps = 28/407 (7%)
 Frame = +3

Query  93    KAVLPISTTLVIFATFCFTSYNIS----------------------DSLLQSFNLFPGG-  203
             K ++P    L +FA   FT   +S                      D L +S +L     
Sbjct  16    KQMIPKVALLAVFAILVFTVTPLSYPLFRYSSSLKNRAPSVPLPSFDDLNESASLPSTSV  75

Query  204   -ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
              +C+IF G WVP P+ PYYTN T   I + QNCMK+GRPD+ F+KWRW+P+ CELP+F+ 
Sbjct  76    KKCDIFTGEWVPNPKAPYYTNKTCWAIHEHQNCMKYGRPDSEFMKWRWKPNGCELPIFNP  135

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTL  551
              QFLE+VRGK++AFVGDSV RNQMQS+ CLL+    P+ VS   D    RW Y  YNFT+
Sbjct  136   FQFLEIVRGKSLAFVGDSVGRNQMQSMICLLSRAEWPIDVSYTRDDYFMRWKYPNYNFTM  195

Query  552   LSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
              SFW+PH+V++K++D    S   L NLY DEPD  W  ++ + D VI + G WF R   +
Sbjct  196   ASFWTPHLVRSKESDSNGPSQTGLYNLYLDEPDEKWITQIEDFDYVILNGGHWFTRSMVF  255

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+  KI+GCH C    +     Y+GY  AFRTAFK +   + F+G+  LRTFSP+HFENG
Sbjct  256   YEQQKIIGCHYCLLENVPDLTMYYGYRRAFRTAFKAINSLKNFKGITFLRTFSPSHFENG  315

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              WN GGNCVRT+PF   + +LEG  LE Y+ Q+ EF  A++E  KKG+R+RL DT ++ +
Sbjct  316   IWNEGGNCVRTKPFRSNETQLEGLNLEYYMIQLEEFKIAEKEARKKGLRYRLFDTMQATL  375

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+ YGHW +EN T   DCVHWC+PGPIDTW++FLL +LKME
Sbjct  376   LRPDGHPSKYGHWPNENVTLYNDCVHWCLPGPIDTWSDFLLDLLKME  422



>ref|XP_009357003.1| PREDICTED: protein trichome birefringence-like 19 [Pyrus x bretschneideri]
 ref|XP_009357004.1| PREDICTED: protein trichome birefringence-like 19 [Pyrus x bretschneideri]
 ref|XP_009378326.1| PREDICTED: protein trichome birefringence-like 19 [Pyrus x bretschneideri]
 ref|XP_009378327.1| PREDICTED: protein trichome birefringence-like 19 [Pyrus x bretschneideri]
Length=444

 Score =   417 bits (1071),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 189/347 (54%), Positives = 250/347 (72%), Gaps = 5/347 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G WVP PE PYYTN T   I + QNCMK+GRPDT F+KW+W+PD CELP+F+  
Sbjct  79    KCDIFTGEWVPNPEAPYYTNKTCWAIHEHQNCMKYGRPDTEFMKWKWKPDDCELPVFNPA  138

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLEL+RGK+MAFVGDSV RNQMQS+ CLL+ V  P+ VS   D    RW Y  YNFT+ 
Sbjct  139   QFLELLRGKSMAFVGDSVGRNQMQSMICLLSRVEYPIDVSTTEDQRFIRWKYTSYNFTMA  198

Query  555   SFWSPHIVKAKDADPL-WVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
             +FW+PH+VK+K+A      +   L  LY DE D  W  ++   D +I +AG WFFRP  Y
Sbjct  199   TFWTPHLVKSKEATYTDGPTKTGLFELYLDEFDEAWTTQINEFDYIILAAGHWFFRPMVY  258

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+N KI GC+ C    +     ++G+  AFRTAFK +   E ++G+  +RTF+P+HFENG
Sbjct  259   YENRKITGCNYCLLDNVPDLGKHYGHRKAFRTAFKAINSLENYKGITYVRTFAPSHFENG  318

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              WN GGNC+RT+P+   + +LEG  LE+Y+ Q+ EF  A++EG KKG+++RLLDTT++ +
Sbjct  319   IWNEGGNCLRTKPYKSNETRLEGLNLELYMIQIEEFRKAEKEGRKKGLKYRLLDTTQAAL  378

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+ YGHW +EN T   DCVHWC+PGPIDTW++FLL++LKME
Sbjct  379   LRPDGHPSRYGHWPNENVTLYNDCVHWCLPGPIDTWSDFLLEMLKME  425



>ref|XP_008357813.1| PREDICTED: protein trichome birefringence-like 19 [Malus domestica]
Length=444

 Score =   417 bits (1071),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 189/347 (54%), Positives = 248/347 (71%), Gaps = 5/347 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G WVP PE PYYTN T   I + QNCMK+GRPDT F+KW+W+PD CELP+F+  
Sbjct  79    KCDIFTGEWVPNPEAPYYTNKTCWAIHEHQNCMKYGRPDTEFMKWKWKPDDCELPVFNPA  138

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLEL+RGK+MAFVGDSV RNQMQS+ CLL+ V  P+ VS   D    RW Y  YNFT+ 
Sbjct  139   QFLELLRGKSMAFVGDSVGRNQMQSMICLLSRVEYPIDVSTTEDQRFIRWKYTSYNFTMA  198

Query  555   SFWSPHIVKAKDADPL-WVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
             +FW+PH+VK K+A      +   L  LY DE D  W  ++   D +I SAG WFFRP  Y
Sbjct  199   TFWTPHLVKTKEATYTDGPTKTGLFELYLDEFDEAWTTQINEFDYIILSAGHWFFRPMVY  258

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+N KI GC+ C    +     ++GY  AFRTAFK +   E ++G+  +RTF+P+HFENG
Sbjct  259   YENRKITGCNYCLLDNVPDLGKHYGYRKAFRTAFKAINSLENYKGITYVRTFAPSHFENG  318

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              WN GGNC+RT+P+   + +LEG  LE+Y+ Q+ E+  A++EG K G+++RLLDTT++ +
Sbjct  319   IWNEGGNCLRTKPYKSNETRLEGLNLELYMIQIEEYRKAEKEGRKNGLKYRLLDTTQATL  378

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+ YGHW +EN T   DCVHWC+PGPIDTW++FLL++LKME
Sbjct  379   LRPDGHPSRYGHWPNENVTLYNDCVHWCLPGPIDTWSDFLLEMLKME  425



>gb|KEH21842.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=438

 Score =   416 bits (1069),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/408 (50%), Positives = 266/408 (65%), Gaps = 29/408 (7%)
 Frame = +3

Query  93    KAVLPISTTLVIFATFCFT----SY----------NISDS--------LLQSFNLFPGG-  203
             K ++P  T L IFA   FT    SY          NI  S        LL      P   
Sbjct  16    KQMIPKVTLLAIFAILVFTVTPFSYPLFRNPSSMKNIKQSNQPSTAFDLLNESASLPSTS  75

Query  204   --ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFD  377
               +C+IF G WVP P+ PYYTN T   I + QNCMK+GRPD+ +LKW+W+P+ CELP+F+
Sbjct  76    TKKCDIFTGEWVPNPKAPYYTNKTCWAIHEDQNCMKYGRPDSDYLKWKWKPNGCELPIFN  135

Query  378   GRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA---VGRWVYKEYNFT  548
               QFLE+VRGK+MAFVGDSV RNQMQS+ CLL+ V  PV VS +      RW Y  YNFT
Sbjct  136   PFQFLEIVRGKSMAFVGDSVGRNQMQSMICLLSRVEWPVVVSHSQNDYFMRWHYPTYNFT  195

Query  549   LLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFF  728
             + SFW+PH+V++K++D        L +LY DEPD  W  ++ + + VI + G WF R   
Sbjct  196   MASFWTPHLVRSKESDLKGPGSTGLFDLYIDEPDENWITQIEDFNYVILNGGHWFTRSMV  255

Query  729   YYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFEN  908
             +Y+  KIVGCH C    +     Y GY  AFRTAFK + + + F+G+  LRTFSP+HFEN
Sbjct  256   FYEKQKIVGCHYCLLENVPDLTMYHGYRRAFRTAFKAINNLQNFKGITFLRTFSPSHFEN  315

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G WN GGNCVRT+PF   + +LEG+ LE Y+ Q+ EF  A++E  KKG++FRL DTT++ 
Sbjct  316   GLWNQGGNCVRTKPFRSNETQLEGFNLEFYMIQLEEFKIAEKEARKKGLKFRLYDTTQAT  375

Query  1089  VLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             +LRPDGHP+ YGHW +EN T   DCVHWC+PGPIDTW++FLL +LKME
Sbjct  376   MLRPDGHPSKYGHWPNENVTLYNDCVHWCLPGPIDTWSDFLLDMLKME  423



>ref|XP_010029464.1| PREDICTED: protein trichome birefringence-like 19 [Eucalyptus 
grandis]
Length=440

 Score =   416 bits (1068),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 190/345 (55%), Positives = 244/345 (71%), Gaps = 4/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WVP P  PYYTN T   I + QNCMK+GRPDT F+KWRW+PD CELPLF+  Q
Sbjct  78    CDIFTGEWVPNPRAPYYTNKTCWAIHEHQNCMKYGRPDTDFMKWRWKPDGCELPLFNPAQ  137

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA---VGRWVYKEYNFTLLS  557
             FLELVRGK+MAFVGDSVARNQMQS+ CLL+ V  P+ VS  +     RW Y  YNFTL +
Sbjct  138   FLELVRGKSMAFVGDSVARNQMQSMICLLSRVEYPIDVSHTSNQQYMRWRYVTYNFTLAN  197

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FW+PH+VK+ + DP   +   L +L+ DE D  W  E    D +I SAG WF+RP  +++
Sbjct  198   FWTPHLVKSAETDPNGPTKTGLFSLHLDEADDRWLSEAEEFDYLIVSAGHWFYRPLVFHE  257

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
              GKIVGCH C    +     ++GY  AFRTAFK +   + ++G+  LRTF+P+HFE G W
Sbjct  258   GGKIVGCHFCLLENVPDLTKFYGYRKAFRTAFKAINGLKNYKGITYLRTFAPSHFEGGIW  317

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GGNCVRTRPF   +  L    LE+Y+ QV EF  A++E  ++G+++RLLDTT++ ++R
Sbjct  318   NQGGNCVRTRPFQSNETALADENLELYMIQVEEFRKAEQEARERGLKYRLLDTTQATLMR  377

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGHW HEN T   DCVHWC+PGPIDTW++FLL++LK E
Sbjct  378   PDGHPSRYGHWPHENVTLYNDCVHWCLPGPIDTWSDFLLEMLKTE  422



>ref|XP_003555085.1| PREDICTED: protein YLS7-like [Glycine max]
Length=425

 Score =   414 bits (1065),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 197/403 (49%), Positives = 264/403 (66%), Gaps = 19/403 (5%)
 Frame = +3

Query  93    KAVLPISTTLVIFATF-------CFTSYNISDSL-LQSFNLFPGG-------ECNIFKGN  227
             K +LP  T LV+ +         C+  ++ S  L +  +N  P         +CNIF G 
Sbjct  16    KQMLPKVTLLVLLSILIFVVTPMCYPLFSYSSLLKINKYNKHPESLPSTSVKKCNIFSGE  75

Query  228   WVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRG  407
             WV  PE PYYTN T   I + QNCMK+GRPDT F+KWRW+P+ CELP+F+  QFLE+++G
Sbjct  76    WVSNPEAPYYTNNTCWAIHEHQNCMKYGRPDTDFMKWRWKPNECELPIFNPFQFLEIMKG  135

Query  408   KTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA---VGRWVYKEYNFTLLSFWSPHIV  578
             K+MAFVGDSV RN MQSL CLL+ V  P+ VS        +W Y  YNFT+ +FW+P++V
Sbjct  136   KSMAFVGDSVGRNHMQSLICLLSRVEWPIDVSPTTNDYFRQWKYPSYNFTVAAFWTPYLV  195

Query  579   KAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGC  758
             K+K  D +  S + L NLY D+ D  WA ++   D +I +AG WFFR   +Y+   IVGC
Sbjct  196   KSKMVDSIGPSHNGLFNLYLDQVDETWATQIEEFDYIIINAGHWFFRSMIFYEKQNIVGC  255

Query  759   HRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCV  938
               C    +     Y+GY   FRTAFK +   + F+G+  LRTF+P+HFENG WN GG+CV
Sbjct  256   CDCLLKNVTDLTTYYGYRQVFRTAFKAINSLQNFKGVTFLRTFAPSHFENGTWNKGGHCV  315

Query  939   RTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNH  1118
             R++PF    ++LE   LE+Y+ Q+ E   AK+EG KKG+ FRL DTT++M+LRPDGHP+ 
Sbjct  316   RSKPFKNNDIRLESTNLELYMIQLEELEIAKKEGRKKGLEFRLFDTTQAMLLRPDGHPSR  375

Query  1119  YGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKMETPEYN  1244
             YGHW HE  T   DCVHWC+PGPIDTWN+FLL++LKME  +++
Sbjct  376   YGHWPHEKVTLYNDCVHWCLPGPIDTWNDFLLEMLKMEDMKFS  418



>gb|KHG26986.1| putative C7orf58 [Gossypium arboreum]
Length=448

 Score =   414 bits (1064),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/349 (54%), Positives = 245/349 (70%), Gaps = 6/349 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G WVP+P+GPYY+N T   I D+QNC+KFGRPDT F+KWRW+P  CELPLFD  
Sbjct  88    KCDVFTGKWVPYPQGPYYSNETCRLIVDQQNCIKFGRPDTEFMKWRWKPHDCELPLFDAA  147

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKEYNF  545
             QFLE+VRGK+MAFVGDSV RNQM+SL CLLA  A P+ +S  +        RW Y +YNF
Sbjct  148   QFLEIVRGKSMAFVGDSVGRNQMESLVCLLAHEAYPLDISRNSSADVNYFKRWFYADYNF  207

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             TL +FWSP +VK+  A     S + L++LY DEPD  W +E+   D VI S GQWFFRP 
Sbjct  208   TLAAFWSPFLVKSGGAHINGHSVNGLISLYLDEPDEAWTNEIEKFDYVIVSVGQWFFRPL  267

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              +Y+ G+++GCH CN+  I   + Y  Y +AFRTAF+TLL  + + G+  LRTF  +HFE
Sbjct  268   LFYEAGRLLGCHICNQNNITSFSKYHAYKMAFRTAFRTLLTLKNYTGVTFLRTFLASHFE  327

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
             NG+W+ GGNC RT+PFT  +MKL+ +  E Y  QV E   A+ +G K G+ F L++TTE 
Sbjct  328   NGDWDKGGNCPRTKPFTSNEMKLQEFNKEFYWVQVEELREAEEKGKKIGLTFELMNTTEI  387

Query  1086  MVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             M +RPDGHPN YGH   +N +  DCVHWC+PGPIDT NEFLL ++K + 
Sbjct  388   MWMRPDGHPNGYGHSMIKNASVYDCVHWCLPGPIDTLNEFLLYLMKKDV  436



>ref|XP_006844211.1| hypothetical protein AMTR_s00006p00266110 [Amborella trichopoda]
 gb|ERN05886.1| hypothetical protein AMTR_s00006p00266110 [Amborella trichopoda]
Length=437

 Score =   414 bits (1063),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 195/389 (50%), Positives = 257/389 (66%), Gaps = 10/389 (3%)
 Frame = +3

Query  96    AVLPISTTLVIFATFCFTSY----NISDSLLQSFNLFPGG--ECNIFKGNWVPFPEGPYY  257
              V+P+S ++ I +     S     NI DS       F      C+IF+G WVP P+ PYY
Sbjct  43    TVIPLSFSIKISSFLLINSSLWGNNIRDSTANDLGAFKETIRSCDIFRGEWVPDPKAPYY  102

Query  258   TNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSV  437
             TN T   I D QNCMK+GRPDTGF+KW+W+PD CE+P F   +F E VRGK++AFVGDSV
Sbjct  103   TNTTCWAIHDHQNCMKYGRPDTGFMKWKWRPDECEMPEFHPSEFFETVRGKSIAFVGDSV  162

Query  438   ARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWV  608
             ARN MQSL CLL+ V  PV  S   D    RW Y  YNFT+ +FWSP++VK+ +AD L  
Sbjct  163   ARNHMQSLICLLSRVEYPVDASIDSDERFRRWFYATYNFTIAAFWSPYLVKSMEADHLGP  222

Query  609   SPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKK  788
             +   L +L+ D  D  W  ++   D VI SAG WFFRP  +Y+ GK+VGC+ C +  I  
Sbjct  223   ALTGLFDLHLDTFDDDWTAQIEGFDYVIISAGHWFFRPMVFYEQGKVVGCYYCKQKNITD  282

Query  789   RNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQM  968
                 + Y  AFRTAFK +   + F+G   LRTF+PAHFE G WN GGNC+RT+P    + 
Sbjct  283   LGINYAYRRAFRTAFKAINGLQNFKGTTFLRTFAPAHFEGGLWNQGGNCIRTKPVKSNET  342

Query  969   KLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKT  1148
             KLEG  +E+Y++Q+ EF  A+R G ++G +FR++DTT++M++RPDGHP+ +GHW HEN T
Sbjct  343   KLEGMNMELYMSQIEEFRDAERVGRERGHKFRVIDTTQAMLMRPDGHPSRFGHWPHENVT  402

Query  1149  T-ADCVHWCMPGPIDTWNEFLLQVLKMET  1232
                DCVHWC+PGPID+WN FLL++LK E 
Sbjct  403   LYNDCVHWCLPGPIDSWNSFLLEMLKTEV  431



>ref|XP_004304156.1| PREDICTED: uncharacterized protein LOC101297564 [Fragaria vesca 
subsp. vesca]
Length=448

 Score =   413 bits (1061),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 186/346 (54%), Positives = 246/346 (71%), Gaps = 4/346 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             EC+IF G W+P PE PYYTN T   I + QNC K+GRPD+ F+KW+W+PD CELP+F+  
Sbjct  86    ECDIFTGEWIPNPEAPYYTNTTCWAIHEHQNCQKYGRPDSEFMKWKWKPDGCELPVFNPA  145

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLEL+RGK++AFVGDSV RNQMQSL CLL+ V  P+ VS   D    RW Y  YNFT+ 
Sbjct  146   QFLELLRGKSLAFVGDSVGRNQMQSLICLLSRVEYPIDVSYTKDEKYKRWKYTSYNFTMA  205

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             S+W+PH++K+K+ D    +   +  LY DE D  W  ++ + D +I SAG WF R   ++
Sbjct  206   SYWTPHLIKSKEEDIHGPTNTGIFGLYLDEFDEAWTTQVEDFDYLIVSAGHWFMRSMVFH  265

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N KI GCH C    +     Y+GY  AFRTAFK +   + F+G+  LRTF+P+HFE G 
Sbjct  266   ENNKIAGCHYCLLDNVTDVGMYYGYRKAFRTAFKAINSMKNFKGITYLRTFAPSHFEGGM  325

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GG+CVRT+PF   + +LEG +LE Y+ Q+ EF AA++EG KKG+++RLLDTT++M+L
Sbjct  326   WNKGGDCVRTKPFKSNETQLEGVSLEFYMIQLEEFRAAEKEGRKKGLKYRLLDTTQAMLL  385

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGH   EN T   DCVHWC+PGPIDTW++FLL++LK E
Sbjct  386   RPDGHPSRYGHLPEENVTLYNDCVHWCLPGPIDTWSDFLLEMLKTE  431



>gb|KHN28370.1| hypothetical protein glysoja_029631 [Glycine soja]
Length=388

 Score =   410 bits (1054),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 186/346 (54%), Positives = 242/346 (70%), Gaps = 4/346 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +CNIF G WV  PE PYYTN T   I + QNCMK+GRPDT F+KWRW+P+ CELP+F+  
Sbjct  31    KCNIFSGEWVSNPEAPYYTNNTCWAIHEHQNCMKYGRPDTDFMKWRWKPNECELPIFNPF  90

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA---VGRWVYKEYNFTLL  554
             QFLE+++GK+MAFVGDSV RN MQSL CLL+ V  P+ VS        +W Y  YNFT+ 
Sbjct  91    QFLEIMKGKSMAFVGDSVGRNHMQSLICLLSRVEWPIDVSPTTNDYFRQWKYPSYNFTVA  150

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             +FW+P++VK+K  D +  S + L NLY D+ D  WA ++   D +I +AG WFFR   +Y
Sbjct  151   AFWTPYLVKSKMVDSIGPSHNGLFNLYLDQVDETWATQIEEFDYIIINAGHWFFRSMIFY  210

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +   IVGC  C    +     Y+GY   FRTAFK +   + F+G+  LRTF+P+HFENG 
Sbjct  211   EKQNIVGCCDCLLKNVTDLTTYYGYRQVFRTAFKAINSLQNFKGVTFLRTFAPSHFENGT  270

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GG+CVR++PF    ++LE   LE+Y+ Q+ E   AK+EG KKG+ FRL DTT++M+L
Sbjct  271   WNKGGHCVRSKPFKNNDIRLESTNLELYMIQLEELEIAKKEGRKKGLEFRLFDTTQAMLL  330

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGHW HE  T   DCVHWC+PGPIDTWN+FLL++LKME
Sbjct  331   RPDGHPSRYGHWPHEKVTLYNDCVHWCLPGPIDTWNDFLLEMLKME  376



>ref|XP_008230367.1| PREDICTED: protein trichome birefringence-like 19 [Prunus mume]
Length=456

 Score =   412 bits (1058),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/349 (54%), Positives = 245/349 (70%), Gaps = 7/349 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G WVP PE PYYTN T   I + QNCMK+GRPDT F+KWRW+PD CELP+F+  
Sbjct  89    KCDIFTGEWVPNPEAPYYTNKTCWAIHEHQNCMKYGRPDTEFMKWRWKPDGCELPIFNPA  148

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYKEYNFT  548
             QFLEL+RGK++AFVGDSV RNQMQSL CLL+ V  P+ VS          RW Y  YNFT
Sbjct  149   QFLELLRGKSLAFVGDSVGRNQMQSLICLLSRVEYPIDVSITPDPTQKFIRWKYMSYNFT  208

Query  549   LLSFWSPHIVKAKDADPL-WVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             + +FW+PH++K+K A      +   L  LY DE D  W  ++   D +I SAG WFFR  
Sbjct  209   MATFWTPHLIKSKAATYTNGPTKTGLFELYLDEFDEAWTTQVEEFDYIILSAGHWFFRSM  268

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              YY+N KI GCH C    +     ++GY  AFR+AFK +   + ++G+  +RTF+P+HFE
Sbjct  269   VYYENQKISGCHYCLLDNVPDVGIFYGYRKAFRSAFKAINSLQNYKGITYVRTFAPSHFE  328

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
             NG WN GGNC+RT PF   + +LEG  LE+Y+ Q+ EF  A +EG KKG+++RLLDTT++
Sbjct  329   NGLWNQGGNCLRTMPFRSNETQLEGANLELYMIQIEEFRNAVKEGRKKGLKYRLLDTTQA  388

Query  1086  MVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
              +LRPDGHP+ YGHW HEN T   DCVHWC+PGPIDTW++FLL++LKME
Sbjct  389   SLLRPDGHPSRYGHWPHENVTLYNDCVHWCLPGPIDTWSDFLLEMLKME  437



>gb|KEH25275.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=434

 Score =   410 bits (1054),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 184/345 (53%), Positives = 246/345 (71%), Gaps = 4/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WVP P+GPYYTN T   I + QNCMK+GRPD+ F+KWRW+P+ CELP+F+  Q
Sbjct  78    CDIFSGEWVPNPKGPYYTNKTCWAIHEHQNCMKYGRPDSEFMKWRWKPNECELPIFNPFQ  137

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FLE+VRGK+MAFVGDSV RN MQSL CLL+ V  P+ VS   D    RW Y  YNFT+ +
Sbjct  138   FLEIVRGKSMAFVGDSVGRNHMQSLICLLSRVEWPIDVSYTKDDYFMRWKYPSYNFTMAA  197

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             +W+P +VKA+  +    +   L NLY DE D  W  ++ + D VI + G WF++P  +Y+
Sbjct  198   YWTPFLVKAQRENSDGPTHTGLYNLYLDEFDEKWTSQIEDFDYVIINGGHWFYKPMVFYE  257

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
              GKIVGCH C    +     Y+GY  AFRTAF+ L   E F+G+  LRTF+P+HFENG W
Sbjct  258   KGKIVGCHYCLLENVTDLTMYYGYRKAFRTAFRALNSLENFKGVTFLRTFAPSHFENGIW  317

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GGNC+RT+PF   + +LEG  +E+Y+ Q+ E+  ++++  + G++FRLLDTT++M+LR
Sbjct  318   NQGGNCLRTKPFKSNEARLEGTNMELYMIQLEEYKISQKKAKRNGLKFRLLDTTQAMLLR  377

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGH   EN T   DCVHWC+PGPIDTW++FLL++LKME
Sbjct  378   PDGHPSRYGHLPQENVTLYNDCVHWCLPGPIDTWSDFLLEMLKME  422



>ref|XP_007139340.1| hypothetical protein PHAVU_008G021200g [Phaseolus vulgaris]
 gb|ESW11334.1| hypothetical protein PHAVU_008G021200g [Phaseolus vulgaris]
Length=436

 Score =   410 bits (1054),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 199/407 (49%), Positives = 263/407 (65%), Gaps = 28/407 (7%)
 Frame = +3

Query  93    KAVLPISTTLVIFATFCFTSYNIS----------------------DSLLQSFNLFPGG-  203
             K ++P  T L +FA   FT   +S                      D L +S +L     
Sbjct  16    KQMIPKVTLLAVFAILLFTVTPLSYPLFRYSSSSLKNKESKPSSAFDDLNESASLPSTSI  75

Query  204   -ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
              +C+IF G W+P P+ PYYTN T   I + QNCMK+GRPD+ FLKW+W+P+ CELP+F+ 
Sbjct  76    KKCDIFTGEWLPNPKAPYYTNKTCWAIHEHQNCMKYGRPDSDFLKWKWKPNGCELPVFNP  135

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTL  551
              QFLE++RGK+MAF+GDSV RNQMQS+ CLL+ V  P+ VS   D    RW Y  YNFT+
Sbjct  136   FQFLEIMRGKSMAFIGDSVGRNQMQSMICLLSRVEWPIDVSYKRDDYFMRWRYPSYNFTM  195

Query  552   LSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
              SFW+ H+V++ +AD     P  L NLY DEPD  W  ++ + D VI + G WF R   +
Sbjct  196   ASFWTTHLVRSTEADSKGPGPTGLCNLYLDEPDEKWITQIEDFDYVILNGGHWFTRSMVF  255

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+N KIVGCH C    +     Y+GY  AFRTAFK +   E F+G V LRTF+P+HFENG
Sbjct  256   YENQKIVGCHYCLLENVPDLTMYYGYRKAFRTAFKAINRLENFKGTVFLRTFAPSHFENG  315

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              WN GGNC+RT+PF   + +LEG  LE Y+ Q+ EF  A+++  KKG+++RL D T++ +
Sbjct  316   LWNQGGNCIRTKPFRSNETQLEGLNLEFYMIQLEEFKIAEKDARKKGLKYRLFDITQASL  375

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+ YGH  +EN T   DCVHWC+PGPIDTW++FLL +LKME
Sbjct  376   LRPDGHPSRYGHLPNENVTLYNDCVHWCLPGPIDTWSDFLLGMLKME  422



>emb|CDP02387.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   407 bits (1047),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 197/386 (51%), Positives = 256/386 (66%), Gaps = 13/386 (3%)
 Frame = +3

Query  96    AVLPISTTLVIFATFCFTSYNISDSLLQSFNLFPGGE----CNIFKGNWVPFPEGPYYTN  263
             A+LPI   L  + +        S     +  L    E    C+IF G W+P P  PYYTN
Sbjct  32    AILPIYYPLRRYPSQAVVKIAASPPYHSAQKLIKAVEDEEKCDIFTGEWIPNPNAPYYTN  91

Query  264   ATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVAR  443
             AT   I + QNCMK+GRPD GF+KW+W+P+ C+LP+F+  QFL++VRGK+MAFVGDS+ R
Sbjct  92    ATCWAIHEHQNCMKYGRPDDGFMKWKWKPEGCDLPIFNPYQFLDIVRGKSMAFVGDSIGR  151

Query  444   NQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSP  614
             N MQSL CLL+ V  P+  S   D    RW Y  YNFTL +FWSP +VK +       +P
Sbjct  152   NHMQSLICLLSRVEFPIDDSATDDDYFRRWKYPSYNFTLAAFWSPFLVKFQKPG----AP  207

Query  615   DSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRN  794
             D L +LY DE D  W+ ++   D VI +AGQW+FRP  YY+  ++VGC  C    I    
Sbjct  208   D-LFDLYLDESDEKWSTDIEGFDYVILNAGQWYFRPSMYYEKRRLVGCRFCQLGNIIDLP  266

Query  795   HYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKL  974
               +GY  A RTAF+ +   + +RG+  LRT++P+HFENGEWN GGNC+R RPF   +  L
Sbjct  267   MTYGYRRALRTAFRAINSLKNYRGITFLRTYAPSHFENGEWNKGGNCLRKRPFWSNETAL  326

Query  975   EGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-  1151
             E   LE+YLTQ+ EF AA+REG KKG+R+RLLD T++M+LRPDGHP+ YGHW HEN T  
Sbjct  327   EANNLEVYLTQMEEFRAAEREGKKKGLRYRLLDVTQAMLLRPDGHPSRYGHWPHENVTLY  386

Query  1152  ADCVHWCMPGPIDTWNEFLLQVLKME  1229
              DCVHWC+PGPID+W++FLL +LKME
Sbjct  387   NDCVHWCLPGPIDSWSDFLLHMLKME  412



>ref|XP_009768257.1| PREDICTED: protein trichome birefringence-like 19 [Nicotiana 
sylvestris]
Length=455

 Score =   409 bits (1050),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 184/349 (53%), Positives = 246/349 (70%), Gaps = 6/349 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G WVP PEGPYYTN T   I++ QNCMK+GRPDTGFLKW+W+PD CELP+FD R
Sbjct  108   KCDLFSGEWVPNPEGPYYTNMTCFQIQEHQNCMKYGRPDTGFLKWKWKPDDCELPIFDPR  167

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLELVR K++AFVGDSVARN MQSL CLL+ V  PV VS   D    RW Y +YNF + 
Sbjct  168   QFLELVRDKSLAFVGDSVARNHMQSLICLLSRVVYPVDVSNTTDLENKRWEYSDYNFNMS  227

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              FWSP++V+A+ +DP  +      NLY +EPD  W  ++ + D VI SAG WFFRP  +Y
Sbjct  228   MFWSPYLVRAEKSDPNNIY--QPFNLYLNEPDESWTTKIQSFDYVIISAGHWFFRPTMFY  285

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
              N  ++GC  C++  + +    F Y  AF+TAF+ +   E ++G+  LRTF+P+HFE+G 
Sbjct  286   LNHSLIGCLFCSQANVSQLTSNFSYQKAFQTAFRAINSLENYKGVTFLRTFAPSHFEDGV  345

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             W+ GG+CVRT PF + +  L+ Y L+ Y  Q++E   A++EG  +G++FRL D T++M+L
Sbjct  346   WDKGGDCVRTVPFKRNEKVLDEYNLDFYKIQLQELEIAQKEGENRGLKFRLFDATQAMLL  405

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKMETPE  1238
             R DGHP+ YGHW + N T   DCVHWC+PGPID WN+FLLQ+LK E  +
Sbjct  406   RADGHPSKYGHWQNPNVTVRKDCVHWCLPGPIDVWNDFLLQLLKREVTD  454



>gb|KHN28371.1| hypothetical protein glysoja_029632 [Glycine soja]
Length=427

 Score =   407 bits (1047),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 190/346 (55%), Positives = 248/346 (72%), Gaps = 4/346 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G WVP P+ PYYTN T   I + QNC+K+GRPD+ F+KWRW+P  CELP+F+  
Sbjct  75    KCDIFSGEWVPNPKAPYYTNKTCWAIHEHQNCIKYGRPDSEFMKWRWKPSECELPIFNPF  134

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLE+V+GK+MAFVGDSV RNQMQS+ CLL+ V  P+ VS   D    RW Y  YNFT+ 
Sbjct  135   QFLEIVKGKSMAFVGDSVGRNQMQSMICLLSRVEWPIDVSYTTDEYFKRWKYPSYNFTMA  194

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             +FW+PH+V++K AD    S   L NLY DE D  W  ++   D +I   G WF+RP  +Y
Sbjct  195   TFWTPHLVRSKMADSHGPSNTGLFNLYLDEFDEKWTTQIEEFDYIILDGGHWFYRPMVFY  254

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +  KIVGCH C    +     ++GY  AFRTAFK +   E F+G+V LRTF+P+HFENG+
Sbjct  255   EKQKIVGCHYCLLENVPDLTMFYGYRKAFRTAFKAIDSLENFKGIVFLRTFAPSHFENGK  314

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNCVRT+PF   + +LE   LE+Y+ Q+ EF  A++EG KKG++ +LLDTT++M+L
Sbjct  315   WNQGGNCVRTKPFRSNETRLESTNLELYMIQLEEFKKAEKEGRKKGLKLKLLDTTQAMLL  374

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGHW  EN T   DCVHWC+PGPIDTW++FLL++LKME
Sbjct  375   RPDGHPSRYGHWPQENVTLYNDCVHWCLPGPIDTWSDFLLEMLKME  420



>ref|XP_006601780.1| PREDICTED: uncharacterized protein LOC100527506 isoform X1 [Glycine 
max]
 gb|KHN13804.1| hypothetical protein glysoja_016088 [Glycine soja]
Length=441

 Score =   408 bits (1048),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 199/412 (48%), Positives = 263/412 (64%), Gaps = 33/412 (8%)
 Frame = +3

Query  93    KAVLPISTTLVIFATFCFTSYNIS---------------------------DSLLQSFNL  191
             K ++P  T L +FA   FT   +S                           D L +S +L
Sbjct  16    KQMIPKVTLLAVFAVLLFTVTPLSYPLFRYSSSSSSLKSNKQLSKKPSSAFDDLNESASL  75

Query  192   FPGG--ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCEL  365
                   +C+IF G WVP P+ PYYTN T   I + QNCMK+GR D+ F+KW+W+P+ C+L
Sbjct  76    PSTSIKKCDIFTGEWVPNPKAPYYTNKTCWAIHEHQNCMKYGRTDSEFMKWKWKPNGCDL  135

Query  366   PLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKE  536
             P+F+  QFLE++RGK+MAFVGDSV RNQMQS+ CLL+ V  P+ VS   D    RW Y  
Sbjct  136   PVFNPFQFLEIMRGKSMAFVGDSVGRNQMQSMICLLSRVEWPIDVSYKRDDYFMRWKYPS  195

Query  537   YNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFF  716
             YNFT+ +FW+ H+VK+K+AD     P  L NLY DEPD  W  ++ + D VI + G WF 
Sbjct  196   YNFTMAAFWTTHLVKSKEADAKGPGPTGLCNLYLDEPDEKWITQIEDFDHVILNGGHWFT  255

Query  717   RPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPA  896
             R   +Y+  KIVGCH C    +     Y+GY  AFRTAF+ +   E F+G V LRTF+P+
Sbjct  256   RSMVFYEKQKIVGCHYCLLENVPDLTMYYGYRKAFRTAFRAINRLENFKGTVFLRTFAPS  315

Query  897   HFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDT  1076
             HFENG WN GGNC+RT+PF   + +LEG  LE Y+ Q+ EF  A++E  KKG+++RL D 
Sbjct  316   HFENGLWNEGGNCIRTKPFKSTETQLEGLNLEFYMIQLEEFKIAEKEARKKGLKYRLFDI  375

Query  1077  TESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             T++ +LRPDGHP+ YGHW +EN T   DCVHWC+PGPIDTW++FLL +LKME
Sbjct  376   TQASLLRPDGHPSRYGHWPNENVTLYNDCVHWCLPGPIDTWSDFLLGMLKME  427



>gb|KHG26987.1| putative C7orf58 [Gossypium arboreum]
Length=442

 Score =   407 bits (1047),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 189/356 (53%), Positives = 246/356 (69%), Gaps = 4/356 (1%)
 Frame = +3

Query  174   LQSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPD  353
             L S  +  G +C+IF G WVP    PYYTN T   I + QNCMK+GRPDT F+KW+W+PD
Sbjct  68    LPSIKISEGEDCDIFLGEWVPNHAAPYYTNTTCWAIHEHQNCMKYGRPDTEFMKWKWKPD  127

Query  354   RCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRW  524
              CELP+ +  QFLE+VRGK++AFVGDS+ RNQMQSL CLL+ +  P+ VS   D    RW
Sbjct  128   GCELPVLNPAQFLEIVRGKSLAFVGDSLGRNQMQSLICLLSRIEYPIDVSYTSDERFKRW  187

Query  525   VYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAG  704
              Y  YNFTL  F S ++VK+K+ D    +   L NLY DE D  W  ++   D VI ++G
Sbjct  188   KYTSYNFTLAYFSSTYLVKSKERDDNGPTHTGLFNLYLDEFDEQWTTQIEGFDYVIINSG  247

Query  705   QWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRT  884
              WF+RP  +Y+N +IVGCH C    +K    ++GY  AFRTAF+ +   E F+G+  LRT
Sbjct  248   HWFYRPSVFYENHQIVGCHYCLIDNVKDLTKFYGYRKAFRTAFRAINSLENFKGVTFLRT  307

Query  885   FSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFR  1064
             F+P HFENG WN GGNCVRT+PF  +++ L+G  LE Y+ Q+ EF  A++EG KK  ++R
Sbjct  308   FAPPHFENGLWNEGGNCVRTKPFQSKEIALDGDNLEFYMIQIEEFKRAQKEGRKKEKKYR  367

Query  1065  LLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             L+DTT + +LRPDGHP+ YGHW +EN T   DCVHWC+PGPID WN+FLLQ+LKME
Sbjct  368   LMDTTHASLLRPDGHPSRYGHWPNENVTLYNDCVHWCLPGPIDNWNDFLLQMLKME  423



>ref|XP_009371027.1| PREDICTED: protein trichome birefringence-like 19 [Pyrus x bretschneideri]
Length=451

 Score =   407 bits (1047),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 187/347 (54%), Positives = 244/347 (70%), Gaps = 5/347 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G WVP PE PYY+N T   I + QNCMK+GRPD  F+KW+W+PD CELP+F+  
Sbjct  86    KCDIFTGEWVPNPEAPYYSNTTCWAIHEHQNCMKYGRPDAEFMKWKWKPDDCELPVFNPA  145

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLELVRGK+MAFVGDSV RNQMQSL CLL+ V  P+ VS   D    RW Y  YNFTL 
Sbjct  146   QFLELVRGKSMAFVGDSVGRNQMQSLICLLSRVEYPIVVSSTEDQRFIRWKYTSYNFTLA  205

Query  555   SFWSPHIVKAKDAD-PLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
             +FW+P+++K+K        + + L  LY DE D+ W  ++   D +I SAG WFFR   Y
Sbjct  206   AFWTPYLIKSKQVTYTEGPTKNGLFELYLDEFDKAWTTQIDEFDYIILSAGHWFFRSMVY  265

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+N  I GC+ C    +      + Y  AFRTAFK +   E F+G+  +RTF+P+HFENG
Sbjct  266   YENQTISGCNYCLIDNVTDIGKQYAYRKAFRTAFKAINSLENFKGITYVRTFAPSHFENG  325

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              WN GGNC+RT+P+   + +LEG  LE+Y  Q+ E+   +REG KKG+++RLLDTT++M+
Sbjct  326   MWNEGGNCLRTKPYRSNETRLEGLDLELYKIQIEEYRKGEREGRKKGLKYRLLDTTQAML  385

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+ YGHW +EN T   DCVHWC+PGPIDTW++FLL++LKME
Sbjct  386   LRPDGHPSRYGHWPNENVTLYNDCVHWCLPGPIDTWSDFLLEMLKME  432



>emb|CDP02386.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   410 bits (1055),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 188/349 (54%), Positives = 245/349 (70%), Gaps = 5/349 (1%)
 Frame = +3

Query  201   GECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             G CN+F G WVP PEGPYYTN T   I++ QNCMKFG+PDTGFLKWRW+PD CELP+FD 
Sbjct  188   GYCNLFSGEWVPNPEGPYYTNETCWAIQEHQNCMKFGKPDTGFLKWRWKPDGCELPIFDP  247

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADP--VKVSDAAVGRWVYKEYNFTLL  554
             +QFLE+VRGK++AFVGDSVARN MQSL CLL+ V  P  V ++     RWVYK+YNF + 
Sbjct  248   QQFLEIVRGKSIAFVGDSVARNHMQSLICLLSRVVYPEDVSITTDENKRWVYKDYNFNIS  307

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              FW+P++V+++   P  V+      LY DE D  W   +   D VI SAG WFFRP  +Y
Sbjct  308   MFWAPYLVRSEKTVPNDVT--RPFRLYLDEFDEDWTSNIETYDYVIISAGHWFFRPTLFY  365

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
              + +++GC  C +  +      F Y  AFRTAF+ L   + F+G+  LRTF+P+HFE G+
Sbjct  366   VDRRLIGCLYCPQENVTHLKSSFSYRRAFRTAFRALNSLDNFKGVTFLRTFAPSHFEGGQ  425

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             W+ GG+CVRTRPF + +  L+ Y LEMY  Q+ E   A++EG +KG++FRL D T+SM+L
Sbjct  426   WDKGGDCVRTRPFKRSERALDDYNLEMYTIQLEELRIAQKEGRRKGLKFRLFDATQSMLL  485

Query  1095  RPDGHPNHYGHWA-HENKTTADCVHWCMPGPIDTWNEFLLQVLKMETPE  1238
             RPDGHP+ YGHW  H+     DCVHWC+PGPID+WN+FLL++LK E  E
Sbjct  486   RPDGHPSKYGHWPNHDVAMANDCVHWCLPGPIDSWNDFLLELLKREETE  534



>ref|XP_008341846.1| PREDICTED: protein trichome birefringence-like 19 [Malus domestica]
Length=451

 Score =   406 bits (1044),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 187/346 (54%), Positives = 241/346 (70%), Gaps = 5/346 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WVP PE PYYTN T   I + QNCMK+GRPD  F+KW+W+PD CELP+F+  Q
Sbjct  87    CDIFTGEWVPNPEAPYYTNTTCWAIHEHQNCMKYGRPDAEFMKWKWKPDECELPVFNPAQ  146

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FLELVRGK+MAFVGDSV RNQMQSL CLL+ V  P+ VS   D    RW Y  YNFTL +
Sbjct  147   FLELVRGKSMAFVGDSVGRNQMQSLICLLSRVEYPIVVSSTEDQRFIRWKYTSYNFTLAA  206

Query  558   FWSPHIVKAKDAD-PLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             FW+P+++K+K        + + L  LY DE D  W  ++   D +I SAG WFFR   YY
Sbjct  207   FWTPYLIKSKQVTYTEGPTKNGLFELYLDEFDEAWTTQIDEFDYIILSAGHWFFRSMVYY  266

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N  I GC+ C    +      + Y  AFRTAFK +   E F+G+  +RTF+P+HFENG 
Sbjct  267   ENQTISGCNYCLIDNVTDIGKQYAYRKAFRTAFKAINSLENFKGITYVRTFAPSHFENGM  326

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNC+RT+P+   + +LEG  LE+Y  Q+ E+   +REG KKG+++RLLDTT++M+L
Sbjct  327   WNEGGNCLRTKPYRSNETRLEGIDLELYKIQIEEYRKGEREGRKKGLKYRLLDTTQAMLL  386

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGHW + N T   DCVHWC+PGPIDTW++FLL++LKME
Sbjct  387   RPDGHPSRYGHWPNANVTLYNDCVHWCLPGPIDTWSDFLLEMLKME  432



>ref|XP_006844210.1| hypothetical protein AMTR_s00006p00266030 [Amborella trichopoda]
 gb|ERN05885.1| hypothetical protein AMTR_s00006p00266030 [Amborella trichopoda]
Length=437

 Score =   406 bits (1043),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 192/389 (49%), Positives = 249/389 (64%), Gaps = 10/389 (3%)
 Frame = +3

Query  96    AVLPISTTLVIFATFCFTSY----NISDSLLQSFNLFPGG--ECNIFKGNWVPFPEGPYY  257
              ++P++  + I + F   S     NI+DS      +F      C+IF+G WVP P  PYY
Sbjct  43    TIIPLAFPIKIHSFFLINSSLWGNNITDSTANDLGVFKEAIRSCDIFRGEWVPDPRAPYY  102

Query  258   TNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSV  437
             TN T   I + QNCMK+GRPDTGF+KW+W+PD CEL  F+  +F E VRGK++AFVGDSV
Sbjct  103   TNTTCSAIHEHQNCMKYGRPDTGFMKWKWKPDECELTEFNPSEFFETVRGKSIAFVGDSV  162

Query  438   ARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWV  608
             ARN MQSL CLL+ V  PV  S   D    RW Y  +NFT+ +FWSP +VK+ +A PL  
Sbjct  163   ARNHMQSLICLLSRVEYPVDASIESDDRFKRWFYTTFNFTIAAFWSPFLVKSMEAVPLAA  222

Query  609   SPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKK  788
                 L NL+ D  D  W  ++   D VI SAG WFFR   +Y+ GK+VGC  C    I  
Sbjct  223   PMTRLFNLHLDTFDDNWIAQIEGFDYVIISAGHWFFRHIIFYEKGKVVGCSNCQHKNITD  282

Query  789   RNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQM  968
                Y+GY  AFRTAFK +   + F+G   LRTFSPAHFE G WN G NC+RT+P    + 
Sbjct  283   LGMYYGYRRAFRTAFKAINALQNFKGTTFLRTFSPAHFEGGLWNQGANCIRTKPLKSTET  342

Query  969   KLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKT  1148
             KLEG  +E+Y+TQ+ E   A+R G ++G +FR++DT+ +M++RPDGHP   GHW  EN T
Sbjct  343   KLEGTNMELYMTQIEELGDAERVGRERGHKFRVIDTSHAMLMRPDGHPGRLGHWGEENVT  402

Query  1149  T-ADCVHWCMPGPIDTWNEFLLQVLKMET  1232
                DCVHWC+PGPID+WN FLL++LK E 
Sbjct  403   LYTDCVHWCLPGPIDSWNSFLLEMLKEEV  431



>ref|XP_010262152.1| PREDICTED: protein trichome birefringence-like 19 [Nelumbo nucifera]
Length=429

 Score =   405 bits (1042),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/354 (54%), Positives = 243/354 (69%), Gaps = 4/354 (1%)
 Frame = +3

Query  171   LLQSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQP  350
             + QS  L    +C++F G W+P P+ P YTN+T   I D QNCMKFGRPDT ++KWRW+P
Sbjct  71    IQQSTGLPSSKQCDLFTGEWIPNPDAPSYTNSTCFTIHDEQNCMKFGRPDTEYMKWRWKP  130

Query  351   DRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGRWVY  530
             D CELP+F+  QF ELVRGK+MAFVGDS+ RNQM+SL CLL+SV  PV+       RW Y
Sbjct  131   DGCELPVFNPLQFFELVRGKSMAFVGDSIGRNQMESLMCLLSSVEQPVEYQTL---RWRY  187

Query  531   KEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQW  710
               YNFT+ + W+P IVK+K ADP      +L NLY DE D  W   + + D VI +A  W
Sbjct  188   PTYNFTIANVWAPFIVKSKAADPDGPVYTALFNLYLDEFDDDWIKVVVDFDYVILAAEHW  247

Query  711   FFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFS  890
             FFRP  +Y+ G++VGC+ C +  +   +  + Y  A+RTAF+ L   + F+G+  LRTFS
Sbjct  248   FFRPTMFYEKGQLVGCYLCRQENVTDLSSAYSYSKAYRTAFRALNSLQGFQGITFLRTFS  307

Query  891   PAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLL  1070
             P HFENG WN GG CVRTRP+   + +LEG  LEMYL Q  EF  A+REG K+G++FRLL
Sbjct  308   PQHFENGFWNEGGRCVRTRPYKSSETRLEGLPLEMYLAQTDEFKVAEREGRKRGLKFRLL  367

Query  1071  DTTESMVLRPDGHPNHYGHWAHENKT-TADCVHWCMPGPIDTWNEFLLQVLKME  1229
             D T + +LRPD HPN+YGHW  EN T   DC HWC+PG IDTWN+ LLQ++KME
Sbjct  368   DITFTSLLRPDAHPNNYGHWPRENVTFYNDCSHWCLPGAIDTWNDLLLQMMKME  421



>ref|XP_010100922.1| hypothetical protein L484_009692 [Morus notabilis]
 gb|EXB85846.1| hypothetical protein L484_009692 [Morus notabilis]
Length=427

 Score =   404 bits (1037),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 189/358 (53%), Positives = 248/358 (69%), Gaps = 8/358 (2%)
 Frame = +3

Query  174   LQSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPD  353
             L+  + +    C++F G WVP+ E PYYTN +   I D+QNCMKFGRPD  FL+WRW+PD
Sbjct  60    LKGKDQYSAKTCDVFNGTWVPYLEEPYYTNGSCPWIIDQQNCMKFGRPDQEFLQWRWKPD  119

Query  354   RCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG-----  518
              CELPLFD  +FLELVRGK++AF+GDSV RNQM SL CLL  VA P  VS+         
Sbjct  120   DCELPLFDAVEFLELVRGKSLAFLGDSVGRNQMNSLVCLLGKVAYPEDVSEKYYNNTEYF  179

Query  519   -RWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIF  695
              R++Y EYNFT+   W+P +VK ++ DP   S +S MNLY DEP+  W+ E+   D VI 
Sbjct  180   KRFIYPEYNFTIGVLWAPFLVKTRETDPKVYSGNSRMNLYLDEPNEGWSTEVEKFDYVIV  239

Query  696   SAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVI  875
             SAGQWFFRP   ++ G+++GC +C E  I +   ++ Y  AFRT F+TLL  E ++G+  
Sbjct  240   SAGQWFFRPLMLHEGGRLIGCSKCMEKNITELTPHYIYRRAFRTVFRTLLGLELYKGVTF  299

Query  876   LRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTL--EMYLTQVREFMAAKREGSKK  1049
             +RTFS AHFENG WN GG+C R+RPF + +++   Y    +M   QV EF AA+  G +K
Sbjct  300   MRTFSTAHFENGAWNDGGSCERSRPFGRGEVEKATYQYIWDMNSIQVEEFRAAEELGKQK  359

Query  1050  GVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             G++FR++DTTE+M +RPDGHPN YGH  H N T ADCVHWC+PGPIDTWNEFL+ +L+
Sbjct  360   GLQFRMMDTTEAMFMRPDGHPNFYGHSPHRNMTIADCVHWCLPGPIDTWNEFLMYILR  417



>ref|XP_010257817.1| PREDICTED: protein trichome birefringence-like 19 [Nelumbo nucifera]
Length=439

 Score =   404 bits (1038),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 189/347 (54%), Positives = 246/347 (71%), Gaps = 5/347 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G WVP PE PYYTN +   I + QNCMK+GRPDT F+KWRW+P+ CELP+F+  
Sbjct  80    QCDIFTGEWVPNPEAPYYTNLSCWAIHEHQNCMKYGRPDTEFMKWRWKPNDCELPIFNPA  139

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             +FL+LV GK++AFVGDSVARNQMQSL CLL+ V  PV VS   D    RW Y  YNFT+ 
Sbjct  140   KFLQLVTGKSLAFVGDSVARNQMQSLICLLSRVEYPVDVSYTADEHFKRWKYMSYNFTIA  199

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             SFW+P +VKA++ +    +   L NLY DE +  W  ++ + D +I SAG WFFRP  YY
Sbjct  200   SFWTPFLVKAEETEADGPTKTGLFNLYLDEFNPEWTTQIDDFDYLIISAGHWFFRPGMYY  259

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             + G++VGC  C    +      +GY  A  TA + +   E F+G+ ILRTF+P+HFENG 
Sbjct  260   EKGQLVGCRYCLIENVTDLPMSYGYRKAIHTALRAINSLESFKGVTILRTFAPSHFENGL  319

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREF-MAAKREGSKKGVRFRLLDTTESMV  1091
             WN GGNC+R RP+  ++ +L+G  LE+Y  QV EF +AA+R G + G++FRLLDTT++ +
Sbjct  320   WNQGGNCLRRRPYRSKEKRLDGTDLELYRIQVEEFKVAAERGGKRGGLKFRLLDTTQASL  379

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+ YGHW HEN T   DCVHWC+PGPIDTWN+FLL +LKME
Sbjct  380   LRPDGHPSRYGHWPHENVTLYNDCVHWCLPGPIDTWNDFLLDMLKME  426



>ref|XP_009775178.1| PREDICTED: LOW QUALITY PROTEIN: protein trichome birefringence-like 
19 [Nicotiana sylvestris]
Length=402

 Score =   401 bits (1031),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 246/346 (71%), Gaps = 4/346 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF+G W+P P+GPYYTN T  +I + QNCMK+GRPDT FLKWRW+P  CELP+F+  
Sbjct  53    KCDIFRGEWIPNPDGPYYTNTTCGEIHEHQNCMKYGRPDTDFLKWRWKPKGCELPIFNPH  112

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFL+++R K++AFVGDSV RNQMQSL CLL+ V  P+ +S   D    RW YK YNFTL 
Sbjct  113   QFLDMMRNKSLAFVGDSVGRNQMQSLICLLSRVEHPIDISSTPDFNFKRWKYKTYNFTLA  172

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             ++WSP +VK ++AD      D + N+Y DEPD+ W  ++   + VI ++G WF R   YY
Sbjct  173   TYWSPFLVKMEEADSDGPRHDGVFNIYLDEPDKKWTSQIKEFNYVILNSGHWFSRLSVYY  232

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +  ++VGC RC    I +  +Y+GY   F+TA K + + E F+G + +RTF+P+HFE GE
Sbjct  233   EKNQVVGCWRCGLPNITELPNYYGYERVFKTALKAINNLENFKGTIFVRTFAPSHFEGGE  292

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN+GGNC+R  PFT+ +  LEG  LE Y +QV EF  A++EG  KG  F+LLD T++M+L
Sbjct  293   WNTGGNCLRKSPFTRTEKVLEGLNLEFYKSQVEEFWVAEKEGKIKGKNFKLLDITQAMLL  352

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGH  +E+     DCVHWC+PGPID+WN+FLL +LK+E
Sbjct  353   RPDGHPSRYGHLPNESVVLYNDCVHWCLPGPIDSWNDFLLHMLKIE  398



>ref|XP_011099297.1| PREDICTED: protein trichome birefringence-like 19 [Sesamum indicum]
Length=430

 Score =   402 bits (1033),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 188/347 (54%), Positives = 243/347 (70%), Gaps = 7/347 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G WVP PE PYYTN T   I + QNCMK+GRPD+GF+KWRW+PD C+LP+F+  
Sbjct  71    KCDIFTGEWVPNPEAPYYTNKTCWAIHEHQNCMKYGRPDSGFMKWRWKPDGCDLPVFNPY  130

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFL++VRGK+MAFVGDSV RNQMQS+ CLL+ V  P+ VS   D    RW Y+ YNFT  
Sbjct  131   QFLDMVRGKSMAFVGDSVGRNQMQSMICLLSRVEYPIDVSPTPDERFKRWRYETYNFTFG  190

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              FWSP +V++++ D    +   L NL+ D+ D+ W  ++ + D VI +AG WF RP  YY
Sbjct  191   YFWSPFLVRSENRDSDGPTHTGLFNLHLDDFDQSWTTQIDDFDYVILNAGHWFTRPAVYY  250

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N  IVGC  C    I      +GY   FRTAFK +   E F+G+  LRTF+P+HFENG 
Sbjct  251   ENSHIVGCRFCQLPNITDLQMTYGYRRVFRTAFKAINARENFKGVTFLRTFAPSHFENGL  310

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNC+R RPF   +  LEG  L++Y+ Q+ EF AA++EG KK   FRLLDTT++M+L
Sbjct  311   WNEGGNCLRQRPFRSNETLLEGLNLDLYMIQLEEFRAAQKEGKKK---FRLLDTTQAMLL  367

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             RPDGHP+ YGHW +EN T   DCVHWC+PGPID+W +FLL ++KME 
Sbjct  368   RPDGHPSRYGHWPNENVTLYNDCVHWCLPGPIDSWADFLLHMIKMEA  414



>gb|KHN14479.1| hypothetical protein glysoja_029741 [Glycine soja]
Length=443

 Score =   402 bits (1033),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 186/346 (54%), Positives = 246/346 (71%), Gaps = 4/346 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G WVP P+ PYYTN T   I + QNCMK+GRPD+ F+KW+W+P+ C+LP+F+  
Sbjct  84    KCDIFTGEWVPNPKAPYYTNKTCWAIHEHQNCMKYGRPDSEFMKWKWKPNGCDLPVFNPF  143

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLE++RGK+MAFVGDSV RNQMQS+ CLL+ V  P+ VS   D    RW Y  YNFT+ 
Sbjct  144   QFLEIMRGKSMAFVGDSVGRNQMQSMICLLSRVEWPIDVSYKRDDYFMRWRYPSYNFTMA  203

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             +FW+ H+V++K+AD     P  L NLY DEPD  W  ++ + D VI + G WF R   +Y
Sbjct  204   AFWTTHLVRSKEADAKGPGPTGLCNLYLDEPDEKWITQVEDFDYVILNGGHWFTRSMVFY  263

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +  KIVGCH C +  +     Y+GY  AFRTAF+ +   E F+G V LRTF+P+HFENG 
Sbjct  264   EKQKIVGCHYCLQENVPDLTMYYGYRKAFRTAFRAINRLENFKGTVFLRTFAPSHFENGL  323

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNC+RT+PF   + +LEG  LE Y+ Q+ EF  A++E  KKG+++RL D T++ +L
Sbjct  324   WNEGGNCIRTKPFKSNETQLEGLNLEFYMIQLEEFKIAEKEAKKKGLKYRLFDITQASLL  383

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGHW +EN T   DCVHWC+PGPIDTW++FLL +LKME
Sbjct  384   RPDGHPSRYGHWLNENVTLYNDCVHWCLPGPIDTWSDFLLGMLKME  429



>ref|XP_009801267.1| PREDICTED: protein trichome birefringence-like 19 [Nicotiana 
sylvestris]
Length=534

 Score =   405 bits (1040),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/344 (54%), Positives = 238/344 (69%), Gaps = 5/344 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WV  PEGPYYTN T   I+  QNCMKFGRPD G LKWRWQPD CELP+FD  Q
Sbjct  186   CDLFSGEWVENPEGPYYTNETCYAIQQHQNCMKFGRPDNGHLKWRWQPDGCELPIFDPVQ  245

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG--RWVYKEYNFTLLSF  560
             FLELV+GK++AFVGDSVARN MQSL CLL+ V  P  VS+      RW+YK+Y+F +  F
Sbjct  246   FLELVKGKSLAFVGDSVARNHMQSLICLLSRVVYPEDVSETQDENRRWIYKDYDFNISMF  305

Query  561   WSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKN  740
             W+P++VK +  DP  VS     NLY DE D  W +++   D VI SAG WFFRP  +Y N
Sbjct  306   WAPYLVKTEKTDPDDVS--KPFNLYLDEFDEFWTNQIQGFDYVIISAGHWFFRPTMFYLN  363

Query  741   GKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWN  920
              ++VGC  C +  +     YF Y  AFRTAF+ +   E ++G+  LRTF+P+HFENG W+
Sbjct  364   RRLVGCLYCPQANVSHVTSYFSYRRAFRTAFRAINSLENYKGVTFLRTFAPSHFENGYWD  423

Query  921   SGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRP  1100
              GG+CVRT+PF + +  L+ Y LE Y  Q+ E   A+R G + G++FRL D T+ M+LRP
Sbjct  424   KGGDCVRTKPFKRNEKVLDDYNLEFYKIQLDELKIAQRAGRRTGLKFRLFDATQPMLLRP  483

Query  1101  DGHPNHYGHWAHENKTTA-DCVHWCMPGPIDTWNEFLLQVLKME  1229
             DGHP+ YG W + N T   DCVHWC+PGPIDTWN+FL+Q+LK E
Sbjct  484   DGHPSKYGRWPNPNVTVPNDCVHWCLPGPIDTWNDFLVQLLKRE  527



>ref|XP_010692278.1| PREDICTED: protein trichome birefringence-like 19 [Beta vulgaris 
subsp. vulgaris]
Length=444

 Score =   401 bits (1030),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 243/346 (70%), Gaps = 4/346 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G WVP PEGPYYTN +   I + QNCMK+GRPD+ F+KWRW+PD CELP+F+ R
Sbjct  80    KCDLFAGEWVPNPEGPYYTNTSCWAIHEHQNCMKYGRPDSEFMKWRWKPDGCELPIFNPR  139

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QF E+VRGK++AF+GDSVARNQMQSL CLL+ V  P  VS   D    RW Y  YNFT+ 
Sbjct  140   QFFEIVRGKSLAFIGDSVARNQMQSLICLLSRVEYPYDVSYTKDEHFKRWHYNNYNFTIA  199

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              F S  +VKA++ DP   +   +  L+ DE D  WA ++   D ++ SAG WFFRP  YY
Sbjct  200   MFTSTFLVKAQENDPNGPTGTGMFGLHLDEVDETWATQIDEFDYIMLSAGHWFFRPLMYY  259

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             + G ++GC  C    +      +GY  AFRTAF+ +L+ E F+G+  LRTF+P+HFE G 
Sbjct  260   EKGSLIGCRFCQIPNVTDYTMAYGYRKAFRTAFRAILERENFKGVAYLRTFAPSHFEGGV  319

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNC+R +PF   ++ L+G  L++Y+ Q+ EF  A++ G +KG RFRL+D T+++++
Sbjct  320   WNEGGNCLRKKPFKSSEINLQGVDLDLYMAQLGEFKVAQKLGRQKGQRFRLIDLTQTILM  379

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGHW +E  T   DCVHWC+PGPIDTWN+FLL++++ E
Sbjct  380   RPDGHPSSYGHWPNEKVTLYNDCVHWCLPGPIDTWNDFLLEMIRSE  425



>ref|XP_009594677.1| PREDICTED: protein trichome birefringence-like 19 [Nicotiana 
tomentosiformis]
Length=463

 Score =   401 bits (1031),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 242/348 (70%), Gaps = 6/348 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WV   EGPYYTN T   I++ QNCMK+GRPDTGFL W+W+PD CELP+FD RQ
Sbjct  117   CDLFSGEWVANTEGPYYTNMTCFQIQEHQNCMKYGRPDTGFLMWKWKPDDCELPIFDPRQ  176

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FLELVR K++AFVGDSVARN MQSL CLL+    PV VS   D    RW Y++YNF +  
Sbjct  177   FLELVRDKSLAFVGDSVARNHMQSLICLLSRAVYPVDVSNTTDLENKRWEYRDYNFNMSM  236

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FW+P++V+A+  +P  +      NLY DEPD  W  ++ + D VI SAG WFFRP  +Y 
Sbjct  237   FWAPYLVRAEKTEPNNIY--QPFNLYLDEPDESWTTKIQSFDYVIISAGHWFFRPTMFYL  294

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             N  ++GC  C++  + +   YF Y  AF+TAF+ +   E ++G+  LRTF+P+HFE+G W
Sbjct  295   NHSLIGCLFCSQANVSQLTSYFSYQRAFQTAFRAINSLENYKGVTFLRTFAPSHFEDGVW  354

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             + GG+CVRT PF + +  L+ Y L+ Y  Q++E   A++EG  +G++FRL D T++M+LR
Sbjct  355   DKGGDCVRTVPFKRNEKVLDEYNLDFYKIQLQELEVAQKEGENRGLKFRLFDATQAMLLR  414

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKMETPE  1238
              DGHP+ YGHW + N T   DCVHWC+PGPID WN+FLLQ+LK E  +
Sbjct  415   ADGHPSKYGHWQNPNVTVRKDCVHWCLPGPIDVWNDFLLQLLKREVTD  462



>emb|CDP19314.1| unnamed protein product [Coffea canephora]
Length=428

 Score =   398 bits (1023),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/349 (53%), Positives = 244/349 (70%), Gaps = 8/349 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G W+P P+ PYYTN+T   I + QNCMK+GRPD  F+KWRW+PD CELP+F+  
Sbjct  68    KCDIFTGKWIPNPKAPYYTNSTCWAIHEYQNCMKYGRPDDEFMKWRWKPDACELPIFNPN  127

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVK---VSDAAVGRWVYKEYNFTLL  554
             +FL++V+GK+MAF+GDS+ RN MQSL CLL+ V  P+    V D    RW Y   NFTL 
Sbjct  128   EFLDIVKGKSMAFLGDSLGRNHMQSLICLLSKVETPIDASYVEDDHYRRWNYTSRNFTLA  187

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             + WSP +VK+  A+     PD   NLY DE D  WA ++   D VI ++G WF+RP FYY
Sbjct  188   ALWSPFLVKSGKAN---TGPDHY-NLYLDEVDWNWASKIEEFDYVILNSGNWFYRPSFYY  243

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N + VGC  C    +   +  +GY  A +TAF TL   + ++G+  LRTF P+H+ENG 
Sbjct  244   ENHQFVGCSSCQMDNVTDLSMTYGYRKALKTAFGTLKSLKNYKGITFLRTFPPSHYENGN  303

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN+GGNC+R  P+ K ++ LEG  LE+YLT+V EF AA++E  +KG+RFRL DTT++M+L
Sbjct  304   WNAGGNCLRKVPYMKNEISLEGTQLEIYLTEVEEFKAAEKEWEEKGLRFRLFDTTQAMLL  363

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKMETPE  1238
             RPDGHP+ YGHW  EN T   DCVHWC+PGPID+WN+FLL +LKME  E
Sbjct  364   RPDGHPSKYGHWPKENVTLYNDCVHWCLPGPIDSWNDFLLHMLKMEGKE  412



>ref|XP_006338761.1| PREDICTED: uncharacterized protein LOC102597459 [Solanum tuberosum]
Length=532

 Score =   400 bits (1027),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 182/345 (53%), Positives = 239/345 (69%), Gaps = 5/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WV  PEGPYYTN T   I+  QNC+KF RPD+ FLKWRW+PD CELP+FD  Q
Sbjct  188   CDLFSGEWVKNPEGPYYTNDTCYAIQQHQNCLKFERPDSDFLKWRWKPDACELPIFDPTQ  247

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG--RWVYKEYNFTLLSF  560
             FLE VRGK++AFVGDSVARN MQSL CLL+ V  P  VS+      RW+YK+Y+F +  F
Sbjct  248   FLEFVRGKSLAFVGDSVARNHMQSLICLLSKVVYPEDVSETQDENRRWIYKDYDFNISMF  307

Query  561   WSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKN  740
             W+P++VK +  DP  V+     NLY DE D  W +++   D VI SAG WFFRP  +Y N
Sbjct  308   WAPYLVKTEKTDPNDVT--QPFNLYLDEFDEFWTNQIQGFDYVIISAGHWFFRPTMFYLN  365

Query  741   GKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWN  920
              ++VGC  C ++ +     YF Y  AFRTAF+ +   E ++G+  LRTF+P+HFENG W+
Sbjct  366   RRLVGCLYCPQSNVNHVTSYFSYRRAFRTAFRAINSLENYKGVTFLRTFAPSHFENGPWD  425

Query  921   SGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRP  1100
              GG+C RT+PF + + KLEGY LE Y  Q+ E   A+R G ++G++FRL D T+ M+LRP
Sbjct  426   KGGDCARTKPFKRNEKKLEGYNLEFYKIQLDELKIAQRAGRRRGLKFRLFDATQPMLLRP  485

Query  1101  DGHPNHYGHWAHENKTTA-DCVHWCMPGPIDTWNEFLLQVLKMET  1232
             DGHP+ YG + + N T   DCVHWC+PGPID WN+FL+++LK E 
Sbjct  486   DGHPSKYGRYTNPNVTVPNDCVHWCLPGPIDAWNDFLVELLKREV  530



>ref|XP_006400116.1| hypothetical protein EUTSA_v10013629mg [Eutrema salsugineum]
 gb|ESQ41569.1| hypothetical protein EUTSA_v10013629mg [Eutrema salsugineum]
Length=427

 Score =   396 bits (1018),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 190/347 (55%), Positives = 234/347 (67%), Gaps = 7/347 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCE--LPLFDG  380
             C+IF G WVP PE PYYTN T   I + QNCMKFGRPDT F+KW+W+PDRCE  LP+FD 
Sbjct  67    CDIFSGEWVPNPEAPYYTNTTCWAIHEHQNCMKFGRPDTDFIKWKWKPDRCEDGLPVFDP  126

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTL  551
              +FLE+VRGKTMAFVGDSV+RN MQSL CLL+ V  PV  S   D    RW Y+ YNFT+
Sbjct  127   FRFLEIVRGKTMAFVGDSVSRNHMQSLICLLSQVEYPVDASVKADEYFKRWTYETYNFTI  186

Query  552   LSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
              +FW+ H+VK+    P       L NL+ DE D  W  E+ + D VI S+G W FRP  Y
Sbjct  187   AAFWTTHLVKSTGPVPTQPDHTDLFNLHLDEADESWTGEIGDFDYVIISSGHWHFRPSVY  246

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+N  + GCH C    I     ++GY  AFRTAFK +LD EKF G++ LRTF+P+HFE G
Sbjct  247   YENQTLTGCHYCQLPNITDLTMFYGYRKAFRTAFKAILDSEKFEGVMYLRTFAPSHFEGG  306

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              WN GGNC+R RP+   + + E  T+ ++  Q+ EF  A+ E  KKG R RLLDTT++M 
Sbjct  307   LWNEGGNCLRKRPYQSNKTQDE-VTMRLHKIQLEEFGRAEEEAKKKGKRLRLLDTTQAMW  365

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+HYGH    N T   DCVHWC+PGPID  N+FLL +LK E
Sbjct  366   LRPDGHPSHYGHLPEANVTLYNDCVHWCLPGPIDNLNDFLLAMLKRE  412



>ref|XP_009623245.1| PREDICTED: protein trichome birefringence-like 19 [Nicotiana 
tomentosiformis]
Length=567

 Score =   400 bits (1029),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/345 (53%), Positives = 237/345 (69%), Gaps = 5/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             CN+F G WV  PEGPYYTN T   I+  QNCMKFGRPD G+LKWRWQPD CELP+FD  Q
Sbjct  223   CNLFSGEWVENPEGPYYTNETCYAIQQHQNCMKFGRPDNGYLKWRWQPDACELPIFDPIQ  282

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG--RWVYKEYNFTLLSF  560
             FLELV+GK++AFVGDSVARN MQSL CLL+ V  P  +S+      RW+YK+Y+F +  F
Sbjct  283   FLELVKGKSLAFVGDSVARNHMQSLICLLSRVVYPEDISETQDENRRWIYKDYDFNISMF  342

Query  561   WSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKN  740
             W+P++VK +  D   V+     NLY DE D  W   + + D VI SAG WFFRP  +Y N
Sbjct  343   WAPYLVKTEKTDLNDVT--KPFNLYLDEFDEFWTTGIQSFDYVIISAGHWFFRPTMFYLN  400

Query  741   GKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWN  920
              ++VGC  C +  +     YF Y  AFRTAF+ +  +E ++G+  LRTF+P+HFENG W+
Sbjct  401   RRLVGCLYCPQANVSHVTSYFSYRRAFRTAFRAINSNENYKGVTFLRTFAPSHFENGYWD  460

Query  921   SGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRP  1100
              GG+CVRT+P  + +  L+ Y LE Y  Q+ E   A+R G + G+RFRL D T+ M+LRP
Sbjct  461   KGGDCVRTKPLKRNEKVLDDYNLEFYKVQLDELKIAQRAGRRTGLRFRLFDATQPMLLRP  520

Query  1101  DGHPNHYGHWAHENKTTA-DCVHWCMPGPIDTWNEFLLQVLKMET  1232
             DGHP+ YG W + N T   DCVHWC+PGPIDTWN+FL+++LK E 
Sbjct  521   DGHPSKYGRWPNPNVTVPNDCVHWCLPGPIDTWNDFLVELLKREV  565



>ref|XP_009395269.1| PREDICTED: protein trichome birefringence-like 19 [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   397 bits (1019),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/345 (56%), Positives = 239/345 (69%), Gaps = 4/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF+G WVP P  PYYTN T   I + QNCMKFGRPDT FLKWRW+P+ C+LP+F+  Q
Sbjct  108   CDIFRGEWVPNPNAPYYTNETCWAIHEHQNCMKFGRPDTEFLKWRWKPNDCDLPIFNPAQ  167

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FLELVRGK++AFVGDSV RNQMQSL CLL  V   V  S   D    R+ +  +NFT+ S
Sbjct  168   FLELVRGKSLAFVGDSVGRNQMQSLICLLLRVTYAVDASVTEDEKFRRYHFPTHNFTVAS  227

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP +V+A +ADP   +   L NL+ D+ D  W  +M   D VI SAG WFFRP  +++
Sbjct  228   FWSPFLVRAHEADPNGPTLTGLFNLHLDQVDTNWTTQMTPFDYVIVSAGHWFFRPTMFFE  287

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
               ++VGCH C    +     Y+ Y  AFR A +   D   FRG V LRTF+P+HFENGEW
Sbjct  288   ADQLVGCHYCLHPNVTDLTMYYSYRRAFRAALRAFNDLPGFRGTVFLRTFAPSHFENGEW  347

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GGNCVR RPF   + +++GY LEMY+ Q+ E+ AA+ EG +KGVRFRLLDTTE+M+LR
Sbjct  348   NKGGNCVRQRPFRSNETRMDGYNLEMYMAQLEEYRAAEGEGKEKGVRFRLLDTTEAMLLR  407

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP  +GH   EN T   DCVHWC+PGPID WN+FLL +LK E
Sbjct  408   PDGHPGRFGHRPDENVTLYNDCVHWCLPGPIDNWNDFLLHMLKNE  452



>ref|XP_004233652.1| PREDICTED: protein trichome birefringence-like 19 [Solanum lycopersicum]
Length=531

 Score =   399 bits (1024),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/345 (53%), Positives = 237/345 (69%), Gaps = 5/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WV  PEGPYYTN T   I+  QNC+KF RPDT FLKWRW+PD CELP+F+  Q
Sbjct  187   CDLFSGEWVKNPEGPYYTNDTCYAIQQHQNCLKFERPDTDFLKWRWKPDACELPIFNPTQ  246

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG--RWVYKEYNFTLLSF  560
             FLE VRGK++AFVGDSVARN MQSL CLL+ V  P  VS+      RW+YK+Y+F +  F
Sbjct  247   FLEFVRGKSLAFVGDSVARNHMQSLICLLSKVVYPEDVSETQDENRRWIYKDYDFNISMF  306

Query  561   WSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKN  740
             W+P++VK +  DP  V+     NLY DE D  W  ++   D V+ SAG WFFRP  +Y N
Sbjct  307   WAPYLVKTEKTDPNDVT--QPFNLYLDEFDEFWTKQIQGFDYVVISAGHWFFRPTMFYIN  364

Query  741   GKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWN  920
              ++VGC  C ++ +     YF Y  AFRTAF+ +   E F+G+  LRTF+P+HFENG W+
Sbjct  365   RRLVGCLYCPQSNVNHVTSYFSYRRAFRTAFRAINSLESFKGVTFLRTFAPSHFENGPWD  424

Query  921   SGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRP  1100
              GG+C RT+PF + + KLEGY LE Y  Q+ E   A+R G ++G++FRL D T+ M+LRP
Sbjct  425   KGGDCARTKPFKRNEKKLEGYNLEFYKIQLDELKIAQRTGRRRGLKFRLFDATQPMLLRP  484

Query  1101  DGHPNHYGHWAHENKTTA-DCVHWCMPGPIDTWNEFLLQVLKMET  1232
             DGHP+ YG +   N T   DCVHWC+PGPID WN+FL+++LK E 
Sbjct  485   DGHPSKYGRYTDPNVTVPNDCVHWCLPGPIDAWNDFLVELLKREV  529



>emb|CDY34729.1| BnaA01g32960D [Brassica napus]
Length=481

 Score =   396 bits (1018),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/349 (53%), Positives = 240/349 (69%), Gaps = 11/349 (3%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WVP PE PYYTN T   I + QNCMK+GRPD GFLKWRW+P  C+LPLFD  +
Sbjct  135   CDLFSGEWVPNPEAPYYTNTTCWAIHEHQNCMKYGRPDLGFLKWRWKPKECDLPLFDPYE  194

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYKEYNFTL  551
             FLE+VRGK MAFVGDSV RN +QSL CLL+ V +P   S     D    RW YK YNFT+
Sbjct  195   FLEIVRGKNMAFVGDSVNRNHVQSLICLLSRVEEPEDDSRQQDFDFNFQRWKYKTYNFTI  254

Query  552   LSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
              +FW+ H+V++++  P    P+S  NLY DEPD  WA ++A  D +I S+GQWFFRP F 
Sbjct  255   ATFWTTHLVRSEENGP--AGPNSFYNLYLDEPDPSWASQVAEFDYIIISSGQWFFRPLFL  312

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y   K++GC  C    ++    +F Y  A RT FKT++    F+G V LRTF+P+HFE G
Sbjct  313   YDKQKMIGCLYCYIPGVRNVGAHFAYRRALRTTFKTIIGLANFKGEVFLRTFAPSHFEKG  372

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKK-GVRFRLLDTTESM  1088
             EW+ GGNC+RTRPF   + +LEG  LE +  Q+ EF  AKR+ +K  G+  RLLD T+ M
Sbjct  373   EWDKGGNCLRTRPFRSNETELEGMNLETHTIQLDEFRIAKRDKNKSNGLSLRLLDVTQMM  432

Query  1089  VLRPDGHPNHYGHWAHENKTTA--DCVHWCMPGPIDTWNEFLLQVLKME  1229
             +LRPDGHP+ +GH   E+K     DCVHWC+PGPID+WN+FLL++LK+E
Sbjct  433   LLRPDGHPSRFGH-KPEDKVILYNDCVHWCLPGPIDSWNDFLLEMLKIE  480



>ref|XP_009118032.1| PREDICTED: protein trichome birefringence-like 20 [Brassica rapa]
Length=481

 Score =   396 bits (1017),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 186/349 (53%), Positives = 240/349 (69%), Gaps = 11/349 (3%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WVP PE PYYTN T   I + QNCMK+GRPD GFLKWRW+P  C+LPLFD  +
Sbjct  135   CDLFSGEWVPNPEAPYYTNTTCWAIHEHQNCMKYGRPDLGFLKWRWKPKECDLPLFDPYE  194

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYKEYNFTL  551
             FLE+VRGK MAFVGDSV RN +QSL CLL+ V +P   S     D    RW YK YNFT+
Sbjct  195   FLEIVRGKNMAFVGDSVNRNHVQSLICLLSRVEEPEDDSRQQDFDFNFQRWKYKTYNFTI  254

Query  552   LSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
              +FW+ H+V++++  P    P+S  NLY DEPD  WA ++A  D +I S+GQWFFRP F 
Sbjct  255   ATFWTTHLVRSEENGP--AGPNSFYNLYLDEPDPSWASQVAEFDYIIISSGQWFFRPLFL  312

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y   K++GC  C    ++    +F Y  A RT FKT++    F+G V LRTF+P+HFE G
Sbjct  313   YDKQKMIGCLYCYIPGVRNVGAHFAYRRALRTTFKTIIGLANFKGEVFLRTFAPSHFEKG  372

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKK-GVRFRLLDTTESM  1088
             EW+ GGNC+RTRPF   + +LEG  LE +  Q+ EF  AKR+ +K  G+  RLLD T+ M
Sbjct  373   EWDKGGNCLRTRPFRSNETELEGMNLETHTIQLDEFRIAKRDKNKSNGLSLRLLDVTQMM  432

Query  1089  VLRPDGHPNHYGHWAHENKTTA--DCVHWCMPGPIDTWNEFLLQVLKME  1229
             +LRPDGHP+ +GH   E+K     DCVHWC+PGPID+WN+FLL++LK+E
Sbjct  433   LLRPDGHPSRFGH-KPEDKVILYNDCVHWCLPGPIDSWNDFLLEMLKIE  480



>ref|XP_009605806.1| PREDICTED: protein trichome birefringence-like 19 [Nicotiana 
tomentosiformis]
Length=433

 Score =   393 bits (1010),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/345 (54%), Positives = 239/345 (69%), Gaps = 4/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IFKG W+P P+GPYYTN T   I + QNCMK+GRPDT FLKWRW+P  CELP+F+  Q
Sbjct  73    CDIFKGEWIPNPDGPYYTNTTCWAIHEHQNCMKYGRPDTDFLKWRWKPKGCELPIFNPYQ  132

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FL+++R K++AFVGDSV RNQMQSL CLL+    P+ VS   D    RW Y  YNFTL +
Sbjct  133   FLDMMRNKSLAFVGDSVGRNQMQSLICLLSQAVYPIDVSTTPDENFKRWKYTSYNFTLAT  192

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             +WSP +VK KD D    +   L NLY DE D  W +++   D VI +AG WF R   YY+
Sbjct  193   YWSPFLVKMKDTDSDGPTKTGLFNLYLDEVDEKWGNQIEEFDYVILNAGHWFTRCSVYYE  252

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
               ++VGC  C    +      +GY  A RT  KT+ + E F+G+  LRTF+P+HFE GEW
Sbjct  253   KNQLVGCRYCELPNVTDLPSSYGYQRAIRTVLKTINNLENFKGITFLRTFAPSHFEGGEW  312

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GGNCVR +PF+  +  LEG+ L++Y  QV EF AA++E  KKG R RLLDTT++M+LR
Sbjct  313   NKGGNCVRRKPFSSNETTLEGFHLDLYTIQVEEFKAAEKESKKKGKRLRLLDTTQAMLLR  372

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGHW +EN     DCVHWC+PGPID+W++FLL +LK+E
Sbjct  373   PDGHPSRYGHWPNENVVLYNDCVHWCLPGPIDSWSDFLLHMLKLE  417



>ref|XP_006365644.1| PREDICTED: uncharacterized protein LOC102595520 [Solanum tuberosum]
Length=450

 Score =   394 bits (1011),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 242/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G WV   E PYYTN T   I++ QNCMK+GRPDT FLKW+W+PDRCELP+FD  
Sbjct  103   KCDLFSGEWVENQEAPYYTNKTCFTIQEHQNCMKYGRPDTDFLKWKWKPDRCELPIFDAH  162

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLE VRGK++AFVGDSVARN MQSL CLL+ V  P+ VS   D    RW Y++YNF + 
Sbjct  163   QFLEFVRGKSLAFVGDSVARNHMQSLICLLSKVVYPIDVSNSTDQENRRWEYRDYNFNMS  222

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              FW+P++VKA   +P  +      NLY DEPD  W+ ++ + D VI S+G WF RP  +Y
Sbjct  223   IFWAPYLVKANKTEPNNIY--QPFNLYLDEPDESWSTKIQDFDYVIISSGHWFSRPTMFY  280

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
              N  ++GC  C++  + +   +F Y  AF TAF+ + + + ++G+  LRTF+P+HFE+G 
Sbjct  281   LNHTLIGCLFCSQPNVSQMTSFFSYQKAFHTAFQAINNLKNYKGVTFLRTFAPSHFEDGV  340

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             W+ GG+CVRT PF + +  L+ Y+LE Y  Q++E M A+++G  + ++FRL D T++M+L
Sbjct  341   WDKGGDCVRTTPFKRNEKVLDDYSLEFYKIQLQELMVAQKQGKMRNLKFRLFDATQAMLL  400

Query  1095  RPDGHPNHYGHWAHENKT-TADCVHWCMPGPIDTWNEFLLQVLKME  1229
             R DGHP+ YGHW   N T + DCVHWC+PGPID WN+FLL+++K E
Sbjct  401   RADGHPSKYGHWPKPNVTFSNDCVHWCLPGPIDVWNDFLLELMKRE  446



>ref|XP_011099299.1| PREDICTED: protein trichome birefringence-like 19 [Sesamum indicum]
Length=468

 Score =   394 bits (1012),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/346 (54%), Positives = 241/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G WVP P+GPYYTNAT   I+D QNCMK+GRPDTGFLKWRW+PD C+LP+FD  
Sbjct  124   KCDLFTGEWVPNPQGPYYTNATCDAIQDHQNCMKYGRPDTGFLKWRWKPDGCDLPIFDPH  183

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA--VGRWVYKEYNFTLLS  557
             QFLELV+GK++AFVGDSVARNQMQSL CLL+ VA P  +S       R+ Y E++F +  
Sbjct  184   QFLELVQGKSLAFVGDSVARNQMQSLICLLSRVAYPEDLSAPTDQNKRYQYTEHDFNISM  243

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP++VK    DP    P    +LY DE D  W  ++A  D +I SAG WFFRP ++Y 
Sbjct  244   FWSPYLVKTGKLDPNEKRP---FDLYLDEFDPHWTTKIALFDYLIISAGHWFFRPTYFYV  300

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             N + +GC  C E+ I      F Y  AFRTAF+ +     F+G+  LRTF+P+HFE G W
Sbjct  301   NNRRMGCLYCPESNISHMTSVFSYRRAFRTAFRAINGAVNFKGVTFLRTFAPSHFEGGPW  360

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             + GGNCVR RPF +++  L  ++LEMYL Q+ E   A+R G + G +FRL D T+ M+LR
Sbjct  361   DKGGNCVRKRPFKRKETSLRDFSLEMYLIQLEELKIARRAGRRNGGKFRLFDATKPMLLR  420

Query  1098  PDGHPNHYGHWAHENKTTA-DCVHWCMPGPIDTWNEFLLQVLKMET  1232
             PDGHP+ YG+W   N+T A DCVHWC+PGPID+WN+FL ++LK E 
Sbjct  421   PDGHPSKYGNWPVANQTFANDCVHWCLPGPIDSWNDFLQELLKREN  466



>ref|XP_006300170.1| hypothetical protein CARUB_v10016401mg [Capsella rubella]
 gb|EOA33068.1| hypothetical protein CARUB_v10016401mg [Capsella rubella]
Length=452

 Score =   392 bits (1008),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 240/346 (69%), Gaps = 7/346 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             EC+IF G W+P PE PYYTN T   I + QNC+K+GRPD GF+KWRW+P  C+LPLFD  
Sbjct  100   ECDIFSGEWIPNPEAPYYTNTTCRAIHEHQNCIKYGRPDLGFMKWRWKPKECDLPLFDPS  159

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADP---VKVSDAAVGRWVYKEYNFTLL  554
             +FLE+VRGK+MAFVGDSV+RN +QSL CLL+ V DP    +  D    RW+YK YNFT+ 
Sbjct  160   EFLEMVRGKSMAFVGDSVSRNHVQSLICLLSQVEDPEDDSRQQDFNFQRWIYKTYNFTIA  219

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             +FW+ H+V++++ +     P+S  NLY DEP   WA ++   D VI S+GQWFFRP F +
Sbjct  220   TFWTTHLVRSEETETGPAGPNSFYNLYLDEPAPSWASQIVEFDYVIISSGQWFFRPLFLF  279

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
                K +GC  C    ++    +F Y  A RT FKT+L  E F+G V LRTF+P+HFE+GE
Sbjct  280   DKQKRIGCLYCYIPGVRNVGAHFAYRRALRTTFKTILGLENFKGEVFLRTFAPSHFEDGE  339

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKK-GVRFRLLDTTESMV  1091
             W+ GGNC++TRP+   + +LEG  LE +  Q+ EF  AKR+ +K  G+  RLLD T  M+
Sbjct  340   WDKGGNCLKTRPYRSNETELEGMNLETHNIQLDEFRIAKRDENKNDGLNLRLLDVTRVML  399

Query  1092  LRPDGHPNHYGHWAHENKTTA--DCVHWCMPGPIDTWNEFLLQVLK  1223
             LRPDGHP+ +GH   E+K     DCVHWC+PGPID+WN+FLL++LK
Sbjct  400   LRPDGHPSRFGH-KPEDKVVLYNDCVHWCLPGPIDSWNDFLLEMLK  444



>ref|XP_004233404.1| PREDICTED: protein trichome birefringence-like 19 [Solanum lycopersicum]
Length=455

 Score =   392 bits (1008),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 240/346 (69%), Gaps = 6/346 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G WV   E PYYTN T   I++ QNCMK+GRPDT FLKW+W+PD CELP+FD  
Sbjct  107   KCDLFLGEWVENQEAPYYTNMTCFTIQEHQNCMKYGRPDTDFLKWKWKPDGCELPIFDAH  166

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLELVRGK++AFVGDSVARN MQSL CLL+ V  P+ VS   D    RW Y+EYNF + 
Sbjct  167   QFLELVRGKSLAFVGDSVARNHMQSLICLLSKVVYPIDVSNSTDQDNRRWEYREYNFNMS  226

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              FW+P+++KA   +P  +      NLY DEPD  W+ ++ + D VI S+G WF RP  +Y
Sbjct  227   IFWAPYLIKANKTEPNNIY--QPFNLYLDEPDESWSTKIQDFDYVIISSGHWFSRPTMFY  284

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
              N  +VGC  C++  + +   +F Y  AF TAF+T    E ++G+  LRTF+P+HFE+G 
Sbjct  285   LNHTLVGCLFCSQPNVTQMTSFFSYQKAFHTAFRTFNSLENYKGVTFLRTFAPSHFEDGV  344

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             W+ GG+CVR  PF + +  LE Y+LE Y  Q++E   A++EG  + ++FRL D T++M+L
Sbjct  345   WDKGGDCVRKTPFKRNEKVLEDYSLEFYKIQLQELTIAQKEGKMRNLKFRLFDATQAMLL  404

Query  1095  RPDGHPNHYGHWAHENKT-TADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGHW   N T + DCVHWC+PGPID W++FLL+++K E
Sbjct  405   RPDGHPSKYGHWPKPNVTFSNDCVHWCLPGPIDVWSDFLLELMKRE  450



>ref|XP_009623683.1| PREDICTED: protein trichome birefringence-like 19 [Nicotiana 
tomentosiformis]
Length=429

 Score =   391 bits (1005),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 179/345 (52%), Positives = 233/345 (68%), Gaps = 4/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G+WVP P+GPYYTN T   I + QNCMK+GRPDT FLKWRW+P  C+LP+F+  Q
Sbjct  73    CDVFIGDWVPNPDGPYYTNTTCWAIHEHQNCMKYGRPDTEFLKWRWKPKGCKLPIFNPYQ  132

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FL+++R K+MAF+GDSV RNQMQSL CLL+ V  PV +S   D    RW Y  YNFTL +
Sbjct  133   FLDMMRNKSMAFIGDSVGRNQMQSLICLLSRVEYPVDISYDEDQNFKRWKYTTYNFTLAA  192

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             +WSP +V  K++DP   S   L NLY DEPD  W  ++   D +I ++  WF R   YY+
Sbjct  193   YWSPFLVTVKESDPDGPSHTGLFNLYLDEPDAKWITQIEQFDYLILNSAHWFTRCSIYYE  252

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
               +I+GC  C    +      +GY  A +T    +   + ++G+  LRT +P+HFE GEW
Sbjct  253   KNRIIGCRYCGLPNVTDLPINYGYQKALKTTLDAINRLKNYKGVTFLRTIAPSHFEGGEW  312

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GGNCVR RPF   +  L+G +LE Y TQV EF  A  EG KKG RFRLLD T++M+LR
Sbjct  313   NKGGNCVRRRPFRSNETTLDGLSLEFYTTQVEEFKIASEEGKKKGKRFRLLDMTQAMLLR  372

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGHW +EN     DCVHWC+PGPID+W++FLL +LK+E
Sbjct  373   PDGHPSRYGHWPNENVVLYNDCVHWCLPGPIDSWSDFLLHMLKLE  417



>ref|XP_009801264.1| PREDICTED: protein trichome birefringence-like 19 isoform X1 
[Nicotiana sylvestris]
Length=427

 Score =   391 bits (1004),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 185/345 (54%), Positives = 236/345 (68%), Gaps = 4/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WV  P+GPYYTN T   I + QNCMK+GRPD+ +LK+RW+P+ CELP+F+  Q
Sbjct  73    CDIFSGEWVWNPDGPYYTNMTCFAIHEHQNCMKYGRPDSDYLKYRWKPNGCELPIFNPFQ  132

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD---AAVGRWVYKEYNFTLLS  557
             FL++VR K++A VGDSV RNQMQSL CLL  V  P  +SD    A  +  YK YNFTL +
Sbjct  133   FLDMVRNKSLALVGDSVGRNQMQSLICLLGRVEYPEDISDNPDQAFKKLRYKTYNFTLAT  192

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             +WSP +V  K+AD    S   + NLY DE D  W +E+   D VI +AG WF R   YY+
Sbjct  193   YWSPFLVSTKEADKDGPSHTGVFNLYLDEADEKWTNEIEGYDYVILNAGHWFARISVYYE  252

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             N + VGC  C    +      + Y  AFRTA K + D E F+G+ ILRTF+P+HFE G+W
Sbjct  253   NNQRVGCRYCGLPNVTALPLNYAYQRAFRTALKAINDLENFKGVAILRTFAPSHFEGGDW  312

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             NSGG+CVRTRPF   +  L+G +LE Y  QV EF AA++EG  KG RFRL+DTT++M+LR
Sbjct  313   NSGGDCVRTRPFRSNETALDGQSLEQYQIQVEEFKAAEKEGKTKGKRFRLMDTTQAMLLR  372

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGHW + N     DCVHWC+PGPID+W +FL  +LKME
Sbjct  373   PDGHPSKYGHWPNANVVLYNDCVHWCLPGPIDSWADFLFHMLKME  417



>ref|XP_010549949.1| PREDICTED: protein trichome birefringence-like 19 isoform X1 
[Tarenaya hassleriana]
Length=430

 Score =   390 bits (1002),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/345 (50%), Positives = 244/345 (71%), Gaps = 4/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WVP P+ PYYTN T   I + QNCMKFGRPD+GF++WRW+PD CE+P+F+  Q
Sbjct  71    CDIFSGKWVPNPDTPYYTNTTCWAIHEHQNCMKFGRPDSGFIQWRWKPDACEMPVFNPFQ  130

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA---VGRWVYKEYNFTLLS  557
             FLE++RGK+MAFVGDSV+RN MQSL CLL+ V  PV VSD +     RW Y+ Y+FT+ +
Sbjct  131   FLEIMRGKSMAFVGDSVSRNHMQSLICLLSRVEYPVDVSDNSDEYFKRWKYETYDFTIAA  190

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FW+PH+V++ + DP       L  L+ DE D  W  E+ + D +I S+G W +RP  +++
Sbjct  191   FWTPHLVRSTEPDPTRPHHSGLFYLHLDEADDKWTAEIGDFDYLIISSGHWHYRPSIFFE  250

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             +  +VGCH C    +     ++GY  AFRTAF+ +L+ E F+G++ LR+F+P+HFE G W
Sbjct  251   DRALVGCHYCQLPNLTDLTMFYGYRKAFRTAFRAVLNSESFKGVMYLRSFAPSHFEGGLW  310

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GGNC+R +P+   +M L+  ++E+Y+ Q+ EF AA++E  K+G+RFR LD T++M +R
Sbjct  311   NEGGNCLRKQPYRSNEMDLDERSMELYMIQMEEFQAAEKEARKRGMRFRALDMTQAMWMR  370

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGH    N +   DCVHWC+PGPIDT N+FLL +LK E
Sbjct  371   PDGHPSRYGHPPGANVSLYNDCVHWCLPGPIDTLNDFLLAMLKRE  415



>ref|XP_009774615.1| PREDICTED: protein trichome birefringence-like 19 [Nicotiana 
sylvestris]
Length=434

 Score =   390 bits (1001),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/345 (54%), Positives = 241/345 (70%), Gaps = 4/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G W+P P+GPYYTN T   I + QNCMK+GRPDT FLKWRW+P  CELP+F+  Q
Sbjct  73    CDIFTGEWIPNPDGPYYTNTTCWAIHEHQNCMKYGRPDTDFLKWRWKPKGCELPIFNPYQ  132

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FL+++R K++AFVGDSV RNQMQSL CLL+    P+ VS   D    RW Y  YNFTL +
Sbjct  133   FLDMMRNKSLAFVGDSVGRNQMQSLICLLSQAVYPIDVSTTPDENFKRWKYTSYNFTLAT  192

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             +WSP +V+ KD D    +   L NLY DE D  WA+++   D VI +AG WF R   YY+
Sbjct  193   YWSPFLVRMKDIDSDGPTKTGLFNLYLDEVDEKWANQIEEFDYVILNAGHWFTRCSVYYE  252

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
               ++VGC  C    +      +GY  A RT  KT+ +   F+G+  LRTF+P+HFE GEW
Sbjct  253   KNQLVGCRYCGLPNVTDLPSSYGYQKAIRTVLKTINNLANFKGITFLRTFAPSHFEGGEW  312

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N+GGNCVR +PF+  +  LEG+ L++Y  QV EF AA++EG KKG RFRLLDTT++M+LR
Sbjct  313   NNGGNCVRRKPFSSNETTLEGFHLDLYTIQVEEFKAAEKEGKKKGKRFRLLDTTQAMLLR  372

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGHW +EN     DCVHWC+PGPID+W++FLL +LK+E
Sbjct  373   PDGHPSRYGHWPNENVVLYNDCVHWCLPGPIDSWSDFLLHMLKLE  417



>ref|XP_009767997.1| PREDICTED: protein trichome birefringence-like 19 [Nicotiana 
sylvestris]
Length=425

 Score =   389 bits (998),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 235/346 (68%), Gaps = 4/346 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G+WVP P+GPYYTN T   I + QNCMK+GRPDT FL+WRW+P  C+LP+F+  
Sbjct  68    DCDVFIGDWVPNPDGPYYTNTTCWAIHEHQNCMKYGRPDTDFLRWRWKPKGCDLPIFNPY  127

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFL+++R K+MAF+GDSV RNQMQSL CLL+ V  P+ +S   D    RW Y  YNFTL 
Sbjct  128   QFLDMMRNKSMAFIGDSVGRNQMQSLICLLSRVEYPIDISYDDDQNFKRWKYTTYNFTLA  187

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             ++WSP +V  K++DP   S   L NLY DEPD  W  ++   D +I ++  WF R   YY
Sbjct  188   AYWSPFLVTVKESDPDGPSHTGLFNLYLDEPDVKWITQIEQFDYLILNSAHWFTRCSVYY  247

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +  +I+GC  C    +      +GY  A +T  + +   + ++G+  LRT +P+HFE GE
Sbjct  248   EKNQIIGCRYCGLPNVTDLPINYGYQKALKTTLEAINRLKNYKGVTFLRTIAPSHFEGGE  307

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNC+R RPF   +  L+G  LE Y+TQV EF  A  EG K+G RFRLLD T++M+L
Sbjct  308   WNKGGNCIRRRPFRSNETSLDGLCLEFYMTQVEEFKVASDEGKKRGKRFRLLDMTQAMLL  367

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGHW +EN     DCVHWC+PGPID+W++FLL +LK+E
Sbjct  368   RPDGHPSRYGHWPNENVVLYNDCVHWCLPGPIDSWSDFLLHMLKLE  413



>ref|XP_009623247.1| PREDICTED: protein trichome birefringence-like 19 [Nicotiana 
tomentosiformis]
Length=426

 Score =   388 bits (997),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 183/345 (53%), Positives = 233/345 (68%), Gaps = 4/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+ F G WV  P+ PYYTN T   I + QNCMK+GRPD+ +LKWRW+P+ CELP+F+  Q
Sbjct  72    CDTFSGEWVWNPDAPYYTNMTCFAIHEHQNCMKYGRPDSDYLKWRWKPNGCELPIFNPFQ  131

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD---AAVGRWVYKEYNFTLLS  557
             FL++VR K++A VGDSV RNQMQSL CLL  V  P  +SD    A  +  YK YNFTL +
Sbjct  132   FLDMVRNKSLALVGDSVGRNQMQSLICLLGRVEYPEDISDNPDQAFKKLRYKTYNFTLST  191

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             +WSP +V  K+AD    S   + NLY DE D  W +E+   D VI +AG WF R   YY+
Sbjct  192   YWSPFLVSTKEADADGPSHTGVFNLYLDEADEKWTNEIEGYDYVILNAGHWFARISVYYE  251

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             N + VGC  C    +      + Y  AFRTA K + D E F+G+ ILRTF+P+HFE G+W
Sbjct  252   NKQRVGCRYCGLPNVTALPLNYAYQRAFRTALKAINDLENFKGVAILRTFAPSHFEGGDW  311

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             NSGG+CVRTRPF   +  LEG +LE Y  QV EF AA++EG  KG RFRL+DTT++M++R
Sbjct  312   NSGGDCVRTRPFRSNETALEGQSLEQYQIQVEEFKAAEKEGKTKGKRFRLMDTTQAMLMR  371

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGHW + N     DCVHWC+PGPID+W +FL  + KME
Sbjct  372   PDGHPSKYGHWPNANVVLYNDCVHWCLPGPIDSWADFLFHMFKME  416



>ref|XP_003541704.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN08442.1| hypothetical protein glysoja_014207 [Glycine soja]
Length=411

 Score =   387 bits (995),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 198/388 (51%), Positives = 248/388 (64%), Gaps = 13/388 (3%)
 Frame = +3

Query  99    VLPISTTLVIFATFCFTSYNISDSLL--QSFNLFPGGECNIFKGNWVPFPEGPYYTNATK  272
             +LP  T LV+      T+ N S S L   S        CNIF GNWVP  +GPYY+N + 
Sbjct  24    LLPF-TFLVVVILLLITNLNESYSYLYGSSVESTENFSCNIFSGNWVPHSKGPYYSNESC  82

Query  273   CDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQM  452
               I  +QNC   GRPD  FLKWRW+PD CELPLFD +QFL+LVRGK+MAFVGDS+ RNQM
Sbjct  83    PFITYKQNCFMHGRPDREFLKWRWKPDECELPLFDAKQFLKLVRGKSMAFVGDSIGRNQM  142

Query  453   QSLKCLLASVADPVKVS-------DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVS  611
             +SL CLL SVA P  ++       D     W Y +Y FT+   WSP +VK+        S
Sbjct  143   ESLLCLLNSVARPEDITARYTSNDDKYFKWWYYADYKFTVTILWSPFLVKSSQTYLNDTS  202

Query  612   PDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKR  791
               +  NLY DE D+ WA  + N D VIFS GQWFFRP  +Y+NG +VGC +C+       
Sbjct  203   FSNAENLYVDEADKAWASHIENFDYVIFSGGQWFFRPLTFYENGHVVGCQKCHNLMEDPL  262

Query  792   NHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMK  971
             N Y GY  AFRTAF+T+++ + F+G+V + T SP HFENGEWN GG C RT P T+ +  
Sbjct  263   NLY-GYRHAFRTAFRTVINLKGFKGVVFMVTHSPNHFENGEWNKGGGCNRTLPVTREESA  321

Query  972   -LEGYTL-EMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENK  1145
              L  Y L E Y TQV EF AA++E  +KG+RF L++ T  M++RPDGHP+ YGH    N 
Sbjct  322   FLRPYGLDEFYQTQVEEFTAAEKEAREKGLRFGLMNITGVMLMRPDGHPHKYGHNLDRNV  381

Query  1146  TTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             +  DCVHWCMPGP+DTWNEFLL ++K E
Sbjct  382   SVNDCVHWCMPGPVDTWNEFLLHMMKKE  409



>ref|XP_011085560.1| PREDICTED: protein trichome birefringence-like 19 [Sesamum indicum]
Length=354

 Score =   385 bits (988),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 238/346 (69%), Gaps = 6/346 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G WVP P GPYYTN T   I++ QNC+KFGRPD GFLKWRW+PD CELPLFD  
Sbjct  11    QCDMFTGEWVPNPNGPYYTNETCSAIQEHQNCIKFGRPDRGFLKWRWKPDDCELPLFDPN  70

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG--RWVYKEYNFTLLS  557
             QFLELVRGK++AFVGDSVARN MQSL CLL+SVA+PV ++       R+ Y+E++F +  
Sbjct  71    QFLELVRGKSIAFVGDSVARNHMQSLICLLSSVANPVDLAAPLDQNRRYEYREHDFNVSI  130

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FW+P++V+ +  DP          LY DE D  W  ++A  D VI SAG WFFRP ++Y 
Sbjct  131   FWAPYLVRTEKTDP--NDEKRPFKLYLDEFDEHWTTQIALFDYVIISAGHWFFRPTYFYL  188

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             N  ++GC  C E+ +     YF Y  AFRTAF+  ++   + G+  LRT++P+HFE   W
Sbjct  189   NNLLIGCLYCPESNVNHLTAYFSYRRAFRTAFRA-INAANYNGVTFLRTYAPSHFEGAPW  247

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             + GG+C R RP+ + +  LE Y LEMYL Q+ E   A++ G ++G +FRL D T+SM+LR
Sbjct  248   DKGGDCARKRPYQRNETVLEDYGLEMYLIQLEELRIAQKAGRRRGGKFRLFDATKSMLLR  307

Query  1098  PDGHPNHYGHWAHENKTTA-DCVHWCMPGPIDTWNEFLLQVLKMET  1232
             PDGHP+ YGHW   ++T   DCVHWC+PGPID WN+FL ++L  ET
Sbjct  308   PDGHPSKYGHWPMADQTIPNDCVHWCLPGPIDAWNDFLQELLMRET  353



>ref|XP_010549950.1| PREDICTED: protein trichome birefringence-like 19 isoform X2 
[Tarenaya hassleriana]
Length=429

 Score =   387 bits (994),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 174/345 (50%), Positives = 245/345 (71%), Gaps = 5/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WVP P+ PYYTN T   I + QNCMKFGRPD+GF++WRW+PD CE+P+F+  Q
Sbjct  71    CDIFSGKWVPNPDTPYYTNTTCWAIHEHQNCMKFGRPDSGFIQWRWKPDACEMPVFNPFQ  130

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA---VGRWVYKEYNFTLLS  557
             FLE++RGK+MAFVGDSV+RN MQSL CLL+ V  PV VSD +     RW Y+ Y+FT+ +
Sbjct  131   FLEIMRGKSMAFVGDSVSRNHMQSLICLLSRVEYPVDVSDNSDEYFKRWKYETYDFTIAA  190

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FW+PH+V++ + DP       L  L+ DE D  W  E+ + D +I S+G W +RP  +++
Sbjct  191   FWTPHLVRSTEPDPTRPHHSGLFYLHLDEADDKWTAEIGDFDYLIISSGHWHYRPSIFFE  250

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             +  +VGCH C    +     ++GY  AFRTAF+ +L+ E F+G++ LR+F+P+HFE G W
Sbjct  251   DRALVGCHYCQLPNLTDLTMFYGYRKAFRTAFRAVLNSESFKGVMYLRSFAPSHFEGGLW  310

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GGNC+R +P++  +M L+  ++E+Y+ Q+ EF AA++E  K+G+RFR LD T++M +R
Sbjct  311   NEGGNCLRKQPYSN-EMDLDERSMELYMIQMEEFQAAEKEARKRGMRFRALDMTQAMWMR  369

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGH    N +   DCVHWC+PGPIDT N+FLL +LK E
Sbjct  370   PDGHPSRYGHPPGANVSLYNDCVHWCLPGPIDTLNDFLLAMLKRE  414



>ref|XP_002873749.1| hypothetical protein ARALYDRAFT_488438 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50008.1| hypothetical protein ARALYDRAFT_488438 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score =   386 bits (992),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 235/347 (68%), Gaps = 7/347 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCE--LPLFDG  380
             C+IF G WVP PE PYYTN T   I + QNCMKFGRPDT F+KW+W+P  CE  LP+FD 
Sbjct  67    CDIFSGEWVPNPEAPYYTNTTCWAIHEHQNCMKFGRPDTDFIKWKWKPYGCEDGLPVFDP  126

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTL  551
              +FLE+VRGKTMAFVGDSV+RN MQSL CLL+ V  P+  S   D    RW Y+ YNFT+
Sbjct  127   FRFLEIVRGKTMAFVGDSVSRNHMQSLICLLSQVEYPMDASVKDDDYFKRWTYETYNFTI  186

Query  552   LSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
              +FW+PH+VK+K+ D        + +LY DE D  W  ++ + D VI S+G W +RP  Y
Sbjct  187   AAFWTPHLVKSKEPDQTQTEHTDIFDLYLDEADESWTADIGDFDYVIISSGHWHYRPSVY  246

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+N  I GCH C    I     ++GY  AFRTAFK +LD E F+G++ LR+F+P+HFE G
Sbjct  247   YENRTITGCHYCQLPNITDLTMFYGYRKAFRTAFKAILDSESFKGVMYLRSFAPSHFEGG  306

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              WN GGNC+R +P+   + + E  T+++++ Q+ EF  A+ E  KKG R RLLDTT++M 
Sbjct  307   LWNEGGNCLRKQPYKSNESQDET-TMKLHMIQLEEFWRAEEEAKKKGKRLRLLDTTQAMW  365

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+ YGH    N     DCVHWC+PGPID  N+FLL +LK E
Sbjct  366   LRPDGHPSRYGHMPEANVMLYNDCVHWCLPGPIDNLNDFLLAMLKRE  412



>ref|XP_010262140.1| PREDICTED: protein trichome birefringence-like 19 [Nelumbo nucifera]
Length=443

 Score =   386 bits (992),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 179/342 (52%), Positives = 234/342 (68%), Gaps = 5/342 (1%)
 Frame = +3

Query  210   NIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQF  389
             ++F G WVP P+ PYYTN T   I + QNCMK+GRPDTGF+KWRW+P+ CELP+F+   F
Sbjct  88    DLFTGEWVPNPDAPYYTNRTCWTIHEEQNCMKYGRPDTGFMKWRWKPNDCELPIFNPYHF  147

Query  390   LELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGRWVYKEYNFTLLSFWSP  569
             LELVRGK+MAFVGDS+ RN M+SL CLL+ V +PV+V    + RW    YNF +  FW+P
Sbjct  148   LELVRGKSMAFVGDSLGRNHMESLLCLLSRVENPVEVQ---LQRWKLTGYNFKIAHFWAP  204

Query  570   HIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKI  749
             +++KA+ AD    S  +L +LY DE D  WA ++   D +I SAG WFFRP  +Y+NG++
Sbjct  205   YLIKAERADANDPSYTALFHLYLDELDPEWATKIVEFDYIIISAGHWFFRPTLFYENGQL  264

Query  750   VGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGG  929
             VGC  C    +      + Y  A +TAF+ +     F+GL  LRTFSP HFENG WN GG
Sbjct  265   VGCFNCYRENVTDLRFSYSYRKALQTAFRAIYSSRNFKGLTFLRTFSPQHFENGSWNQGG  324

Query  930   NCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGH  1109
             NCVRTRPFT  + +LE   L+ +  +  EF  A+ EG K+G++FRLLD T + +LRPDGH
Sbjct  325   NCVRTRPFTSNETRLEDINLQTHSIETEEFKVAESEGRKRGLKFRLLDITFASLLRPDGH  384

Query  1110  PNHYGHWA-HENKT-TADCVHWCMPGPIDTWNEFLLQVLKME  1229
             P+ YGH A H+N T   DC HWC+PG ID WN+ LLQ++KME
Sbjct  385   PSRYGHLAPHDNMTFVNDCAHWCLPGAIDAWNDLLLQMMKME  426



>emb|CAN73683.1| hypothetical protein VITISV_016120 [Vitis vinifera]
Length=356

 Score =   383 bits (984),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/312 (56%), Positives = 226/312 (72%), Gaps = 4/312 (1%)
 Frame = +3

Query  306   FGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVA  485
              GRPD  F+KWRW+PD CELP+F+  QFLEL+R KT+AFVGDSVARN MQSL CLL+ V 
Sbjct  26    LGRPDLDFMKWRWKPDGCELPIFNPAQFLELMRDKTLAFVGDSVARNHMQSLMCLLSRVV  85

Query  486   DPVKVS---DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRL  656
              P+ VS   D    RW Y +YNFT+ SFW+P ++K K ADP   +   L NLY DE D  
Sbjct  86    YPIDVSYTTDENFKRWRYTDYNFTMASFWTPFLIKTKLADPGGPTQTGLFNLYLDELDEA  145

Query  657   WADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFK  836
             W ++M   D +I SAGQWF+RP  +Y+N ++ GC+ C +  +     Y+GY  AFRT FK
Sbjct  146   WTNQMEEFDYLIISAGQWFYRPTMFYENRRVSGCYYCLQENVTDLTVYYGYRKAFRTVFK  205

Query  837   TLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVRE  1016
              +  ++ F+G+ ILRTFSPAHFENG WN GGNCVRTRPF   +  +EG  LE+Y+TQ+ E
Sbjct  206   AINSNKNFKGMTILRTFSPAHFENGLWNKGGNCVRTRPFMSNESTMEGPNLELYMTQIEE  265

Query  1017  FMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDT  1193
             + AA+R   K+G++FRLLDTT++M LRPDGHP+ YGHW + N T   DCVHWC+PGPIDT
Sbjct  266   YRAAERVALKRGLKFRLLDTTQAMWLRPDGHPSRYGHWPNANVTLYNDCVHWCLPGPIDT  325

Query  1194  WNEFLLQVLKME  1229
             W++FLL++LKME
Sbjct  326   WSDFLLEMLKME  337



>ref|XP_006338290.1| PREDICTED: uncharacterized protein LOC102586744 isoform X1 [Solanum 
tuberosum]
Length=427

 Score =   386 bits (991),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 233/346 (67%), Gaps = 4/346 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WV  P+ PYYTN T   I + QNCMK+GRPD+ +LKWRW+P+ CELP+FD   
Sbjct  73    CDIFTGEWVWNPDAPYYTNMTCYAIHEHQNCMKYGRPDSDYLKWRWKPNGCELPIFDPFL  132

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD---AAVGRWVYKEYNFTLLS  557
             FL+LVR K++A VGDSV RNQMQSL CLLA V  PV +SD    A  ++ Y  YNFTL +
Sbjct  133   FLDLVRNKSLALVGDSVGRNQMQSLICLLARVEYPVDISDNPDEAFKKYKYTTYNFTLAT  192

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             +WSP +V  K+AD    S   + NL+ DE D  W  E+   D VI +AG WF R   Y++
Sbjct  193   YWSPFLVSTKEADADGPSHTGVYNLHLDEADEKWTTEIERYDYVILNAGHWFARISVYFE  252

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             N + VGC  C    + +    + Y  AFRTA K + D E F+G+ ILRTF+P+HFE GEW
Sbjct  253   NNQRVGCRYCGIPNVSELPITYAYQKAFRTALKAINDLENFKGVAILRTFAPSHFEGGEW  312

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GG+C RTRP+   +  LEG +LE Y  Q+ EF AA+ EG  KG +FRL+DTT++M+LR
Sbjct  313   NKGGSCARTRPYRSNETALEGQSLEQYRIQLEEFKAAEEEGKMKGKKFRLMDTTQAMLLR  372

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             PDGHP+ YGHW + N     DCVHWC+PGPID+W++FL  + KME 
Sbjct  373   PDGHPSKYGHWPNANVVLYNDCVHWCLPGPIDSWSDFLFHMFKMEA  418



>ref|XP_009623246.1| PREDICTED: protein trichome birefringence-like 19 [Nicotiana 
tomentosiformis]
Length=424

 Score =   385 bits (988),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/344 (51%), Positives = 230/344 (67%), Gaps = 4/344 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WV  P+ PYYTN T  +I + QNCMK+GRPD+ +LKWRW+P  CELP+F+  Q
Sbjct  72    CDIFSGEWVRNPDAPYYTNMTCSEIHEHQNCMKYGRPDSDYLKWRWKPSGCELPIFNPFQ  131

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD---AAVGRWVYKEYNFTLLS  557
             FL++VR K++A VGDSV RN MQSL CLL  V  PV +SD    +  ++ Y  YNFTL  
Sbjct  132   FLDMVRNKSLAIVGDSVGRNHMQSLICLLGRVEYPVDISDNPDQSFKKYKYTTYNFTLAI  191

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
              WSP +V  K+AD        L NLY DE D  W   +   D +I +AG WF R   YY+
Sbjct  192   NWSPFLVSTKEADADGPCHTGLYNLYLDEADEKWTTLIGGYDYIILNAGHWFARCSVYYE  251

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             N ++VGC  C    + +  H + Y  AFRTA K + D E F+G+ ILRTF+P+H+E G+W
Sbjct  252   NNQLVGCRYCGLPNVTELPHNYAYQRAFRTALKAINDVENFKGVAILRTFAPSHYEGGDW  311

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GG+C++TRPF   +   EG +LE Y  QV EF  A++EG  KG RFRL+DTT++M+LR
Sbjct  312   NKGGDCIKTRPFRSNETASEGQSLEQYRIQVEEFKVAEKEGKMKGKRFRLMDTTQAMLLR  371

Query  1098  PDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGHW +EN    DCVHWC+PGPID+W +FL  + KME
Sbjct  372   PDGHPSKYGHWPNEN-VVNDCVHWCLPGPIDSWADFLFHMFKME  414



>ref|XP_010467973.1| PREDICTED: protein trichome birefringence-like 20 [Camelina sativa]
Length=462

 Score =   386 bits (992),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 239/347 (69%), Gaps = 7/347 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G W+P PE PYYTN T   I + QNCMK+GRPD GF+KWRW+P  C+LPLFD  +
Sbjct  116   CDIFSGEWIPNPEAPYYTNTTCRAIHEHQNCMKYGRPDLGFMKWRWKPKDCDLPLFDPYE  175

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADP---VKVSDAAVGRWVYKEYNFTLLS  557
             FLE+VRGK MAFVGDSV+RN +QSL CLL+ V DP    +  D    RW YK YNFT+ +
Sbjct  176   FLEVVRGKNMAFVGDSVSRNHVQSLICLLSRVEDPEDDSRQQDFNFQRWKYKTYNFTIAT  235

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FW+ H+V++++ +     P+S  NLY DEPD  WA ++   D +I S+GQWFFRP F + 
Sbjct  236   FWTTHLVRSEETETGQPGPNSFYNLYLDEPDPSWASQIVEFDYIIISSGQWFFRPLFLFD  295

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
               K +GC  C    ++    +F Y  A RT FKT+L  E F+G V LRTF+P+HFE+GEW
Sbjct  296   KQKRIGCLYCYIPGVRNVGAHFAYRRALRTTFKTILGLEDFKGEVFLRTFAPSHFEDGEW  355

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSK-KGVRFRLLDTTESMVL  1094
             + GGNC++TRP+   + +LEG  LE +  Q+ EF  AKR+ +K +G+  RLLD T+ M+L
Sbjct  356   DKGGNCLKTRPYRSNETELEGMNLETHNIQLDEFRIAKRDKNKNEGLNLRLLDVTQVMLL  415

Query  1095  RPDGHPNHYGHWAHENKTTA--DCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ +GH   E+K     D VHWC+PGPID+WN+FLL +LK +
Sbjct  416   RPDGHPSRFGH-KPEDKVVLYNDFVHWCLPGPIDSWNDFLLDMLKTK  461



>ref|XP_004233405.1| PREDICTED: protein trichome birefringence-like 19 [Solanum lycopersicum]
Length=430

 Score =   384 bits (987),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/345 (51%), Positives = 231/345 (67%), Gaps = 4/345 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WV  P+ PYYTN T   I + QNCMK+GRPDT FLKWRW+P  C+LP+F+  Q
Sbjct  75    CDVFIGEWVRNPDAPYYTNMTCWAIHEHQNCMKYGRPDTDFLKWRWKPKGCDLPIFNPYQ  134

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FL+++R K+MAF+GDSV RNQMQSL CLL+ V  P+ +S   D    RW Y  YNFTL +
Sbjct  135   FLDMMRNKSMAFIGDSVGRNQMQSLICLLSRVEYPIDISNDTDQNFRRWKYTTYNFTLAA  194

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             +WSP +V  K++DP   S   L NLY DEPD  W  ++   + +I ++  W+ R   YY+
Sbjct  195   YWSPFLVTVKESDPDGPSHTGLFNLYLDEPDPKWTTQIEQFNYLILNSAHWYTRCSVYYE  254

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
               +I+GCH C    I   +  +GY  A +T  K +   E F+G+  +RT +P+HFE GEW
Sbjct  255   KNQIIGCHYCGLPNITDLSINYGYQKALKTTLKAINSLENFKGVTFVRTIAPSHFEGGEW  314

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GGNCVR  PF   +  L+G ++E Y TQV EF  A +EG  KG RFRLLD T++M+LR
Sbjct  315   NKGGNCVRQGPFRSNETTLDGISMEFYRTQVEEFKVAAKEGKAKGKRFRLLDMTQAMLLR  374

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGHW + N     DCVHWC+PGPIDTW++FLL +LK+E
Sbjct  375   PDGHPSKYGHWPNANVVLYNDCVHWCLPGPIDTWSDFLLHMLKLE  419



>ref|XP_004514421.1| PREDICTED: uncharacterized protein LOC101496510 [Cicer arietinum]
Length=436

 Score =   384 bits (987),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 237/347 (68%), Gaps = 5/347 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             EC+IF G WVP P+ PYYTN T   I + QNCMK+GRPD+ F+KWRW+P+ CELP+F+  
Sbjct  77    ECDIFNGEWVPNPKAPYYTNKTCWAIHEHQNCMKYGRPDSDFMKWRWKPNECELPIFNPF  136

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFLE+VRGKT+AFVGDSV RN MQSL CLL+ V  P+ VS   D    RW Y  YNFT+ 
Sbjct  137   QFLEIVRGKTLAFVGDSVGRNHMQSLICLLSRVEWPIDVSYTKDDYFMRWRYPSYNFTMA  196

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              FWSP +VKAK  +    +   L N++ DE D  W  ++   D VI + G WFF+P  ++
Sbjct  197   FFWSPFLVKAKQENSDGPTHTGLYNIHLDEFDHKWTSQIEGFDYVIINGGHWFFKPMVFF  256

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             + GKIVGCH C    +     Y+GY  AF+TA + L   E ++G+  LRTF+P+HFENG 
Sbjct  257   EKGKIVGCHYCLLENVTDLTMYYGYRKAFKTALQALNSLENYKGVTFLRTFAPSHFENGL  316

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREF-MAAKREGSKKGVRFRLLDTTESMV  1091
             WN GGNC+RT+PF   + +LE   +E+Y+ Q+ E+ +A K+       + RL DTT++M+
Sbjct  317   WNEGGNCLRTKPFKSSETRLESTNMELYMIQLEEYKIAQKKAKKNGLKKVRLFDTTQAML  376

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+ YGH  +EN T   DCVHWC+PGPIDTWN+FLL++LK E
Sbjct  377   LRPDGHPSRYGHLPNENVTLYNDCVHWCLPGPIDTWNDFLLEMLKTE  423



>ref|NP_197094.1| protein trichome birefringence-like 19 [Arabidopsis thaliana]
 sp|Q9LFT0.1|TBL19_ARATH RecName: Full=Protein trichome birefringence-like 19 [Arabidopsis 
thaliana]
 emb|CAC01789.1| putative protein [Arabidopsis thaliana]
 gb|AED92222.1| protein trichome birefringence-like 19 [Arabidopsis thaliana]
Length=426

 Score =   382 bits (982),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 235/347 (68%), Gaps = 7/347 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCE--LPLFDG  380
             C+IF G WVP PE PYYTN T   I + QNCMKFGRPDT F+KW+W+P  CE  LP+FD 
Sbjct  67    CDIFSGEWVPNPEAPYYTNTTCWAIHEHQNCMKFGRPDTDFIKWKWKPYGCEDGLPVFDP  126

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTL  551
              +FLE+VRGKTMAFVGDSV+RN MQSL CLL+ V  P+  S   D    RW Y+ YNFT+
Sbjct  127   VRFLEIVRGKTMAFVGDSVSRNHMQSLICLLSQVEYPMDASVKNDDYFKRWTYETYNFTI  186

Query  552   LSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
              +FW+PH+VK+K+ D        + +LY DE D  W  ++ + D VI S+G W +RP  Y
Sbjct  187   AAFWTPHLVKSKEPDQTQPKHIDIFDLYLDEADESWTADIGDFDFVIISSGHWHYRPSVY  246

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+N  I GCH C    I     ++GY  AFRTAFK +LD E F+G++ LR+F+P+HFE G
Sbjct  247   YENRTITGCHYCQLPNITDLTMFYGYRKAFRTAFKAILDSESFKGVMYLRSFAPSHFEGG  306

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              WN GG+C+R +P+   + + E  T++++  Q+ EF  A+ E  KKG R RLLDTT++M 
Sbjct  307   LWNEGGDCLRKQPYRSNETQDET-TMKLHKIQLEEFWRAEEEAKKKGKRLRLLDTTQAMW  365

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+ YGH    N T   DCVHWC+PGPID  N+FLL +LK E
Sbjct  366   LRPDGHPSRYGHIPEANVTLYNDCVHWCLPGPIDNLNDFLLAMLKRE  412



>ref|XP_008461577.1| PREDICTED: LOW QUALITY PROTEIN: protein trichome birefringence-like 
19 [Cucumis melo]
Length=448

 Score =   383 bits (984),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 185/382 (48%), Positives = 248/382 (65%), Gaps = 20/382 (5%)
 Frame = +3

Query  105   PISTTLVIFATFCFTSYNISDSLLQSFNLFPGGECNIFKGNWVPF--PEGPY-YTNATKC  275
             P S     F    F+S N+S        L     C++  G+W+P   P+    YTN +  
Sbjct  60    PASAASAAFRPQIFSSGNLS--------LLSALPCDLAIGDWIPNSNPKAALPYTNDSCW  111

Query  276   DIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQ  455
              I D  NC+K+GRPD GFL+WRW+P+ CELP F+  QFLEL+R K  AFVGD++ARN +Q
Sbjct  112   AIHDHLNCLKYGRPDGGFLRWRWRPEGCELPSFNPAQFLELMRHKAFAFVGDNIARNHVQ  171

Query  456   SLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLM  626
             SL CLL+ +  P+ VS   D    +W Y  YNFT+   W+ H+VK+K+     ++   + 
Sbjct  172   SLICLLSKLEYPIDVSPSRDEHFKKWKYMSYNFTMAFLWTTHLVKSKE-----LTTGGVF  226

Query  627   NLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFG  806
             NLY DE D  W  ++A  D ++ S+GQWF  P FYY+NG+++GCH C    + +   Y G
Sbjct  227   NLYLDEYDEAWTSQIAGFDYLMISSGQWFLHPMFYYENGQVIGCHDCFLNNVTELGIYHG  286

Query  807   YGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYT  986
             Y  AFRTAFK +L+ E ++G+  LRTFSP+HFENG WN GGNC+RT PF  +   LEG  
Sbjct  287   YRKAFRTAFKAILNSESYKGITYLRTFSPSHFENGLWNQGGNCLRTEPFKSKDTALEGMN  346

Query  987   LEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCV  1163
             LE+Y+TQ+ EF  A+REG KKG + RLLDTT++M LRPDGHP+ YGHW   N+    DC+
Sbjct  347   LELYMTQMEEFRRAEREGRKKGFKLRLLDTTQAMWLRPDGHPSKYGHWPQGNENLYNDCI  406

Query  1164  HWCMPGPIDTWNEFLLQVLKME  1229
             HWC+PGPID W++FLL +LKME
Sbjct  407   HWCLPGPIDIWSDFLLHMLKME  428



>ref|XP_004232107.1| PREDICTED: protein trichome birefringence-like 19 [Solanum lycopersicum]
Length=427

 Score =   382 bits (981),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 232/346 (67%), Gaps = 4/346 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WV  P+ PYYTN T   I + QNC+K+GRPDT +LKWRW+P+ CELP+FD   
Sbjct  73    CDIFTGEWVWNPDAPYYTNMTCYAIHEHQNCIKYGRPDTDYLKWRWKPNGCELPIFDPFL  132

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD---AAVGRWVYKEYNFTLLS  557
             FL+LVR K++A VGDSV RNQMQSL CLLA V  PV +SD    A  ++ Y  YNFTL +
Sbjct  133   FLDLVRNKSLALVGDSVGRNQMQSLICLLARVEYPVDISDNPDEAFKKYKYTTYNFTLAT  192

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             +WSP +V  K+AD    S   + NL+ D+ D  W  E+   D VI +AG WF R   Y++
Sbjct  193   YWSPFLVSTKEADADGPSHTGVYNLHLDKADEKWTTEIERYDYVILNAGHWFARISVYFE  252

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             N + VGC  C    + +    + Y  AFRTA K + + E F+G+ ILRTF+P+HFE GEW
Sbjct  253   NNQRVGCRYCGIPDVSELPITYAYQKAFRTALKAINNLENFKGVAILRTFAPSHFEGGEW  312

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GGNC RTRP+   +  LEG +LE Y  QV EF AA+ EG  KG +FRL+DTT++M+LR
Sbjct  313   NKGGNCARTRPYRSNETALEGQSLEQYRIQVEEFKAAEEEGKVKGKKFRLMDTTQAMLLR  372

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             PDGHP+ YGHW + N     DCVHWC+PGPID+W + L  + KME+
Sbjct  373   PDGHPSKYGHWPNANVVLYNDCVHWCLPGPIDSWADILFHMFKMES  418



>emb|CDP02551.1| unnamed protein product [Coffea canephora]
Length=943

 Score =   397 bits (1021),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 182/343 (53%), Positives = 239/343 (70%), Gaps = 5/343 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WVP PE PYYTNAT   I+D QNC+K+ RPDTGFLKWRW+PD C LP+FD   
Sbjct  597   CDLFSGEWVPNPEAPYYTNATCYRIQDHQNCLKYARPDTGFLKWRWKPDGCVLPIFDPNH  656

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS--DAAVGRWVYKEYNFTLLSF  560
             FLELVRGK++AF+GDSVARN MQSL CLL+ V DP+ VS  +     WVYK+YNF +  F
Sbjct  657   FLELVRGKSIAFIGDSVARNHMQSLICLLSRVLDPLDVSTGNDENQHWVYKDYNFNISIF  716

Query  561   WSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKN  740
              +P++V+++  DP  V+     NLY DE D  W  ++   D ++ SAGQWFFRP  +Y+N
Sbjct  717   SAPYLVRSEKTDPNDVT--RPFNLYLDEFDEDWTTKVEGYDYIVISAGQWFFRPTIFYEN  774

Query  741   GKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWN  920
               ++GC  C    + +    F Y  AFRTAFK +     F+G+  LRT +P+HFE G W+
Sbjct  775   RTLIGCLACQLDNVARLRMNFSYERAFRTAFKAINSLANFKGVTFLRTITPSHFEGGSWD  834

Query  921   SGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRP  1100
              GG+CVRT P+ + +  LE Y +EMY  Q RE   A+ EGSK+G++FRLLD T+ M+LRP
Sbjct  835   KGGDCVRTMPYKRNEAVLEDYMVEMYEIQRRELRIAQEEGSKRGLKFRLLDATQPMLLRP  894

Query  1101  DGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             DGHP+ YGHW +E K   DCVHWC+PGPIDTWN+FL ++++ E
Sbjct  895   DGHPSKYGHWPNE-KMANDCVHWCLPGPIDTWNDFLQELIERE  936


 Score =   375 bits (963),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 233/339 (69%), Gaps = 5/339 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WVP PE PYYTN+    I++ QNCMK+GRPD  FLKWRW+PD CELP+FD  Q
Sbjct  98    CDLFSGEWVPNPEAPYYTNSCY-GIQEHQNCMKYGRPDIEFLKWRWKPDGCELPIFDPHQ  156

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG--RWVYKEYNFTLLSF  560
             FLELVRGK++AFVGDSVARN +QSL CLL+ V  P ++S++     +W Y+ YNF +  F
Sbjct  157   FLELVRGKSIAFVGDSVARNHLQSLMCLLSRVLYPQEISNSTDENRQWEYQGYNFRMSIF  216

Query  561   WSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKN  740
             W+P++V++ +         S  +LY DE D  W  ++   D VI +AG WFFRP  +Y+ 
Sbjct  217   WAPYLVRSVEITGPKDRTRSF-SLYLDEFDENWTTKIEEYDYVIINAGHWFFRPTMFYEK  275

Query  741   GKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWN  920
             G +VGC  C +    +   YF Y  AFRTAF  +   + F+G++ LRTF+P+HFENG W+
Sbjct  276   GNLVGCQYCPQENATRLTTYFSYQRAFRTAFGAINSLQNFKGVIFLRTFAPSHFENGTWD  335

Query  921   SGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRP  1100
             SGGNC RTRP+ + +  LEGY LE+Y  Q+ E   A+ EG K+G+R RL D T++M+LRP
Sbjct  336   SGGNCPRTRPYKRNEAVLEGYNLELYKIQLEELRIAQEEGRKRGLRLRLFDATKAMLLRP  395

Query  1101  DGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQ  1214
             DGHP+ YGH   +  +   DCVHWC+PGPID+WN+ LL+
Sbjct  396   DGHPSVYGHLPDQKLELPRDCVHWCLPGPIDSWNDVLLE  434



>ref|XP_010692310.1| PREDICTED: protein trichome birefringence-like 19 [Beta vulgaris 
subsp. vulgaris]
Length=411

 Score =   381 bits (978),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 174/343 (51%), Positives = 239/343 (70%), Gaps = 6/343 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G W+P  E PYYTN +   I++ QNCMK+GRPDT F+KW+W+P+ CELP+F+  +
Sbjct  70    CDVFSGEWIPNMEAPYYTNDSCNVIQEHQNCMKYGRPDTEFMKWKWKPNECELPIFNPYK  129

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FLE+VRGK++AFVGDSVARN MQSL CLL+ V  P+ VS   D    RW Y+ YNFTL+ 
Sbjct  130   FLEIVRGKSLAFVGDSVARNHMQSLVCLLSRVEHPIDVSNNKDDNFKRWFYQSYNFTLVI  189

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
              WSP +VK  + DP   +  +   L+ DE D +W DE+   + +I SAGQWFFRP  YY+
Sbjct  190   LWSPFLVKTLENDPNGRTGKTFWGLHLDEADEVWKDEIDKFNYIIISAGQWFFRPLIYYE  249

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
                 +GC  C    + + +  FGY  AFRTAF+T+L+ E F+G+V LRTF P HFE GEW
Sbjct  250   KRNFMGCRYCEIDNLTEYSLSFGYQNAFRTAFQTILEKENFKGVVYLRTFVPGHFEGGEW  309

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             ++GG+C++  P+   ++ LEG TLE+Y  Q++EF  A+    ++G+ FRLLD T  M++R
Sbjct  310   DNGGDCLKKSPYKSNEVHLEGETLELYTAQMQEFREAQGLAQQRGLSFRLLDMTRLMLMR  369

Query  1098  PDGHPNHYGHWAHENKT-TADCVHWCMPGPIDTWNEFLLQVLK  1223
             PDGHP+ YG  A  N T  +DCVHWC+PGPID+W++FLL++ K
Sbjct  370   PDGHPSKYGRPA--NLTWPSDCVHWCLPGPIDSWSDFLLEMFK  410



>gb|EYU39365.1| hypothetical protein MIMGU_mgv1a004599mg [Erythranthe guttata]
Length=518

 Score =   385 bits (988),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 178/355 (50%), Positives = 243/355 (68%), Gaps = 6/355 (2%)
 Frame = +3

Query  177   QSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDR  356
             Q   +    +C++F G WVP P+GPYYTN T   I++ QNC+KFGRPD GFLKWRW+P+ 
Sbjct  163   QEIRILDDEQCDLFSGEWVPDPDGPYYTNDTCNAIQEHQNCLKFGRPDRGFLKWRWKPND  222

Query  357   CELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG--RWVY  530
             CE+P+FD  QFLELVRGK++AFVGDSVARN MQSL CLL+ VA PV +SD      R+ +
Sbjct  223   CEMPVFDPTQFLELVRGKSIAFVGDSVARNHMQSLICLLSRVAIPVDLSDPLDQNRRYEF  282

Query  531   KEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQW  710
             ++++F +  FW+P++V+ +  DP         NLY DE DR W   +A  D +I SAG W
Sbjct  283   RDHDFNISMFWAPYLVRTEKTDP--KDEKRPFNLYLDEFDRHWQTGIAAFDYLIISAGHW  340

Query  711   FFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFS  890
             FFRP ++Y +G++ GC  C +  +     YF Y  AFRTAF + ++   F G+  LR+++
Sbjct  341   FFRPTYFYLDGRLAGCLYCPDPNLPHLTSYFSYRRAFRTAF-SAINAAGFSGVTFLRSYA  399

Query  891   PAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLL  1070
             P+HFE   W+ GG+CVRTRPF K +++L  Y+LEMYL Q+ E   A++ G + G +FRL 
Sbjct  400   PSHFEGAAWDKGGDCVRTRPFRKDEIQLSDYSLEMYLIQLEELRIAQKVGRRTGGKFRLF  459

Query  1071  DTTESMVLRPDGHPNHYGHWAHENKTTA-DCVHWCMPGPIDTWNEFLLQVLKMET  1232
             D T +M+LRPDGHP+ YGH    N++ A DCVHWC+PGPID WN+FL ++LK E 
Sbjct  460   DATRAMLLRPDGHPSKYGHLQGANQSFANDCVHWCLPGPIDAWNDFLQELLKREV  514



>gb|KHN09539.1| hypothetical protein glysoja_049688 [Glycine soja]
Length=342

 Score =   378 bits (971),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 176/331 (53%), Positives = 227/331 (69%), Gaps = 13/331 (4%)
 Frame = +3

Query  240   PEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMA  419
             P  PYY+N T   I D+QNC+KFGRPD  +L WRW+PD CELPLF+  +FL LVRGK MA
Sbjct  4     PAAPYYSNETCHWIIDQQNCLKFGRPDREYLHWRWKPDECELPLFNATRFLNLVRGKKMA  63

Query  420   FVGDSVARNQMQSLKCLLASVADPVKVSDAAVGRWVYKEYNFTLLSFWSPHIVKAKDADP  599
             FVGDSV+  +          V+           R+ Y +YNFTL + WSP+ V++ DADP
Sbjct  64    FVGDSVSEPE---------DVSHKYSSDVVYFKRYFYHDYNFTLGNLWSPYFVRSSDADP  114

Query  600   LWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETA  779
                + +S+M LY DE D  W   + N D+VI S+GQWFFRP  +Y+ GK+VGC++C    
Sbjct  115   RGHTYNSIMKLYVDEADEAWTSLVENFDIVIISSGQWFFRPLLFYEEGKLVGCNKCRIDN  174

Query  780   IKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTK  959
             +    H +GY  AFRTAF+ L   E ++G+  LRTFSPAHFENG+WN GG CVRT PFTK
Sbjct  175   VTDLTHLYGYKKAFRTAFRALSSLENYKGVTFLRTFSPAHFENGDWNKGGRCVRTMPFTK  234

Query  960   RQMKLEG----YTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGH  1127
             ++M+LE     Y LEMY+TQV EF  A+R  +K+G+ F +++TTE M+LRPDGHPN+YGH
Sbjct  235   QEMRLEDGAVEYILEMYVTQVEEFREAQRVATKRGLEFLMMNTTEIMLLRPDGHPNNYGH  294

Query  1128  WAHENKTTADCVHWCMPGPIDTWNEFLLQVL  1220
                +N T  DCVHWC+PGP+DTWNEFLL +L
Sbjct  295   SKDKNMTLNDCVHWCLPGPVDTWNEFLLYML  325



>gb|EPS57802.1| hypothetical protein M569_17015, partial [Genlisea aurea]
Length=345

 Score =   378 bits (971),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 178/345 (52%), Positives = 229/345 (66%), Gaps = 5/345 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G W+P P+ PYYTN T  +I++ QNCMK+GRPD+ +LKWRW+P+ C+LP FD  
Sbjct  3     QCDIFSGEWIPDPDAPYYTNRTCSEIQEHQNCMKYGRPDSEYLKWRWKPEGCDLPAFDAS  62

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADP-VKVSDAAVGRWVYKEYNFTLLSF  560
             +FL LV GK MA VGDSV RNQMQS+ CLL+ V  P V ++D     W Y  YNFTL  F
Sbjct  63    RFLSLVAGKAMAVVGDSVGRNQMQSMVCLLSRVESPTVVIADDHFKTWRYLNYNFTLAHF  122

Query  561   WSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKN  740
             WSP +VK    +    +   L NLY DEPD  WAD++   D ++ S+G WF R   YY+N
Sbjct  123   WSPFLVKFDVRNSDGPTHTGLYNLYLDEPDPAWADKIDGFDYIVLSSGHWFTRTAVYYEN  182

Query  741   GKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWN  920
              +IVGC  C    I +  + F Y  AFRT+F  +   ++F GL  LRTFSP+HFE G WN
Sbjct  183   RRIVGCRFCQIENITELPYEFAYRTAFRTSFGNIESRDRFGGLTFLRTFSPSHFEGGLWN  242

Query  921   SGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRP  1100
             +GGNCVR RP+ + +  ++G TL  Y  QV EF AA   G K+   FRL+D T+ MVLRP
Sbjct  243   AGGNCVRRRPYRRNETAMDGTTLNFYTAQVEEFAAATARGKKE---FRLMDMTKVMVLRP  299

Query  1101  DGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             DGHP+ YGHW HEN T   DCVHWC+PGPID+W +FL  +++ E 
Sbjct  300   DGHPSRYGHWLHENVTLYNDCVHWCLPGPIDSWADFLAHLIQKEA  344



>emb|CDP02553.1| unnamed protein product [Coffea canephora]
Length=925

 Score =   397 bits (1019),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 241/343 (70%), Gaps = 5/343 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WVP PE PYYTN+T   I D QNCMK+GRPDT FLKWRW+PD CELP+FD  Q
Sbjct  576   CDLFTGEWVPNPEAPYYTNSTCYGIYDHQNCMKYGRPDTDFLKWRWKPDGCELPIFDPHQ  635

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDA--AVGRWVYKEYNFTLLSF  560
             FLE+VRGK++AFVGDS+ARN M SL CLL+ V  P+ VS A     RWVY+EYNF +  F
Sbjct  636   FLEVVRGKSIAFVGDSLARNHMLSLMCLLSRVLYPLDVSTANDENRRWVYREYNFNVSMF  695

Query  561   WSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKN  740
             W+P++V+++  DP  ++     NLY DE D  W  ++   D +I SAGQWFFRP  +Y+N
Sbjct  696   WAPYLVRSERTDPNDIT--RPFNLYLDEFDDGWTTKVQAYDYIIISAGQWFFRPTNFYEN  753

Query  741   GKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWN  920
               ++GC  C + ++ +    F Y  AFRTAF+ ++    F+G+ ILRT +P+HFE G W+
Sbjct  754   RTLIGCLACKQDSVTQFTMNFSYERAFRTAFRAIISLANFKGVTILRTIAPSHFEGGVWD  813

Query  921   SGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRP  1100
              GG+CVRTRPF + +  L  Y  E++  Q++E   A+ EGSK G+RFRL D T++M LRP
Sbjct  814   QGGDCVRTRPFKRNETVLADYISELHKIQLKELRIAQEEGSKWGLRFRLFDVTQAMSLRP  873

Query  1101  DGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             DGHP+ YGHW  E K T DCVHWC+PGPID WN+FL +++K E
Sbjct  874   DGHPSKYGHWPTE-KVTNDCVHWCLPGPIDAWNDFLQELIKRE  915


 Score =   385 bits (990),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 237/351 (68%), Gaps = 10/351 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G WVP P+ PYYTN T   I++ QNC+K+GRPD  FLKWRW+PD CELP+FD  
Sbjct  99    KCDLFAGEWVPNPDAPYYTNTTCYVIQEHQNCLKYGRPDLDFLKWRWKPDGCELPIFDPH  158

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA--VGRWVYKEYNFTLLS  557
             QFLELVRGK++AFVGDSV+RN MQSL CLL+ V  P ++S       +W YKEYNF +  
Sbjct  159   QFLELVRGKSIAFVGDSVSRNHMQSLFCLLSKVLYPEEISSTTDESRQWKYKEYNFKISI  218

Query  558   FWSPHIVKAKDADPLWVSPDS---LMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFF  728
              W+P++V++ +      SP+       LY DE D  W  ++   D V+ S G WFFRP  
Sbjct  219   LWAPYLVRSAEI----TSPNDKARSFGLYLDEFDENWTTKIEGYDYVVISGGHWFFRPAM  274

Query  729   YYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFEN  908
              Y+NG+IVGC  C +  +      F Y  AFRTAF+ +     F+G+  LRTFSP HFEN
Sbjct  275   LYENGRIVGCLYCPQENVTHVTPLFSYQRAFRTAFRAINSLGNFKGVTFLRTFSPQHFEN  334

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G W+SGGNCVR RP+ + ++ L    LEMY  Q++E   A++EGSK+G++FRL D T+ M
Sbjct  335   GTWDSGGNCVRKRPYKRNEILLADNNLEMYKIQLQELKIAQKEGSKRGLKFRLFDATKPM  394

Query  1089  VLRPDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQVLKMETPE  1238
             +LRPDGHP+ YGHW  +  +   DCVHWC+PGPIDTWN+F L++LK E  E
Sbjct  395   LLRPDGHPSIYGHWPSQTVEMPNDCVHWCLPGPIDTWNDFFLELLKREESE  445



>ref|XP_009121537.1| PREDICTED: protein trichome birefringence-like 21 [Brassica rapa]
Length=450

 Score =   382 bits (981),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 235/346 (68%), Gaps = 9/346 (3%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++FKG W+P  E PYY NAT   I++ QNCMKFGRPDTGF++WRW+PD C+LP+FD  +
Sbjct  108   CDLFKGEWIPNEESPYYNNATCWAIQEHQNCMKFGRPDTGFMRWRWKPDGCDLPIFDPNE  167

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FLE+ RGK+M FVGDS++RNQ+QSL CLL+ V  P  +S   D A   W Y  YNFTL  
Sbjct  168   FLEMARGKSMGFVGDSISRNQVQSLLCLLSRVEYPEDISSSPDTAFKVWNYTSYNFTLHV  227

Query  558   FWSPHIVKAKDADPLWVSPD-SLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              WSP++VK   ADP    P+ +L NLY DE D  W  ++   D ++ S+G WF+RP  +Y
Sbjct  228   MWSPYLVKTTKADP--TDPECNLFNLYLDEYDTKWTSQINQLDYLVISSGHWFYRPVIFY  285

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N  I GC  C      +   Y+GY  A RT+ + +L  E F+GL +LR+FSP HFE G 
Sbjct  286   ENETISGCQYCALPNTTQLPLYYGYRKALRTSLRAIL--ENFKGLAVLRSFSPQHFEGGP  343

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             W+ GG+CVRTRP+ + +   EG  L+++  Q+ EF AA+ E  KKG+R RL+DTT++M+L
Sbjct  344   WDKGGDCVRTRPYRRNETIPEGADLKIHDIQLEEFRAAEEEMKKKGLRLRLMDTTQAMLL  403

Query  1095  RPDGHPNHYGHW-AHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP  YGH    E     DC+HWC+PGPID+WN+ LLQ++K E
Sbjct  404   RPDGHPGRYGHLQTAEVSLRNDCIHWCLPGPIDSWNDILLQMMKTE  449



>ref|XP_006286845.1| hypothetical protein CARUB_v10003873mg [Capsella rubella]
 gb|EOA19743.1| hypothetical protein CARUB_v10003873mg [Capsella rubella]
Length=426

 Score =   380 bits (977),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 179/347 (52%), Positives = 233/347 (67%), Gaps = 7/347 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCE--LPLFDG  380
             C++F G WVP PE PYYTN T   I + QNCM+FGRPDT F KW+W+P  CE  LP+FD 
Sbjct  67    CDLFSGEWVPNPEAPYYTNTTCWAIHEHQNCMRFGRPDTDFFKWKWRPYGCEDGLPVFDP  126

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTL  551
              +FLE+VRGKTMAFVGDSV+RN MQSL CLL+ V  PV  S   D    RW Y+ YNFT+
Sbjct  127   IRFLEIVRGKTMAFVGDSVSRNHMQSLICLLSQVEYPVDASVKDDDYFRRWTYETYNFTM  186

Query  552   LSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
              +FW+PH+VK+ +          + +LY DE D +W  ++ + D VI S+G W +RP  Y
Sbjct  187   AAFWTPHLVKSTEPGKTHPKYTDIFDLYLDEADEIWTADIGDFDYVIISSGHWHYRPSLY  246

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+N  +VGCH C    I     ++GY  AFRTA K +LD E F+G++ LRTF+P+HFE G
Sbjct  247   YENKSVVGCHYCQLPNITDLTMFYGYRKAFRTALKAVLDSESFKGVMYLRTFAPSHFEGG  306

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              WN GG+C+R +P+ K  +  +  T+ ++  Q+ EF  A+ E  +KG R RLLDTT++M 
Sbjct  307   LWNEGGDCLRKQPY-KSDVTQDETTMMLHKIQLEEFQRAEEEAKQKGKRLRLLDTTQAMW  365

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+HYGH    N T   DCVHWC+PGPID  N+FLL +LK E
Sbjct  366   LRPDGHPSHYGHMPETNVTLYNDCVHWCLPGPIDNLNDFLLAMLKRE  412



>ref|XP_006346862.1| PREDICTED: uncharacterized protein LOC102584725 [Solanum tuberosum]
Length=432

 Score =   380 bits (976),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 187/365 (51%), Positives = 244/365 (67%), Gaps = 7/365 (2%)
 Frame = +3

Query  147   TSYNISDSLLQSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTG  326
             ++Y+I D  ++   +     C+I  G W+P P+GPYYTN T   I + QNCMK+GRPDT 
Sbjct  57    STYHIEDMEIK---IMDDETCDISIGEWIPNPDGPYYTNTTCWAIHEHQNCMKYGRPDTD  113

Query  327   FLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-  503
             FLKWRW+P  CELP+F+  QFL+++R K++AFVGDSV RNQMQSL CLL+    P+  S 
Sbjct  114   FLKWRWKPKECELPIFNPFQFLDMMRNKSLAFVGDSVGRNQMQSLICLLSRAVYPIDDSI  173

Query  504   --DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMAN  677
               D    RW Y +YNFTL ++WSP +VK K+AD    +   L NLY DE D  W  ++  
Sbjct  174   SPDENFKRWKYVDYNFTLATYWSPFLVKMKEADADGPTKTGLFNLYLDEADDKWLSQIEE  233

Query  678   ADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEK  857
              D VIF+ G WF R   YY+N ++VGC  C    +      +GY  A RT  +T+ + E 
Sbjct  234   FDYVIFNGGHWFTRCSVYYENNQLVGCRYCGLPNVTDLPSTYGYQKAIRTVLRTINNLEN  293

Query  858   FRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKRE  1037
             F+G+  +RTF+P+HFE GEWN GGNCVR +PF   +  LEG  LE+Y  QV EF AA++E
Sbjct  294   FKGITFVRTFAPSHFEGGEWNKGGNCVRRKPFISNETSLEGLNLELYTIQVEEFKAAEKE  353

Query  1038  GSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQ  1214
             G KKG RFRLLDTT +M+LRPDGHP+ YGHW +EN     DCVHWC+PGPID+W++FLL 
Sbjct  354   GKKKGKRFRLLDTTLAMLLRPDGHPSRYGHWPNENVVLYNDCVHWCLPGPIDSWSDFLLH  413

Query  1215  VLKME  1229
             +L  E
Sbjct  414   MLMFE  418



>gb|EYU44284.1| hypothetical protein MIMGU_mgv1a006950mg [Erythranthe guttata]
Length=424

 Score =   380 bits (975),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 229/346 (66%), Gaps = 7/346 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             EC+IF G WV   + PYYTN T   I + QNCMK+GRPD+ FLKW+W+PD CELP+ +  
Sbjct  65    ECDIFTGEWVRNTDAPYYTNKTCWAIHEHQNCMKYGRPDSDFLKWKWKPDGCELPVMNPY  124

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             QFL++ R KT+AFVGDSV RNQMQS+ CLL+ V  P+ VS   D    RW Y  YNFTL 
Sbjct  125   QFLDMARDKTIAFVGDSVGRNQMQSMICLLSRVEYPIDVSPTTDEHFKRWTYVNYNFTLA  184

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              FW+P +V++ + D    +   + NLY DE D  W  E+   D VI +AG WF R   YY
Sbjct  185   YFWTPFLVRSDERDSDGPTHTGIFNLYLDEFDESWTSEIDEFDYVILNAGHWFTRTAVYY  244

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N +IVGC  C    I      +GY   FRTA + +   + F G+V LRTF+P+HFENG 
Sbjct  245   ENRRIVGCRFCQIPNITDLPMTYGYRRVFRTALRAINGRKNFNGVVFLRTFAPSHFENGM  304

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNC+R RP+   +  LEG  L+ Y+ Q+ EF AA+REG KK   FRLLDTT++M+L
Sbjct  305   WNEGGNCLRRRPYRSNETILEGLNLDFYMIQLEEFRAAQREGKKK---FRLLDTTQAMLL  361

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGHW  E  T   DCVHWC+PGPID+W +FL  +LKME
Sbjct  362   RPDGHPSRYGHWPEEKVTLYNDCVHWCLPGPIDSWADFLAHMLKME  407



>ref|XP_007148050.1| hypothetical protein PHAVU_006G176300g [Phaseolus vulgaris]
 gb|ESW20044.1| hypothetical protein PHAVU_006G176300g [Phaseolus vulgaris]
Length=413

 Score =   379 bits (974),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/349 (53%), Positives = 231/349 (66%), Gaps = 10/349 (3%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             CNIF GNWV + EGPYY N     I  +QNC   GRPD  FL WRW+PD CELPLFD +Q
Sbjct  64    CNIFSGNWVAYSEGPYYDNENCPFITYKQNCFMHGRPDREFLNWRWKPDECELPLFDAKQ  123

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR-------WVYKEYNF  545
             FL+LV GK+MAFVGDS+ RNQM+SL CLL SVA P  ++D            W Y  YNF
Sbjct  124   FLKLVAGKSMAFVGDSIGRNQMESLLCLLNSVARPEDITDRYTLNDDKYFKWWFYARYNF  183

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             T+   WSP +VK+        S  +  NLY DE D  W   +AN D VIFS GQWFFRP 
Sbjct  184   TVAILWSPFLVKSSQKYLNDTSFSNAENLYVDEADEAWTTHIANFDYVIFSGGQWFFRPL  243

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              +Y+ G++VGC +C++   +  N Y GY  A RTAF+T+++ E F+G+VIL T SP HFE
Sbjct  244   TFYEKGRVVGCQKCHDLVTEPLNLY-GYRNALRTAFRTVVNIEGFKGMVILVTHSPNHFE  302

Query  906   NGEWNSGGNCVRTRPFTKRQMKL-EGYTL-EMYLTQVREFMAAKREGSKKGVRFRLLDTT  1079
             NGEWN GG C RT P TK +  L + Y L E Y +QV EF+AA++EG +KG+RF L++ T
Sbjct  303   NGEWNKGGGCNRTMPVTKEESALVKPYGLEEFYESQVEEFIAAEKEGREKGLRFGLMNIT  362

Query  1080  ESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKM  1226
               M++RPDGHP+ YGH    N    DCVHWCMPGP+DTWN+FLL  + +
Sbjct  363   GVMLMRPDGHPDKYGHNLDGNVNINDCVHWCMPGPVDTWNQFLLHFIGI  411



>ref|XP_004145657.1| PREDICTED: uncharacterized protein LOC101212650 [Cucumis sativus]
 gb|KGN57735.1| hypothetical protein Csa_3G270790 [Cucumis sativus]
Length=448

 Score =   380 bits (977),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/382 (48%), Positives = 246/382 (64%), Gaps = 20/382 (5%)
 Frame = +3

Query  105   PISTTLVIFATFCFTSYNISDSLLQSFNLFPGGECNIFKGNWVPF--PEGPY-YTNATKC  275
             P S     F    F+S N+S        L     C++  G+W+P   P+ P  YTN +  
Sbjct  60    PASAASAAFRPQIFSSGNLS--------LLSALPCDLAIGDWIPNSNPKAPLPYTNDSCW  111

Query  276   DIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQ  455
              I D  NC+K+GRPD GFL+WRW+PD CELP F+  QFLEL+R K  AFVGD++ARN +Q
Sbjct  112   AIHDHLNCLKYGRPDGGFLRWRWRPDGCELPSFNPAQFLELMRHKAFAFVGDNIARNHVQ  171

Query  456   SLKCLLASVADPVKVSDA---AVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLM  626
             SL CLL+ +  P+ VS +      +W Y  YNFT+   W+ H+VK+K+     ++   + 
Sbjct  172   SLICLLSKLEYPIDVSPSRGEHFKKWKYMNYNFTVAFLWTTHLVKSKE-----LTTGGVF  226

Query  627   NLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFG  806
             NLY DE D  W   +A  D ++ S+GQWF  P FYY+NG++ GCH C    + +   Y G
Sbjct  227   NLYLDEYDEAWTSHIAGFDYLMISSGQWFLHPMFYYENGQVTGCHDCFLNNVTELGIYHG  286

Query  807   YGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYT  986
             Y  AFRTAFK +L+ E ++G+  +RTFSP+HFENG WN GGNC+RT PF  +   LEG  
Sbjct  287   YRKAFRTAFKAILNSENYKGITYMRTFSPSHFENGLWNQGGNCLRTEPFKSKNTALEGMN  346

Query  987   LEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKT-TADCV  1163
             LE+Y+TQ+ EF  A+REG KKG + RLLDTT++M LRPDGHP+ Y HW   N+    DC+
Sbjct  347   LELYMTQMEEFRRAEREGRKKGFKLRLLDTTQAMWLRPDGHPSKYSHWPQGNENLNNDCI  406

Query  1164  HWCMPGPIDTWNEFLLQVLKME  1229
             HWC+PGPID W++FLL +LKME
Sbjct  407   HWCLPGPIDIWSDFLLHMLKME  428



>ref|XP_009801265.1| PREDICTED: protein trichome birefringence-like 19 isoform X2 
[Nicotiana sylvestris]
Length=425

 Score =   379 bits (972),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 177/344 (51%), Positives = 228/344 (66%), Gaps = 4/344 (1%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WV  P+ PYYTN T  +I + QNCMK+GRPDT +LKWRW+P+ CEL +F+  Q
Sbjct  73    CDIFSGEWVWNPDAPYYTNVTCSEIHEHQNCMKYGRPDTDYLKWRWKPNGCELHIFNPFQ  132

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD---AAVGRWVYKEYNFTLLS  557
             FL++VR K++A VGDSV RNQMQSL CLL  V  P+ +SD    +  ++ Y  YNFTL  
Sbjct  133   FLDMVRNKSLAIVGDSVGRNQMQSLICLLGRVEYPIDISDNPDQSFKKYKYTTYNFTLAM  192

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
              WSP +V  K+ D        L NLY DE D  W   +   D +I +AG WF R   YY+
Sbjct  193   NWSPFLVSTKEIDADGPCHTGLYNLYLDEADEKWTTLIEGYDYIILNAGHWFARCSVYYE  252

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             N + VGC  C    + +  H + Y  AFRTA K + D E F+G+ ILRTF+P+H+E G+W
Sbjct  253   NNQRVGCKYCGLPNVTELPHNYAYQRAFRTALKAINDVENFKGVAILRTFAPSHYEGGDW  312

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GG+C  TRPF   +   EG +LE Y  QV+EF  A++EG  KG RFRL+DTT++M+LR
Sbjct  313   NKGGDCAMTRPFRSNETASEGQSLEQYRIQVKEFKIAEKEGKMKGRRFRLMDTTKAMLLR  372

Query  1098  PDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGHW  EN    DCVHWC+PGPID+W +FL  +LKME
Sbjct  373   PDGHPSKYGHWPSEN-VVNDCVHWCLPGPIDSWADFLFHMLKME  415



>ref|XP_010029461.1| PREDICTED: protein trichome birefringence-like 19 [Eucalyptus 
grandis]
Length=365

 Score =   376 bits (965),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 235/353 (67%), Gaps = 22/353 (6%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G WVP P  PYYTN T   I + QNCMK+GRPDT F+KWRWQPD CELP+F+  +
Sbjct  5     CDIFTGEWVPNPRAPYYTNKTCWAIHEHQNCMKYGRPDTDFMKWRWQPDGCELPVFNPAR  64

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FLELVRGK+MAFVGDSVARNQMQS+ CLL+ V  P+ VS   D    RW Y  YNFTL +
Sbjct  65    FLELVRGKSMAFVGDSVARNQMQSMICLLSRVEYPIYVSHTPDEQGLRWRYVTYNFTLAN  124

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FW+P++VK+ + DP   +   L +L+ DE D  W  +    D +I SAG WF+RP  +++
Sbjct  125   FWTPYLVKSVETDPNGPTKTGLFSLHLDEADNRWLSKAEEFDYLIVSAGHWFYRPLVFHE  184

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
              GKIVGC  C    +              TAFK +   + ++G+  LRTF+P+HFE G W
Sbjct  185   GGKIVGCQFCLLENVP----------YLTTAFKAINGLKNYKGITYLRTFAPSHFEGGIW  234

Query  918   NSGGNCVRTRPFTKRQMK--------LEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLD  1073
             N GGNCVRTRPF     +        L    LE+Y  QV EF  A++E  ++G+++RLLD
Sbjct  235   NQGGNCVRTRPFRSNDTRPFRSNETALADENLELYKIQVEEFRKAEQEARERGLKYRLLD  294

Query  1074  TTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             TT++ ++RPDGHP+ YGHW H+N T   DCVHWC+PGPIDTW++FLL++LK E
Sbjct  295   TTQATLMRPDGHPSRYGHWPHDNVTLYNDCVHWCLPGPIDTWSDFLLEMLKTE  347



>sp|Q9M896.2|TBL20_ARATH RecName: Full=Protein trichome birefringence-like 20 [Arabidopsis 
thaliana]
Length=478

 Score =   379 bits (973),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 233/344 (68%), Gaps = 6/344 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF G W+P P+ PYYTN T   I + QNC+K+GRPD GF+KWRW+P  C+LPLFD  +
Sbjct  127   CDIFSGEWIPNPKAPYYTNTTCRAIHEHQNCIKYGRPDLGFMKWRWKPKECDLPLFDPYE  186

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG--RWVYKEYNFTLLSF  560
             FLE+VRG  MAFVGDSV+RN +QSL CLL+ V  P   S       RW YK YNFT+ +F
Sbjct  187   FLEIVRGTRMAFVGDSVSRNHVQSLICLLSRVEHPEGDSQQEFNFQRWKYKTYNFTIATF  246

Query  561   WSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKN  740
             W+ H+V+A++ +     P+S  NLY DEPD  WA ++   D +I S+GQWFFRP F +  
Sbjct  247   WTTHLVRAEETETGPTGPNSFYNLYLDEPDPTWASQIGEFDYIIISSGQWFFRPLFLFDK  306

Query  741   GKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWN  920
              K +GC  C    ++    +F Y  A RT FKT+L  E F+G V LRTF+P+HFE GEW+
Sbjct  307   QKRIGCLYCYIPGVRNVGAHFAYRRALRTTFKTILGLENFKGEVFLRTFAPSHFEGGEWD  366

Query  921   SGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKK-GVRFRLLDTTESMVLR  1097
              GGNC++TRP+   + +L+G  LE +  Q+ EF  A R+ ++  G+  RLLD T+ M+LR
Sbjct  367   KGGNCLKTRPYRSNETELDGMNLETHSIQLDEFRIANRDKNRNDGLNLRLLDVTQMMLLR  426

Query  1098  PDGHPNHYGHWAHENKTTA--DCVHWCMPGPIDTWNEFLLQVLK  1223
             PDGHP+ +GH   E+K     DCVHWC+PGPID+WN+FLL +LK
Sbjct  427   PDGHPSRFGH-KREDKVILYNDCVHWCLPGPIDSWNDFLLDMLK  469



>ref|XP_004234695.1| PREDICTED: protein trichome birefringence-like 19 [Solanum lycopersicum]
Length=434

 Score =   377 bits (967),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 185/365 (51%), Positives = 242/365 (66%), Gaps = 7/365 (2%)
 Frame = +3

Query  147   TSYNISDSLLQSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTG  326
             ++Y+I D  ++   +     C+I  G W+P P+GPYYTN T   I + QNCMK+GRPD  
Sbjct  57    STYHIEDMEIK---IMDDEACDISIGEWIPNPDGPYYTNTTCWAIHEHQNCMKYGRPDID  113

Query  327   FLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-  503
             FLKWRW+P  CELP+F+  QFL+++R K++AFVGDSV RNQMQSL CLL+    P+  S 
Sbjct  114   FLKWRWKPKGCELPIFNPFQFLDMMRNKSLAFVGDSVGRNQMQSLICLLSRAVYPIDESI  173

Query  504   --DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMAN  677
               D    RW Y +YNFTL ++WSP +VK K+AD    +   L NLY DE D  W   +  
Sbjct  174   SPDENFKRWKYVDYNFTLATYWSPFLVKMKEADADGPTKTGLFNLYLDEADEKWLSRIEE  233

Query  678   ADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEK  857
              D VIF+ G WF R   YY+N ++VGC  C    +      +GY  A RT  +++   E 
Sbjct  234   FDYVIFNGGHWFTRCSVYYENNQLVGCRYCGLPNVTDLPSTYGYQRAIRTVLRSMNKLEN  293

Query  858   FRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKRE  1037
             F+G+  +RTF+P+HFE GEWN GGNCVR +PF   +  LEG  LE+Y  QV EF AA++E
Sbjct  294   FKGITFVRTFAPSHFEGGEWNKGGNCVRRKPFRSNETSLEGLNLELYTIQVEEFKAAEKE  353

Query  1038  GSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQ  1214
             G KKG RFRLLDTT++M+LRPDGHP+ YGHW +EN     DCVHWC+PGPID+W++FLL 
Sbjct  354   GKKKGKRFRLLDTTQAMLLRPDGHPSRYGHWPNENVVLYNDCVHWCLPGPIDSWSDFLLH  413

Query  1215  VLKME  1229
             +L  E
Sbjct  414   MLMFE  418



>gb|KHN15257.1| hypothetical protein glysoja_046990 [Glycine soja]
Length=329

 Score =   373 bits (957),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 169/314 (54%), Positives = 224/314 (71%), Gaps = 4/314 (1%)
 Frame = +3

Query  300   MKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLAS  479
             MK+GRPD+ F+KWRW+P+ CELP+F+   FLE++RGK+MAFVGDSV RN MQSL CLL+ 
Sbjct  1     MKYGRPDSEFMKWRWKPNECELPIFNPFHFLEIMRGKSMAFVGDSVGRNHMQSLICLLSR  60

Query  480   VADPVKVSDAA---VGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPD  650
             V  P+ VS        +W Y  YNFT+ +FW+P++VK+K  D +  S + L NL+ D+ D
Sbjct  61    VEWPIDVSPTTNDYFRQWKYPSYNFTVAAFWTPYLVKSKMVDSIGPSHNGLFNLHLDQVD  120

Query  651   RLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTA  830
               WA ++   D +I +AG WFFRP  +Y+   IVGC  C    +     Y+GY   FRTA
Sbjct  121   VTWATQIKKFDYIIMNAGHWFFRPMIFYEKQNIVGCCDCLLKNVTDLTTYYGYRQVFRTA  180

Query  831   FKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQV  1010
             FK +   + F+G+  LRTF+P+HFENG WN GG+CVRT+PF   +++LEG  LE+Y+ Q+
Sbjct  181   FKAINSLQNFKGVTFLRTFAPSHFENGTWNKGGHCVRTKPFKSNEIRLEGTNLELYMIQL  240

Query  1011  REFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPI  1187
              EF  AK+EG KKG+ FRL DTT++M+LRPDGHP+ YGHW HE  T   DCVHWC+PGPI
Sbjct  241   EEFKIAKKEGRKKGLEFRLFDTTQAMLLRPDGHPSRYGHWPHEKVTLYNDCVHWCLPGPI  300

Query  1188  DTWNEFLLQVLKME  1229
             DTWN+FLL++LKME
Sbjct  301   DTWNDFLLEMLKME  314



>ref|XP_004232106.1| PREDICTED: protein trichome birefringence-like 19 [Solanum lycopersicum]
Length=425

 Score =   376 bits (965),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 173/355 (49%), Positives = 229/355 (65%), Gaps = 4/355 (1%)
 Frame = +3

Query  177   QSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDR  356
             Q        +C+IF G W+  PE PYYTN T  +I D QNCMK GRPD+ +LKWRW+P+ 
Sbjct  63    QKIEFKEADKCDIFSGKWIWNPEAPYYTNVTCTEIHDHQNCMKHGRPDSDYLKWRWKPNE  122

Query  357   CELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD---AAVGRWV  527
             CELP+F+  QFL+LVR K++A VGDSV RNQMQSL CLL+ V  PV +SD    +  ++ 
Sbjct  123   CELPIFNPFQFLDLVRNKSVAIVGDSVGRNQMQSLLCLLSRVEYPVDISDNPDQSFKKYK  182

Query  528   YKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQ  707
             Y  YNFTL  +WSP +V  K+ D        L NLY DE D  W  ++   D +I +AG 
Sbjct  183   YTTYNFTLAMYWSPFLVSTKEVDADGPCHTGLYNLYLDEADEKWTTKIEGYDYIILNAGH  242

Query  708   WFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTF  887
             WF R   YY N + VGC  C    + +    + Y  AF T  K + + + F+G+ ILRTF
Sbjct  243   WFARCSVYYVNNQRVGCRYCGIPNVTELPSTYAYQRAFETTLKAINNLDNFKGVAILRTF  302

Query  888   SPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRL  1067
             +P+H+E G+WN GG+C RTRP+   +  LE  ++E Y  QV EF  A++EG  KG RFRL
Sbjct  303   APSHYEGGKWNEGGDCARTRPYGSNETSLEDQSVEQYRIQVEEFEVAEKEGKMKGKRFRL  362

Query  1068  LDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             +DTT +M++RPDGHP+ YGHW +EN    DCVHWC+PGPID+W++FL  + KME 
Sbjct  363   MDTTRAMLMRPDGHPSKYGHWPNEN-VANDCVHWCLPGPIDSWSDFLFHMFKMEA  416



>ref|XP_007215656.1| hypothetical protein PRUPE_ppa008330mg [Prunus persica]
 gb|EMJ16855.1| hypothetical protein PRUPE_ppa008330mg [Prunus persica]
Length=336

 Score =   372 bits (956),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 172/317 (54%), Positives = 224/317 (71%), Gaps = 7/317 (2%)
 Frame = +3

Query  300   MKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLAS  479
             MK+GRPDT F+KWRW+PD CELP+F+  QFLEL+RGK++AFVGDSV RNQMQSL CLL+ 
Sbjct  1     MKYGRPDTEFMKWRWKPDGCELPIFNPAQFLELLRGKSLAFVGDSVGRNQMQSLICLLSR  60

Query  480   VADPVKVS-----DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPL-WVSPDSLMNLYTD  641
             V  P+ VS          RW Y  YNFT+ +FW+PH++K+K+A      +   L  LY D
Sbjct  61    VEYPIDVSITPDPTQKFIRWKYMSYNFTMATFWTPHLIKSKEATYTNGPTKTGLFELYLD  120

Query  642   EPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAF  821
             E D  W  ++   D +I SAG WFFR   YY+N KI GCH C    +     ++GY  AF
Sbjct  121   EFDEAWTTKVEEFDYIILSAGHWFFRSMVYYENQKISGCHYCLLDNVPDVGIFYGYRKAF  180

Query  822   RTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYL  1001
             R AFK +   + ++G+  LRTF+P+HFENG WN GGNC+RT PF   + +LEG  LE+Y+
Sbjct  181   RLAFKAINSLQNYKGITYLRTFAPSHFENGLWNQGGNCLRTTPFQSNETQLEGANLELYM  240

Query  1002  TQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMP  1178
              Q+ EF  A++EG KKG+++RLLDTT++ +LRPDGHP+ YGHW HEN T   DCVHWC+P
Sbjct  241   IQIEEFRNAEKEGRKKGLKYRLLDTTQASLLRPDGHPSRYGHWPHENVTLYNDCVHWCLP  300

Query  1179  GPIDTWNEFLLQVLKME  1229
             GPIDTW++FLL++LKME
Sbjct  301   GPIDTWSDFLLEMLKME  317



>gb|AFK43919.1| unknown [Lotus japonicus]
Length=329

 Score =   372 bits (954),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 169/314 (54%), Positives = 223/314 (71%), Gaps = 4/314 (1%)
 Frame = +3

Query  300   MKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLAS  479
             MK+GRPD+ F+KWRW+P+ CELPLF+  QFLE+V+GK+MAFVGDSV RNQMQS+ CLL+ 
Sbjct  1     MKYGRPDSEFMKWRWKPNECELPLFNPFQFLEVVKGKSMAFVGDSVRRNQMQSMICLLSR  60

Query  480   VADPVK---VSDAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPD  650
             V  P+     SD    RW Y  YNFT+ +FW+PH+V++K+ADP   +   L NLY DE D
Sbjct  61    VEWPIDESYTSDNNFMRWRYPSYNFTMANFWTPHLVRSKEADPNGPTNTGLFNLYLDEFD  120

Query  651   RLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTA  830
               W  ++ + D VI + G WF+RP  +Y+  KIVGCH C    +     Y+GY  AFRTA
Sbjct  121   ERWTTQIQDFDYVILNGGHWFYRPMVFYEKQKIVGCHFCLLKNVTDLTKYYGYRKAFRTA  180

Query  831   FKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQV  1010
             FK +   E F+G+  LRTF+P+HFE G WN GGNC RT+PF   + ++ G  LE+Y+ Q+
Sbjct  181   FKAINSLENFKGVTFLRTFAPSHFEGGLWNQGGNCERTKPFRSNEAQINGTELELYMIQL  240

Query  1011  REFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPI  1187
              E+  A++E  KKG++ RLLD T++  LRPDGHP+ YGHW HEN T   DCVHWC+PGPI
Sbjct  241   EEYRIAEKEARKKGLKLRLLDITQATFLRPDGHPSKYGHWPHENVTLYNDCVHWCLPGPI  300

Query  1188  DTWNEFLLQVLKME  1229
             DTW++FLL++LKME
Sbjct  301   DTWSDFLLEMLKME  314



>ref|XP_010692289.1| PREDICTED: protein trichome birefringence-like 19 [Beta vulgaris 
subsp. vulgaris]
Length=424

 Score =   375 bits (963),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 168/350 (48%), Positives = 236/350 (67%), Gaps = 4/350 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G WV   E PYYTN +   I+  QNCMK+GRPDT F+KW+W P+ CELP+F+  
Sbjct  74    KCDLFSGEWVQNMEAPYYTNDSCRVIQQHQNCMKYGRPDTEFMKWKWMPNGCELPVFNPY  133

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
              FL++V+GK++AFVGDSVARN MQSL CLL+ V  P+ +S   D    RW Y+ YNFTL+
Sbjct  134   HFLDIVKGKSLAFVGDSVARNHMQSLICLLSRVEHPLDISPTKDDNFKRWYYQSYNFTLV  193

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
               WSP +VK +D DP   +  + + L+ DEP+  W  ++   D +I SAG WFFRP  YY
Sbjct  194   ILWSPFLVKTQDNDPNGKTGKTFVGLFLDEPNEDWTAQIDGIDYIIISAGHWFFRPLIYY  253

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +  + +GC  C    + + +  FGY  AF+TAF+ +L+ E F+G V LRTF+P+HFE GE
Sbjct  254   EKRRFMGCRYCEIDNLTEYSLSFGYRNAFKTAFRAILERESFKGTVYLRTFAPSHFEEGE  313

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             W+ GG+C++ RP    +   EG  LEMY  Q+  F  A++   ++G++F L+D T  M++
Sbjct  314   WDHGGDCLKKRPIKSNETNFEGENLEMYTAQIEAFQEAQKLAQQRGLKFELMDMTRLMLM  373

Query  1095  RPDGHPNHYGHWAHENKT-TADCVHWCMPGPIDTWNEFLLQVLKMETPEY  1241
             RPDGHP+ YG  A+ N T  +DCVHWC+PGPID+WN+FLL++LK E   +
Sbjct  374   RPDGHPSVYGRPANLNVTWPSDCVHWCLPGPIDSWNDFLLELLKSEKKNF  423



>ref|XP_009121535.1| PREDICTED: protein trichome birefringence-like 19 [Brassica rapa]
Length=425

 Score =   375 bits (963),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 237/352 (67%), Gaps = 14/352 (4%)
 Frame = +3

Query  201   GECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCE--LPLF  374
             G C+IF G WV  PE PYYTN T   I + QNCM+FGRPDT F+KW+W+P  CE  LP+F
Sbjct  65    GSCDIFSGEWVLNPEAPYYTNTTCWAIHEHQNCMRFGRPDTDFIKWKWKPHGCEDDLPVF  124

Query  375   DGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKE  536
             D  +FLE VRGKTMAFVGDSV+RN MQSL CLL+ V  PV   DA+V       RW Y+ 
Sbjct  125   DPLRFLETVRGKTMAFVGDSVSRNHMQSLICLLSQVEYPV---DASVNTSDYFKRWTYET  181

Query  537   YNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFF  716
             YNFT+  FWS H+VK+ + +P   +  S+ +LY DE D  W  E+ + D VI S+G W +
Sbjct  182   YNFTIAPFWSTHLVKSTEPEP-GKTEHSVFDLYLDEADERWTAEIGDFDYVIISSGHWHY  240

Query  717   RPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPA  896
             RP  YY+N  I+GC  C    I   + ++GY  AFRTAFK +LD E F G++ LRTF+P+
Sbjct  241   RPSVYYENNTIIGCRYCQLPNITDFSMFYGYRKAFRTAFKAILDTETFEGVLYLRTFAPS  300

Query  897   HFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDT  1076
             HFE G WN GGNC+R  P+ + + + +  T++++  QV EF  A+ E  +KG RFRLLDT
Sbjct  301   HFEGGLWNEGGNCLRRGPYQRNETQ-DDVTMKLHRIQVEEFERAEVEAKRKGKRFRLLDT  359

Query  1077  TESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             T++M LRPDGHP+ YGH    N +   DCVHWC+PGPID  N+FLL ++K E
Sbjct  360   TQAMWLRPDGHPSRYGHLPEANVSLYNDCVHWCLPGPIDNLNDFLLAMIKRE  411



>gb|KHN28368.1| hypothetical protein glysoja_029629 [Glycine soja]
Length=325

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/314 (54%), Positives = 223/314 (71%), Gaps = 8/314 (3%)
 Frame = +3

Query  300   MKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLAS  479
             MK GRPD+ F+KWRW+P+ CELP+F+  QFLE++RGK+MAF+GDS +RN MQS+ CLL+ 
Sbjct  1     MKHGRPDSEFMKWRWKPNECELPIFNPLQFLEIMRGKSMAFIGDSTSRNHMQSMICLLSR  60

Query  480   VADPVKVS---DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPD  650
             V  P+ VS   D +  RW Y  YNFT+ +FW+PH+V+AK  D    S   L N+Y DE D
Sbjct  61    VEWPIDVSQVNDLSFKRWKYLSYNFTIANFWTPHLVRAKKTD----SNSVLFNVYLDEFD  116

Query  651   RLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTA  830
               W  ++   D VI + GQWF  P  +Y+  KIVGC  C+   +   N  +G    FRTA
Sbjct  117   ETWTTQIKEFDYVIINGGQWFLGPMVFYEKQKIVGCQYCDIENVTHLNLNYGIRKVFRTA  176

Query  831   FKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQV  1010
             FK ++  E F+G+  LRTFSP+HFENG WN GGNCVRT+PF   + KLEG+ LE+++ Q+
Sbjct  177   FKAIISLENFKGITFLRTFSPSHFENGLWNKGGNCVRTKPFRNNETKLEGHNLELHMIQL  236

Query  1011  REFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPI  1187
              EF  AK+EG KKG++F LLDTT++M+LRPDGHPN YG+W +EN T   DCVHWC+PG I
Sbjct  237   EEFKIAKKEGIKKGLKFMLLDTTQAMLLRPDGHPNRYGYWPNENMTLYNDCVHWCLPGAI  296

Query  1188  DTWNEFLLQVLKME  1229
             D W++FLL++LKME
Sbjct  297   DIWSDFLLEMLKME  310



>gb|EPS67152.1| hypothetical protein M569_07623, partial [Genlisea aurea]
Length=501

 Score =   377 bits (967),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 235/345 (68%), Gaps = 8/345 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G WVP PEGPYYTN T   I++ QNC+KFGRPD GFLKW+W+PD CELP+FD  
Sbjct  162   QCDLFSGEWVPNPEGPYYTNETCNAIQEHQNCLKFGRPDEGFLKWQWKPDECELPIFDAH  221

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDA--AVGRWVYKEYNFTLLS  557
             +FL LV GK++AFVGDSVARN MQSL CLL+ VA+PV +S       R+ ++E++F +  
Sbjct  222   RFLHLVTGKSIAFVGDSVARNHMQSLICLLSQVAEPVDLSHPLDQNKRYEFREFDFNVSM  281

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FW+P++V+ +  DP          LY DE D  W   +A  D +I SAG WFFRP ++Y 
Sbjct  282   FWAPYLVRTEKTDP--NDEKRPFKLYLDEFDENWRIGIAPFDYLIISAGHWFFRPTYFYF  339

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             NG + GC  C E+ +K R  Y+ Y  AFRTAF+ +   + F G+  LRT++P+HFE   W
Sbjct  340   NGSLDGCLYCPESDVKHRTSYYSYRRAFRTAFQAIRKSD-FSGITFLRTYAPSHFEGAAW  398

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             + GG+CVR RPF +    LE Y+LEMYL Q+ E   A+R+   K   F+L D T +MVLR
Sbjct  399   DKGGDCVRKRPFRRSDAALEDYSLEMYLIQLEELRIARRKTGGKA--FKLFDATRAMVLR  456

Query  1098  PDGHPNHYGHWAHENKTTA-DCVHWCMPGPIDTWNEFLLQVLKME  1229
             PDGHP+ YGHW   N++ A DCVHWC+PGPID+WN+FL ++L  E
Sbjct  457   PDGHPSKYGHWPVANQSFANDCVHWCLPGPIDSWNDFLQELLSRE  501



>ref|XP_010525312.1| PREDICTED: protein trichome birefringence-like 20 [Tarenaya hassleriana]
 gb|ABD96951.1| hypothetical protein [Cleome spinosa]
Length=503

 Score =   377 bits (967),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 240/346 (69%), Gaps = 4/346 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+I  G WVP  E PYYTN T   I + QNCMKFGRPD+GF+KWRW+P  C+LPLFD  
Sbjct  157   DCDISSGEWVPNHEAPYYTNTTCWAIHEHQNCMKFGRPDSGFMKWRWKPYGCDLPLFDPL  216

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             +FLE++RGK+MAF+GDSV+RN MQSL CLL+ V  P  VS   D    RW YK +NFT+ 
Sbjct  217   EFLEIMRGKSMAFIGDSVSRNHMQSLICLLSRVEYPEDVSLVQDFNFPRWKYKSFNFTIA  276

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             SFWS H+V++ +  P      +  NL+ DEPD +WA ++   D VI S+GQWFFRP F++
Sbjct  277   SFWSTHLVRSTETGPTGQYMTNYYNLHLDEPDPIWASQIGGFDYVIVSSGQWFFRPLFFF  336

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
               GK+VGC  C    ++    +F +  AFRT F+ +L  + F+G V LRTF+P+HFENGE
Sbjct  337   DKGKLVGCLYCYMPGVRNVGAFFAFRRAFRTTFRAILGAKHFKGEVFLRTFAPSHFENGE  396

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNC+RT P    + +L+G  LE +  Q+ EF  A+REG +KGVRFRL+D T++M+L
Sbjct  397   WNKGGNCLRTHPDRSNETELKGMNLEAHEIQLEEFRIARREGRRKGVRFRLVDVTKAMLL  456

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             R DGHP+ YGH   +N     DCVHWC+PGPID+WN+FLL  LK +
Sbjct  457   RGDGHPSRYGHRPEDNVILYNDCVHWCLPGPIDSWNDFLLHTLKNQ  502



>ref|XP_010492443.1| PREDICTED: protein trichome birefringence-like 19 [Camelina sativa]
Length=427

 Score =   372 bits (956),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/347 (51%), Positives = 227/347 (65%), Gaps = 6/347 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCE--LPLFDG  380
             C+IF G WVP P+ PYYTN T   I + QNCMKFGRPDT F KW+W+P  C   LP+FD 
Sbjct  67    CDIFSGEWVPNPDAPYYTNTTCWAIHEHQNCMKFGRPDTDFFKWKWKPYGCVDGLPVFDP  126

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTL  551
              +FLE+VRGKTMAFVGDSV+RN MQSL CLL+ V  PV  S   D    RW Y+ YNFT+
Sbjct  127   FRFLEIVRGKTMAFVGDSVSRNHMQSLICLLSQVEYPVDASVKDDDYFKRWTYETYNFTI  186

Query  552   LSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
               FW+PH+VK+ +          + +LY DE D  W  ++   D VI S+G W +RP  Y
Sbjct  187   AVFWTPHLVKSIEPGQTHPKNTDIFDLYLDEADESWTADIGEFDHVIISSGHWHYRPSVY  246

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+N  I+GCH C    I   + ++GY  AFRTA K +LD + F+G++ LRTF+P+HFE G
Sbjct  247   YENQTIIGCHYCQLPNITDLSMFYGYRKAFRTALKAILDSKTFKGVMYLRTFAPSHFEGG  306

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              WN GGNC+R +P+       +  T +++  Q+ EF  A+ E  KKG R RLLDTT++M 
Sbjct  307   LWNEGGNCLRKQPYKSDDQAQDDTTRKLHKIQLEEFWRAEEEAKKKGKRLRLLDTTQAMW  366

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+ YGH    N T   DCVHWC+PGPID  N+FLL +LK E
Sbjct  367   LRPDGHPSRYGHMPEANVTLYNDCVHWCLPGPIDNLNDFLLAMLKRE  413



>ref|XP_010097815.1| hypothetical protein L484_009121 [Morus notabilis]
 gb|EXB72238.1| hypothetical protein L484_009121 [Morus notabilis]
Length=326

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/316 (54%), Positives = 223/316 (71%), Gaps = 8/316 (3%)
 Frame = +3

Query  300   MKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLAS  479
             MKFGRPD  FL+WRW+PD CELPLFD  +FLELVRGK++AF+GDSV RNQM SL CLL  
Sbjct  1     MKFGRPDQEFLQWRWKPDDCELPLFDAVEFLELVRGKSLAFLGDSVGRNQMNSLVCLLGK  60

Query  480   VADPVKVSDAAVG------RWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTD  641
             VA P  VS+          R++Y EYNFT+   W+P +VK ++ DP   S +S MNLY D
Sbjct  61    VAYPEDVSEKYYNNTEYFKRFIYPEYNFTIGVLWAPFLVKTRETDPKVYSGNSRMNLYLD  120

Query  642   EPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAF  821
             EP+  W+ E+   D VI SAGQWFFRP   ++ G+++GC +C E  I +   ++ Y  AF
Sbjct  121   EPNEGWSTEVEKFDYVIVSAGQWFFRPLMLHEGGRLIGCSKCMEKNITELTPHYIYRRAF  180

Query  822   RTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTL--EM  995
             RT F+TLL  E ++G+  +RTFSPAHFENG WN GG+C R+RPF + +++   Y    +M
Sbjct  181   RTVFRTLLGLELYKGVTFMRTFSPAHFENGAWNDGGSCERSRPFGRGEVEKATYQYIWDM  240

Query  996   YLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCM  1175
                QV EF AA+  G +KG++FR++DTTE+M +RPDGHPN YGH  H N T ADCVHWC+
Sbjct  241   NSIQVEEFRAAEELGKQKGLQFRMMDTTEAMFMRPDGHPNFYGHSPHRNMTIADCVHWCL  300

Query  1176  PGPIDTWNEFLLQVLK  1223
             PGPIDTWNEFL+ +L+
Sbjct  301   PGPIDTWNEFLMYILR  316



>emb|CDP02547.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   372 bits (956),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/337 (51%), Positives = 234/337 (69%), Gaps = 6/337 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WVP PE PYYTN+    I++ QNCMK+GRPD  FLKWRW+PD CELP+FD RQ
Sbjct  112   CDLFSGEWVPNPEAPYYTNSCY-GIQEHQNCMKYGRPDIEFLKWRWKPDGCELPIFDPRQ  170

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG--RWVYKEYNFTLLSF  560
             FL+LVRGK++AFVGDSVARN +QSL CLL+SV  P ++S++      W Y+ YNF +  F
Sbjct  171   FLQLVRGKSIAFVGDSVARNHLQSLMCLLSSVLYPREISNSTDENRHWEYQGYNFRMSIF  230

Query  561   WSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKN  740
             W+P++V++ +         S  +LY DE D  W  ++   D  I SAG WFFRP  +Y+ 
Sbjct  231   WAPYLVRSVERTGPKDRTRSF-SLYLDEFDENWTTKIEEYDYFIISAGHWFFRPTMFYEK  289

Query  741   GKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWN  920
             G +VGC  C +  + +   YF Y  A RTAF+ +   + F+ ++ LRTF+P+HFENG W+
Sbjct  290   GNLVGCQYCPQENVTRLTAYFSYQRALRTAFRAINSLQNFKSVIFLRTFAPSHFENGTWD  349

Query  921   SGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKK-GVRFRLLDTTESMVLR  1097
             SGGNC RTRP+ + +  LEGY LE+Y  ++ E   A+ EG +K G+RFRL D T++M+LR
Sbjct  350   SGGNCPRTRPYKRNEAVLEGYNLELYKIELEELRIAQEEGRRKPGLRFRLFDATKAMLLR  409

Query  1098  PDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEF  1205
             PDGHP+ YGH A +N +   DCVHWC+PGPID+WN+F
Sbjct  410   PDGHPSVYGHLAGQNLELPRDCVHWCLPGPIDSWNDF  446



>ref|XP_006400115.1| hypothetical protein EUTSA_v10015268mg [Eutrema salsugineum]
 gb|ESQ41568.1| hypothetical protein EUTSA_v10015268mg [Eutrema salsugineum]
Length=514

 Score =   374 bits (960),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 229/346 (66%), Gaps = 12/346 (3%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WVP  E PYYTN T   I + QNCMK+GRPDTGF+KWRW+PD C+LP+FD ++
Sbjct  175   CDLFTGEWVPNEEAPYYTNTTCWAIHEHQNCMKYGRPDTGFMKWRWKPDSCDLPIFDPQE  234

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FLE+VRGK M FVGDS++RNQ+QSL CLL+ V  P  +S   D     W Y  YNFTL +
Sbjct  235   FLEMVRGKAMGFVGDSISRNQVQSLLCLLSKVEYPEDISSSPDTDFKIWNYTSYNFTLHA  294

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
              WSP +VK+           SL +LY DE D  W  ++   D ++ S+G WF+RP  +Y+
Sbjct  295   MWSPFLVKSTKP-----PKSSLFSLYLDEYDTKWTSQIDRLDYLVISSGHWFYRPVIFYE  349

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             N KI GC  C      +   Y+GY  A R + K +L    F+GL  LR+FSP HFE G W
Sbjct  350   NKKITGCQYCELPNTTELPLYYGYRKALRISLKAIL--HNFKGLAFLRSFSPQHFEGGAW  407

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREG-SKKGVRFRLLDTTESMVL  1094
             N GG+CVRTRP+ + +   EG  L+++  Q+ EF AA+ EG  KKG+R RL+DTT++M+L
Sbjct  408   NEGGDCVRTRPYRRNETIPEGADLKIHDIQLDEFRAAEEEGRKKKGLRLRLMDTTQAMLL  467

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP  YGH  +   T   DC+HWC+PGPIDTWN+ LLQ++K E
Sbjct  468   RPDGHPGRYGHLPNAKVTLRNDCIHWCLPGPIDTWNDILLQMMKTE  513



>ref|XP_006338291.1| PREDICTED: uncharacterized protein LOC102586744 isoform X2 [Solanum 
tuberosum]
 ref|XP_006338292.1| PREDICTED: uncharacterized protein LOC102586744 isoform X3 [Solanum 
tuberosum]
Length=422

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/355 (48%), Positives = 227/355 (64%), Gaps = 4/355 (1%)
 Frame = +3

Query  177   QSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDR  356
             Q   +    +C++F G W+  P+ PYYTN T  +I D QNCMK  RPD+ +LKWRW+P+ 
Sbjct  60    QKIAIKEAEKCDVFSGKWIWNPDAPYYTNVTCTEIHDHQNCMKHERPDSDYLKWRWRPNG  119

Query  357   CELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD---AAVGRWV  527
             CELP+F+  QFL LVR  ++A VGDSV RNQMQSL CLL+ V  PV +SD    +  ++ 
Sbjct  120   CELPIFNPFQFLNLVRNTSVAIVGDSVGRNQMQSLICLLSRVEYPVDISDNPDQSFKKYK  179

Query  528   YKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQ  707
             Y  YNFTL  +WSP +V  K+ D        L NLY DE D  W  ++   D +I +AG 
Sbjct  180   YTTYNFTLAIYWSPFLVSTKEVDADGPCHTGLYNLYLDEADEKWTTKIEGYDYIILNAGH  239

Query  708   WFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTF  887
             WF R   YY N + VGC  C    + +    + Y  AF+T  K + + E F+G+ ILRTF
Sbjct  240   WFARCSVYYVNNQRVGCRYCGLPNVTELPSTYAYQRAFKTTLKAINNLENFKGVAILRTF  299

Query  888   SPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRL  1067
             +P+H+E G WN GG+C RTRP+   +  LE  ++E Y  QV EF  A++EG  KG RFRL
Sbjct  300   APSHYEGGNWNEGGDCARTRPYGSNETALEDQSMEQYRIQVEEFEVAEKEGKMKGKRFRL  359

Query  1068  LDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             +DTT +M+LRPDGHP+ YGHW +EN    DCVHWC+PGPID+W++FL  + KME 
Sbjct  360   MDTTRAMLLRPDGHPSKYGHWPNEN-VANDCVHWCLPGPIDSWSDFLFHMFKMEA  413



>gb|EYU44283.1| hypothetical protein MIMGU_mgv1a005621mg [Erythranthe guttata]
Length=476

 Score =   371 bits (952),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/347 (50%), Positives = 228/347 (66%), Gaps = 10/347 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G WVP P+GPYYTN T   I+D QNCM+FGRPD GF+KWRW+PD CELPLFD  
Sbjct  129   KCDLFSGEWVPNPDGPYYTNTTCYSIQDHQNCMRFGRPDLGFMKWRWKPDECELPLFDPI  188

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR--WVYKEYNFTLLS  557
              FLELVRGK++AFVGDSVARN MQSL CLL++V  PV +S    G   +VY EYNF +  
Sbjct  189   GFLELVRGKSLAFVGDSVARNHMQSLICLLSTVGHPVDMSKPKAGNRLYVYTEYNFNISI  248

Query  558   FWSPHIVKAKDADPL-WVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
               SP++++ +   P  + +P    NL+ DE D+ W  ++   D +I SAGQWFFRP ++Y
Sbjct  249   ISSPYLIRTEKTVPGDFATP---FNLFLDEFDQTWTGKIHTFDYIIISAGQWFFRPSYFY  305

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
              N  ++GC  C E  +      F Y  AFRTAF+ +       G+  LRT +P+HFE G 
Sbjct  306   LNRTLIGCLYCPEANVTHLPSAFSYRWAFRTAFRAI---NGGAGVAFLRTLAPSHFEGGP  362

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             W+ GG+CVRT P+ + +  LE Y +EMY  Q+ E   A++ G   G + RL D T  MVL
Sbjct  363   WDKGGDCVRTGPYKRNETGLEEYNMEMYSVQLEEMRIAQKAGRGTGGKLRLFDATNMMVL  422

Query  1095  RPDGHPNHYGHWAHENKTTA-DCVHWCMPGPIDTWNEFLLQVLKMET  1232
             RPDGHP+ YGHW   N+T   DCVHWC+PGPID WN+ L ++LK E 
Sbjct  423   RPDGHPSKYGHWPVANRTIPNDCVHWCLPGPIDAWNDLLQELLKREV  469



>gb|EYU44282.1| hypothetical protein MIMGU_mgv1a007070mg [Erythranthe guttata]
Length=420

 Score =   368 bits (945),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 228/348 (66%), Gaps = 12/348 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G WVP PEGPYYTN +   I++ Q+CMKFGRPD GFLKWRW+PD C+L LFD R
Sbjct  74    QCDLFSGEWVPDPEGPYYTNESCYAIQEHQDCMKFGRPDLGFLKWRWKPDECQLALFDPR  133

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA--VGRWVYKEYNFTLLS  557
             +FLELVRGK++AFVGDSVARN MQSL CLLA VA P  VS+      R+ Y E+NF +  
Sbjct  134   RFLELVRGKSLAFVGDSVARNHMQSLICLLAKVAYPSDVSETTDENKRYTYTEHNFNISI  193

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP++VK    D      +   +LY DE D  W  ++++ D VI SAG WFFRP +++ 
Sbjct  194   FWSPYLVKTGKLD------NEPFDLYLDEFDPSWTTQISHYDYVIISAGHWFFRPTYFHL  247

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTL---LDHEKFRGLVILRTFSPAHFEN  908
               + VGC  C E  I      F Y  AFRTAF+ +          G+  LRTF+P+HFE 
Sbjct  248   ENRRVGCLYCPEPEITHLTPVFSYRRAFRTAFRGINGGGAARSGGGVTFLRTFAPSHFEG  307

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G WNSGGNC RTRPF + +  LEG  LE Y  Q+ E   A+  G   G +FRL D T+ M
Sbjct  308   GGWNSGGNCTRTRPFRRNETVLEGPGLEFYTVQLEELGIAQSAGRGTGGKFRLFDATKVM  367

Query  1089  VLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             +LRPDGHP+ YGHW   N+    DCVHWC+PGPID+WN+FL ++L  E
Sbjct  368   LLRPDGHPSRYGHWPGANRVLYNDCVHWCLPGPIDSWNDFLQELLMRE  415



>emb|CDX69489.1| BnaA10g18380D [Brassica napus]
Length=803

 Score =   380 bits (976),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 235/346 (68%), Gaps = 9/346 (3%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G W+P  E PYY NAT   I++ QNCMKFGRPDTGF++WRW+PD C+LP+FD  +
Sbjct  461   CDLFNGEWIPNEESPYYNNATCWAIQEHQNCMKFGRPDTGFMRWRWKPDGCDLPIFDPNE  520

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FLE+VRGK+M FVGDS++RNQ+QSL CLL+ V  P  +S   D A   W Y  YNFTL  
Sbjct  521   FLEMVRGKSMGFVGDSISRNQVQSLLCLLSRVEYPEDISSSPDTAFKVWNYTSYNFTLHV  580

Query  558   FWSPHIVKAKDADPLWVSPD-SLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              WSP++VK   ADP    P+ +L NLY DE D  W  ++   D ++ S+G WF+RP  +Y
Sbjct  581   MWSPYLVKTTKADP--TDPECNLFNLYLDEYDTKWTSQINQLDYLVISSGHWFYRPVIFY  638

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N  I GC  C      +   Y+GY  A RT+ + +L  E F+GL ILR+FSP HFE G 
Sbjct  639   ENETISGCQYCALPNTTQLPLYYGYRKALRTSLRAIL--ENFKGLAILRSFSPQHFEGGP  696

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             W+ GG+CVRTRP+ + +   EG  L+++  Q+ EF AA+ E  KKG+R RL+DTT++M+L
Sbjct  697   WDKGGDCVRTRPYRRNETIPEGADLKIHDIQLEEFRAAEEEMKKKGLRLRLMDTTQAMLL  756

Query  1095  RPDGHPNHYGH-WAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP  YGH    E     DC+HWC+PGPID+WN+ LLQ++K E
Sbjct  757   RPDGHPGRYGHIQTAEVSLRNDCIHWCLPGPIDSWNDILLQMMKTE  802


 Score =   376 bits (966),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 237/352 (67%), Gaps = 14/352 (4%)
 Frame = +3

Query  201   GECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCE--LPLF  374
             G C+IF G WVP PE PYYTN T   I + QNCM+FGRPDT F+KW+W+P  CE  LP+F
Sbjct  65    GSCDIFSGEWVPNPEAPYYTNTTCWAIHEHQNCMRFGRPDTDFIKWKWKPHGCEDDLPVF  124

Query  375   DGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKE  536
             D  +FLE VRGKTMAFVGDSV+RN MQSL CLL+ V  PV   DA+V       RW Y+ 
Sbjct  125   DPLRFLETVRGKTMAFVGDSVSRNHMQSLICLLSQVEYPV---DASVNTSDYFKRWTYET  181

Query  537   YNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFF  716
             YNFT+  FWS H+VK+ + +P   +   + +LY DE D  W  E+ + D VI S+G W +
Sbjct  182   YNFTIAPFWSTHLVKSTEPEP-GKTEHGVFDLYLDEADERWTAEIGDFDYVIISSGHWHY  240

Query  717   RPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPA  896
             RP  YY+N  I+GC  C    I   + ++GY  AFRTAFK +LD E F G++ LRTF+P+
Sbjct  241   RPSVYYENNTIIGCRYCQLPNITDFSMFYGYRKAFRTAFKAILDTETFEGVLYLRTFAPS  300

Query  897   HFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDT  1076
             HFE G WN GGNC+R  P+ + + + +  T++++  QV EF  A+ E  +KG RFRLLDT
Sbjct  301   HFEGGLWNEGGNCLRKGPYQRNETQ-DDVTMKLHRIQVEEFERAEVEAKRKGKRFRLLDT  359

Query  1077  TESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             T++M LRPDGHP+ YGH    N +   DCVHWC+PGPID  N+FLL ++K E
Sbjct  360   TQAMWLRPDGHPSRYGHLPEANVSLYNDCVHWCLPGPIDNLNDFLLAMIKRE  411



>ref|XP_006365643.1| PREDICTED: uncharacterized protein LOC102595198 [Solanum tuberosum]
Length=436

 Score =   369 bits (946),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 177/347 (51%), Positives = 232/347 (67%), Gaps = 6/347 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WV  P+ PYYTN T   I + QNCMK+GRPD  FLKWRW+P  C+LP+F+  Q
Sbjct  78    CDVFIGEWVHNPDAPYYTNLTCWAIHEHQNCMKYGRPDIDFLKWRWKPKGCDLPIFNPYQ  137

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FL+++R K+MAF+GDSV RNQMQSL CLL+ V  P+ +S   D    RW Y  YNFTL +
Sbjct  138   FLDMMRNKSMAFIGDSVGRNQMQSLICLLSRVEYPIDISYDTDQNFRRWKYTTYNFTLAA  197

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANA--DVVIFSAGQWFFRPFFY  731
             +WSP +V  K++DP   S   L NLY DEPD  W  ++ N   + +I ++  W+ R   Y
Sbjct  198   YWSPFLVTVKESDPDGPSHTGLFNLYLDEPDPKWTTQIENEQFNYLILNSAHWYTRCSIY  257

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+  +I+GCH C    I   +  +GY  A +T  K +   E F+G+  +RT +P+HFE G
Sbjct  258   YEKNQIIGCHYCGLPNITDLSINYGYQKALKTTLKAINSLENFKGVTFVRTIAPSHFEGG  317

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
             EWN GGNCVR  PF   +  L+G +LE Y TQV EF  A +EG KKG RFRLLD T++M+
Sbjct  318   EWNKGGNCVRQGPFRSNETTLDGISLEFYRTQVEEFKIAAKEGKKKGKRFRLLDMTQAML  377

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+ YGHW + N     DCVHWC+PGPIDTW++FLL +LK+E
Sbjct  378   LRPDGHPSKYGHWPNANVVLYNDCVHWCLPGPIDTWSDFLLHMLKLE  424



>gb|KEH36591.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=405

 Score =   367 bits (942),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 182/355 (51%), Positives = 236/355 (66%), Gaps = 23/355 (6%)
 Frame = +3

Query  210   NIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQF  389
             N+F G WVP+ + PYY N T   I ++QNC+  GRPD+ FLKWRW+PD CELPLFD  QF
Sbjct  56    NLFLGTWVPYLKQPYY-NQTCPFITEKQNCLIHGRPDSDFLKWRWKPDNCELPLFDATQF  114

Query  390   LELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---------WVYKEYN  542
              ++V+GK+MAFVGDS+ RNQM+SL CLL SVA P +++   V           W Y +YN
Sbjct  115   FKIVKGKSMAFVGDSIGRNQMESLLCLLNSVARPEEITTKYVSSIEDLTYFKWWFYADYN  174

Query  543   FTLLSFWSPHIVKAKDA----DPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQW  710
             FT+   WSP +VK+  +       +  P+S   LY DEPD  W   + N D VIFS GQW
Sbjct  175   FTIAMLWSPFLVKSSKSYIYNSSNFYKPES---LYLDEPDTAWTSRIENFDYVIFSGGQW  231

Query  711   FFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFS  890
             FFRPF +Y+NG IVGC +CN +      +Y+GY  A+RTAFKT+++   F+GL  L T S
Sbjct  232   FFRPFTFYENGTIVGCQKCNNSI---ELNYYGYKKAYRTAFKTIMNPNLFKGLAFLVTHS  288

Query  891   PAHFENGEWNSGGNCVRTRPFTKRQM-KLEGYTLE-MYLTQVREFMAAKREGSKKGVRFR  1064
             P HFENGEWN GG C RT+PFT  Q  ++  Y LE ++  Q+ EF AAK    K G RF 
Sbjct  289   PNHFENGEWNRGGGCNRTQPFTNEQKWEVHPYGLEIIHQIQLDEFSAAKNNTGKNGSRFG  348

Query  1065  LLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNE-FLLQVLKM  1226
             L+D T++M++RPDGHPN YGH + +N +  DCVHWCMPGP+DT NE FL  +++M
Sbjct  349   LIDITDAMLMRPDGHPNKYGHVSGKNASINDCVHWCMPGPVDTINEIFLYMIMRM  403



>ref|XP_009411154.1| PREDICTED: uncharacterized protein LOC103992946 [Musa acuminata 
subsp. malaccensis]
Length=892

 Score =   381 bits (979),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/343 (54%), Positives = 227/343 (66%), Gaps = 4/343 (1%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+I +G WV  P+ PYYTN T   I++ QNCMK+GRPD  FL+WRW+P  CELP FD  
Sbjct  548   DCDISQGEWVRDPDAPYYTNLTCFTIQEHQNCMKYGRPDMDFLRWRWRPAACELPRFDAS  607

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
              FLELVRGK++AFVGDS+ARN MQSL CLL+ V  P  +S   D    R  Y  YNFT+ 
Sbjct  608   WFLELVRGKSLAFVGDSLARNHMQSLMCLLSKVEYPKDISNTTDENFKRMFYTAYNFTIS  667

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             +FWSP +VKA++AD    +   L NLY DE D  WA  +   D VI S G WF RP  +Y
Sbjct  668   TFWSPFLVKAQEADTDGPNHTGLWNLYLDEVDDTWASRIREFDYVIISDGNWFTRPAMFY  727

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             + G IVGCH C    +      + + +AFRTA + + + + F G V LRT SP+HFENGE
Sbjct  728   EKGVIVGCHFCLVDNVTDLTLRYSHRMAFRTALRAITELDGFGGKVFLRTVSPSHFENGE  787

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GGNCVRTRPF   + +LEG  LE Y  QV EF  A+  G  KGV  ++LDTT +M+L
Sbjct  788   WNKGGNCVRTRPFRGNETRLEGLDLEFYEAQVEEFREAESVGRAKGVELKMLDTTRAMLL  847

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVL  1220
             RPDGHP+ YGHWAHEN T   DCVHWC+PGPID WN  L  +L
Sbjct  848   RPDGHPSRYGHWAHENVTLYNDCVHWCLPGPIDMWNTLLFLML  890


 Score =   356 bits (914),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 222/346 (64%), Gaps = 7/346 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++ KG WV  P+ PYYTN T   I++ QNCMK+GRPD  FLKWRWQP+ C+LP FD   
Sbjct  55    CDLSKGEWVRDPDAPYYTNKTCFTIQEHQNCMKYGRPDLDFLKWRWQPEGCDLPRFDAAW  114

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA---VGRWVYKEYNFTLLS  557
             FL LV GK+MAFVGDS+ARNQMQSL CLL+ V  P  +SD+      R  Y  Y FT+  
Sbjct  115   FLHLVTGKSMAFVGDSLARNQMQSLMCLLSGVERPQDMSDSKDDNFKRMFYPTYRFTISI  174

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP +VKA+ AD    +   L NLY DE D  WA ++   D VI S G WF RP  +Y+
Sbjct  175   FWSPFLVKAQLADTDGPNHTGLWNLYLDEVDEKWASQLHKFDYVIISDGNWFTRPSLFYE  234

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
               K+VGCH C    +     ++ + +AFRTA + +     F+G V++R+ SP+HFENGEW
Sbjct  235   QKKLVGCHYCLIENVTDLTLHYSHRMAFRTALRAINGLASFKGKVLVRSISPSHFENGEW  294

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLR  1097
             N GGNC R RP+   +  LE    E Y  Q+ EF  A+RE    GVR RLLDTT++M+LR
Sbjct  295   NKGGNCKRKRPYRSNETTLESLDREFYEQQLEEFRQAERE---PGVRMRLLDTTQAMLLR  351

Query  1098  PDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             PDGHP+ YGH  HE+     DCVHWC+PGPID WN+ L  +L   T
Sbjct  352   PDGHPSRYGHSIHESVAMYNDCVHWCLPGPIDMWNQLLFLMLGERT  397



>gb|EYU44288.1| hypothetical protein MIMGU_mgv1a006956mg [Erythranthe guttata]
Length=424

 Score =   367 bits (941),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 230/347 (66%), Gaps = 7/347 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+IF G WV   + PYYTN T   I ++ NC+K+GRPD  FLKWRW+P+ CELP+ +  
Sbjct  70    KCDIFTGEWVRNADAPYYTNTTCWAIHEQNNCIKYGRPDLDFLKWRWKPNGCELPVLNPY  129

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             +FL++ RGK MAFVGDSV RN +QS+ CLL+ V  P+ VS   D    R  Y  YNFTL 
Sbjct  130   RFLDMARGKKMAFVGDSVGRNHVQSMICLLSRVEYPIDVSTTSDDHFRRLSYVNYNFTLA  189

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              FW+P +V+ ++ DP   +   L NLY DE D  WA ++   D ++ +AG WF R   YY
Sbjct  190   YFWTPFLVRFEERDPDGPAHTGLFNLYLDESDESWASQIDGFDYLVLNAGHWFPRTTVYY  249

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N  IVGC  C    + +    +GY  AFRTAFK + + + F G+ +LRTF+PAHFENG 
Sbjct  250   ENRHIVGCRYCKLPNVTEYPMAYGYRYAFRTAFKAINERKNFSGVTLLRTFAPAHFENGM  309

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GG+C R RP+   +  LEG  L+MY+ Q  E  AA++EG K+   FRLLDTT++M+L
Sbjct  310   WNEGGDCPRRRPYRSNEKTLEGDNLDMYVIQSEELKAAQKEGKKE---FRLLDTTQAMLL  366

Query  1095  RPDGHPNHYGHWAHENKT-TADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             RPDGHP+ YGHW  +N T   DCVHWC+PGPID+W +FL  ++KME 
Sbjct  367   RPDGHPSRYGHWPDQNVTFYNDCVHWCLPGPIDSWADFLAHIIKMEA  413



>ref|XP_011099298.1| PREDICTED: protein trichome birefringence-like 19 [Sesamum indicum]
Length=535

 Score =   370 bits (949),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 176/363 (48%), Positives = 235/363 (65%), Gaps = 7/363 (2%)
 Frame = +3

Query  156   NISDSLLQSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLK  335
             +I  ++++S       +C++F G WVP  EGPYYTN T   I++ QNCMKFGRPDTGFLK
Sbjct  168   DIEVNMIRSNTSEGSKKCDLFTGEWVPNAEGPYYTNTTCDAIQEHQNCMKFGRPDTGFLK  227

Query  336   WRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAV  515
             WRW+PD CELP+FD  +FLELVRGK++AFVGDSVARN +QSL CLL+ V  PV VS    
Sbjct  228   WRWKPDECELPIFDPYKFLELVRGKSLAFVGDSVARNHIQSLICLLSRVVRPVDVSKPTD  287

Query  516   GR--WVYKEYNFTLLSFWSPHIVKAKDADPL-WVSPDSLMNLYTDEPDRLWADEMANADV  686
                 + Y +Y+F +    SP++++ +  DP  +  P    NL+ DE D  W  ++ + D 
Sbjct  288   ENRLYEYTDYDFNISIISSPYLIRTQKTDPNDFTRP---FNLFLDEFDETWTSKIPSFDY  344

Query  687   VIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG  866
             +I SAG WFFRP ++Y N  + GC  C E  +      F    AF+TAF+ +     F G
Sbjct  345   IIISAGHWFFRPTYFYLNRTLAGCLYCPEPNVTHLASSFSARWAFQTAFRAINAAVNFNG  404

Query  867   LVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSK  1046
             +  LRTF+P+HFE G W+ GG+CVRTRPF + +  LE Y+LEMY  Q+ E   A+  G +
Sbjct  405   VTFLRTFAPSHFEGGPWDKGGDCVRTRPFKRNETALEDYSLEMYSIQLEELRTAQEAGRR  464

Query  1047  KGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTA-DCVHWCMPGPIDTWNEFLLQVLK  1223
              G +FRL D T+ M+LR DGHP+ YGHW   N+    DCVHWC+PGPID WN+FL ++LK
Sbjct  465   TGRKFRLFDATKPMLLRADGHPSKYGHWPVANRIIPNDCVHWCLPGPIDAWNDFLQELLK  524

Query  1224  MET  1232
              E 
Sbjct  525   REV  527



>emb|CDY69475.1| BnaCnng63710D, partial [Brassica napus]
Length=399

 Score =   365 bits (937),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/337 (53%), Positives = 228/337 (68%), Gaps = 14/337 (4%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCE--LPLFDG  380
             C+IF G WVP PE PYYTN T   I + QNCM+FGRPDT F+KW+W+P  CE  LP+FD 
Sbjct  67    CDIFSGEWVPNPEAPYYTNTTCWAIHEHQNCMRFGRPDTDFIKWKWKPHGCEDDLPVFDP  126

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVG------RWVYKEYN  542
              +FLE VRGKTMAFVGDSV+RN MQSL CLL+ V  PV   DA+V       RW Y+ YN
Sbjct  127   LRFLETVRGKTMAFVGDSVSRNHMQSLICLLSQVEYPV---DASVNTSDYFKRWTYETYN  183

Query  543   FTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRP  722
             FT+  FWS H+VK+ + +P   +  S+ +LY DE D  W  E+ + D VI S+G W +RP
Sbjct  184   FTIAPFWSTHLVKSTEPEP-GKTEHSVFDLYLDEADERWTAEIGDFDYVIISSGHWHYRP  242

Query  723   FFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHF  902
               YY+N  I+GC  C    I   + ++GY  AFRTAFK +LD E F G++ LRTF+P+HF
Sbjct  243   SVYYENNTIIGCRYCQLPNISDFSMFYGYRKAFRTAFKAILDSETFEGVMYLRTFAPSHF  302

Query  903   ENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTE  1082
             E G WN GGNC+R  P+ + + + +  T++++  QV EF  A+ E  +KG RFRLLDTT+
Sbjct  303   EGGLWNEGGNCLRKGPYQRNETQ-DDVTMKLHKIQVEEFERAEVEAKRKGKRFRLLDTTQ  361

Query  1083  SMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPID  1190
             +M LRPDGHP+ YGH    N +   DCVHWC+PGPID
Sbjct  362   AMWLRPDGHPSRYGHLPEANVSLYNDCVHWCLPGPID  398



>ref|XP_010420267.1| PREDICTED: protein trichome birefringence-like 19 [Camelina sativa]
Length=425

 Score =   365 bits (937),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 175/347 (50%), Positives = 227/347 (65%), Gaps = 7/347 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCE--LPLFDG  380
             C+IF G WVP P+ PYYTN T   I + QNCMKFGRPDT F  W+W+P  C   LP+FD 
Sbjct  67    CDIFSGEWVPNPDAPYYTNTTCWAIHEHQNCMKFGRPDTDFFMWKWKPYGCVDGLPVFDP  126

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTL  551
              +FLE VRGKTMAFVGDSV+RN MQSL CLL+ V  PV  S   D    RW Y+ YNFT+
Sbjct  127   FRFLETVRGKTMAFVGDSVSRNHMQSLICLLSQVEYPVDASVNDDDYFKRWAYETYNFTI  186

Query  552   LSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
               FW+PH+VK+ +          + +LY DE D  W  ++ + D VI S+G W +RP  Y
Sbjct  187   AVFWTPHLVKSIEPGQTHPKNTDIFDLYLDEADETWTADIGDFDYVIISSGHWHYRPSVY  246

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+N  I+GCH C    I     ++GY  AFRTA K ++D + F+G++ LRTF+P+HFE G
Sbjct  247   YENQTIIGCHYCQLPNITDLTMFYGYRKAFRTALKAIVDSKTFKGVMYLRTFAPSHFEGG  306

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              WN GG+C+R +P+   + + +  T +++  Q+ EF  A+ E  KKG R RLLDTT++M 
Sbjct  307   LWNEGGDCLRKQPYKNDEAQ-DDTTRKLHKIQLEEFWRAEEEAKKKGKRLRLLDTTQAMW  365

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP+ YGH    N T   DCVHWC+PGPID  N+FLL +LK E
Sbjct  366   LRPDGHPSRYGHMPEANVTLYNDCVHWCLPGPIDNLNDFLLAMLKRE  412



>ref|XP_010453740.1| PREDICTED: protein trichome birefringence-like 19 [Camelina sativa]
Length=427

 Score =   365 bits (937),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 225/346 (65%), Gaps = 6/346 (2%)
 Frame = +3

Query  210   NIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCE--LPLFDGR  383
             +IF G WVP P+ PYYTN T   I + QNCMKFGRPDT F KW+W+P  C   LP+FD  
Sbjct  68    DIFSGEWVPNPDAPYYTNTTCWAIHEHQNCMKFGRPDTDFFKWKWKPYGCVDGLPVFDPF  127

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             +FLE+VRGKTMAFVGDSV+RN MQSL CLL+ V  PV  S   D    RW Y+ YNFT+ 
Sbjct  128   RFLEIVRGKTMAFVGDSVSRNHMQSLICLLSQVEYPVDASVKDDDYFKRWTYETYNFTIA  187

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             +FW+PH+VK+ D          + +LY DE D  W  ++ + D VI S+G W +RP  YY
Sbjct  188   AFWTPHLVKSIDPGLTHPKYTDIFDLYLDEADESWTADIGDFDYVIISSGHWHYRPSVYY  247

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N  I+GCH C    I     ++GY  AFRT  K +LD + F+G++ LRTF+P+HFE G 
Sbjct  248   ENQTIIGCHYCQLQNIIDLTMFYGYRKAFRTTLKAILDSKTFKGVMYLRTFAPSHFEGGL  307

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GG+C+R +P+       +  T +++  Q+ EF  A+ E  KKG   RLLDTT++M L
Sbjct  308   WNEGGDCLRKQPYKSDDHAQDDTTRKLHKIQLEEFWRAEEEAKKKGKMLRLLDTTQAMWL  367

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP+ YGH    N T   DCVHWC+PGPID  N+FLL +LK E
Sbjct  368   RPDGHPSRYGHMPEANVTLYNDCVHWCLPGPIDNLNDFLLAMLKRE  413



>emb|CDY26474.1| BnaC09g41940D [Brassica napus]
Length=500

 Score =   366 bits (939),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/347 (49%), Positives = 233/347 (67%), Gaps = 10/347 (3%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++FKG W+P  E PYY NAT   I++ QNCMKFGRPDTGF++WRW+PD C+LP+FD  +
Sbjct  157   CDLFKGEWIPNEESPYYNNATCWAIQEHQNCMKFGRPDTGFMRWRWKPDGCDLPIFDPNE  216

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FLE+VRGK+M FVGDS++RNQ+QSL CLL+ V  P  +S   D A   W Y  YNF L  
Sbjct  217   FLEMVRGKSMGFVGDSISRNQVQSLLCLLSRVEYPEDISSSPDIAFKVWNYTSYNFILHV  276

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
              WSP++VK    DP      +  +LY D+ D  W  ++   D +I S+G WF+RP  +Y+
Sbjct  277   MWSPYLVKTTKPDPTDAK-SNFFSLYLDQYDTKWTSQINQLDYLIISSGHWFYRPLIFYE  335

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             N K+ GC  C+     +   ++GY  A RT+ + +L  E F GL ILR+FSP HFE G W
Sbjct  336   NEKLSGCQYCSLPNTTELPFHYGYTKALRTSLRAIL--ENFTGLAILRSFSPQHFEGGPW  393

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKK--GVRFRLLDTTESMV  1091
             N GG+C RT+P+ + +   E   L+++  Q+ EF AA+ EG KK  G+R RL++TT++M+
Sbjct  394   NKGGDCARTQPYRRNETIPEVSDLKIHDIQLEEFRAAE-EGMKKKMGLRLRLMNTTQAML  452

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP  YGH   E  ++  DC+HWC+PGPIDTWN+ LLQ++K E
Sbjct  453   LRPDGHPGRYGHLQTEEVSSRNDCIHWCLPGPIDTWNDILLQMMKTE  499



>ref|XP_010492444.1| PREDICTED: protein trichome birefringence-like 21 [Camelina sativa]
Length=532

 Score =   366 bits (940),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 227/347 (65%), Gaps = 10/347 (3%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WVP  E PYYTN T   I + QNCMK+GRPDTGFL+WRW+PD C+LP+ D ++
Sbjct  189   CDLFTGEWVPNEEAPYYTNTTCWAIHEHQNCMKYGRPDTGFLRWRWKPDGCDLPIIDPQE  248

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA---VGRWVYKEYNFTLLS  557
             FLE+VRGK M FVGDS++RNQ+QSL CLL+ V  P  +S +       W Y  YNFTL +
Sbjct  249   FLEMVRGKAMGFVGDSISRNQVQSLLCLLSRVEYPEDISPSPNTDFKVWNYTSYNFTLHA  308

Query  558   FWSPHIVKAKDADPLWVSPDS-LMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              WSP +VK    DP    P S   +LY DE D  W  ++   D ++ S+G WF+RP  +Y
Sbjct  309   MWSPFLVKTTKPDP--TDPKSKFFSLYLDEYDTAWTSQLDKLDYLVISSGHWFYRPVIFY  366

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N KI GC  C      +    +GY  A R + K +L  E F GL  LR+FSP HFE G 
Sbjct  367   ENKKISGCQYCALPNTTELPLDYGYRKALRISLKAIL--ENFNGLAFLRSFSPQHFEGGA  424

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREG-SKKGVRFRLLDTTESMV  1091
             WN GG+CVRTRP+ + +   EG  L+++  Q+ EF AA+ EG  KKG+R +L+D T++M+
Sbjct  425   WNEGGDCVRTRPYRRNETIPEGSDLQVHDIQLEEFRAAEEEGRKKKGLRLKLMDMTQAML  484

Query  1092  LRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LRPDGHP  YGH  +   T   DC+HWC+PGPIDTWN+ LLQ++K E
Sbjct  485   LRPDGHPGRYGHLQNAGVTLRNDCIHWCLPGPIDTWNDILLQMMKTE  531



>ref|XP_006289546.1| hypothetical protein CARUB_v10003090mg [Capsella rubella]
 gb|EOA22444.1| hypothetical protein CARUB_v10003090mg [Capsella rubella]
Length=517

 Score =   365 bits (938),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/348 (50%), Positives = 229/348 (66%), Gaps = 10/348 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C++F G WVP  E PYYTN T   I D QNC+K+GRPDTGF++WRW+PD C+LP+ D +
Sbjct  173   KCDLFSGEWVPNEEAPYYTNMTCWAIHDHQNCIKYGRPDTGFMRWRWKPDSCDLPIIDPQ  232

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA---VGRWVYKEYNFTLL  554
              FLE+VRGK M FVGDS++RNQ+QSL CLL+ V  P  +S +       W Y  YNFTL 
Sbjct  233   VFLEMVRGKAMGFVGDSISRNQVQSLLCLLSRVEYPEDISPSPNTDFKVWNYTSYNFTLH  292

Query  555   SFWSPHIVKAKDADPLWVSPDS-LMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
             + WSP +VK+   DP    P S   NLY DE D  W  ++   D ++ S+G WF+RP  +
Sbjct  293   AMWSPFLVKSTKLDP--TDPKSNFFNLYLDEYDTEWTSQLDYLDYLVISSGHWFYRPVIF  350

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             Y+N +I GC  C      +    +GY  A R + K +L  EKF+GL  LRTFSP HFE G
Sbjct  351   YENRQISGCQYCGLPNTTELPLDYGYRKALRISLKAIL--EKFKGLAFLRTFSPQHFEGG  408

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREG-SKKGVRFRLLDTTESM  1088
              WN GG+CVRTRP+ + +   EG  L+++  Q+ EF AA+ EG  KKG+R +L+D T++M
Sbjct  409   PWNKGGDCVRTRPYRRNETIAEGADLKVHDIQLEEFRAAEEEGRKKKGLRLQLMDMTQAM  468

Query  1089  VLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             +LRPDGHP  YGH  +   T   DC+HWC+PGPID WN+ LLQ++K E
Sbjct  469   LLRPDGHPGRYGHLQNAEVTLRNDCIHWCLPGPIDNWNDILLQMMKTE  516



>ref|XP_010420269.1| PREDICTED: protein trichome birefringence-like 21 [Camelina sativa]
Length=542

 Score =   366 bits (940),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 230/349 (66%), Gaps = 14/349 (4%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WVP  E PYYTN T   I + QNCMK+GRPDTGF++WRW+PD C+LP+ D R+
Sbjct  199   CDLFTGEWVPNEEAPYYTNTTCWAIHEHQNCMKYGRPDTGFMRWRWKPDGCDLPIIDPRE  258

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYKEYNFTL  551
             FLE+VRGK M FVGDS++RNQ+QSL CLL+ V  P  +S     D+ V  W Y  YNFTL
Sbjct  259   FLEMVRGKAMGFVGDSISRNQVQSLLCLLSRVEYPEDISPSPNTDSEV--WNYTSYNFTL  316

Query  552   LSFWSPHIVKAKDADPLWVSPDS-LMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFF  728
              + WSP +VK+   DP    P S   +LY DE D  W  ++   D ++ S+G WF+RP  
Sbjct  317   HAMWSPFLVKSTKPDP--TDPRSKFFSLYIDEYDTAWTSQLDQLDYLVISSGHWFYRPVI  374

Query  729   YYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFEN  908
             +Y+N KI GC  C      +    +GY  A R + K +L  E F GL  LR+FSP HFE 
Sbjct  375   FYENRKISGCQYCALPNTTELPLDYGYRKALRISLKAIL--ENFNGLAFLRSFSPQHFEG  432

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREG-SKKGVRFRLLDTTES  1085
             G WN GG+CVRTRP+ + +   EG  L+++  Q+ EF AA+ EG  KKG+R +L+D T++
Sbjct  433   GAWNEGGDCVRTRPYRRNETIPEGPDLQVHDIQLDEFRAAEEEGRKKKGLRLKLMDMTKA  492

Query  1086  MVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             M+LRPDGHP  YGH  +   T   DC+HWC+PGPIDTWN+ LLQ++K E
Sbjct  493   MLLRPDGHPGRYGHLQNAGVTLRNDCIHWCLPGPIDTWNDILLQMMKTE  541



>ref|XP_010453739.1| PREDICTED: protein trichome birefringence-like 21 [Camelina sativa]
Length=523

 Score =   365 bits (938),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/364 (49%), Positives = 234/364 (64%), Gaps = 12/364 (3%)
 Frame = +3

Query  156   NISDSLLQSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLK  335
             NIS S +Q  N      C++F G WVP  E PYYTN T   I + QNCM++GRPDTGF++
Sbjct  165   NISPSRMQ--NRDDEQRCDLFTGEWVPNEEAPYYTNTTCWAIHEHQNCMRYGRPDTGFMR  222

Query  336   WRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA-  512
             WRW+PD C+LP+ D ++FLE+VRGK M FVGDS++RNQ+QSL CLL+ V  P  VS +  
Sbjct  223   WRWKPDGCDLPIIDPQEFLEMVRGKAMGFVGDSISRNQVQSLLCLLSKVEYPEDVSPSPN  282

Query  513   --VGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPD-SLMNLYTDEPDRLWADEMANAD  683
                  W Y  YNFTL + WSP +VK+   DP    P     +LY DE D  W  ++   D
Sbjct  283   TDFKVWNYTSYNFTLHAMWSPFLVKSTKPDP--TDPKFKFFSLYLDEYDTAWTSQLDKLD  340

Query  684   VVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFR  863
              ++ S+G WF+RP  +Y+N KI GC  C+     +    +GY  A R + K +L  E F 
Sbjct  341   YLVISSGHWFYRPVIFYENKKISGCQYCSLPNTTELPLDYGYRKALRISLKAIL--ENFN  398

Query  864   GLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREG-  1040
             GL  LR+FSP HFE G WN GG+CVRTRP+ + +   EG  L+++  Q+ EF AAK EG 
Sbjct  399   GLAFLRSFSPQHFEGGAWNEGGDCVRTRPYRRNETIPEGSDLQVHDIQLEEFRAAKEEGR  458

Query  1041  SKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQV  1217
              KKG R +L+D T++M+LRPDGHP  YGH  +   T   DC+HWC+PGPIDTWN+ LLQ+
Sbjct  459   KKKGFRLKLMDMTKAMLLRPDGHPGRYGHLQNAGVTLRNDCIHWCLPGPIDTWNDILLQM  518

Query  1218  LKME  1229
             +K E
Sbjct  519   MKTE  522



>ref|XP_010041154.1| PREDICTED: protein trichome birefringence-like 20 [Eucalyptus 
grandis]
Length=395

 Score =   360 bits (923),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/351 (49%), Positives = 226/351 (64%), Gaps = 12/351 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGP-YYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C++F G WV  P+ P YYTN T   I D+QNCMKFGRPD  FLKWRW+PD CELP FD 
Sbjct  29    KCDVFVGKWVYRPDAPTYYTNETCYAISDQQNCMKFGRPDMEFLKWRWEPDGCELPPFDA  88

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYKEYNF  545
              +F E+ RGK++AFVGDS+ RN MQSL CLL+SV  P  +S     D    RW   ++N 
Sbjct  89    AEFAEMARGKSIAFVGDSLGRNHMQSLLCLLSSVDQPEDISLRHTTDYNFKRWYLPKHNL  148

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             TL +FW+P +V+  DA     + D ++ L+ D+P   W+ E++  D VI SAGQWFFRP 
Sbjct  149   TLGTFWAPFLVRTTDARG-GQTLDGILTLHLDKPHPSWSAEISAFDYVIVSAGQWFFRPL  207

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG-----LVILRTFS  890
              YY+NG+++GC  C +  + + + +  Y    RT  + +   +   G        LRTFS
Sbjct  208   IYYRNGRLLGCSACGQDNVTEVSRFQAYRAVLRTTLRAITGRKGREGSGGGGTTFLRTFS  267

Query  891   PAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLL  1070
             PAHFE+G+W  GG+C RTRP    + K+EGY LE Y+ QV EF+ A+R+    G + RLL
Sbjct  268   PAHFEHGDWTDGGSCPRTRPLGSDEKKMEGYDLEFYVAQVEEFLEAERQARADGSKIRLL  327

Query  1071  DTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             DTT +M+LRPDGHPN   +W   N   ADCVHWC+PGPIDTWNE L  V+K
Sbjct  328   DTTRAMLLRPDGHPNRQCNWPKSNVDRADCVHWCLPGPIDTWNELLFYVMK  378



>gb|KCW44585.1| hypothetical protein EUGRSUZ_L01896, partial [Eucalyptus grandis]
Length=381

 Score =   359 bits (921),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/351 (49%), Positives = 226/351 (64%), Gaps = 12/351 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGP-YYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C++F G WV  P+ P YYTN T   I D+QNCMKFGRPD  FLKWRW+PD CELP FD 
Sbjct  29    KCDVFVGKWVYRPDAPTYYTNETCYAISDQQNCMKFGRPDMEFLKWRWEPDGCELPPFDA  88

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYKEYNF  545
              +F E+ RGK++AFVGDS+ RN MQSL CLL+SV  P  +S     D    RW   ++N 
Sbjct  89    AEFAEMARGKSIAFVGDSLGRNHMQSLLCLLSSVDQPEDISLRHTTDYNFKRWYLPKHNL  148

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             TL +FW+P +V+  DA     + D ++ L+ D+P   W+ E++  D VI SAGQWFFRP 
Sbjct  149   TLGTFWAPFLVRTTDARG-GQTLDGILTLHLDKPHPSWSAEISAFDYVIVSAGQWFFRPL  207

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG-----LVILRTFS  890
              YY+NG+++GC  C +  + + + +  Y    RT  + +   +   G        LRTFS
Sbjct  208   IYYRNGRLLGCSACGQDNVTEVSRFQAYRAVLRTTLRAITGRKGREGSGGGGTTFLRTFS  267

Query  891   PAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLL  1070
             PAHFE+G+W  GG+C RTRP    + K+EGY LE Y+ QV EF+ A+R+    G + RLL
Sbjct  268   PAHFEHGDWTDGGSCPRTRPLGSDEKKMEGYDLEFYVAQVEEFLEAERQARADGSKIRLL  327

Query  1071  DTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             DTT +M+LRPDGHPN   +W   N   ADCVHWC+PGPIDTWNE L  V+K
Sbjct  328   DTTRAMLLRPDGHPNRQCNWPKSNVDRADCVHWCLPGPIDTWNELLFYVMK  378



>ref|XP_010549948.1| PREDICTED: protein trichome birefringence-like 21 [Tarenaya hassleriana]
 gb|ABD96865.1| hypothetical protein [Cleome spinosa]
Length=437

 Score =   361 bits (926),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 228/346 (66%), Gaps = 6/346 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+ F G WV  PE PYYTN T   I + QNC+K+GRPDT F+KWRW+PD CELP+F+  
Sbjct  93    KCDYFSGEWVSNPEAPYYTNTTCWAIHEHQNCIKYGRPDTEFMKWRWKPDGCELPVFNPI  152

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLL  554
             +FL++V GK MAFVGDS++RNQ+QSL CLL+ V  P  +S   D     W Y  YNFT+ 
Sbjct  153   EFLQIVSGKAMAFVGDSISRNQVQSLLCLLSRVEYPQDISPTADTDFRTWKYPSYNFTVH  212

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             + WSP +V + +ADP       L NLY DE D +W  E+   D +I S+G WFFRP  +Y
Sbjct  213   ALWSPFLVSSTEADPSGPDKTGLFNLYIDEFDPIWMAEIGQLDYLIISSGHWFFRPVIFY  272

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             +N ++VGCH C    +      +GY  A RT  K +LD+  F G+   RTFSP HFE G 
Sbjct  273   ENRQLVGCHYCGLANVTVLPLDYGYRKALRTVLKAILDN--FAGVAFFRTFSPHHFEGGP  330

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVL  1094
             WN GG+C+RTRP+ + +       LE +  Q+ EF AA+ E  KKG+R RL+DTT++M+L
Sbjct  331   WNKGGDCIRTRPYRRNETVFRDENLEFHNIQLEEFRAAEEEAVKKGLRLRLIDTTQAMLL  390

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP  YGH  +   T   DCVHWC+PGPIDTWN+FLL+++K E
Sbjct  391   RPDGHPGKYGHPPNAQVTLFKDCVHWCLPGPIDTWNDFLLRMMKTE  436



>ref|XP_010029465.1| PREDICTED: protein trichome birefringence-like 19 [Eucalyptus 
grandis]
 gb|KCW56383.1| hypothetical protein EUGRSUZ_I02109 [Eucalyptus grandis]
Length=455

 Score =   360 bits (923),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 228/353 (65%), Gaps = 12/353 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEG-PYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C++F G WV  P+   YYTN T   I D+QNCMKFGRPD  FLKWRW+PD CELP F+ 
Sbjct  89    KCDVFVGKWVYRPDALTYYTNETCYAISDQQNCMKFGRPDMEFLKWRWEPDGCELPPFNA  148

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYKEYNF  545
              +F E+ RGK++AFVGDS+ RN MQSL CLL+SV  P  +S     D    RW   ++N 
Sbjct  149   AEFAEMARGKSIAFVGDSLGRNHMQSLLCLLSSVDQPEDISLRYTTDYNFKRWYLPKHNL  208

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             TL +FW+P +V+  DA     + + ++ L+ DEP   W+ E++  D VI SAGQWFFRP 
Sbjct  209   TLGTFWAPFLVRTTDARG-GQTLNGILTLHLDEPHPSWSAEISAFDYVIVSAGQWFFRPL  267

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG-----LVILRTFS  890
              YY+NG+++GC  C +  + + + +  Y  A RT  + +   +   G        LRTFS
Sbjct  268   IYYRNGRLLGCSACGQDNVTEVSRFQAYQAALRTTLRAITGRKGREGSGGGGTTFLRTFS  327

Query  891   PAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLL  1070
             PAHFE+G+W  GG+C RTRPF   + KLEGY LE Y+ QV EF+ A+R+    G + RLL
Sbjct  328   PAHFEHGDWTDGGSCPRTRPFGSDEKKLEGYDLEFYVAQVEEFLEAERQARADGSKIRLL  387

Query  1071  DTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             DTT +M+LRPDGHPN   +W   N   ADCVHWC+PGPIDTWNE L  V+K +
Sbjct  388   DTTRAMLLRPDGHPNRQCNWPKSNVGRADCVHWCLPGPIDTWNELLFYVMKSD  440



>gb|KCW56388.1| hypothetical protein EUGRSUZ_I02116, partial [Eucalyptus grandis]
Length=392

 Score =   353 bits (907),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 171/355 (48%), Positives = 227/355 (64%), Gaps = 14/355 (4%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGP-YYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C++F G WV  P+ P YYTN T   I D+QNCMKFGRPD  FLKWRW+PD CELP F+ 
Sbjct  38    KCDVFMGKWVYRPDVPTYYTNETCYAISDQQNCMKFGRPDMEFLKWRWEPDGCELPPFNA  97

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYKEYNF  545
              +F E+ RGK++AFVGDS+ RN MQSL CLL+SV  P  +S     D    RW   ++N 
Sbjct  98    AEFAEMARGKSIAFVGDSLGRNHMQSLLCLLSSVDQPEDISLRYTTDYNFKRWYLPKHNL  157

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             TL +FW+P +V+  DA     + + ++ L+ DEP   W+ E+   D VI S GQWFFRP 
Sbjct  158   TLGTFWAPFLVRTTDAHG-GQTLNGVLTLHLDEPHPSWSAEIGAFDYVIVSTGQWFFRPL  216

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG-------LVILRT  884
              YY+NG+++GC  C +  + + + +  Y    RT  + +   +  +G          LRT
Sbjct  217   VYYRNGRLLGCSACGQDNVTEVSRFQAYRTVLRTTLRAITGRKGCKGSGGGNGGTTFLRT  276

Query  885   FSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFR  1064
             FSPAHFE+G+W  GG+C RTRPF   + KLEGY LE Y+ QV EF+ A+R+    G + R
Sbjct  277   FSPAHFEHGDWTDGGSCPRTRPFGSDKKKLEGYDLEFYVAQVEEFLEAERQARADGSKIR  336

Query  1065  LLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LLDTT +M+LRP+GHPN   +W   N   ADCVHWC+PGPIDTWNE L  V+K +
Sbjct  337   LLDTTRAMLLRPNGHPNRQCNWPKSNVGQADCVHWCLPGPIDTWNELLFYVMKSD  391



>ref|XP_010030809.1| PREDICTED: protein trichome birefringence-like 19 [Eucalyptus 
grandis]
Length=457

 Score =   355 bits (911),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/355 (48%), Positives = 227/355 (64%), Gaps = 14/355 (4%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGP-YYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C++F G WV  P+ P YYTN T   I D+QNCMKFGRPD  FLKWRW+PD CELP F+ 
Sbjct  89    KCDVFMGKWVYRPDVPTYYTNETCYAISDQQNCMKFGRPDMEFLKWRWEPDGCELPPFNA  148

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYKEYNF  545
              +F E+ RGK++AFVGDS+ RN MQSL CLL+SV  P  +S     D    RW   ++N 
Sbjct  149   AEFAEMARGKSIAFVGDSLGRNHMQSLLCLLSSVDQPEDISLRYTTDYNFKRWYLPKHNL  208

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             TL +FW+P +V+  DA     + + ++ L+ DEP   W+ E+   D VI S GQWFFRP 
Sbjct  209   TLGTFWAPFLVRTTDAHG-GQTLNGVLTLHLDEPHPSWSAEIGAFDYVIVSTGQWFFRPL  267

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG-------LVILRT  884
              YY+NG+++GC  C +  + + + +  Y    RT  + +   +  +G          LRT
Sbjct  268   VYYRNGRLLGCSACGQDNVTEVSRFQAYRTVLRTTLRAITGRKGCKGSGGGNGGTTFLRT  327

Query  885   FSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFR  1064
             FSPAHFE+G+W  GG+C RTRPF   + KLEGY LE Y+ QV EF+ A+R+    G + R
Sbjct  328   FSPAHFEHGDWTDGGSCPRTRPFGSDKKKLEGYDLEFYVAQVEEFLEAERQARADGSKIR  387

Query  1065  LLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             LLDTT +M+LRP+GHPN   +W   N   ADCVHWC+PGPIDTWNE L  V+K +
Sbjct  388   LLDTTRAMLLRPNGHPNRQCNWPKSNVGQADCVHWCLPGPIDTWNELLFYVMKSD  442



>gb|KHN15256.1| hypothetical protein glysoja_046989 [Glycine soja]
Length=311

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 216/304 (71%), Gaps = 4/304 (1%)
 Frame = +3

Query  330   LKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS--  503
             +KWRW+P  CELP+F+  QFLE+V+GK+MAFVGDSV RNQMQS+ CLL+ V  P+ VS  
Sbjct  1     MKWRWKPSECELPIFNPFQFLEIVKGKSMAFVGDSVGRNQMQSMICLLSRVEWPIDVSYT  60

Query  504   -DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANA  680
              D    RW Y  YNFT+ +FW+PH+V++K AD    S   L NLY DE D  W  ++   
Sbjct  61    TDEYFKRWKYPSYNFTMATFWTPHLVRSKMADSHGPSNTGLFNLYLDEVDEKWTTQIEEF  120

Query  681   DVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKF  860
             D +I   G WF+RP  +Y+  KIVGCH C    +     ++GY  AFRTAFK +   E F
Sbjct  121   DYIILDGGHWFYRPMVFYEKQKIVGCHYCLLENVPDLTMFYGYRKAFRTAFKAINSLENF  180

Query  861   RGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREG  1040
             +G+V LRTF+P+HFENG WN GGNCVRT+P    + +LEG  LE+Y+ Q+ EF  A++EG
Sbjct  181   KGIVFLRTFAPSHFENGIWNQGGNCVRTKPSRSNETRLEGTNLELYMIQLEEFKKAEKEG  240

Query  1041  SKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQV  1217
              KKG++ +LLDTT++M+LRPDGHP+ YGHW  EN T   DCVHWC+PGPIDTW++FLL++
Sbjct  241   RKKGLKLKLLDTTQAMLLRPDGHPSRYGHWPQENVTLYNDCVHWCLPGPIDTWSDFLLEM  300

Query  1218  LKME  1229
             LKME
Sbjct  301   LKME  304



>ref|XP_009391262.1| PREDICTED: protein trichome birefringence-like 19 [Musa acuminata 
subsp. malaccensis]
Length=437

 Score =   351 bits (901),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 174/345 (50%), Positives = 232/345 (67%), Gaps = 8/345 (2%)
 Frame = +3

Query  201   GECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
              EC+IF+G WVP PEGPYYTN T   I+D QNCM+FGRPD  FL+WRW+P+ CELP FD 
Sbjct  96    AECDIFRGEWVPDPEGPYYTNVTCTMIQDHQNCMRFGRPDREFLQWRWKPEGCELPRFDP  155

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDA--AVGRWVYKEYNFTLL  554
              +FLEL RGK+MAFVGDS+ARN MQSL CLL+ VA P  +S+      R  Y +YNFT+ 
Sbjct  156   HRFLELARGKSMAFVGDSLARNHMQSLLCLLSGVAYPDDISNTRDENRRLFYSDYNFTVS  215

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              FWSP ++K   A  +    D+L NLY DE D  WA  +   D++I S+G WF RP  Y+
Sbjct  216   IFWSPFLIKGGAAGGV----DNLWNLYLDEVDDNWAARVQAVDILIISSGTWFTRPSIYF  271

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYG-LAFRTAFKTLLDHEKFRGLVILRTFSPAHFENG  911
             K  +  GC+ C ++    R   +     AFR+AFK +     FRG+ +LRT SP+HFENG
Sbjct  272   KKRQPFGCNYCAQSPNLTRVSVYSVNRAAFRSAFKAIGKLRGFRGVTVLRTVSPSHFENG  331

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
             +W+ GG+C RTRP  + + +LE   LEMY  QV+EF  A+RE  ++G++ +++D T +M+
Sbjct  332   KWDQGGSCNRTRPARREETRLEAVELEMYRAQVKEFERARREWERRGLQLKMMDATAAML  391

Query  1092  LRPDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             +RPDGHP+ YGH   +  +   DCVHWC+PGPID WN+ LLQ+L 
Sbjct  392   MRPDGHPDVYGHRPEQRVQLHNDCVHWCLPGPIDLWNDLLLQMLS  436



>ref|NP_197093.1| protein trichome birefringence-like 21 [Arabidopsis thaliana]
 sp|Q9LFT1.1|TBL21_ARATH RecName: Full=Protein trichome birefringence-like 21 [Arabidopsis 
thaliana]
 emb|CAC01788.1| putative protein [Arabidopsis thaliana]
 gb|AED92221.1| protein trichome birefringence-like 21 [Arabidopsis thaliana]
Length=526

 Score =   354 bits (908),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/346 (48%), Positives = 226/346 (65%), Gaps = 12/346 (3%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++F G WVP  E PYYTN T   I + QNCMK+GRPDTGF++WRW+P+ C+LP+FD ++
Sbjct  187   CDLFTGEWVPNEEAPYYTNTTCWAIHEHQNCMKYGRPDTGFMRWRWKPESCDLPIFDPQE  246

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLS  557
             FLE+VRGK M FVGDS++RNQ+QSL CLL+ V  P  +S   D     W Y  YNFTL  
Sbjct  247   FLEMVRGKAMGFVGDSISRNQVQSLLCLLSRVEYPEDISPSPDTDFKVWNYTSYNFTLHV  306

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
              WSP +VKA   DP      +  +LY DE D  W  ++   D ++ S+G WF RP  +Y+
Sbjct  307   MWSPFLVKATKPDPK----SNFFSLYLDEYDTKWTSQLDQLDYLVISSGHWFSRPVIFYE  362

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEW  917
             N +I GC  C      +    +GY  A R + K ++  E F+GL  LR+FSP HFE G W
Sbjct  363   NQQISGCQYCALPNTTELPLTYGYRKALRISLKAII--ENFKGLAFLRSFSPQHFEGGAW  420

Query  918   NSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKK-GVRFRLLDTTESMVL  1094
             N GG+CVRT+P+ +R   +    L+++  Q  EF AA+ +G KK G+R +L+DTT++M+L
Sbjct  421   NEGGDCVRTQPY-RRNETIPEADLKVHDIQREEFRAAEEDGMKKSGLRLKLMDTTQAMLL  479

Query  1095  RPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLKME  1229
             RPDGHP  YGH  + N T   DC+HWC+PGPIDT N+ LLQ++K +
Sbjct  480   RPDGHPGRYGHLQNPNVTLRNDCIHWCLPGPIDTLNDILLQMMKTD  525



>ref|XP_007148049.1| hypothetical protein PHAVU_006G176200g [Phaseolus vulgaris]
 gb|ESW20043.1| hypothetical protein PHAVU_006G176200g [Phaseolus vulgaris]
Length=400

 Score =   349 bits (895),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 173/358 (48%), Positives = 239/358 (67%), Gaps = 22/358 (6%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +CNIF GNWVP+P+ PYY+N T   I D+ NC+K GR D  FLK RW+P  CELPLFD  
Sbjct  51    KCNIFSGNWVPYPQQPYYSNQTCPFILDQLNCIKNGRSDRDFLKLRWKPHDCELPLFDAT  110

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-------DAAVGRWVYKEYN  542
             QFLELVRGK++AFVGDS+ RNQ++SL CL+ +VA P  ++       D     W   +YN
Sbjct  111   QFLELVRGKSIAFVGDSMGRNQLESLLCLINTVARPEDITAKHTSYDDIFFRWWFVADYN  170

Query  543   FTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRP  722
             FT+ + WSP +VK  D+DP   +  S   LY DEPD  W+ ++ N D V+FS GQWFFRP
Sbjct  171   FTVTTLWSPFLVKFNDSDPSGRAYYSATKLYLDEPDEAWSSKIKNFDYVVFSTGQWFFRP  230

Query  723   FFYYKNGKIVGCHRC-NETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAH  899
               +Y+ G++VGC +C N T +    +++GY  AF+TAF+TL + E F+G+  L + SP H
Sbjct  231   LTFYEKGQVVGCQKCQNSTEL----NFYGYKKAFQTAFRTLRNVEGFKGVSFLVSHSPEH  286

Query  900   FENGEWNSGGNCVRTRPFT--KRQMKLEGYTLE-MYLTQVREFMAAKREGSKKGVRFRLL  1070
             FENG WN GG+C RT+PF+  +R +   G  ++ ++  QV EF AA+    + G+RF L+
Sbjct  287   FENGAWNEGGSCNRTKPFSLEERGVYESGDIVKALHEIQVEEFNAAR----ENGLRFGLI  342

Query  1071  DTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKMETPEYN  1244
             D T++M +R DGHP+ +      NK   DCVHWC+PG +DTWNEFLL ++K+E  ++N
Sbjct  343   DITDAMAMRADGHPSRF---KPGNKNVNDCVHWCLPGAVDTWNEFLLYLMKLEGQKHN  397



>ref|NP_001057369.1| Os06g0273500 [Oryza sativa Japonica Group]
 dbj|BAC20615.1| leaf senescence protein-like [Oryza sativa Japonica Group]
 dbj|BAD68447.1| leaf senescence protein-like [Oryza sativa Japonica Group]
 dbj|BAF19283.1| Os06g0273500 [Oryza sativa Japonica Group]
 gb|EAZ36600.1| hypothetical protein OsJ_20946 [Oryza sativa Japonica Group]
 dbj|BAG97679.1| unnamed protein product [Oryza sativa Japonica Group]
Length=406

 Score =   347 bits (890),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 224/351 (64%), Gaps = 16/351 (5%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEG-----PYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELP  368
             +C+IF+G WVP         PYYTNAT  +I++ QNCMK+GRPD GFL+WRW+P+RCELP
Sbjct  55    DCDIFRGEWVPATAADDGAAPYYTNATCGEIQEHQNCMKYGRPDLGFLRWRWRPERCELP  114

Query  369   LFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKV---SDAAVGRWVYKEY  539
              FD   FL+L+RGK+MAFVGDS++RN MQSL CLL+ V +P +V   +D       Y+ +
Sbjct  115   RFDAAAFLDLLRGKSMAFVGDSLSRNHMQSLLCLLSKVENPREVPKTADPEFRAVRYESH  174

Query  540   NFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFR  719
             NFT+  F SP++V A  +DP       + +LY DEPD  WA  +A  D V+ S G WF R
Sbjct  175   NFTVAVFRSPYLVTANQSDP----AGGMWDLYLDEPDAAWATAVAGFDYVVVSTGIWFNR  230

Query  720   PFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-A  896
             P  +Y+ G++VGC+ C    +      +   LAFRTA + L     F G VI+RT SP +
Sbjct  231   PTMFYERGRLVGCYSCRLPGVPDLTLRYSLPLAFRTALRALTAASVFNGTVIVRTLSPTS  290

Query  897   HFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREF--MAAKREGSKKGVRFRLL  1070
             HFE GEW+ GG+C RTRP    + ++ G  ++ +  QV EF    A    S   VR  L+
Sbjct  291   HFEGGEWDKGGDCRRTRPTAASEARMSGLDVDFHAAQVEEFRRAEAAAAASGSAVRMLLM  350

Query  1071  DTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVL  1220
             D T +MV R DGHP+ YGHWAHEN T   DCVHWC+PGP+D WNE LLQ+L
Sbjct  351   DATAAMVARADGHPSRYGHWAHENVTLYNDCVHWCLPGPVDVWNEMLLQML  401



>gb|AFW86321.1| hypothetical protein ZEAMMB73_999343 [Zea mays]
Length=440

 Score =   347 bits (891),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/354 (49%), Positives = 226/354 (64%), Gaps = 18/354 (5%)
 Frame = +3

Query  195   PGGECNIFK-GNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPL  371
             P G C+IF+ G WVP  + PYYTN T   I++ QNCMK+GRPD GFL+WRW+PD C+LP 
Sbjct  88    PSG-CDIFRPGQWVPDDDAPYYTNLTCPLIQEHQNCMKYGRPDRGFLRWRWRPDGCDLPR  146

Query  372   FDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGRW---VYKEYN  542
             FD   FL+ VR  ++AFVGDS+ARN MQSL CLL+ VA P  VS      +    Y+ YN
Sbjct  147   FDAAAFLDAVRDTSLAFVGDSLARNHMQSLMCLLSKVAYPKDVSTTTNPEFRTMRYEAYN  206

Query  543   FTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRP  722
             FT+  FWSP +V+    DP       + ++Y DEPD  W D ++  D V+ SA  WF RP
Sbjct  207   FTMAIFWSPFLVRGHQPDPR----RHMWDIYLDEPDAAWRDAVSGFDRVVLSAATWFTRP  262

Query  723   FFYYKNG----KIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFS  890
               +Y+ G    ++VGCH C    +  R   +   +A R+A + +L   +F G VILRT S
Sbjct  263   AMFYEAGGGRVRVVGCHYCLVPGVPDRTLRYSLRMALRSALR-VLTGPRFNGTVILRTLS  321

Query  891   P-AHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAK--REGSKKGVRF  1061
             P +HFE GEW+ GG+C RTRPF   + ++ G  L+++  QV EF  A+   E S  G R 
Sbjct  322   PTSHFEGGEWDRGGDCRRTRPFAANETRVAGLDLDLHAVQVEEFSRARAEAEASGGGTRL  381

Query  1062  RLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVL  1220
              L+DTT +MVLRPDGHP+ YGHW HEN T   DCVHWC+PGPID WN+ LLQ+L
Sbjct  382   ALMDTTAAMVLRPDGHPSRYGHWPHENVTLYNDCVHWCLPGPIDAWNDMLLQML  435



>gb|KFK25826.1| hypothetical protein AALP_AA8G166300 [Arabis alpina]
Length=419

 Score =   343 bits (881),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/357 (47%), Positives = 228/357 (64%), Gaps = 7/357 (2%)
 Frame = +3

Query  174   LQSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPD  353
             LQ+  +     C+IF G WVP PEGPYY + T   I + QNCMKFGRPDT F+KW+W+PD
Sbjct  55    LQNDVVTTNENCDIFSGEWVPNPEGPYYNHTTCYAIPEYQNCMKFGRPDTEFMKWKWRPD  114

Query  354   RCE--LPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA---VG  518
              CE  +P+FD  +FLE++RGKTMA VGDSV+ N + SL CLL+ V  P+  S        
Sbjct  115   GCEDAVPVFDPWRFLEIMRGKTMAIVGDSVSNNHINSLICLLSQVEYPMDTSVVPGYRFK  174

Query  519   RWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFS  698
             RW YK YNFT+ +FW+  +VK++    L    D L ++Y DE D  W  ++ + D V+ S
Sbjct  175   RWTYKTYNFTIATFWTTFLVKSRPNPTLPRLGDDLFDVYLDEVDERWTAQIGDFDYVVMS  234

Query  699   AGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVIL  878
             +G W FR   YY+N  +VGCH C    I      +GY  A RTA   +L  E F+G++ L
Sbjct  235   SGHWHFRASIYYENQTMVGCHYCQLPNITDLTILYGYRKAHRTALNAILALENFKGVMYL  294

Query  879   RTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVR  1058
             RTF+P+HFE   WN GG+C+R +P  + + + E  T+++Y  Q+ EF  A++E  KKG+R
Sbjct  295   RTFAPSHFEGALWNEGGDCLRKQPHQRNETQDET-TIKLYNIQLEEFRRAEKEAKKKGIR  353

Query  1059  FRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
              RLLDTT++M LRPDGH   YG    E K  +DC+HWC+PGPID  N+FLL +++ E
Sbjct  354   LRLLDTTQAMWLRPDGHSGRYGRLP-EAKGRSDCIHWCLPGPIDILNDFLLAMIERE  409



>gb|KHN08438.1| hypothetical protein glysoja_014203 [Glycine soja]
Length=397

 Score =   343 bits (879),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/355 (47%), Positives = 229/355 (65%), Gaps = 17/355 (5%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             CNIF GNWVP+P+ PYY N T   I D+ NC+K GRPD  FLK RW+P  CELPLFD  Q
Sbjct  49    CNIFSGNWVPYPKEPYYNNETCPFILDQINCIKNGRPDRDFLKLRWKPHDCELPLFDATQ  108

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR-------WVYKEYNF  545
             FLELVRGK+MAFVGDS+A NQ++SL CL+ +VA P  ++             W   +YNF
Sbjct  109   FLELVRGKSMAFVGDSMATNQLESLLCLINTVAHPEDITAKYTSNDNIFFRWWFVLDYNF  168

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             T+ + WSP +VK  D+DP  +   S   LY DE D  W+ ++ + D V+FS+GQWFFRP 
Sbjct  169   TVTTMWSPFLVKFNDSDPTGLGSYSPTKLYLDEADEAWSSKIKDFDFVVFSSGQWFFRPL  228

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              +Y+N ++VGC +C  ++     +Y+GY  AFRTAF+T+   E F+GL  L T SP HFE
Sbjct  229   TFYENRQVVGCQKCENSS---ELNYYGYKKAFRTAFRTIRKLEGFKGLAFLVTHSPEHFE  285

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLE-MYLTQVREFMAAKREGSKKGVRFRLLDTTE  1082
             NG WN GG+C RT+P  ++ +   G  +E ++  Q+ EF  A     +KG+RF L+D T+
Sbjct  286   NGAWNEGGSCNRTKPLEEKGVYENGDIVEALHQIQLEEFNIA----IEKGLRFGLIDITD  341

Query  1083  SMVLRPDGHPNHYGHWAHENK--TTADCVHWCMPGPIDTWNEFLLQVLKMETPEY  1241
             +M +R D HP  +     +N      DCVHWC+PG +DTWNEFLL ++K+E  ++
Sbjct  342   AMGMRTDAHPGRFRPVGGKNSNLNLNDCVHWCLPGAVDTWNEFLLYLMKLEAEKH  396



>ref|XP_003547168.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN18907.1| hypothetical protein glysoja_036086 [Glycine soja]
Length=404

 Score =   342 bits (877),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/353 (49%), Positives = 228/353 (65%), Gaps = 19/353 (5%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             CNIF GNWVP+P+ PYY N T   I D+ NC+K GRPD  FLK RW+P  CELPLFD  Q
Sbjct  49    CNIFSGNWVPYPKEPYYNNETCPFILDQINCIKNGRPDRDFLKLRWKPHHCELPLFDATQ  108

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR-------WVYKEYNF  545
             FLELVRGK+MAFVGDS+ RNQ++SL CL+ +VA P  +++            W   +YNF
Sbjct  109   FLELVRGKSMAFVGDSMGRNQLESLLCLINTVAHPEDITEKYTSNDNIFFRWWFVPDYNF  168

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             T+ + WSP +VK  D+DP      S   LY +E D  W  ++ + D V+FS GQWFFRP 
Sbjct  169   TVTTMWSPFLVKFNDSDPTGRGFYSATKLYLEEADEAWRSKIKDFDFVVFSTGQWFFRPL  228

Query  726   FYYKNGKIVGCHRC-NETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHF  902
              +Y+ G++VGC +C N T +    +Y+GY  AF+TAF+T+   E F+GL  L T SP HF
Sbjct  229   TFYEKGQVVGCQKCENSTEL----NYYGYKKAFQTAFRTIRKLEGFKGLAFLVTHSPEHF  284

Query  903   ENGEWNSGGNCVRTRPFTKRQMKLEGYTLE-MYLTQVREFMAAKREGSKKGVRFRLLDTT  1079
             ENG WN GG C RT+PF ++ +   G  +E ++  QV EF AA+    +KG+RF L+D T
Sbjct  285   ENGAWNEGGTCNRTKPFEEKGVYENGDIVEALHQIQVEEFNAAR----EKGLRFGLIDIT  340

Query  1080  ESMVLRPDGHPNHY--GHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLKMET  1232
             ++M +R D HP  +  G   + N    DCVHWC PG +DTWNEFLL ++K+E 
Sbjct  341   DAMGMRADAHPGRFRLGGNNNNNLNVNDCVHWCSPGAVDTWNEFLLYLMKLEA  393



>gb|EEC80380.1| hypothetical protein OsI_22500 [Oryza sativa Indica Group]
Length=405

 Score =   342 bits (877),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 223/351 (64%), Gaps = 17/351 (5%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEG-----PYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELP  368
             +C+IF+G WVP         PYYTNAT  +I++ QNCMK+GRPD GFL+WRW+P+RCELP
Sbjct  55    DCDIFRGEWVPATAADDGAAPYYTNATCGEIQEHQNCMKYGRPDLGFLRWRWRPERCELP  114

Query  369   LFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKV---SDAAVGRWVYKEY  539
              FD   FL+L+RGK+MAFVGDS++RN MQSL CLL+ V +P +V   +D       Y+ +
Sbjct  115   RFDAAAFLDLLRGKSMAFVGDSLSRNHMQSLLCLLSKVENPREVPKTADPEFRAVRYESH  174

Query  540   NFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFR  719
             NFT+  F SP++V A  +DP       + +LY DEPD  WA  +A  D V+ S G WF R
Sbjct  175   NFTVAVFRSPYLVTANQSDP----AGGMWDLYLDEPDAAWATAVAGFDYVVVSTGIWFNR  230

Query  720   PFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-A  896
             P  +Y+ G++VGC+ C    +      +    AFRTA +  L    F G VI+RT SP +
Sbjct  231   PTMFYERGRLVGCYSCRLPGVPDLTLRYSLPAAFRTALRA-LTAGVFNGTVIVRTLSPTS  289

Query  897   HFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREF--MAAKREGSKKGVRFRLL  1070
             HFE GEWN GG+C RTRP    + ++ G  ++ +  QV EF    A    S   VR  L+
Sbjct  290   HFEGGEWNKGGDCRRTRPTAASEARMSGLDVDFHAAQVEEFRRAEAAAAASGSAVRMLLM  349

Query  1071  DTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVL  1220
             D T +MV R DGHP+ YGHWAHEN T   DCVHWC+PGP+D WNE LLQ+L
Sbjct  350   DATAAMVARADGHPSRYGHWAHENVTLYNDCVHWCLPGPVDVWNEMLLQML  400



>dbj|BAK06440.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=412

 Score =   342 bits (877),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 169/346 (49%), Positives = 220/346 (64%), Gaps = 9/346 (3%)
 Frame = +3

Query  207   CNIFKGNWVPFPEG-PYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             C+IF+G WVP     PYYTN T   I++ QNCMK+GRPD GFL+WRW+P +CELP FD  
Sbjct  66    CDIFRGEWVPDNGAEPYYTNRTCPLIQEHQNCMKYGRPDLGFLRWRWRPAQCELPRFDAA  125

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGRW---VYKEYNFTLL  554
              F + VRG++MAFVGDS+ARN MQSL CLL+ +  P  +S      +    Y+ YNFT+ 
Sbjct  126   AFFDAVRGRSMAFVGDSLARNHMQSLMCLLSKLEYPKDISTTKNQEFRTLYYESYNFTIS  185

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             +FWSP +VKA  +D  + S   L N+Y DEPD  W   +A AD +I SA  WF RP  +Y
Sbjct  186   TFWSPFLVKANQSDADYGS-GRLWNIYLDEPDDAWLPGVAGADYLILSAANWFTRPSLFY  244

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             ++G++V CH C    +          +AFRT  + +  H  F G  I+RT SP HFE GE
Sbjct  245   ESGRLVACHYCLIPGVPDLTLRHSQRVAFRTVLQAVTSHPGFNGTAIVRTVSPTHFEGGE  304

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQV---REFMAAKREGSKKGVRFRLLDTTES  1085
             WN GG+C RTRP+   + ++ G +L+ +  QV    +   A R     G R  L+DTT +
Sbjct  305   WNKGGDCRRTRPYAANETRMAGLSLDFHTAQVEEFAQAEEAARRRGGGGARLVLMDTTAA  364

Query  1086  MVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVL  1220
             M+LRPDGHP+ YGHWAHEN T   DCVHWC+PGPID WNE LLQ++
Sbjct  365   MLLRPDGHPSRYGHWAHENVTLYKDCVHWCLPGPIDAWNEMLLQMV  410



>ref|NP_001057366.1| Os06g0272900 [Oryza sativa Japonica Group]
 dbj|BAD68439.1| leaf senescence protein-like [Oryza sativa Japonica Group]
 dbj|BAF19280.1| Os06g0272900 [Oryza sativa Japonica Group]
 gb|EAZ00474.1| hypothetical protein OsI_22496 [Oryza sativa Indica Group]
Length=438

 Score =   341 bits (874),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 173/346 (50%), Positives = 217/346 (63%), Gaps = 16/346 (5%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEG---PYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLF  374
             +C+IF+G WVP   G   PYYTN +   I++ QNCMK+GRPD GFL+WRW+P+RCELP F
Sbjct  80    DCDIFRGEWVPDDGGGAAPYYTNESCPLIQEHQNCMKYGRPDLGFLRWRWRPERCELPRF  139

Query  375   DGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNF  545
             D   FLELVRGK+MAFVGDS+ARN MQSL CLL+ V  P  VS   D       Y  +NF
Sbjct  140   DAAAFLELVRGKSMAFVGDSLARNHMQSLMCLLSKVEYPKDVSKTTDPGFRTMHYGSHNF  199

Query  546   TLLSFWSPHIVKA-KDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRP  722
             T+  FWSP++V A + +DP   +   L +LY DEPD  WA  +A  D  + SA  WF RP
Sbjct  200   TIAVFWSPYLVTANQSSDP---AAGGLWDLYLDEPDAAWAVAVAGFDYAVVSAANWFTRP  256

Query  723   FFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEK----FRGLVILRTFS  890
               +++ G++VGCH C    +      +    AFRTA + L         F G  I+RT S
Sbjct  257   SMFHERGRLVGCHYCLVPGVPDLTLRYSLRAAFRTALRALAAGAGGAGVFNGTAIVRTLS  316

Query  891   P-AHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRL  1067
             P +HFE GEWN GG+C RTRP T  + ++ G  L+ +  QV EF  A     +   R  L
Sbjct  317   PTSHFEGGEWNKGGDCRRTRPSTANETRMSGLDLDFHTAQVEEFRRAAMASGRSAARLLL  376

Query  1068  LDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNE  1202
             +DTT +MVLRPDGHP+ YGHWAHE  T   DCVHWC+PGPID WNE
Sbjct  377   MDTTAAMVLRPDGHPSRYGHWAHEKVTLYNDCVHWCLPGPIDVWNE  422



>ref|XP_002458240.1| hypothetical protein SORBIDRAFT_03g029740 [Sorghum bicolor]
 gb|EES03360.1| hypothetical protein SORBIDRAFT_03g029740 [Sorghum bicolor]
Length=406

 Score =   339 bits (870),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 161/344 (47%), Positives = 222/344 (65%), Gaps = 6/344 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF+G WVP  E PYY + T   I++ QNC+K+GRPD GFLKWRW+P  C+LP FD  Q
Sbjct  61    CDIFRGEWVPDAEAPYYNHKTCHMIQEHQNCLKYGRPDLGFLKWRWRPSGCDLPRFDPLQ  120

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLLS  557
             FL+ VRGK++AFVGDS+ARN MQSL CLL+ VA P  +S     +   + Y+ YNFT+  
Sbjct  121   FLQFVRGKSLAFVGDSLARNHMQSLLCLLSQVAYPKDLSANPSDQNKVYHYRAYNFTISM  180

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP +V+A++ D    +     +LY DE D  W  +++  D V+ SA  WF RP  +Y+
Sbjct  181   FWSPFLVRAREPDHDGPAHTGHWSLYLDEADDKWVSQISRFDYVLVSAANWFSRPSLFYE  240

Query  738   NGKIVGCHRCN-ETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-AHFENG  911
               +++GC  C+ +  +     Y+    A+R A + + D E  RG VI+R  SP +HFENG
Sbjct  241   KRRLIGCSFCSRQYGVPDLTLYYSQRRAWRVALRAINDLEHLRGRVIVRMLSPMSHFENG  300

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              W+ GG+C RT+P    Q  +EG  L  Y  Q+ EF AA++  S KG R  L+D T +M+
Sbjct  301   TWDHGGDCKRTQPLRGNQTTMEGRDLHFYTAQMEEFRAAEKVASDKGRRLMLMDATAAML  360

Query  1092  LRPDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQVL  1220
             +RPDGHP+ YGHWA+E  +   DC+HWC+PGPID WN+ L Q+L
Sbjct  361   MRPDGHPSRYGHWANEKVQLYNDCIHWCLPGPIDIWNDMLFQML  404



>gb|EMS53497.1| hypothetical protein TRIUR3_18620 [Triticum urartu]
Length=412

 Score =   338 bits (867),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/346 (48%), Positives = 219/346 (63%), Gaps = 9/346 (3%)
 Frame = +3

Query  207   CNIFKGNWVPFPEG-PYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             C+IF+G WVP   G PYYTN T   I++ QNCMK+GRPD GFL+WRW+P +CELP FD  
Sbjct  66    CDIFRGEWVPDDGGEPYYTNRTCPLIQEHQNCMKYGRPDLGFLRWRWRPAQCELPRFDAA  125

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGRW---VYKEYNFTLL  554
              F + VRG++MAFVGDS+ARN MQSL CLL+ +  P  +S      +    Y+ YNFT+ 
Sbjct  126   AFFDAVRGRSMAFVGDSLARNHMQSLMCLLSKLEYPKDISTTKNQEFRTLYYESYNFTIS  185

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
             +FWSP +VKA  +D  + S   L N+Y DEPD  W   +A A  ++ S   WF RP  +Y
Sbjct  186   TFWSPFLVKANQSDADYGS-GRLWNIYLDEPDDAWLPGVAGAVSLVLSGANWFTRPSLFY  244

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGE  914
             ++G++V CH C    +          +AFRT  + +  H  F G  I+RT SP HFE GE
Sbjct  245   ESGRLVPCHYCLVPGVPDLTLRHSQRVAFRTVLRAVTSHPGFNGTAIVRTVSPTHFEGGE  304

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQV---REFMAAKREGSKKGVRFRLLDTTES  1085
             WN GG+C RTRP+   + ++ G +L+ +  QV    +   A R     G R  L+DTT +
Sbjct  305   WNKGGDCRRTRPYAANETRMAGLSLDFHTAQVEEFAQAEEAARRRGGGGARLVLMDTTAA  364

Query  1086  MVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVL  1220
             M+LRPDGHP+ YGHWAHEN T   DCVHWC+PGPID WNE LLQ++
Sbjct  365   MLLRPDGHPSRYGHWAHENVTLYKDCVHWCLPGPIDAWNEMLLQMV  410



>ref|XP_004969337.1| PREDICTED: uncharacterized protein LOC101767478 [Setaria italica]
Length=405

 Score =   337 bits (865),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/344 (46%), Positives = 219/344 (64%), Gaps = 6/344 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF+G WVP  E PYY + T   I++ QNC+K+GRPD GFLKWRW+P  CELP FD  Q
Sbjct  60    CDIFRGEWVPDTEAPYYNHKTCHMIQEHQNCLKYGRPDLGFLKWRWRPSGCELPRFDPLQ  119

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLLS  557
             FL+  RGK++AFVGDS+ARN MQSL CLL+ VA P  VS     +   + Y+ YNFT+  
Sbjct  120   FLQFARGKSLAFVGDSLARNHMQSLLCLLSQVAYPKDVSANPTDQNKVYHYRAYNFTISM  179

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP +V+ +  D    +     +LY DEPD  W  +++  D V+ SA  WF RP  +Y+
Sbjct  180   FWSPFLVRTRAPDNDGPAHMGHWSLYLDEPDESWVSQISRFDYVLVSAANWFSRPSLFYE  239

Query  738   NGKIVGCHRCN-ETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-AHFENG  911
               +++GC  C+ +  +     Y+    A+R A + + D E  RG VI+R  SP +HFENG
Sbjct  240   KRRLIGCSFCSRQYGVPDLTLYYSQRRAWRVALRAINDLEHLRGRVIVRMLSPMSHFENG  299

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              W+ GG+C RT+P    +  +EG  L  Y  Q+ EF AA++   +KG R  L+D T +M+
Sbjct  300   TWDQGGDCRRTQPLRANETAMEGRDLHFYTAQMEEFRAAEKAAREKGRRLMLMDATAAML  359

Query  1092  LRPDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQVL  1220
             +RPDGHP+ YGHW +E  +   DC+HWC+PGPID WN+ L Q+L
Sbjct  360   MRPDGHPSRYGHWPNEKVQLYNDCIHWCLPGPIDIWNDMLFQML  403



>ref|XP_002438227.1| hypothetical protein SORBIDRAFT_10g009930 [Sorghum bicolor]
 gb|EER89594.1| hypothetical protein SORBIDRAFT_10g009930 [Sorghum bicolor]
Length=441

 Score =   337 bits (863),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/356 (48%), Positives = 219/356 (62%), Gaps = 22/356 (6%)
 Frame = +3

Query  195   PGGECNIFK-GNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPL  371
             P G C+IF+ G WVP  + PYYTN T   I++ QNCMK+GRPD GFL+WRW+PD C+LP 
Sbjct  89    PSG-CDIFRPGEWVPDDDAPYYTNLTCPFIQEHQNCMKYGRPDRGFLRWRWRPDGCDLPR  147

Query  372   FDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGRW---VYKEYN  542
             FD   F + VR  ++AFVGDS+ARN MQSL CLL+ VA P  +S      +    Y+ YN
Sbjct  148   FDAAAFFDAVRNSSLAFVGDSLARNHMQSLMCLLSKVAHPKDISTTTNPEFRTMRYEAYN  207

Query  543   FTLLSFWSPHIVKAKDADP---LWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWF  713
             FT+  FWSP +V+    DP   +W       ++Y DEPD  W D ++  D V+ S   WF
Sbjct  208   FTMAIFWSPFLVRGHQPDPRRWMW-------DIYLDEPDAEWRDAVSGFDRVVLSTATWF  260

Query  714   FRP-FFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLL-DHEKFRGLVILRTF  887
              RP  FY   G++VGCH C    +      +   +A RTA + L     + +G VILRT 
Sbjct  261   TRPAMFYAGGGRVVGCHYCLVRGVPDLTLRYSLRMALRTALRVLTAGPRRIKGTVILRTL  320

Query  888   SP-AHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKG---V  1055
             SP +HFE GEW+ GG+C RTRP    + ++ G  L+++  QV EF  AK E    G    
Sbjct  321   SPTSHFEGGEWDRGGDCRRTRPSAANETRVAGLDLDLHAVQVEEFARAKAEAEASGGGTT  380

Query  1056  RFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVL  1220
             R  L+DTT +MVLRPDGHP+ YGHW HE  T   DCVHWC+PGPID WN+ LLQ+L
Sbjct  381   RLVLMDTTAAMVLRPDGHPSRYGHWPHEKVTLYNDCVHWCLPGPIDAWNDMLLQML  436



>ref|NP_001144354.1| uncharacterized protein LOC100277263 [Zea mays]
 gb|ACG39806.1| hypothetical protein [Zea mays]
Length=406

 Score =   334 bits (856),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 163/344 (47%), Positives = 222/344 (65%), Gaps = 6/344 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF+G WVP  E PYY + T   I++ QNC+K+GRPD GFLKWRW+P  CELP FD  Q
Sbjct  61    CDIFRGEWVPDAEAPYYNHKTCHMIQEHQNCLKYGRPDLGFLKWRWRPSGCELPRFDPLQ  120

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLLS  557
             FL+  RGK++AFVGDS+ARN MQSL CLL+ VA P  +S     +   + Y+ YNFT+  
Sbjct  121   FLQFARGKSLAFVGDSLARNHMQSLLCLLSQVAYPKDLSANPSDQNKVYHYRAYNFTISM  180

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP +V+A++ D    +     +LY DEPD  W  +M   D V+ SA  WF RP  +Y+
Sbjct  181   FWSPFLVRAREPDHDGPAHTGHWSLYLDEPDDKWVSQMPRFDYVLVSAANWFSRPSLFYE  240

Query  738   NGKIVGCHRCN-ETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-AHFENG  911
               ++VGC  C+ +  +     Y+    A+R A + + D E+ RG VILR  SP +HFENG
Sbjct  241   RRRLVGCSFCSRQYGVPDLTLYYSQRRAWRVALRAINDLERLRGRVILRMLSPMSHFENG  300

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              W+ GG+C RT+P    Q  +EG  L  Y  Q+ EF AA++  ++KG R  L+D T +M+
Sbjct  301   TWDHGGDCRRTQPLRANQTAMEGRDLHFYTAQMEEFRAAEKAAAEKGRRLMLMDATAAML  360

Query  1092  LRPDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQVL  1220
             +RPDGHP+ YGHW +E  +   DC+HWC+PGPID WN+ L Q+L
Sbjct  361   MRPDGHPSRYGHWPNEKVQLYNDCIHWCLPGPIDIWNDMLFQML  404



>emb|CDM83559.1| unnamed protein product [Triticum aestivum]
Length=404

 Score =   334 bits (856),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 156/344 (45%), Positives = 219/344 (64%), Gaps = 6/344 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF+G WVP  E PYY + T   I++ QNC+K+GRPD GFLKWRW+P  CELP FD  Q
Sbjct  59    CDIFRGEWVPDAEAPYYNHKTCGMIQEHQNCLKYGRPDLGFLKWRWRPSGCELPRFDPVQ  118

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLLS  557
             FL+ VR K++AFVGDS+ARN MQSL CLL+ VA P  +S     +   + Y+ YNFT+  
Sbjct  119   FLQFVRHKSLAFVGDSLARNHMQSLLCLLSQVAYPKDISANPTDQNKVYYYRAYNFTINM  178

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP +V+A++ D    +     +LY DEPD  W  ++   D V+ SA  WF RP  +Y+
Sbjct  179   FWSPFLVRAREPDHDDPAHTGHYSLYLDEPDDKWVSQVPRFDYVLVSAANWFSRPSLFYE  238

Query  738   NGKIVGCHRCN-ETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-AHFENG  911
               +++GC  C+ +  +     Y+    A+R A + +   +  +G VI+R  SP +HFENG
Sbjct  239   KRRLIGCSFCSRQYGVPDLTLYYSQRKAWRVALRAINALDGVKGRVIVRMLSPMSHFENG  298

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              W+ GGNC RT P    Q  +EG  L+ Y  Q+ E+ AA++    KG+R  L+D T +M+
Sbjct  299   TWDQGGNCKRTEPIRSNQTVMEGRDLQFYTAQMEEYRAAEKAARPKGLRLMLMDATAAML  358

Query  1092  LRPDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQVL  1220
             +RPDGHP+ YGHW +E  +   DC+HWC+PGPID WN+ L Q++
Sbjct  359   MRPDGHPSRYGHWPNEKVQLYNDCIHWCLPGPIDIWNDLLFQMM  402



>gb|ACG34463.1| hypothetical protein [Zea mays]
 gb|ACN26237.1| unknown [Zea mays]
 tpg|DAA58311.1| TPA: putative DUF231 domain containing family protein [Zea mays]
Length=406

 Score =   333 bits (853),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/344 (47%), Positives = 222/344 (65%), Gaps = 6/344 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF+G WVP  E PYY + T   I++ QNC+K+GRPD GFLKWRW+P  CELP FD  Q
Sbjct  61    CDIFRGEWVPDAEAPYYNHKTCHMIQEHQNCLKYGRPDLGFLKWRWRPSGCELPRFDPLQ  120

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLLS  557
             FL+  RGK++AFVGDS+ARN MQSL CLL+ VA P  +S     +   + Y+ YNFT+  
Sbjct  121   FLQFARGKSLAFVGDSLARNHMQSLLCLLSQVAYPKDLSANPSDQNKVYHYRAYNFTISM  180

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP +V+A++ D    +     +LY DEPD  W  +M   D V+ SA  WF RP  +Y+
Sbjct  181   FWSPFLVRAREPDHDGPAHTGHWSLYLDEPDDKWVSQMPRFDYVLVSAANWFSRPSLFYE  240

Query  738   NGKIVGCHRCN-ETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-AHFENG  911
               ++VGC  C+ +  +     Y+    A+R A + + D E+ RG VI+R  SP +HFENG
Sbjct  241   RRRLVGCSFCSRQYGVPDLTLYYSQRRAWRVALRAINDLERLRGRVIVRMLSPMSHFENG  300

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              W+ GG+C RT+P    Q  +EG  L  Y  Q+ EF AA++  ++KG R  L+D T +M+
Sbjct  301   TWDHGGDCRRTQPLRANQTAMEGRDLHFYTAQMEEFRAAEKAAAEKGRRLMLMDATAAML  360

Query  1092  LRPDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQVL  1220
             +RPDGHP+ YGHW +E  +   DC+HWC+PGPID WN+ L Q+L
Sbjct  361   MRPDGHPSRYGHWPNEKVQLYNDCIHWCLPGPIDIWNDMLFQML  404



>ref|XP_006644448.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=404

 Score =   331 bits (848),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 156/344 (45%), Positives = 219/344 (64%), Gaps = 6/344 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF+G WVP  E PYY + T   I++ QNC+K+GRPD GFLKWRW+P  CELP FD  Q
Sbjct  59    CDIFRGEWVPDLEAPYYNHKTCYMIQEHQNCLKYGRPDLGFLKWRWRPSGCELPRFDPVQ  118

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLLS  557
             FL+  R K++AFVGDS+ARN MQSL CLL+ V+ P  +S     +   + Y+ YNFT+  
Sbjct  119   FLQFARHKSLAFVGDSLARNHMQSLLCLLSQVSYPKDISANPSTQNKVYHYRAYNFTISM  178

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP +V+A++ D    +     +LY DEPD+ W  E++  D V+ SA  WF RP  +Y+
Sbjct  179   FWSPFLVRAREPDHDGPAHTGHWSLYLDEPDQSWVSEISRFDYVLVSAANWFSRPSLFYE  238

Query  738   NGKIVGCHRCN-ETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-AHFENG  911
               ++VGC  C+ +  +     Y+    A+R + K + D E  RG VI+R  SP +HFENG
Sbjct  239   KRRLVGCSFCSRQYGVPALTLYYSQRRAWRVSLKAINDLENLRGRVIVRMLSPMSHFENG  298

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              W+ GG+C RT+P    +  +EG  L  Y  Q+ E+ AA++    KG R  L+D T +M+
Sbjct  299   TWDQGGDCKRTQPLRSNETVMEGRDLHFYTAQMEEYRAAEKVAEAKGRRMMLMDATAAML  358

Query  1092  LRPDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQVL  1220
             +RPDGHP+ YGH  ++  +   DC+HWC+PGPID WN+ L Q+L
Sbjct  359   MRPDGHPSRYGHLPNQKVQLYNDCIHWCLPGPIDIWNDMLFQML  402



>gb|EMT28803.1| hypothetical protein F775_32535 [Aegilops tauschii]
Length=405

 Score =   330 bits (846),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/345 (46%), Positives = 219/345 (63%), Gaps = 7/345 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF+G WVP  E PYY + T   I++ QNC+K+GRPD GFLKWRW+P  CELP FD  Q
Sbjct  59    CDIFRGEWVPDAEAPYYNHKTCGMIQEHQNCLKYGRPDLGFLKWRWRPSGCELPRFDPVQ  118

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLLS  557
             FL+ VR K++AFVGDS+ARN MQSL CLL+ VA P  +S     +   + Y+ YNFT+  
Sbjct  119   FLQFVRHKSLAFVGDSLARNHMQSLLCLLSQVAYPKDISANPTDQNKVYHYRAYNFTINM  178

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP +V+A++ D    +     +LY DEPD  W  ++   D V+ SA  WF RP  +Y+
Sbjct  179   FWSPFLVRAREPDHDDPAHTGHYSLYLDEPDDKWVSQVPRFDYVLVSAANWFSRPSLFYE  238

Query  738   NGKIVGCHRCN-ETAIKKRNHYFGYGLAFRTAFKTLLDHE-KFRGLVILRTFSP-AHFEN  908
               +++GC  C+ +  +     Y+    A+R A + +   E K +  VI+R  SP +HFEN
Sbjct  239   KRRLIGCSFCSRQYGVPDLTLYYSQRKAWRVALRAINALEGKVKARVIVRMLSPMSHFEN  298

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G W+ GGNC RT P    Q  +EG  L+ Y  Q+ E+ AA++    KG+R  L+D T +M
Sbjct  299   GTWDQGGNCKRTEPVRSNQTVMEGRDLQFYTAQMEEYRAAEKTARTKGLRLMLMDATAAM  358

Query  1089  VLRPDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQVL  1220
             ++RPDGHP+ YGHW +E  +   DC+HWC+PGPID WN+ L Q++
Sbjct  359   LMRPDGHPSRYGHWPNEKVQLYNDCIHWCLPGPIDIWNDLLFQMM  403



>ref|NP_001172486.1| Os01g0652800 [Oryza sativa Japonica Group]
 dbj|BAB86576.1| leaf senescence protein-like [Oryza sativa Japonica Group]
 dbj|BAB90425.1| leaf senescence protein-like [Oryza sativa Japonica Group]
 gb|EAY75204.1| hypothetical protein OsI_03095 [Oryza sativa Indica Group]
 gb|EAZ12926.1| hypothetical protein OsJ_02847 [Oryza sativa Japonica Group]
 dbj|BAG87757.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96590.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91216.1| Os01g0652800 [Oryza sativa Japonica Group]
Length=404

 Score =   330 bits (846),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/344 (46%), Positives = 218/344 (63%), Gaps = 6/344 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF+G WVP  + PYY + T   I++ QNC+K+GRPD  FLKWRW+P  CELP FD  Q
Sbjct  59    CDIFRGEWVPDSDAPYYNHKTCYMIQEHQNCLKYGRPDLEFLKWRWRPSGCELPRFDPVQ  118

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLLS  557
             FL+  R K++AFVGDS+ARN MQSL CLL+ VA P  +S     +   + Y+ YNFT+  
Sbjct  119   FLQFNRHKSLAFVGDSLARNHMQSLLCLLSQVAYPKDMSANPTTQNKVYHYRGYNFTVSM  178

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP +VKA++ D    +     +LY DEPD+ W  E++  D V+ SA  WF RP  +Y+
Sbjct  179   FWSPFLVKAREPDHDGPAHTGHWSLYLDEPDQSWVSEISRFDYVLVSAANWFSRPSLFYE  238

Query  738   NGKIVGCHRCN-ETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-AHFENG  911
               ++VGC  C+ +  +     Y+    A+R A K + D E  RG VI+R  SP +HFENG
Sbjct  239   KRRLVGCSFCSRQYGVPDLTLYYSQRRAWRVALKAINDLESLRGRVIVRMLSPMSHFENG  298

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMV  1091
              W+ GGNC RT+P    +  +EG  L  Y  Q+ E+ AA++    KG R  L+D T +M+
Sbjct  299   TWDQGGNCKRTQPLRSNETVMEGRDLHFYTAQMEEYRAAEKVAEAKGRRMMLMDATAAML  358

Query  1092  LRPDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQVL  1220
             +RPDGHP+ YGH  ++  +   DC+HWC+PGPID WN+ L Q+L
Sbjct  359   MRPDGHPSRYGHLPNQKVQLYNDCIHWCLPGPIDIWNDMLFQML  402



>ref|XP_006644449.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=393

 Score =   329 bits (844),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 173/383 (45%), Positives = 232/383 (61%), Gaps = 20/383 (5%)
 Frame = +3

Query  114   TTLVIFATFCFTSY--NISDSLLQSFNLF---PGGECNIFKGNWVPFPEGPYYTNATKCD  278
             + LV+ + F    Y   +S + L S+  +   P   C+IF+G WVP    P YTN T   
Sbjct  17    SALVVLSCFKSVPYLSRMSSTELPSYMSYFESPIPRCDIFQGEWVPDEASPEYTNETCSY  76

Query  279   IEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQS  458
             I++ QNCM +GRPD  FLKWRW+P  CELP FD  +FL LV  KT+AFVGDS+ARN MQS
Sbjct  77    IQEHQNCMMYGRPDLEFLKWRWKPAGCELPRFDPDKFLRLVSNKTLAFVGDSLARNHMQS  136

Query  459   LKCLLASVADPVKVSDAAVGR------WVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDS  620
             L CLL+ VA P  VS    G+        Y+ YNFT+  FWSP +V+A+++     SP +
Sbjct  137   LLCLLSKVATPKDVS--VTGKTDPNKMLYYEGYNFTIYIFWSPFLVRAEESAE---SPGA  191

Query  621   LMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHY  800
               NLY DEPD  W   +A  D V+FSA  WF RP  +Y++G++VG               
Sbjct  192   F-NLYLDEPDCKWFARVARLDYVLFSAANWFTRPSVFYESGRLVGGSYVALNITSDLTLR  250

Query  801   FGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-AHFENGEWNSGGNCVRTRPFTKRQMKLE  977
               + +AFRTA + + D  +FRG  I+RT SP +HFE G W+ GG+C RTRP+   +  + 
Sbjct  251   HSHRMAFRTALRAINDI-RFRGRAIVRTLSPMSHFEGGAWDKGGDCRRTRPYRGNETAMG  309

Query  978   GYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-A  1154
             G  L+ Y +QV EF  A+RE +  GV   L+D T +M+LRPDGHP+ YGHW  E +    
Sbjct  310   GLDLDFYTSQVEEFREAQREAAANGVDIVLMDPTGAMLLRPDGHPSRYGHWPDEKRVLYN  369

Query  1155  DCVHWCMPGPIDTWNEFLLQVLK  1223
             DC+HWC+PGP+D WN+ LL +L 
Sbjct  370   DCIHWCLPGPVDAWNDMLLHMLS  392



>ref|XP_003569468.1| PREDICTED: protein trichome birefringence-like 19 [Brachypodium 
distachyon]
Length=405

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/345 (46%), Positives = 219/345 (63%), Gaps = 7/345 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF+G WVP  E PYY + T   I++ QNC+K+GRPD GFLKWRW+P  CELP FD  Q
Sbjct  59    CDIFRGEWVPDTEAPYYNHKTCYMIQEHQNCLKYGRPDLGFLKWRWRPSGCELPRFDPVQ  118

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLLS  557
             FL+  R K++AFVGDS+ARN MQSL CLL+ VA P  +S     +   + Y+ YNFT+  
Sbjct  119   FLQFARHKSLAFVGDSLARNHMQSLLCLLSQVAYPKDMSANPTDQNKVYYYRAYNFTINM  178

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP +V+A++ D    +     +LY DEPD  W  ++   D V+ SA  WF RP  +Y+
Sbjct  179   FWSPFLVRAREPDHDDPAHTGHYSLYLDEPDDKWVSQVPRFDYVLVSAANWFSRPSLFYE  238

Query  738   NGKIVGCHRCN-ETAIKKRNHYFGYGLAFRTAFKTLLDHE-KFRGLVILRTFSP-AHFEN  908
               ++VGC  C+ +  +     Y+    A+R + + +   + K +G VI+R  SP +HFEN
Sbjct  239   KRRLVGCSFCSRQYGVPDLTLYYSQRKAWRVSLQAINALQGKVKGRVIVRMLSPMSHFEN  298

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G W+ GGNC RT P    Q  +EG  L+ Y  Q+ E+ AA++    KGVR  L+D T +M
Sbjct  299   GTWDQGGNCKRTEPLRSNQTVMEGRDLQFYTAQMEEYRAAEKTAKAKGVRMMLMDATAAM  358

Query  1089  VLRPDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQVL  1220
             ++RPDGHP+ YGHW +E  +   DC+HWC+PGPID WN+ L Q++
Sbjct  359   LMRPDGHPSRYGHWPNEKVQLYNDCIHWCLPGPIDIWNDLLFQMI  403



>ref|NP_001043741.1| Os01g0653100 [Oryza sativa Japonica Group]
 dbj|BAB86580.1| leaf senescence protein-like [Oryza sativa Japonica Group]
 dbj|BAB90429.1| leaf senescence protein-like [Oryza sativa Japonica Group]
 dbj|BAF05655.1| Os01g0653100 [Oryza sativa Japonica Group]
 gb|EAY75205.1| hypothetical protein OsI_03096 [Oryza sativa Indica Group]
 gb|EAZ12927.1| hypothetical protein OsJ_02848 [Oryza sativa Japonica Group]
Length=393

 Score =   328 bits (842),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 171/383 (45%), Positives = 228/383 (60%), Gaps = 20/383 (5%)
 Frame = +3

Query  114   TTLVIFATFCFTSY--NISDSLLQSFNLF---PGGECNIFKGNWVPFPEGPYYTNATKCD  278
             + LV+ + F    Y   +S S L S+  +   P  +C+IF+G WVP    P YTN T   
Sbjct  17    SALVVLSCFKSVPYLSRMSSSELPSYMSYFESPISKCDIFQGEWVPDESSPQYTNLTCSY  76

Query  279   IEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQS  458
             I++ QNCM +GRPD  FLKWRW+P  C+LP FD  +FL LV  KT+AFVGDS+ARN MQS
Sbjct  77    IQEHQNCMMYGRPDLEFLKWRWKPAGCDLPRFDPDKFLRLVGNKTLAFVGDSLARNHMQS  136

Query  459   LKCLLASVADPVKVSDAAVGR------WVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDS  620
             L CLL+ VA P  VS    G+        Y+ YNFT+  FWSP +V+ +++         
Sbjct  137   LLCLLSKVATPKDVS--VTGKTDPDKILYYEGYNFTIHIFWSPFLVRTEES----AESPG  190

Query  621   LMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHY  800
             +  LY DEPD  W   +A  D VIFS   WF RP  +Y+NG++VG               
Sbjct  191   VFKLYLDEPDCKWFARVARFDYVIFSGANWFTRPSLFYENGRLVGGSYVALNITSDLTLR  250

Query  801   FGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-AHFENGEWNSGGNCVRTRPFTKRQMKLE  977
               + +AFRTA + + D  +FRG  I+RT SP +HFE G W+ GG+C RTRP+   +  + 
Sbjct  251   HSHRMAFRTALRAIND-IRFRGKAIVRTLSPMSHFEGGAWDKGGDCRRTRPYRGNETAMG  309

Query  978   GYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-A  1154
             G  LE Y +QV EF  A+RE +  GV   L+D T +M+LRPDGHP+ YGHW  E +    
Sbjct  310   GMDLEFYTSQVEEFREAQREAAANGVDMVLMDPTAAMLLRPDGHPSRYGHWPDEKRVLYN  369

Query  1155  DCVHWCMPGPIDTWNEFLLQVLK  1223
             DC+HWC+PGP+D WN+ LL +L 
Sbjct  370   DCIHWCLPGPVDAWNDMLLHMLS  392



>gb|EEC80379.1| hypothetical protein OsI_22498 [Oryza sativa Indica Group]
Length=432

 Score =   325 bits (833),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 169/348 (49%), Positives = 218/348 (63%), Gaps = 25/348 (7%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEG------PYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCEL  365
             +C+IF+G WVP  +G      PYYTNAT  +I++ QNCMK+GRPD GFL+WRW+P+RCEL
Sbjct  80    DCDIFRGEWVPAADGDDDGAAPYYTNATCGEIQEHQNCMKYGRPDLGFLRWRWRPERCEL  139

Query  366   PLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKE  536
             P FD   FL+L+RGK+MAFVGDS+ARN MQSL CLL+ V +P  VS   D       Y+ 
Sbjct  140   PRFDSAAFLDLLRGKSMAFVGDSLARNHMQSLMCLLSEVENPKDVSTTTDPEFRTVRYES  199

Query  537   YNFTLLSFWSPHIVKA-KDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWF  713
             +NFT+ +F SP++V A + +DP       + +LY DEPD  WA  +A  D V+ S   WF
Sbjct  200   HNFTVAAFRSPYLVTANQSSDPA----GGMWDLYLDEPDAAWATAVAGFDYVVVSTANWF  255

Query  714   FRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSP  893
              RP  ++++G++VGCH C    +      +    + R A + L     F G VI+RT SP
Sbjct  256   NRPTMFHESGRLVGCHHCLVPGVADLKRTY----SLRAALRALTGGAGFDGTVIVRTLSP  311

Query  894   -AHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREF--MAAKREGSKKGVRFR  1064
              +HFE GEWN GG+C RTRP   R   + G  L+ +  QV EF    A    S   VR  
Sbjct  312   TSHFEGGEWNKGGDCRRTRPTAAR---MAGLDLDFHTVQVEEFRRAEAAAAASGSAVRML  368

Query  1065  LLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEF  1205
             L+D T +MV R DGHP+ YGHWAHEN T   DCVHWC+PGPID WNE 
Sbjct  369   LMDATAAMVARADGHPSRYGHWAHENVTLYNDCVHWCLPGPIDVWNEM  416



>gb|EAZ36599.1| hypothetical protein OsJ_20944 [Oryza sativa Japonica Group]
Length=438

 Score =   325 bits (833),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 218/351 (62%), Gaps = 25/351 (7%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEG------PYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCEL  365
             +C+IF+G WVP  +G      PYYTNAT  +I++ QNCMK+GRPD GFL+WRW+P+RCEL
Sbjct  78    DCDIFRGEWVPAADGDDDGAAPYYTNATCGEIQEHQNCMKYGRPDLGFLRWRWRPERCEL  137

Query  366   PLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKE  536
             P FD   F+E+VRG++MAFVGDS+ARN MQSL CLL+ V +P  VS   D       Y+ 
Sbjct  138   PRFDAAAFMEVVRGRSMAFVGDSLARNHMQSLMCLLSKVENPKDVSTTKDPEFRTVRYES  197

Query  537   YNFTLLSFWSPHIVKA-KDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWF  713
             +NFT+ +F SP++V A + +DP       + +LY DEPD  WA  +A  D V+ S   WF
Sbjct  198   HNFTVAAFRSPYLVTANQSSDPA----GGMWDLYLDEPDAAWATAVAGFDYVVVSTANWF  253

Query  714   FRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLL---DHEKFRGLVILRT  884
              RP  +++ G++VGCH C    +      +    AFRTA + L        F G VI+RT
Sbjct  254   NRPTMFHEAGRLVGCHHCLVPGVADLKRTYSLRAAFRTALRALTAGAGGAGFDGTVIVRT  313

Query  885   FSP-AHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREF---MAAKREGSKKG  1052
              SP +HFE GEWN GG+C RTRP   R   + G  L+ +  QV EF    AA    S   
Sbjct  314   LSPTSHFEGGEWNKGGDCRRTRPTAAR---MAGLDLDFHTVQVEEFRRAEAAAAAASGGA  370

Query  1053  VRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNE  1202
              R  L+DTT  MV R DGHP+ YGHWAHE  T   DCVHWC+PGPID WNE
Sbjct  371   ARLLLMDTTAVMVARADGHPSRYGHWAHEKVTLYNDCVHWCLPGPIDVWNE  421



>ref|NP_001174709.1| Os06g0273200 [Oryza sativa Japonica Group]
 dbj|BAD68443.1| leaf senescence protein-like [Oryza sativa Japonica Group]
 dbj|BAH93437.1| Os06g0273200 [Oryza sativa Japonica Group]
Length=438

 Score =   324 bits (830),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 218/351 (62%), Gaps = 25/351 (7%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEG------PYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCEL  365
             +C+IF+G WVP  +G      PYYTNAT  +I++ QNCMK+GRPD GFL+WRW+P+RCEL
Sbjct  78    DCDIFRGEWVPAADGDDDGAAPYYTNATCGEIQEHQNCMKYGRPDLGFLRWRWRPERCEL  137

Query  366   PLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKE  536
             P FD   F+E+VRG++MAFVGDS+ARN MQSL CLL+ V +P  VS   D       Y+ 
Sbjct  138   PRFDAAAFMEVVRGRSMAFVGDSLARNHMQSLMCLLSKVENPKDVSTTKDPEFRTVRYES  197

Query  537   YNFTLLSFWSPHIVKA-KDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWF  713
             +NFT+ +F SP++V A + +DP       + +LY DEPD  WA  +A  D V+ S   WF
Sbjct  198   HNFTVAAFRSPYLVTANQSSDPA----GGMWDLYLDEPDAAWATAVAGFDYVVVSTANWF  253

Query  714   FRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLL---DHEKFRGLVILRT  884
              RP  +++ G++VGCH C    +      +    AFRTA + L        F G VI+RT
Sbjct  254   NRPTMFHEAGRLVGCHHCLVPGVADLKRTYSLRAAFRTALRALTAGAGGAGFDGTVIVRT  313

Query  885   FSP-AHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREF---MAAKREGSKKG  1052
              SP +HFE GEWN GG+C RTRP   R   + G  L+ +  QV EF    AA    S   
Sbjct  314   LSPTSHFEGGEWNKGGDCRRTRPTAAR---MAGLDLDFHTVQVEEFRRAEAAAAAASGGA  370

Query  1053  VRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNE  1202
              R  L+DTT  MV R DGHP+ YGHWAHE  T   DCVHWC+PGPID WNE
Sbjct  371   ARLLLMDTTAVMVARADGHPSRYGHWAHEKVTLYNDCVHWCLPGPIDVWNE  421



>gb|EMS60648.1| hypothetical protein TRIUR3_31576 [Triticum urartu]
Length=419

 Score =   322 bits (826),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/345 (46%), Positives = 220/345 (64%), Gaps = 7/345 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF+G WVP  E PYYT+ T   I++ QNC+K+GRPD GFLKWRW+P  CELP FD  Q
Sbjct  73    CDIFRGEWVPDAEAPYYTHKTCGMIQEHQNCLKYGRPDLGFLKWRWRPSGCELPRFDPVQ  132

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLLS  557
             FL+ VR K++AFVGDS+ARN MQSL CLL+ VA P  +S     +   + Y+ YNFT+  
Sbjct  133   FLQFVRHKSLAFVGDSLARNHMQSLLCLLSQVAYPKDISANPTDQNKVYHYRAYNFTINM  192

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP +V+A++ D    +     +LY DEPD  W  ++   D V+ SA  WF RP  +Y+
Sbjct  193   FWSPFLVRAREPDHDDPAHTGHYSLYLDEPDDKWVSQVPRFDYVLVSAANWFSRPSLFYE  252

Query  738   NGKIVGCHRCN-ETAIKKRNHYFGYGLAFRTAFKTLLDHE-KFRGLVILRTFSP-AHFEN  908
               +++GC  C+ +  +     Y+    A+R + + +   E K +G V++R  SP +HFEN
Sbjct  253   KRRLIGCSFCSRQYGVPDLTLYYSQRKAWRVSLQAINALEAKVKGRVMVRMLSPMSHFEN  312

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G W+ GGNC RT P    Q  +EG  L  Y  Q+ E+ AA++    KG+R  L+D T +M
Sbjct  313   GTWDQGGNCKRTEPVRSNQTVMEGRDLHFYTAQMEEYRAAEKAARAKGLRLMLMDATAAM  372

Query  1089  VLRPDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQVL  1220
             ++RPDGHP+ YGHW +E  +   DC+HWC+PGPID WN+ L Q++
Sbjct  373   LMRPDGHPSRYGHWPNEKVQLYNDCIHWCLPGPIDIWNDLLFQMM  417



>gb|ACF88461.1| unknown [Zea mays]
Length=420

 Score =   322 bits (825),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 214/347 (62%), Gaps = 6/347 (2%)
 Frame = +3

Query  201   GECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             G C+IF+G WVP P+ PYYTN T   I +  +CM +G+PD GF+ WRWQPD C+LP F+ 
Sbjct  74    GGCDIFRGEWVPDPDAPYYTNDTCKVIHEHYDCMGYGKPDLGFVNWRWQPDGCDLPRFNP  133

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKV-SDAAVGRWVYKEYNFTLLS  557
              +FL ++RGKT+AFVGDS+ RN   SL CLL +VA+P      +    + Y +YNFT+  
Sbjct  134   WRFLHMMRGKTLAFVGDSLGRNHKDSLICLLTTVAEPTTSWPSSKHTVYYYADYNFTVAH  193

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FW+P++V+ +  D    +   + NLY DEPD +WA  +A  D  + SA  WF+RP   Y+
Sbjct  194   FWAPYLVRHEQIDEDGPAHTGVWNLYLDEPDGVWAAHVAEFDYAVVSASSWFYRPSMLYE  253

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHE-KFRGLVILRTFSPAHFENGE  914
              G++VGCH C    +      +   +A R A + L   + +FRG  +LRT  P+ +E GE
Sbjct  254   AGRLVGCHYCRLPNVTDLTLRYALRMATRAALRALSGADGRFRGTALLRTVDPSQYEGGE  313

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKG--VRFRLLDTTESM  1088
             WN  GNCVRT PF + Q  ++G   E    Q+ EF +A++  +  G  VR  L+DTTE+M
Sbjct  314   WNKDGNCVRTAPFRRGQNAVQGLEREFRTLQLEEFASAEKAATDGGGKVRMLLMDTTEAM  373

Query  1089  VLRPDGHPNHYGHWAHENKTTA--DCVHWCMPGPIDTWNEFLLQVLK  1223
             +LR D HP+ Y  W  E   T   DCVHWC+PG IDTWN+ LL +LK
Sbjct  374   ILRADAHPSKYRGWTPEKHFTLHNDCVHWCLPGAIDTWNDMLLHMLK  420



>tpg|DAA49901.1| TPA: putative DUF231 domain containing family protein [Zea mays]
Length=435

 Score =   323 bits (827),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 214/347 (62%), Gaps = 6/347 (2%)
 Frame = +3

Query  201   GECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             G C+IF+G WVP P+ PYYTN T   I +  +CM +G+PD GF+ WRWQPD C+LP F+ 
Sbjct  89    GGCDIFRGEWVPDPDAPYYTNDTCKVIHEHYDCMGYGKPDLGFVNWRWQPDGCDLPRFNP  148

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKV-SDAAVGRWVYKEYNFTLLS  557
              +FL ++RGKT+AFVGDS+ RN   SL CLL +VA+P      +    + Y +YNFT+  
Sbjct  149   WRFLHMMRGKTLAFVGDSLGRNHKDSLICLLTTVAEPTTSWPSSKHTVYYYADYNFTVAH  208

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FW+P++V+ +  D    +   + NLY DEPD +WA  +A  D  + SA  WF+RP   Y+
Sbjct  209   FWAPYLVRHEQIDEDGPAHTGVWNLYLDEPDGVWAAHVAEFDYAVVSASSWFYRPSMLYE  268

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHE-KFRGLVILRTFSPAHFENGE  914
              G++VGCH C    +      +   +A R A + L   + +FRG  +LRT  P+ +E GE
Sbjct  269   AGRLVGCHYCRLPNVTDLTLRYALRMATRAALRALSGADGRFRGTALLRTVDPSQYEGGE  328

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKG--VRFRLLDTTESM  1088
             WN  GNCVRT PF + Q  ++G   E    Q+ EF +A++  +  G  VR  L+DTTE+M
Sbjct  329   WNKDGNCVRTAPFRRGQNAVQGLEREFRTLQLEEFASAEKAATDGGGKVRMLLMDTTEAM  388

Query  1089  VLRPDGHPNHYGHWAHENKTTA--DCVHWCMPGPIDTWNEFLLQVLK  1223
             +LR D HP+ Y  W  E   T   DCVHWC+PG IDTWN+ LL +LK
Sbjct  389   ILRADAHPSKYRGWTPEKHFTLHNDCVHWCLPGAIDTWNDMLLHMLK  435



>ref|XP_009344545.1| PREDICTED: protein ALTERED XYLOGLUCAN 4-like [Pyrus x bretschneideri]
 ref|XP_009344557.1| PREDICTED: protein ALTERED XYLOGLUCAN 4-like [Pyrus x bretschneideri]
Length=449

 Score =   323 bits (828),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/348 (45%), Positives = 224/348 (64%), Gaps = 9/348 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             EC++FKG+W+P   G  YTN++   I + +NC + GR D  FL WRW+PD+CELP FD +
Sbjct  99    ECDLFKGHWIPDSRGAMYTNSSCATIPESKNCFRNGRRDRDFLNWRWKPDKCELPRFDPK  158

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADP---VKVSDAAVGRWVYKEYNFTLL  554
              FLE+VRGK MAF+GDSVARN ++SL CLL+   +P    K SD     W + +Y+FTL+
Sbjct  159   TFLEIVRGKKMAFIGDSVARNHVESLLCLLSQEENPKDIYKYSDDRFRIWYFPQYDFTLM  218

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
               WS +++ A++   +  S   + +L  D+ D  WA+++   D  IFS G WFFR  + +
Sbjct  219   KLWSKYLIAAEER-MVNGSGSGIFDLQLDKVDDKWAEQLPELDYAIFSGGHWFFRLMYLH  277

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG--LVILRTFSPAHFEN  908
             +  K+ GC  CNE  + + N+     +AFR  FK + D +  +G  L +LRTF+PAHFE 
Sbjct  278   EGDKLTGCVYCNEPNVTEYNNSQALRMAFRAIFKYIKDCKNCKGGLLTLLRTFAPAHFEG  337

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G WN+GG C RT P ++R++ L  +  ++   QV EF  AK+EG  +G RFR+LD T +M
Sbjct  338   GAWNTGGYCNRTNPLSEREIDLGRFDWKLRSIQVEEFERAKKEGEMEGRRFRVLDITRAM  397

Query  1089  VLRPDGHPNHYGHWAHE-NKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             ++RPDGHP    HW ++  K   DCVHWCMPGP+D WN FL+++++ E
Sbjct  398   LMRPDGHPG--AHWGNKWMKGYNDCVHWCMPGPVDYWNHFLMEIIRNE  443



>dbj|BAJ85800.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88425.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=405

 Score =   321 bits (823),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 157/345 (46%), Positives = 219/345 (63%), Gaps = 7/345 (2%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C+IF+G WVP  E PYYT+ T   I++ QNC+K+GRPD GFLKWRW+P  CELP FD  Q
Sbjct  59    CDIFRGEWVPDAEAPYYTHKTCGMIQEHQNCLKYGRPDLGFLKWRWRPSGCELPRFDPVQ  118

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLLS  557
             FL  VR K++AFVGDS+ARN MQSL CLL+ VA P  VS     +   + Y+ YNFT+  
Sbjct  119   FLHFVRHKSLAFVGDSLARNHMQSLLCLLSQVAYPKDVSANPTDQNKVYHYRAYNFTINM  178

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FWSP +V+A++ +    +     +LY DEPD  W  ++   D V+ SA  WF RP  +Y+
Sbjct  179   FWSPFLVRAREPEQDDPAHTGHYSLYLDEPDDKWVSQVPRFDYVLVSAANWFSRPSLFYE  238

Query  738   NGKIVGCHRCN-ETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-AHFENG  911
               +++GC  C+ +  +     Y+    A+R A + +   +K +G VI+R  SP +HFENG
Sbjct  239   KRRLIGCSFCSRQYGVPDLTLYYSQRKAWRVALQAINALDKVKGRVIVRMLSPMSHFENG  298

Query  912   EWNSGGNCVRTRPFTKRQ-MKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
              W+ GGNC RT P    Q + +EG  L  Y  Q+ E+ AA++    KG+R  L+D T +M
Sbjct  299   TWDQGGNCRRTEPLRGNQTVAMEGRDLRFYTAQMEEYRAAEKAARAKGLRMMLMDATAAM  358

Query  1089  VLRPDGHPNHYGHWAHEN-KTTADCVHWCMPGPIDTWNEFLLQVL  1220
             ++RPDGHP+ YGHW +E  +   DC+HWC+PGPID WN+   Q++
Sbjct  359   LMRPDGHPSRYGHWPNEKVQLYNDCIHWCLPGPIDIWNDLFFQMI  403



>ref|XP_003569471.1| PREDICTED: protein trichome birefringence-like 19 [Brachypodium 
distachyon]
Length=395

 Score =   320 bits (821),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 158/352 (45%), Positives = 215/352 (61%), Gaps = 15/352 (4%)
 Frame = +3

Query  192   FPGGECNIFKGNWVPFPE-GPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELP  368
              P   C+IF G WVP P   P YTN T   I++ QNC K+GRPD+ FL+WRWQP +C+LP
Sbjct  50    IPKPTCDIFHGEWVPDPGYSPEYTNETCSYIQEYQNCFKYGRPDSEFLRWRWQPSQCDLP  109

Query  369   LFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYK  533
              FD  +FL LVRGKT+AFVGDS++RN MQSL CLL+ VA P +VS     D       Y+
Sbjct  110   RFDAGKFLRLVRGKTLAFVGDSLSRNHMQSLLCLLSKVALPKEVSMTGTTDERNKILYYE  169

Query  534   EYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWF  713
             +Y FT+   WSP +V+ +DA        + + LY DEPD  W   +A  D +I S   WF
Sbjct  170   DYRFTIKILWSPFLVRTEDAG-------NDIKLYLDEPDAKWLSGVAGFDYMILSGANWF  222

Query  714   FRPFFYYKNGKIVG-CHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFS  890
              RP  +Y+ G++VG  +             + + +AFRTA + +  H   +G VI+RT S
Sbjct  223   TRPTLFYEKGQLVGGSYVAALNMTSNLTLLYSHRMAFRTALRAINGHGNVKGKVIVRTMS  282

Query  891   P-AHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRL  1067
             P +HFE G W+ GG+C RTRP+   +  +EG   +MY  QV EFM AK+  +  GV   L
Sbjct  283   PMSHFEGGSWDKGGDCSRTRPYRSNETTIEGQERDMYTAQVEEFMEAKKAAAAAGVDMAL  342

Query  1068  LDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWCMPGPIDTWNEFLLQVLK  1223
             +D+T +M+LRPDGHP+ YGHW   N    DC+HWC+PGP+D W++ L  ++ 
Sbjct  343   MDSTGAMLLRPDGHPSRYGHWPDANWEYKDCIHWCLPGPVDAWSDMLFHMMS  394



>ref|XP_004156178.1| PREDICTED: uncharacterized protein LOC101226868 [Cucumis sativus]
Length=363

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/285 (52%), Positives = 200/285 (70%), Gaps = 7/285 (2%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIE-DRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             +C++F+G WV   E PYYTN T CD+  + QNC+K+GRPD  FLKWRW+PD CELPLFD 
Sbjct  80    KCDVFRGAWVSKSEQPYYTNDT-CDMMFEYQNCLKYGRPDKEFLKWRWKPDECELPLFDS  138

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS-----DAAVGRWVYKEYNF  545
              QFLE+V+GK++AFVGDSVARN MQSL CLL++V+ PV VS          RW + +YNF
Sbjct  139   AQFLEIVKGKSLAFVGDSVARNHMQSLLCLLSNVSHPVDVSLKYNLTYDFKRWFFPDYNF  198

Query  546   TLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPF  725
             T+  FWSP++VK++DAD    S +SLMNLY DE D  W   +   D VIFSAGQWFFRP 
Sbjct  199   TVARFWSPYLVKSRDADQNGFSSNSLMNLYLDEADETWISAVETFDYVIFSAGQWFFRPQ  258

Query  726   FYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFE  905
              YY+NG++ GC  C ++ + +  +++GYG  F+T+F+ L+  + ++G+  +RTFSP+HFE
Sbjct  259   VYYENGQMKGCFNCQQSNVTQILNFYGYGKVFQTSFRKLMALKGYKGMTFMRTFSPSHFE  318

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREG  1040
             NG+WN GGNC RTRPFTK +M+ +  +L     + R     +R G
Sbjct  319   NGDWNKGGNCARTRPFTKEEMEWKSLSLSCIRLKWRNSEQQRRRG  363



>emb|CDM83560.1| unnamed protein product [Triticum aestivum]
Length=419

 Score =   320 bits (820),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/376 (42%), Positives = 224/376 (60%), Gaps = 10/376 (3%)
 Frame = +3

Query  114   TTLVIFATFCFTSY-NISDSLLQSFNLFPGGECNIFKGNWVPFPEGP-YYTNATKCDIED  287
             + L+I + F    Y + SD        +   +C+I++G WVP  + P  YTN T   I++
Sbjct  47    SALIILSYFTSVPYLSYSDLPYYGSYFWRIPKCDIYQGEWVPDADTPPQYTNETCSYIQE  106

Query  288   RQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKC  467
              QNCMK+GRPD  FL+WRWQP RC+LP FD  +F  LV  KT+AFVGDS+ARN MQSL C
Sbjct  107   HQNCMKYGRPDLEFLRWRWQPSRCDLPRFDADKFFRLVGNKTLAFVGDSLARNHMQSLLC  166

Query  468   LLASVADPVKVSDAA--VGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTD  641
             LL+ VA P +V++    +    Y+ YNFTL   WSP +V+ ++ D    +   +  LY D
Sbjct  167   LLSKVASPTEVTERTDPIKIMHYERYNFTLKIIWSPFLVRTEEPD----NNSGVFKLYLD  222

Query  642   EPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAF  821
             EPD  W   +A  D VI S   WF R   +Y+ G++VG               + + +AF
Sbjct  223   EPDGRWLSGVAGFDYVILSGANWFTRQSMFYERGQLVGGSFVALNITSNLTLRYSHRMAF  282

Query  822   RTAFKTLLDHEKFRGLVILRTFSP-AHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMY  998
             RTA + + +H   +  VI+RT SP +HFE G W+ GG+C RT+P+   +  +    L+ Y
Sbjct  283   RTALRAINNHGSVKAKVIVRTLSPMSHFEGGSWDKGGDCRRTQPYRSNETTMGDLDLDFY  342

Query  999   LTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTA-DCVHWCM  1175
               QV EF  A++  +  GV   L+DTT +M+LRPDGHP+ YGHW  E +  + DC+HWC+
Sbjct  343   TGQVEEFREAEKAAAVAGVDMVLMDTTGAMLLRPDGHPSRYGHWPEEKRVLSNDCIHWCL  402

Query  1176  PGPIDTWNEFLLQVLK  1223
             PGP+D WN+ LLQ++ 
Sbjct  403   PGPVDAWNDMLLQIMS  418



>dbj|BAD68438.1| leaf senescence protein-like [Oryza sativa Japonica Group]
Length=423

 Score =   319 bits (818),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 158/359 (44%), Positives = 212/359 (59%), Gaps = 18/359 (5%)
 Frame = +3

Query  195   PGGE------CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDR  356
             PGG+      CNIF+G WVP P+ PYYTN T   I +  +CMK+G+PD GF++WRW+PD 
Sbjct  61    PGGQKAADEACNIFRGEWVPDPDAPYYTNNTCSVIHEHYDCMKYGKPDLGFVQWRWRPDS  120

Query  357   CELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGRWVYK-  533
             C+LP  D  +FL  +RGKT+AF+GDS+ARN M SL CLL  VA+P   S  +    VY  
Sbjct  121   CDLPRLDPARFLSSMRGKTLAFIGDSLARNHMNSLICLLTRVAEPT-TSWPSSEHTVYHY  179

Query  534   --EYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQ  707
                YNFT+LSFW+P +V+ +  D    +   L NLY DEPD +WA  +   D  + SA  
Sbjct  180   GGGYNFTVLSFWAPFLVQNELVDADGPAHTGLWNLYLDEPDAVWAPHVPAFDYAVVSASS  239

Query  708   WFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKT-LLDHEKFRGLVILRT  884
             WF+RP   Y+ G++VGCH C    +      +   +A R A +  +          +LRT
Sbjct  240   WFYRPSMLYEAGRLVGCHHCLLPNVTDLTLRYALRMATRAALRAVVGGGGGGGVTAVLRT  299

Query  885   FSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFR  1064
              SP+ +E GEWN  GNCVRTRP+ + +  L+G  L+ +  QV EF AAKR  S  G R  
Sbjct  300   VSPSQYEGGEWNKDGNCVRTRPYRRGEKTLQGVELDFHTLQVEEFEAAKRAASGGGARMM  359

Query  1065  LLDTTESMVLRPDGHPNHYGHWAHEN-------KTTADCVHWCMPGPIDTWNEFLLQVL  1220
             L+DTTE+M+LR D HP+ Y  W             + DCVHWC+PG +D WN+ L  +L
Sbjct  360   LMDTTEAMILRADAHPSRYRGWTRRKGWMKEYFTISNDCVHWCVPGAVDAWNDMLSHML  418



>ref|XP_007215434.1| hypothetical protein PRUPE_ppa006176mg [Prunus persica]
 gb|EMJ16633.1| hypothetical protein PRUPE_ppa006176mg [Prunus persica]
Length=424

 Score =   319 bits (818),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/348 (44%), Positives = 217/348 (62%), Gaps = 9/348 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+++KG+W+P   GP YTN++   I + +NC K GR D+ FL WRW+PD+CELPLFD  
Sbjct  75    KCDLYKGHWIPELRGPMYTNSSCATIPESKNCFKNGRRDSDFLNWRWKPDKCELPLFDPN  134

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLL  554
              FLE+VRGK MAF+GDSVARN ++SL CLL+    P  V   +  R   W + +++FTL+
Sbjct  135   TFLEIVRGKKMAFIGDSVARNHVESLLCLLSQEESPKDVYKDSEDRFRTWYFPQHDFTLM  194

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
               WS ++V A D   +  +     +L+ D  D  WA  + + D  I S G WFFR  + +
Sbjct  195   KLWSKYLV-ASDERMINGTGTGTFDLHLDRLDDQWARHLPDLDYAIVSGGHWFFRVMYLH  253

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG--LVILRTFSPAHFEN  908
             + G + GC  CN+  +   N      +AFRT FK + D +  RG  + +LRTF+PAHFEN
Sbjct  254   EGGNLTGCVYCNQPNVTDYNISHAVRMAFRTVFKHIKDCKNCRGGLMALLRTFAPAHFEN  313

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G WN+GG C RT PF++ Q+ L  +  EM   Q+ EF   +REG  KG +F +LD T +M
Sbjct  314   GAWNTGGYCNRTSPFSEAQIDLGTFDWEMRNIQIEEFERGRREGEMKGKKFGVLDITRAM  373

Query  1089  VLRPDGHPNHYGHWAHE-NKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             ++R DGHP    HW ++  K   DCVHWCMPGP+D WN FL+ +++ E
Sbjct  374   LMRADGHPG--AHWGNQWMKGYNDCVHWCMPGPVDYWNHFLMAIIRNE  419



>ref|XP_008379275.1| PREDICTED: protein ALTERED XYLOGLUCAN 4-like isoform X2 [Malus 
domestica]
Length=373

 Score =   317 bits (812),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 155/348 (45%), Positives = 220/348 (63%), Gaps = 9/348 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             EC++FKG+W+P   G  YTN++   I + +NC + GR D  FL WRW+PD+CELP FD +
Sbjct  24    ECDLFKGHWIPDLRGAMYTNSSCATIPESKNCFRNGRRDRDFLNWRWKPDKCELPRFDPK  83

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADP---VKVSDAAVGRWVYKEYNFTLL  554
              FLE+VRGK MAF+GDSVARN ++SL CLL+   +P    K SD     W + +Y+FTL+
Sbjct  84    TFLEIVRGKKMAFIGDSVARNHVESLLCLLSQEENPKDIYKYSDBRFRIWYFPQYDFTLM  143

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
               WS +++ A++   +  S     +L  D+ D  WA+++   D   FSAG WFFR  + +
Sbjct  144   KLWSKYLIAAEER-MVNGSGSGXFDLXLDKVDDKWAEQLPELDYAXFSAGHWFFRLMYLH  202

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG--LVILRTFSPAHFEN  908
             +  K+ GC  CNE  + + N+     +AFR  FK   D +  +G  L +LRTF+PAHFE 
Sbjct  203   EGDKLTGCVYCNEPNVTEYNNSQALRMAFRAIFKYJNDCKNCKGGLLTLLRTFAPAHFEG  262

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G WN+GG C RT P +  ++ L  +  E+   QV EF  AK+EG  +G RFR+LD T +M
Sbjct  263   GAWNTGGYCNRTSPLSXGEIDLGRFDWELRSIQVEEFERAKKEGEMEGRRFRVLDITRAM  322

Query  1089  VLRPDGHPNHYGHWAHE-NKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             ++RPDGHP    HW ++  K   DCVHWCMPGP+D WN FL+++++ E
Sbjct  323   LMRPDGHPG--VHWGNKWMKGYNDCVHWCMPGPVDYWNHFLMEIIRNE  368



>ref|NP_001143774.1| uncharacterized protein LOC100276538 [Zea mays]
 gb|ACG35228.1| hypothetical protein [Zea mays]
Length=420

 Score =   318 bits (816),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/347 (44%), Positives = 211/347 (61%), Gaps = 6/347 (2%)
 Frame = +3

Query  201   GECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             G C+IF+G WVP P+ PYYTN T   I +  +CM +G+PD GF+ WRWQPD C+LP F+ 
Sbjct  74    GGCDIFRGEWVPDPDAPYYTNDTCKVIHEHYDCMGYGKPDLGFVNWRWQPDGCDLPRFNP  133

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKV-SDAAVGRWVYKEYNFTLLS  557
              +FL ++RGKT+AFVGDS+ RN   SL CLL +VA+P      +    + Y +YNFT+  
Sbjct  134   WRFLHMMRGKTLAFVGDSLGRNHKDSLICLLTTVAEPTTSWPSSKHTVYYYADYNFTVAH  193

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FW+P++V+ +  D    +   + NLY DEPD +WA  +A  D  + SA  WF+RP   Y+
Sbjct  194   FWAPYLVRHEQIDEDGPAHTGVWNLYLDEPDGVWAAHVAEFDYAVVSASSWFYRPSMLYE  253

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHE-KFRGLVILRTFSPAHFENGE  914
              G++VGCH C    +      +   +A R A + L   + +FRG  +LRT  P+ +E GE
Sbjct  254   AGRLVGCHYCRLPNVTDLTLRYALRMATRAALRALSGADGRFRGTALLRTVDPSQYEGGE  313

Query  915   WNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKG--VRFRLLDTTESM  1088
             WN  GNC+RT PF + Q  ++G   E    Q+ EF +  +  +  G  VR  L+DTTE+M
Sbjct  314   WNEDGNCIRTAPFRRGQNAVQGLEREFRTLQLEEFASVAKAATDSGGKVRMLLMDTTEAM  373

Query  1089  VLRPDGHPNHYGHWAHENKTTA--DCVHWCMPGPIDTWNEFLLQVLK  1223
             +LR D HP+ Y  W  E   T   DCVHWC+PG ID WN+ LL +LK
Sbjct  374   ILRADAHPSKYRGWTPEKHFTLHNDCVHWCLPGAIDAWNDMLLHMLK  420



>ref|XP_008230649.1| PREDICTED: protein ALTERED XYLOGLUCAN 4-like [Prunus mume]
Length=449

 Score =   319 bits (818),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/348 (44%), Positives = 218/348 (63%), Gaps = 9/348 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +C+++KG+WVP   GP YTN++   I + +NC K GR D+ FL WRW+PD+CELPLFD  
Sbjct  100   KCDLYKGHWVPELRGPMYTNSSCATIPESKNCFKNGRRDSDFLNWRWKPDKCELPLFDPN  159

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLL  554
              FLE+VRGK MAF+GDSVARN ++SL CLL+    P  V   +  R   W + +++FTL+
Sbjct  160   TFLEIVRGKKMAFIGDSVARNHVESLLCLLSQEESPKDVYKDSEDRFRTWYFPQHDFTLM  219

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
               WS +++ A D   +  +     +L+ D  D  WA  + + D  I S G WFFR  + +
Sbjct  220   KLWSKYLI-AADERMVNGTGSGTFDLHLDRLDDQWARHLPDLDYAIVSGGHWFFRLMYLH  278

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG--LVILRTFSPAHFEN  908
             ++G + GC  CN+  +   N      +AFRT FK + D +  RG  + +LRTF+PAHFEN
Sbjct  279   ESGNLTGCVYCNQPNVTDYNISHAVRMAFRTVFKHIKDCKNCRGGLMALLRTFAPAHFEN  338

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G WN+GG C RT PF++ Q+ L  +  EM   Q+ EF   +REG  KG +F +LD T +M
Sbjct  339   GAWNTGGYCNRTSPFSEAQIDLGTFDWEMRNIQIEEFERGRREGEMKGKKFGVLDITRAM  398

Query  1089  VLRPDGHPNHYGHWAHE-NKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             ++R DGHP    HW ++  K   DCVHWCMPGP+D WN FL+ +++ E
Sbjct  399   LMRADGHPG--AHWGNQWMKGYNDCVHWCMPGPVDYWNHFLMAIIRNE  444



>gb|EEC80378.1| hypothetical protein OsI_22495 [Oryza sativa Indica Group]
Length=423

 Score =   318 bits (814),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/359 (44%), Positives = 214/359 (60%), Gaps = 18/359 (5%)
 Frame = +3

Query  195   PGGE------CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDR  356
             PGG+      CNIF+G WVP P+ PYYTN T   I +  +CMK+G+PD GF++WRW+PD 
Sbjct  61    PGGQKAADEACNIFRGEWVPDPDAPYYTNNTCSVIHEHYDCMKYGKPDLGFVQWRWRPDS  120

Query  357   CELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGRWVYK-  533
             C+LP  D  +FL  +RGKT+AF+GDS+ARN M SL CLL  VA+P   S  +    VY  
Sbjct  121   CDLPRLDPARFLSSMRGKTLAFIGDSLARNHMNSLICLLTRVAEPT-TSWPSSEHTVYHY  179

Query  534   --EYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQ  707
                YNFT+LSFW+P +V+ +  D    +   L NLY DEPD +WA  +   D    SA  
Sbjct  180   GGGYNFTVLSFWAPFLVQNELVDADGPAHTGLWNLYLDEPDAVWAPHVPAFDYAFVSASS  239

Query  708   WFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGL-VILRT  884
             WF+RP   Y+ G++VGCH C    +      +   +A R A + ++      G+  +LRT
Sbjct  240   WFYRPSMLYEAGRLVGCHHCLLPNVTDLTLRYALRMATRAALRAVVGGGGGGGVTAVLRT  299

Query  885   FSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFR  1064
              SP+ +E GEWN  GNCVRTRP+ + +  L+G  L+ +  QV EF AAKR  S  G R  
Sbjct  300   VSPSQYEGGEWNKDGNCVRTRPYRRGEKTLQGVELDFHTLQVEEFEAAKRAASGGGARMM  359

Query  1065  LLDTTESMVLRPDGHPNHYGHWAHEN-------KTTADCVHWCMPGPIDTWNEFLLQVL  1220
             L+DTTE+M+LR D HP+ Y  W             + DCVHWC+PG +D WN+ L  +L
Sbjct  360   LMDTTEAMILRADAHPSRYRGWTRRKGWMKEYFTISNDCVHWCVPGAVDAWNDMLSHML  418



>gb|EEE65487.1| hypothetical protein OsJ_20907 [Oryza sativa Japonica Group]
Length=410

 Score =   316 bits (810),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 158/386 (41%), Positives = 225/386 (58%), Gaps = 17/386 (4%)
 Frame = +3

Query  93    KAVLPISTTLVIFATFCFTSYNISDSLLQSFNLFPGGECNIFKGNWVPFPEGPYYTNATK  272
             + ++P  + L++ A        +SD+    F +  G  C+IF+G WVP P+ PYYTN T 
Sbjct  20    RCLIPAISILLLVAVIA-----VSDTYF-PFPVADGEACDIFRGEWVPDPDAPYYTNDTC  73

Query  273   CDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQM  452
               I +  +CMK+G+ D GF++WRW+PD C+LP  D  +FL  +RGKT+AF+GDS+A+N M
Sbjct  74    SFIHEHYDCMKYGKLDLGFVQWRWRPDGCDLPRLDPLRFLSAMRGKTLAFIGDSLAKNHM  133

Query  453   QSLKCLLASVADPVKVSDAAVGRWVYK---EYNFTLLSFWSPHIVKAKDADPLWVSPDSL  623
              SL CLL  VA P   S  +    VY     YNFT+L+FW+P +V+++  D    +   L
Sbjct  134   NSLICLLTRVAKPT-TSWPSSEHTVYHYGGGYNFTVLNFWAPFLVRSELVDADGPAHTGL  192

Query  624   MNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYF  803
              NLY DEP  +WA  +   D  + SA  WF+RP   Y+ G++VGCH C    +      +
Sbjct  193   WNLYLDEPAAVWAPHVPAFDYAVVSASSWFYRPSMLYEAGRLVGCHHCLLPNVTDLTLRY  252

Query  804   GYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGY  983
                +A R A + ++  +      +LRT SP+ +E GEWN  GNCVRTRP+ + +  L+G+
Sbjct  253   ALRMATRAALRAVVSSDGGGVTAVLRTVSPSQYEGGEWNKDGNCVRTRPYRRGEKTLQGF  312

Query  984   TLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENK------  1145
              L+ +  QV EF AAKR  S  GVR  L+DTTE+M+ R D HP+ Y  W    +      
Sbjct  313   ELDFHTLQVEEFEAAKRAASGGGVRMMLMDTTEAMIRRADAHPSRYRGWTRRKEWMKEYF  372

Query  1146  -TTADCVHWCMPGPIDTWNEFLLQVL  1220
                 DCVHWC+PG ID WN+ L  +L
Sbjct  373   TIFNDCVHWCVPGAIDAWNDMLSHML  398



>ref|XP_002467212.1| hypothetical protein SORBIDRAFT_01g021430 [Sorghum bicolor]
 gb|EER94210.1| hypothetical protein SORBIDRAFT_01g021430 [Sorghum bicolor]
Length=427

 Score =   317 bits (811),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 153/355 (43%), Positives = 213/355 (60%), Gaps = 15/355 (4%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
              C+IF+G WVP P+ PYYTN T   I +  +C+++G+PD GF+ WRW+PD C+LP F+  
Sbjct  73    SCDIFRGEWVPDPDAPYYTNDTCKVIHEHYDCIRYGKPDLGFVNWRWRPDGCDLPRFNPW  132

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVS--DAAVGRWVYKEYNFTLLS  557
             +FL ++RGK++AFVGDS+ RNQ  SL CLL   A+P   +   +    + Y +YNFTL  
Sbjct  133   RFLHMMRGKSLAFVGDSLGRNQKDSLICLLTRAAEPTTTTWLSSKHTVYYYGDYNFTLSH  192

Query  558   FWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYK  737
             FW+P++V+ +  D    +   L NLY DEPD +WA  +A  D V+ SA  WF+RP   Y+
Sbjct  193   FWAPYLVRHEQIDEDGPAHTGLWNLYLDEPDDVWAAHVAELDYVVVSASSWFYRPSMLYE  252

Query  738   NGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEK---------FRGLVILRTFS  890
              G++VGCH C    +      +   +A RTA + L              FRG  +LRT  
Sbjct  253   AGRLVGCHYCKLPNVTDLTLRYALRMATRTALRALSGGGAAADDGGRRFFRGTALLRTVD  312

Query  891   PAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKG--VRFR  1064
             P+ +E GEWN  G+CVRT P+ + +  +EG+  +    QV E  +A +  +  G  VR  
Sbjct  313   PSQYEGGEWNGDGDCVRTAPYGRGEKSVEGFERDFRALQVEELASAAKAATDSGGKVRML  372

Query  1065  LLDTTESMVLRPDGHPNHYGHWAHENKTTA--DCVHWCMPGPIDTWNEFLLQVLK  1223
             L+DTTE+MVLR D HP+ Y  W  E   T   DCVHWC+PG IDTWN+ LL +LK
Sbjct  373   LMDTTEAMVLRADAHPSKYRGWTPEKHFTLHNDCVHWCLPGAIDTWNDMLLHMLK  427



>ref|XP_008379274.1| PREDICTED: protein ALTERED XYLOGLUCAN 4-like isoform X1 [Malus 
domestica]
Length=453

 Score =   318 bits (814),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/348 (45%), Positives = 220/348 (63%), Gaps = 9/348 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             EC++FKG+W+P   G  YTN++   I + +NC + GR D  FL WRW+PD+CELP FD +
Sbjct  104   ECDLFKGHWIPDLRGAMYTNSSCATIPESKNCFRNGRRDRDFLNWRWKPDKCELPRFDPK  163

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADP---VKVSDAAVGRWVYKEYNFTLL  554
              FLE+VRGK MAF+GDSVARN ++SL CLL+   +P    K SD     W + +Y+FTL+
Sbjct  164   TFLEIVRGKKMAFIGDSVARNHVESLLCLLSQEENPKDIYKYSDBRFRIWYFPQYDFTLM  223

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
               WS +++ A++   +  S     +L  D+ D  WA+++   D   FSAG WFFR  + +
Sbjct  224   KLWSKYLIAAEER-MVNGSGSGXFDLXLDKVDDKWAEQLPELDYAXFSAGHWFFRLMYLH  282

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG--LVILRTFSPAHFEN  908
             +  K+ GC  CNE  + + N+     +AFR  FK   D +  +G  L +LRTF+PAHFE 
Sbjct  283   EGDKLTGCVYCNEPNVTEYNNSQALRMAFRAIFKYJNDCKNCKGGLLTLLRTFAPAHFEG  342

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G WN+GG C RT P +  ++ L  +  E+   QV EF  AK+EG  +G RFR+LD T +M
Sbjct  343   GAWNTGGYCNRTSPLSXGEIDLGRFDWELRSIQVEEFERAKKEGEMEGRRFRVLDITRAM  402

Query  1089  VLRPDGHPNHYGHWAHE-NKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             ++RPDGHP    HW ++  K   DCVHWCMPGP+D WN FL+++++ E
Sbjct  403   LMRPDGHPG--VHWGNKWMKGYNDCVHWCMPGPVDYWNHFLMEIIRNE  448



>ref|XP_009348027.1| PREDICTED: protein ALTERED XYLOGLUCAN 4-like [Pyrus x bretschneideri]
Length=443

 Score =   316 bits (810),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/349 (43%), Positives = 221/349 (63%), Gaps = 9/349 (3%)
 Frame = +3

Query  201   GECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             GEC++FKG W+    G  YTN +   I + +NC + GR D  FL WRW+PD+CELP FD 
Sbjct  96    GECDLFKGQWISDSRGAMYTNTSCATIPESKNCFRNGRRDRDFLNWRWKPDKCELPRFDP  155

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTL  551
             + FLE+VRGK MAFVGDSVARN ++SL CLL+   +P  +   +  R   W +  YNFTL
Sbjct  156   KTFLEIVRGKRMAFVGDSVARNHVESLLCLLSQEENPKDIYKDSEDRFRTWYFPRYNFTL  215

Query  552   LSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
             +  WS +++ A++   +  S   + +L  D+ D +WAD + + D  I S G WFFR  + 
Sbjct  216   MKLWSKYLIAAEEK-MVNGSGSGVFDLQLDKVDDVWADHLPDLDYAIISGGHWFFRLMYL  274

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG--LVILRTFSPAHFE  905
             ++  K+ GC  CN+  + + N+     +AFR  FK + + +  +G  L +LRTF+PAHFE
Sbjct  275   HEGDKLTGCVYCNKPNVTEYNNSHALRMAFRATFKYIQECKNCKGGLLTLLRTFAPAHFE  334

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
              G WN+GG C RT P ++ ++ L+ +  E+   QV EF  A++EG  +G +FR+LD T +
Sbjct  335   GGAWNTGGYCNRTSPLSEGEVDLKRFDWELRSIQVEEFERARKEGEMEGRKFRVLDITRA  394

Query  1086  MVLRPDGHPNHYGHWAHE-NKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             M++RPDGHP    HW ++  K   DCVHWCMPGP+D WN FL+++++ E
Sbjct  395   MLMRPDGHPG--DHWGNKWMKGYNDCVHWCMPGPVDYWNHFLMEIIRNE  441



>ref|XP_009349865.1| PREDICTED: protein ALTERED XYLOGLUCAN 4-like [Pyrus x bretschneideri]
Length=443

 Score =   316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/349 (43%), Positives = 221/349 (63%), Gaps = 9/349 (3%)
 Frame = +3

Query  201   GECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDG  380
             GEC++FKG W+    G  YTN +   I + +NC + GR D  FL WRW+PD+CELP FD 
Sbjct  96    GECDLFKGQWISDSRGAMYTNTSCATIPESKNCFRNGRRDRDFLNWRWKPDKCELPRFDP  155

Query  381   RQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTL  551
             + FLE+VRGK MAFVGDSVARN ++SL CLL+   +P  +   +  R   W +  YNFTL
Sbjct  156   KTFLEIVRGKRMAFVGDSVARNHVESLLCLLSQEENPKDIYKDSEDRFRTWYFPRYNFTL  215

Query  552   LSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFY  731
             +  WS +++ A++   +  S   + +L  D+ D +WAD + + D  I S G WFFR  + 
Sbjct  216   MKLWSKYLIAAEEK-MVNGSGSGVFDLQLDKVDDVWADHLPDLDYAIISGGHWFFRLMYL  274

Query  732   YKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG--LVILRTFSPAHFE  905
             ++  K+ GC  CN+  + + N+     +AFR  FK + + +  +G  L +LRTF+PAHFE
Sbjct  275   HEGDKLTGCVYCNKPNVTEYNNSHALRMAFRATFKYIQECKNCKGGLLTLLRTFAPAHFE  334

Query  906   NGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTES  1085
              G WN+GG C RT P ++ ++ L+ +  E+   QV EF  A++EG  +G +FR+LD T +
Sbjct  335   GGAWNTGGYCNRTSPLSEGEVDLKRFDWELRSIQVEEFERARKEGEMEGRKFRVLDITRA  394

Query  1086  MVLRPDGHPNHYGHWAHE-NKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             M++RPDGHP    HW ++  K   DCVHWCMPGP+D WN FL+++++ E
Sbjct  395   MLMRPDGHPG--DHWGNKWMKGYNDCVHWCMPGPVDYWNHFLMEIIRNE  441



>ref|XP_008341734.1| PREDICTED: protein ALTERED XYLOGLUCAN 4-like [Malus domestica]
Length=447

 Score =   315 bits (808),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 221/348 (64%), Gaps = 9/348 (3%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             EC++FKG W+P   G  YTN++   I + +NC + GR D+ FL WRW+PD+CELP FD +
Sbjct  98    ECDLFKGQWIPDSRGAMYTNSSCATIPESKNCFRNGRRDSDFLNWRWKPDKCELPRFDPK  157

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGR---WVYKEYNFTLL  554
              FLE+VRGK MAFVGDSVARN ++SL CLL+   +P  +   +  R   W +  YNFTL+
Sbjct  158   TFLEIVRGKRMAFVGDSVARNHVESLJCLLSQEENPKDIYKDSEDRFRTWYFPRYNFTLM  217

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
               WS +++ A++   +  S   + +L  D+ D +WAD++   D  I S G WFFR  + +
Sbjct  218   KLWSKYLIAAEEK-MVNGSGSGVFDLQLDKVDDVWADQLPELDYAIISGGHWFFRLMYLH  276

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRG--LVILRTFSPAHFEN  908
             +  K+ GC  CN+  + + N+     +AFR  FK + D +  +G  L +LRTF+PAHFE 
Sbjct  277   EGDKLTGCVYCNKPNVTEYNNSHALRMAFRATFKYIKDCKNCKGGLLTLLRTFAPAHFEG  336

Query  909   GEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESM  1088
             G WN+GG C RT P ++ ++ L+ +  E+   QV E   A++EG  +G +FR+LD T +M
Sbjct  337   GAWNTGGYCNRTSPLSEGEVDLKRFDWELRSIQVEELERARKEGEMEGRKFRVLDITRAM  396

Query  1089  VLRPDGHPNHYGHWAHE-NKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             ++RPDGHP    HW ++  K   DCVHWCMPG +D WN FL+++++ E
Sbjct  397   LMRPDGHPG--DHWGNKWMKGYNDCVHWCMPGAVDYWNHFLMEIIRNE  442



>emb|CDX69491.1| BnaA10g18400D [Brassica napus]
Length=428

 Score =   312 bits (800),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 207/331 (63%), Gaps = 31/331 (9%)
 Frame = +3

Query  249   PYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVG  428
             PYY N T   I++ QNCM+FGRPDTGF++WRW+PD C+LP+FD  +FLE+VR K+M FVG
Sbjct  124   PYY-NMTCWAIQEHQNCMQFGRPDTGFMRWRWKPDGCDLPIFDPNEFLEMVRAKSMGFVG  182

Query  429   DSVARNQMQSLKCLLASVADPVKVS---DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADP  599
             DS++RNQ+QSL CLL+ V  P  +S   D A   W Y  YNFTL   WSP +VK      
Sbjct  183   DSISRNQVQSLLCLLSRVEYPEDISSSPDIAFKVWNYTSYNFTLHVMWSPFLVK------  236

Query  600   LWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETA  779
                         T +PD       +       S   WF+RP  +Y+N K+ GC  C+   
Sbjct  237   ------------TTKPD------PSPTSSASTSTSHWFYRPLIFYENEKLSGCQYCSLPN  278

Query  780   IKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTK  959
               +   ++GY  A RT+ + +L  E F GL ILR+FSP HFE G WN GGNCVRTRP+ +
Sbjct  279   TTELPLHYGYTKALRTSLRGIL--ENFTGLAILRSFSPQHFEGGPWNKGGNCVRTRPYRR  336

Query  960   RQMKLEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHW-AH  1136
              +   E   L+++  Q+ EF AA+    KKG+R RL+DTT++M+LRPDGHP  YGH    
Sbjct  337   NETIPEVADLKIHDIQLEEFRAAEEGVKKKGLRLRLMDTTQAMLLRPDGHPGRYGHLQTA  396

Query  1137  ENKTTADCVHWCMPGPIDTWNEFLLQVLKME  1229
             E  +  DC+HWC+PGPIDTWN+ LLQ++K E
Sbjct  397   EVSSRNDCIHWCLPGPIDTWNDILLQMMKTE  427



>ref|XP_010262165.1| PREDICTED: protein trichome birefringence-like 19 [Nelumbo nucifera]
Length=291

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 181/259 (70%), Gaps = 7/259 (3%)
 Frame = +3

Query  468   LLASVADPVKVS----DAAVGRWVYKEYNFTLLSFWSPHIVKAKDADPLWVSPDS-LMNL  632
             L   VADPV VS    D    RW + +Y+FT+ ++WSP ++KAKD    W    + LM+L
Sbjct  26    LRFQVADPVDVSENPWDGKFKRWFFSDYSFTIATYWSPQLIKAKDT--TWPKEKTGLMHL  83

Query  633   YTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYG  812
             Y DEPD  W  ++   D VI SAGQWF+RP  +Y+ GK+VGCH C +  +     Y+GY 
Sbjct  84    YLDEPDEAWISKIDKFDYVIISAGQWFWRPLLFYEQGKVVGCHICFDKNMTDLTMYYGYR  143

Query  813   LAFRTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLE  992
              AFR AFK + + ++F+G++ LRTFSP HFE+G W +GG C RT+PF   + KL+G+ LE
Sbjct  144   RAFRMAFKAIRNLKEFKGMLFLRTFSPGHFEDGTWKTGGTCQRTKPFRSNEKKLQGFDLE  203

Query  993   MYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTTADCVHWC  1172
              YLTQV EF  A+RE  K+G+ FRLLDTT++ VLRPDGHP HYGHW  EN T  DCVHWC
Sbjct  204   FYLTQVEEFRTAEREARKQGLEFRLLDTTQATVLRPDGHPGHYGHWPQENITINDCVHWC  263

Query  1173  MPGPIDTWNEFLLQVLKME  1229
             +PGP+DTWNEFLLQ+LKM+
Sbjct  264   LPGPVDTWNEFLLQILKMK  282



>ref|XP_002456067.1| hypothetical protein SORBIDRAFT_03g029760 [Sorghum bicolor]
 gb|EES01187.1| hypothetical protein SORBIDRAFT_03g029760 [Sorghum bicolor]
Length=387

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 164/378 (43%), Positives = 223/378 (59%), Gaps = 19/378 (5%)
 Frame = +3

Query  114   TTLVIFATFCFTSYNISDSLLQSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCD-IEDR  290
             + +VI + F    Y       Q +   P  +C+IF+G WVP P+ P YTN T CD I++ 
Sbjct  18    SVVVILSCFTNVPYLQLSYTDQLYVAPPVPKCDIFRGEWVPDPDSPQYTNET-CDFIQEH  76

Query  291   QNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCL  470
             QNCM +GRPD  FLKWRW+PD C+LP FD   FL++V  KT+AFVGDS+ARN MQSL CL
Sbjct  77    QNCMLYGRPDLEFLKWRWKPDACDLPRFDPHTFLQVVGNKTVAFVGDSLARNHMQSLLCL  136

Query  471   LASVADPVKVS---DAAVGRWVYKE-YNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYT  638
             L+ VA P  VS        + +Y E YN TL  FWSP +V++++          +  LY 
Sbjct  137   LSKVAKPKDVSVTEKTDPNKILYYEGYNVTLYLFWSPFLVRSEEV----ADQPGVFRLYL  192

Query  639   DEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLA  818
             DE D  W    +  D V+ S   WF R  ++Y+ G++VG             +   + +A
Sbjct  193   DEADTKWLSVASRFDYVLLSGANWFTRQSYFYERGQLVGGMYVPLNFTSSLTNQHSHRMA  252

Query  819   FRTAFKTLLDHEKFRGLVILRTFSP-AHFENGEWNSGGNCVRTRPFTKRQMK-LEGYTLE  992
             FRTA + L     FRG VILRT SP +HFE G +++GG+C RTRP+   +   + G  LE
Sbjct  253   FRTALRALAGDAGFRGKVILRTLSPMSHFEGGTYDAGGDCRRTRPYRANETAPMGGVELE  312

Query  993   MYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHENKTT-ADCVHW  1169
              Y +Q+ EF  A      +G+   L+D T +M++RPDGHP+ YGHW HE +T   DC+HW
Sbjct  313   FYTSQLEEFREA------EGLDVVLMDPTAAMLMRPDGHPSRYGHWPHEKRTLYNDCIHW  366

Query  1170  CMPGPIDTWNEFLLQVLK  1223
             C+PGPID WN+ LL +L 
Sbjct  367   CLPGPIDAWNDMLLHMLS  384



>ref|XP_004966894.1| PREDICTED: uncharacterized protein LOC101775275 [Setaria italica]
Length=834

 Score =   322 bits (824),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 210/334 (63%), Gaps = 17/334 (5%)
 Frame = +3

Query  207   CNIFK-GNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             C+IF+ G WVP  + PYYTN T   I++ QNCMK+GRPDTGFL+WRW+P  CELP FD  
Sbjct  102   CDIFRPGEWVPDDDAPYYTNLTCPLIQEHQNCMKYGRPDTGFLRWRWRPAGCELPRFDAA  161

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAAVGRWV---YKEYNFTLL  554
              FL+ VR  +MAFVGDS+ARN MQSL CLL+ VA P  +S      +    Y+ +NFT+ 
Sbjct  162   AFLDAVRDTSMAFVGDSLARNHMQSLMCLLSKVAYPKDISKTTHPEFRTMHYESHNFTVA  221

Query  555   SFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYY  734
              FWSP +V+    DP       + +++ DEPD  WA  +A  D V+ SA  WF RP  +Y
Sbjct  222   IFWSPFLVRGYQPDPR----RHMWDIHLDEPDAAWASGIAGFDRVVLSAANWFTRPAMFY  277

Query  735   KNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-AHFENG  911
             ++G++VGCH C    +    H     +AFR A + L+    F G VI+RT SP +HFE G
Sbjct  278   ESGRVVGCHYCLAPGVPDLTHRHSLRMAFRAALRVLV--AGFNGTVIVRTLSPTSHFEGG  335

Query  912   EWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKRE-----GSKKGVRFRLLDT  1076
              W+ GG+C RTRP T  ++++ G  L+ +  QV EF  AK E        +G R  L+DT
Sbjct  336   AWDRGGDCRRTRPLTAGEVRMGGLDLDYHTAQVEEFARAKAEVEASGSGGRGPRLVLMDT  395

Query  1077  TESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCM  1175
             T +MVLRPDGHP+ YGHWAHEN T   DCVHWC+
Sbjct  396   TPAMVLRPDGHPSRYGHWAHENVTLYNDCVHWCL  429


 Score =   301 bits (770),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 160/387 (41%), Positives = 216/387 (56%), Gaps = 20/387 (5%)
 Frame = +3

Query  108   ISTTLVIFATFCFTSYN-------ISDSLLQSFNLFPGGECNIFKGNWVPFPEGPYYTNA  266
             ++T LVI A       +       ++D    S NL     CNIFKG WVP P  P YT  
Sbjct  450   LATCLVILAVVILQDDSEPLLPSLVADGDSGSANL----SCNIFKGEWVPDPGAPCYTAE  505

Query  267   TKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARN  446
             T   I    +C+++GRPD GF++WRW+P  CELP  D  +FL   RG++MAFVGDS+ARN
Sbjct  506   TCPVIHGHYDCLRYGRPDLGFIRWRWRPAGCELPHLDPARFLRAARGRSMAFVGDSLARN  565

Query  447   QMQSLKCLLASVADPVKVSDAAVGRWVYKEYNFTLLSFWSPHIVKAKDADP--LWVSPDS  620
             QM SL CLLA    P   ++AA   + ++ + FT+ SFWSP +V A +ADP     S   
Sbjct  566   QMHSLVCLLARAETPSPWTNAAGHAFRFRRHRFTVASFWSPFLVHAAEADPDGPARSGAG  625

Query  621   LMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIKKRNHY  800
             L +L+ DEPD  WA   +  D V+ SAG WFFRP  +++ G +VGC+ C    +      
Sbjct  626   LWSLHLDEPDAGWAARASEFDYVVVSAGSWFFRPSVFHERGHLVGCNACLAPNVTDLTLR  685

Query  801   FGYGLAFRTAF-----KTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQ  965
             +    AFRTA             +    V++ T SP+H+ENG WN  G+C RTRP  + +
Sbjct  686   YPLRKAFRTALRAAAAAGAPPGRRRARTVVVGTVSPSHYENGTWNEDGDCARTRPLARGE  745

Query  966   MKLEGYTLEMYLTQVREFMAAKREGSKKG-VRFRLLDTTESMVLRPDGHPNHYGHWAHEN  1142
              ++     EM+  QV EF AA+RE   KG  R  LLD TE+M  RPD HP  Y  W  + 
Sbjct  746   WEVNAVEKEMHAIQVEEFAAARREAKGKGAARMLLLDATEAMAQRPDAHPGKYRLWQPDR  805

Query  1143  -KTTADCVHWCMPGPIDTWNEFLLQVL  1220
                + DC+HWC+PG +D  N+ LL +L
Sbjct  806   FNVSRDCLHWCLPGAMDACNDMLLHML  832



>ref|XP_008675270.1| PREDICTED: protein trichome birefringence-like 20 [Zea mays]
 tpg|DAA58309.1| TPA: putative DUF231 domain containing family protein [Zea mays]
Length=390

 Score =   306 bits (784),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/351 (46%), Positives = 217/351 (62%), Gaps = 22/351 (6%)
 Frame = +3

Query  195   PGGECNIFKGNWVPFPEGPYYTNATKCD-IEDRQNCMKFGRPDTGFLKWRWQPDRCELPL  371
             P  +C+IF+G WVP P  P YTN T CD I++ QNCM +GRPD  FLKWRW+PD C+LP 
Sbjct  51    PVPKCDIFRGEWVPDPAPPQYTNET-CDFIQEHQNCMLYGRPDLEFLKWRWKPDGCDLPR  109

Query  372   FDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADP--VKVSDAAVGRWV--YKEY  539
             FD  +FL++V  K++AFVGDS+ARN MQSL CLLA V  P  V V+D A    +  Y+ Y
Sbjct  110   FDPHRFLQVVANKSVAFVGDSLARNHMQSLFCLLAKVEKPKDVSVTDRADPNMILYYEGY  169

Query  540   NFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWFFR  719
             NFT+  FWSP +V++++          +  LY DEPD  W    +  D V+ S   WF R
Sbjct  170   NFTMYLFWSPFLVRSEE------DVAGVFKLYLDEPDSRWLSVASQLDYVLLSGANWFTR  223

Query  720   PFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-A  896
               ++Y+ G++VG             +   + +AFRTA + L    +FRG VILRT SP +
Sbjct  224   QSYFYEGGQLVGGVYVPLNFTSSLTNQHSHRMAFRTALRALAG-ARFRGKVILRTLSPMS  282

Query  897   HFENGEWNSGGNCVRTRPFTKRQMK-LEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLD  1073
             HFE G +++GG+C RTRP+   +   + G  LE Y +Q+ EF  A      KG+   L+D
Sbjct  283   HFEGGAYDAGGDCRRTRPYRADETAPMGGLELEFYTSQLEEFREA------KGLDVVLMD  336

Query  1074  TTESMVLRPDGHPNHYGHWAHENKTT-ADCVHWCMPGPIDTWNEFLLQVLK  1223
              T +M++RPDGHP+ YGHW  E +T   DC+HWC+PGPID WN+ LL +L 
Sbjct  337   PTAAMLMRPDGHPSRYGHWPDEKRTLYNDCIHWCLPGPIDAWNDMLLHMLS  387



>ref|XP_002454344.1| hypothetical protein SORBIDRAFT_04g029130 [Sorghum bicolor]
 gb|EES07320.1| hypothetical protein SORBIDRAFT_04g029130 [Sorghum bicolor]
Length=455

 Score =   308 bits (788),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 159/363 (44%), Positives = 208/363 (57%), Gaps = 37/363 (10%)
 Frame = +3

Query  207   CNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQ  386
             C++ +G W P  E PYYTN T   I+D QNCMKFG+P   FL+WRWQPD C+LP FD  +
Sbjct  101   CDLTRGQWAPDDEAPYYTNLTCPFIDDLQNCMKFGKPSLEFLRWRWQPDGCDLPRFDAAR  160

Query  387   FLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVK---------VSDAAVGR-WVYKE  536
             FLE  RGK+MAFVGDS+ARN ++SL C+L+ VA PV+         V+  AV R + Y  
Sbjct  161   FLEATRGKSMAFVGDSLARNHLKSLLCILSQVAQPVEMVTTTTEIDVTGRAVRRDFHYGS  220

Query  537   YNFTLLSFWSPHIVKAKDADP-----LWVSPDSLMNLYTDEPDRLWADEMANADVVIFSA  701
             + F +  FWSP +VKA  ++      LW       +++ D PD  WA  +A+ D ++ S 
Sbjct  221   HGFNVSLFWSPFLVKANLSNAELGLGLW-------DMHLDTPDARWAAHIADFDYIVLSG  273

Query  702   GQWFFRPFFYYKNGKIV-------GCHRCNETAIKKRNHYFGYGLAFRTAFKTLLDHEKF  860
               WFFRP  Y+  G+ V       G H   E  +           AFRTA   +   E F
Sbjct  274   TNWFFRPSVYHVGGRPVGRNSGASGAHNATEMPVSG-----AMRAAFRTALGAIAGREGF  328

Query  861   RGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREG  1040
             RG  ++RT +PAHFENGEWN+GG+CVRTRPF + Q   +    E    QV      +   
Sbjct  329   RGKALVRTVTPAHFENGEWNTGGDCVRTRPFRRGQRVRDAVVAEFRAAQVDALRETEATS  388

Query  1041  SKKGVRFRLLDTTESMVLRPDGHPNHYGH---WAHENKTTADCVHWCMPGPIDTWNEFLL  1211
              + G    LLD TE+M LRPDGHP+ YGH    + E     DC+HWC+PGPID W+E L 
Sbjct  389   QRNGAELLLLDITEAMELRPDGHPSRYGHPPGGSVEGSFVVDCLHWCLPGPIDLWSELLF  448

Query  1212  QVL  1220
             Q+L
Sbjct  449   QML  451



>ref|NP_001048004.1| Os02g0729100 [Oryza sativa Japonica Group]
 dbj|BAF09918.1| Os02g0729100 [Oryza sativa Japonica Group]
Length=416

 Score =   305 bits (781),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 164/357 (46%), Positives = 204/357 (57%), Gaps = 25/357 (7%)
 Frame = +3

Query  204   ECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGR  383
             +CN+ +G WVP  E PYYTN T   I+D QNCMKFG+P   ++ WRW+PD CELP FD  
Sbjct  64    KCNLTRGEWVPDGEAPYYTNLTCPFIDDHQNCMKFGKPSLEYVSWRWKPDGCELPRFDAA  123

Query  384   QFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSDAA-----VGRWV-----YK  533
             +FLE +RGK+MAFVGDS+ARN  +SL CLL+ VA PV++  AA      GR V     Y 
Sbjct  124   RFLEAMRGKSMAFVGDSLARNHFKSLLCLLSKVAQPVELVGAAPEIDVTGRAVRRDFRYD  183

Query  534   EYNFTLLSFWSPHIVKAKDADPLWVSPDSLMNLYTDEPDRLWADEMANADVVIFSAGQWF  713
              + FT   FWSP +VKA  A+        L +L+ D  D  WA  +A  D V+ S   WF
Sbjct  184   SHGFTASLFWSPFLVKANLANATL----GLWDLHLDTADARWAAHVAEFDYVVLSDTNWF  239

Query  714   FRPFFYYKNGKIVGCHRCNETAIKKRNHYFGYGLAFRTAFKT-----LLDHEKFRGLVIL  878
              RP  YY+ G+ VG    N  A            A R AF T           FRG  IL
Sbjct  240   LRPSVYYEGGRAVG---RNGAAPVTNATEIAVPRAVRAAFSTALGALAAAPGTFRGKAIL  296

Query  879   RTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYLTQVREFMAAKREGSKKGVR  1058
             R+ +PAHFENGEWN+GG+CVRTRPF + +  L     E    QV     A+    + G  
Sbjct  297   RSVTPAHFENGEWNTGGDCVRTRPFRRDERALGAVEAEYLAVQVDAVREAEAAVRRNGGE  356

Query  1059  FRLLDTTESMVLRPDGHPNHYGH---WAHENKTTADCVHWCMPGPIDTWNEFLLQVL  1220
              RLLD TE+M LRPDGHP+ YGH    + E     DC+HWC+PGPID W+E L  +L
Sbjct  357   LRLLDITEAMDLRPDGHPSRYGHPPGGSVEGSFVVDCLHWCLPGPIDLWSELLFHML  413



>ref|XP_004953787.1| PREDICTED: uncharacterized protein LOC101785560 [Setaria italica]
Length=452

 Score =   305 bits (782),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 161/376 (43%), Positives = 215/376 (57%), Gaps = 28/376 (7%)
 Frame = +3

Query  147   TSYNISDSLLQSFNLFPGGECNIFKGNWVPFPEGPYYTNATKCDIEDRQNCMKFGRPDTG  326
             T+Y+ S SL  +    P   C++ +G WVP  E PYYTN T   I+D QNCMKFG+P   
Sbjct  83    TNYSSSASLATTV---PVEACDLTRGQWVPDDEAPYYTNLTCPFIDDLQNCMKFGKPSLE  139

Query  327   FLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVARNQMQSLKCLLASVADPVKVSD  506
             F++WRWQPD C+LP FD  +FLE +RGK+MAFVGDS+ARN ++SL C+L+ VA PV+V  
Sbjct  140   FMRWRWQPDGCDLPRFDAARFLEAMRGKSMAFVGDSLARNHLKSLLCILSQVAQPVEVLT  199

Query  507   AA----VGRWV-----YKEYNFTLLSFWSPHIVKA--KDADP---LWVSPDSLMNLYTDE  644
              A     GR V     Y  + F +  FWSP +VKA   +A+P   LW       +++ D 
Sbjct  200   TAEIDVTGRAVRRDFHYGSHGFNVSLFWSPFLVKANLSNAEPGLGLW-------DMHLDT  252

Query  645   PDRLWADEMANADVVIFSAGQWFFRPFFYYK-NGKIVGCHRCNETAIKKRNHYFGYGLAF  821
             PD  WA  +++ D ++ S   WFFRP  Y +    +         A  +         AF
Sbjct  253   PDARWAAHISDFDYIVLSGTNWFFRPSVYREGGRVVGRNGGAAHDAATEMPVSGAVRAAF  312

Query  822   RTAFKTLLDHEKFRGLVILRTFSPAHFENGEWNSGGNCVRTRPFTKRQMKLEGYTLEMYL  1001
             RTA   +   E F G  ++RT +PAHFENGEWN+GG+CVR RPF + +   +    E   
Sbjct  313   RTALGAIAAREGFHGKALVRTVTPAHFENGEWNTGGDCVRERPFRRGERDRDAVVAEFRA  372

Query  1002  TQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGH---WAHENKTTADCVHWC  1172
              QV           +KG   RLLD TE+M LRPDGHP+ YGH    + E     DC+HWC
Sbjct  373   AQVDALRDTAATSKRKGAELRLLDITEAMELRPDGHPSRYGHPPGGSVEGSFVVDCLHWC  432

Query  1173  MPGPIDTWNEFLLQVL  1220
             +PGP+D W+E L Q+L
Sbjct  433   LPGPVDLWSELLFQML  448



>ref|XP_004969338.1| PREDICTED: uncharacterized protein LOC101767878 [Setaria italica]
Length=398

 Score =   303 bits (777),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 167/389 (43%), Positives = 229/389 (59%), Gaps = 30/389 (8%)
 Frame = +3

Query  114   TTLVIFATFCFT-------SYNISDSLLQSFNLF---PGGECNIFKGNWVPFPEGPYYTN  263
             + +VI +  CFT       SY   D L  S  L    P  +C+IF+G WVP P+ P+YTN
Sbjct  18    SAVVILS--CFTNVPYLQLSYTDDDDLRHSSYLAAPAPPPKCDIFRGEWVPDPDAPHYTN  75

Query  264   ATKCDIEDRQNCMKFGRPDTGFLKWRWQPDRCELPLFDGRQFLELVRGKTMAFVGDSVAR  443
              T   I++ QNCM +GRPD  FL+WRW+P  C+LP FD  +FL +V  KT+AFVGDS+AR
Sbjct  76    ETCAFIQEHQNCMFYGRPDLDFLRWRWKPHGCDLPRFDPHRFLAVVGNKTIAFVGDSLAR  135

Query  444   NQMQSLKCLLASVADP--VKVSDAAVGRWV--YKEYNFTLLSFWSPHIVKAKDADPLWVS  611
             N MQSL CLL+ V  P  V V+D      +  Y+ YNFT+  FWSP +V++++     V 
Sbjct  136   NHMQSLLCLLSKVVSPKDVSVTDKTDPNKILHYEGYNFTIYLFWSPFLVRSEE-----VG  190

Query  612   PD--SLMNLYTDEPDRLWADEMANADVVIFSAGQWFFRPFFYYKNGKIVGCHRCNETAIK  785
              D   +  LY DEPD  W    +  D V+ S   WF R  ++Y+ G++VG          
Sbjct  191   GDRPGVFRLYLDEPDDRWLSASSRFDYVLLSGANWFTRESYFYERGQLVGGMYVPLNFTS  250

Query  786   KRNHYFGYGLAFRTAFKTLLDHEKFRGLVILRTFSP-AHFENGEWNSGGNCVRTRPFTKR  962
                + + + +AFRTA + L    +FRG VILRT SP +HFE G +N+GG+C RTRP    
Sbjct  251   SLTNQYSHRMAFRTALRALA-VARFRGKVILRTLSPMSHFEGGAYNAGGDCRRTRPNRDN  309

Query  963   QMK-LEGYTLEMYLTQVREFMAAKREGSKKGVRFRLLDTTESMVLRPDGHPNHYGHWAHE  1139
             +   + G  LE Y +Q+ EF  A      + +   L+D T +M++RPDGHP+ YGHW  E
Sbjct  310   ETAPMGGVELEFYTSQLEEFREA---AEARVLDVALMDPTAAMLMRPDGHPSRYGHWPDE  366

Query  1140  NKTT-ADCVHWCMPGPIDTWNEFLLQVLK  1223
              +T   DC+HWC+PGPID WN+ LL +L 
Sbjct  367   KRTLYNDCIHWCLPGPIDAWNDMLLHMLS  395



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4125412501398