BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23946_g1_i2 len=1703 path=[3937:0-232 4170:233-272 4210:273-343
4281:344-376 4314:377-473 4411:474-605 4543:606-643 4581:644-712
4650:713-745 4683:746-845 4783:846-917 4855:918-925 1007:926-955
7607:956-1018 7670:1019-1094 7746:1095-1150 7801:1151-1213
3836:1214-1242 7891:1243-1346 6377:1347-1375 8022:1376-1431
6761:1432-1702]

Length=1703
                                                                      Score     E

ref|XP_006349946.1|  PREDICTED: cytochrome P450 82C2-like               551   0.0      
ref|XP_006339196.1|  PREDICTED: cytochrome P450 82C4-like               534   0.0      
ref|XP_009801176.1|  PREDICTED: cytochrome P450 CYP82D47-like           534   0.0      
ref|XP_009761500.1|  PREDICTED: cytochrome P450 82C2-like               533   2e-180   
ref|XP_009606611.1|  PREDICTED: cytochrome P450 82C4-like               531   5e-180   
gb|ABC69375.1|  CYP82M1v4                                               528   5e-179   Nicotiana tabacum [American tobacco]
ref|XP_009616319.1|  PREDICTED: cytochrome P450 CYP82D47-like           527   1e-178   
gb|ABC69374.1|  CYP82M1v3                                               526   2e-178   Nicotiana tabacum [American tobacco]
ref|XP_006352674.1|  PREDICTED: cytochrome P450 82C4-like               524   1e-177   
gb|ABC69373.1|  CYP82M1v2                                               524   2e-177   Nicotiana tabacum [American tobacco]
gb|ABC69372.1|  CYP82M1v1                                               523   3e-177   Nicotiana tabacum [American tobacco]
gb|ABC69376.1|  CYP82M1v5                                               523   3e-177   Nicotiana tabacum [American tobacco]
ref|XP_004249377.1|  PREDICTED: cytochrome P450 82C4-like               523   5e-177   
dbj|BAM36727.1|  nicotine N-demethylase                                 518   3e-175   
dbj|BAM36724.1|  nicotine N-demethylase                                 518   4e-175   
dbj|BAM36723.1|  nicotine N-demethylase                                 516   1e-174   
ref|XP_011089652.1|  PREDICTED: cytochrome P450 82C2                    516   2e-174   
dbj|BAM36725.1|  nicotine N-demethylase                                 516   3e-174   
dbj|BAM36726.1|  nicotine N-demethylase                                 514   1e-173   
ref|XP_009609537.1|  PREDICTED: cytochrome P450 82C4-like               512   5e-173   
ref|XP_009757628.1|  PREDICTED: cytochrome P450 CYP82D47-like           509   6e-172   
gb|ADP65809.1|  nicotine N-demethylase                                  509   7e-172   
ref|XP_009609539.1|  PREDICTED: cytochrome P450 82C4-like               509   9e-172   
ref|XP_009619218.1|  PREDICTED: cytochrome P450 CYP82D47-like           508   2e-171   
gb|ABX56037.1|  CYP82E5v2                                               508   3e-171   Nicotiana tabacum [American tobacco]
ref|XP_009778755.1|  PREDICTED: cytochrome P450 82C4-like               508   3e-171   
gb|ABA07807.1|  cytochrome P450 monooxygenase CYP82E3                   508   4e-171   Nicotiana tabacum [American tobacco]
gb|ABD39479.1|  CYP82E4v8                                               506   1e-170   Nicotiana tabacum [American tobacco]
gb|ABD39477.1|  CYP82E4v6                                               505   4e-170   Nicotiana tabacum [American tobacco]
gb|ABC69371.1|  CYP82E5                                                 504   6e-170   Nicotiana tabacum [American tobacco]
gb|ABD39480.1|  CYP82E4v10                                              504   1e-169   Nicotiana tabacum [American tobacco]
gb|ABA07805.1|  cytochrome P450 monooxygenase CYP82E4v1                 503   2e-169   Nicotiana tabacum [American tobacco]
gb|ABA07804.1|  cytochrome P450 monooxygenase CYP82E4v2                 503   2e-169   Nicotiana tabacum [American tobacco]
ref|XP_009627979.1|  PREDICTED: cytochrome P450 82C4-like               503   2e-169   
gb|ABD39478.1|  CYP82E4v7                                               503   3e-169   Nicotiana tabacum [American tobacco]
gb|ABD39476.1|  CYP82E4v5                                               503   3e-169   Nicotiana tabacum [American tobacco]
ref|XP_004248527.2|  PREDICTED: cytochrome P450 CYP82D47-like           502   9e-169   
gb|ABD39475.1|  CYP82E4v4                                               501   2e-168   Nicotiana tabacum [American tobacco]
ref|XP_007200049.1|  hypothetical protein PRUPE_ppa023510mg             501   2e-168   
gb|ABD39474.1|  CYP82E4v3                                               501   2e-168   Nicotiana tabacum [American tobacco]
gb|ABD39481.1|  CYP82E4v11                                              501   2e-168   Nicotiana tabacum [American tobacco]
ref|XP_004236938.1|  PREDICTED: cytochrome P450 82C4-like               499   1e-167   
gb|AGD93125.1|  CYP450 nicotine N-demethylase                           498   1e-167   
gb|AJD25203.1|  cytochrome P450 CYP82V2                                 499   2e-167   
gb|ABD39482.1|  CYP82E4v12                                              498   3e-167   Nicotiana tabacum [American tobacco]
ref|XP_002274740.1|  PREDICTED: cytochrome P450 CYP82D47                498   3e-167   Vitis vinifera
ref|XP_008235431.1|  PREDICTED: cytochrome P450 82C4-like               497   7e-167   
ref|XP_002274509.1|  PREDICTED: cytochrome P450 CYP82D47-like           495   8e-166   Vitis vinifera
ref|XP_007201695.1|  hypothetical protein PRUPE_ppa004301mg             493   2e-165   
gb|ABD39485.1|  CYP82E2v4                                               490   2e-164   Nicotiana tabacum [American tobacco]
ref|XP_011101555.1|  PREDICTED: cytochrome P450 CYP82D47-like           489   7e-164   
ref|XP_009758062.1|  PREDICTED: cytochrome P450 82C4-like               488   8e-164   
gb|ABR57311.1|  cytochrome P450 monooxygenase                           488   1e-163   Nicotiana sylvestris
ref|XP_003635525.2|  PREDICTED: cytochrome P450 CYP82D47-like           488   2e-163   
gb|KDP26345.1|  hypothetical protein JCGZ_17503                         488   4e-163   
emb|CBI36491.3|  unnamed protein product                                488   1e-162   
emb|CDP15065.1|  unnamed protein product                                484   5e-162   
gb|ABD39483.1|  CYP82E2v2                                               484   5e-162   Nicotiana tabacum [American tobacco]
ref|XP_006375022.1|  hypothetical protein POPTR_0014s03660g             484   7e-162   
ref|XP_011030904.1|  PREDICTED: cytochrome P450 82C4-like               484   1e-161   
gb|ABA07806.2|  cytochrome P450 monooxygenase CYP82E2                   483   1e-161   Nicotiana tabacum [American tobacco]
emb|CAN61061.1|  hypothetical protein VITISV_018742                     484   1e-161   Vitis vinifera
ref|XP_002264790.1|  PREDICTED: cytochrome P450 CYP82D47                482   3e-161   Vitis vinifera
ref|XP_007136644.1|  hypothetical protein PHAVU_009G061600g             482   7e-161   
ref|XP_004241385.1|  PREDICTED: cytochrome P450 82C2-like               482   1e-160   
emb|CAN77159.1|  hypothetical protein VITISV_019026                     483   2e-160   Vitis vinifera
gb|ABD39484.1|  CYP82E2v3                                               479   4e-160   Nicotiana tabacum [American tobacco]
ref|XP_002264464.1|  PREDICTED: cytochrome P450 CYP82D47                477   3e-159   Vitis vinifera
ref|XP_004517185.1|  PREDICTED: cytochrome P450 82C4-like               476   6e-159   
ref|XP_006473405.1|  PREDICTED: cytochrome P450 82C4-like               476   1e-158   
ref|XP_002300088.2|  hypothetical protein POPTR_0001s34230g             476   1e-158   Populus trichocarpa [western balsam poplar]
ref|XP_009348373.1|  PREDICTED: cytochrome P450 CYP82D47-like           476   2e-158   
ref|XP_002531094.1|  cytochrome P450, putative                          475   2e-158   Ricinus communis
ref|XP_010106089.1|  Cytochrome P450 82C4                               475   3e-158   
ref|XP_010664626.1|  PREDICTED: cytochrome P450 CYP82D47                475   3e-158   
ref|XP_003523888.1|  PREDICTED: cytochrome P450 82C4-like               474   9e-158   
gb|KDP26346.1|  hypothetical protein JCGZ_17504                         473   1e-157   
ref|XP_008235430.1|  PREDICTED: cytochrome P450 CYP82D47-like           473   1e-157   
ref|XP_007227272.1|  hypothetical protein PRUPE_ppa017703mg             473   2e-157   
ref|XP_010069626.1|  PREDICTED: cytochrome P450 CYP82D47-like           474   2e-157   
ref|XP_009599169.1|  PREDICTED: cytochrome P450 82C4-like               473   2e-157   
ref|XP_009768110.1|  PREDICTED: cytochrome P450 82A4-like               473   2e-157   
ref|XP_008372514.1|  PREDICTED: cytochrome P450 CYP82D47-like           472   4e-157   
ref|XP_010069627.1|  PREDICTED: cytochrome P450 CYP82D47-like           473   4e-157   
gb|KDO84376.1|  hypothetical protein CISIN_1g036812mg                   471   5e-157   
ref|XP_006443550.1|  hypothetical protein CICLE_v10019727mg             471   9e-157   
ref|XP_006434890.1|  hypothetical protein CICLE_v10003803mg             471   1e-156   
ref|XP_008372515.1|  PREDICTED: cytochrome P450 82C4-like               470   2e-156   
ref|XP_009364162.1|  PREDICTED: cytochrome P450 82C4-like               470   3e-156   
ref|XP_006355071.1|  PREDICTED: cytochrome P450 82C4-like               469   4e-156   
ref|XP_007017403.1|  Cytochrome P450, family 82, subfamily C, pol...    469   4e-156   
ref|XP_009348374.1|  PREDICTED: cytochrome P450 CYP82D47-like           469   4e-156   
ref|XP_008378409.1|  PREDICTED: cytochrome P450 82C4-like               468   2e-155   
ref|XP_011045174.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    468   2e-155   
ref|XP_002284031.1|  PREDICTED: cytochrome P450 82C4                    468   2e-155   Vitis vinifera
gb|KCW58034.1|  hypothetical protein EUGRSUZ_H00762                     468   2e-155   
ref|XP_009595933.1|  PREDICTED: cytochrome P450 82A4-like               467   5e-155   
ref|XP_011040244.1|  PREDICTED: cytochrome P450 82C4-like               467   5e-155   
ref|XP_010069621.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    467   8e-155   
ref|XP_009792748.1|  PREDICTED: cytochrome P450 CYP82D47-like           466   8e-155   
ref|XP_009770601.1|  PREDICTED: cytochrome P450 CYP82D47-like           465   1e-154   
emb|CAN75482.1|  hypothetical protein VITISV_020998                     464   2e-154   Vitis vinifera
ref|XP_006443549.1|  hypothetical protein CICLE_v10019706mg             465   3e-154   
ref|XP_002323130.1|  hypothetical protein POPTR_0016s00980g             464   3e-154   Populus trichocarpa [western balsam poplar]
ref|XP_006376421.1|  cytochrome P450 family protein                     463   9e-154   
ref|XP_004292356.1|  PREDICTED: cytochrome P450 82C4-like               462   1e-153   
ref|XP_007134137.1|  hypothetical protein PHAVU_010G022400g             463   1e-153   
gb|ABC69420.1|  CYP82E8                                                 462   1e-153   Nicotiana tabacum [American tobacco]
ref|XP_010264712.1|  PREDICTED: cytochrome P450 CYP82D47-like           463   2e-153   
ref|XP_010918630.1|  PREDICTED: cytochrome P450 82C4-like               461   4e-153   
ref|XP_002531093.1|  cytochrome P450, putative                          462   4e-153   Ricinus communis
ref|XP_010104162.1|  Cytochrome P450 82C4                               460   5e-153   
emb|CAN66023.1|  hypothetical protein VITISV_042713                     458   3e-152   Vitis vinifera
ref|XP_004510285.1|  PREDICTED: uncharacterized protein LOC101505071    476   3e-152   
ref|XP_007049681.1|  Cytochrome P450                                    459   3e-152   
ref|XP_011045172.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    460   4e-152   
ref|XP_007017417.1|  Cytochrome P450 82A3, putative isoform 2           459   7e-152   
ref|XP_010253830.1|  PREDICTED: cytochrome P450 CYP82D47-like           458   1e-151   
ref|XP_010437977.1|  PREDICTED: cytochrome P450 82C4-like               457   2e-151   
ref|XP_006435895.1|  hypothetical protein CICLE_v10031217mg             457   2e-151   
dbj|BAA35080.1|  putative cytochrome P450                               457   3e-151   Nicotiana tabacum [American tobacco]
ref|XP_011008137.1|  PREDICTED: cytochrome P450 82G1-like               457   3e-151   
ref|XP_007049687.1|  Cytochrome P450 82A3, putative                     457   4e-151   
ref|XP_010447469.1|  PREDICTED: cytochrome P450 82C4-like               455   2e-150   
ref|XP_002283952.2|  PREDICTED: cytochrome P450 CYP82D47-like           455   2e-150   Vitis vinifera
ref|XP_002510298.1|  cytochrome P450, putative                          455   2e-150   Ricinus communis
gb|KEH25406.1|  cytochrome P450 family protein                          454   2e-150   
ref|XP_002305292.2|  hypothetical protein POPTR_0004s10630g             454   2e-150   Populus trichocarpa [western balsam poplar]
ref|XP_004247061.1|  PREDICTED: cytochrome P450 82C4-like               454   4e-150   
ref|XP_006486179.1|  PREDICTED: cytochrome P450 82C4-like               453   9e-150   
ref|XP_002282035.1|  PREDICTED: cytochrome P450 CYP82D47-like           453   1e-149   Vitis vinifera
emb|CAN74205.1|  hypothetical protein VITISV_031127                     452   2e-149   Vitis vinifera
emb|CBI29738.3|  unnamed protein product                                459   3e-149   
emb|CDP03915.1|  unnamed protein product                                450   3e-149   
emb|CAN81014.1|  hypothetical protein VITISV_025152                     452   3e-149   Vitis vinifera
gb|AJD25202.1|  cytochrome P450 CYP82U4                                 451   4e-149   
emb|CDP15728.1|  unnamed protein product                                452   4e-149   
ref|XP_006342717.1|  PREDICTED: cytochrome P450 82C4-like               451   4e-149   
ref|XP_002264473.1|  PREDICTED: cytochrome P450 82C4-like               451   5e-149   Vitis vinifera
gb|KEH18125.1|  cytochrome P450 family protein                          450   7e-149   
ref|XP_006435903.1|  hypothetical protein CICLE_v10031215mg             451   8e-149   
emb|CAN66846.1|  hypothetical protein VITISV_002367                     451   1e-148   Vitis vinifera
ref|XP_010547839.1|  PREDICTED: cytochrome P450 82C4-like               449   2e-148   
ref|XP_007017416.1|  Cytochrome P450 82A3, putative isoform 1           459   2e-148   
ref|XP_006432712.1|  hypothetical protein CICLE_v10000809mg             450   2e-148   
emb|CDY53704.1|  BnaC03g67210D                                          449   2e-148   
ref|XP_002264520.2|  PREDICTED: cytochrome P450 82C4                    451   2e-148   Vitis vinifera
gb|KDO40892.1|  hypothetical protein CISIN_1g009347mg                   450   2e-148   
ref|XP_006435899.1|  hypothetical protein CICLE_v10031216mg             449   3e-148   
emb|CDY23316.1|  BnaA08g12300D                                          449   4e-148   
ref|XP_011037409.1|  PREDICTED: cytochrome P450 82G1-like               448   4e-148   
ref|XP_006366435.1|  PREDICTED: cytochrome P450 82A3-like               448   6e-148   
ref|XP_002282111.2|  PREDICTED: cytochrome P450 82A3-like               448   7e-148   Vitis vinifera
ref|XP_004252778.1|  PREDICTED: cytochrome P450 82C4-like               447   1e-147   
ref|XP_006486181.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    447   2e-147   
ref|XP_008464765.1|  PREDICTED: cytochrome P450 CYP82D47-like           447   2e-147   
emb|CDP15727.1|  unnamed protein product                                449   3e-147   
gb|KFK29809.1|  hypothetical protein AALP_AA7G181800                    446   4e-147   
ref|XP_006375032.1|  hypothetical protein POPTR_0014s03770g             447   5e-147   
ref|XP_002510313.1|  cytochrome P450, putative                          445   1e-146   Ricinus communis
ref|XP_006375031.1|  hypothetical protein POPTR_0014s03760g             445   2e-146   
ref|XP_003548652.1|  PREDICTED: cytochrome P450 82C4-like               444   2e-146   
ref|NP_194922.1|  cytochrome P450, family 82, subfamily C, polype...    445   2e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109920.1|  PREDICTED: cytochrome P450 82C4                    444   2e-146   
ref|XP_003547786.2|  PREDICTED: cytochrome P450 82C2-like               445   3e-146   
gb|KHG07864.1|  Cytochrome P450 protein                                 444   3e-146   
ref|XP_010436299.1|  PREDICTED: cytochrome P450 82C4-like               443   7e-146   
gb|KDP26347.1|  hypothetical protein JCGZ_17505                         443   8e-146   
ref|XP_010451089.1|  PREDICTED: cytochrome P450 82C4                    443   8e-146   
ref|XP_003548649.2|  PREDICTED: cytochrome P450 82C2-like               443   1e-145   
ref|XP_010445016.1|  PREDICTED: cytochrome P450 82C4-like               442   1e-145   
ref|XP_010432796.1|  PREDICTED: cytochrome P450 82C4-like               442   1e-145   
ref|XP_007049686.1|  Cytochrome P450, family 82, subfamily C, pol...    445   1e-145   
ref|XP_011030967.1|  PREDICTED: cytochrome P450 CYP82D47-like           443   1e-145   
gb|KDO40894.1|  hypothetical protein CISIN_1g009786mg                   442   2e-145   
ref|XP_002869304.1|  CYP82C4                                            442   2e-145   
ref|XP_010091295.1|  Cytochrome P450 82G1                               442   4e-145   
ref|XP_006432710.1|  hypothetical protein CICLE_v10000851mg             441   4e-145   
ref|XP_002281431.2|  PREDICTED: cytochrome P450 82C4                    441   4e-145   Vitis vinifera
ref|XP_006432714.1|  hypothetical protein CICLE_v10000845mg             441   4e-145   
ref|XP_006375030.1|  hypothetical protein POPTR_0014s03750g             442   4e-145   
ref|XP_002282085.3|  PREDICTED: cytochrome P450 82A1-like               457   5e-145   Vitis vinifera
ref|XP_007047111.1|  Cytochrome P450                                    441   5e-145   
ref|XP_010061805.1|  PREDICTED: cytochrome P450 CYP82D47-like           441   7e-145   
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                    448   7e-145   Vitis vinifera
ref|XP_006464328.1|  PREDICTED: cytochrome P450 82C4-like               441   8e-145   
ref|NP_001236179.1|  cytochrome P450 CYP82C1                            441   9e-145   
ref|XP_006340061.1|  PREDICTED: cytochrome P450 82C4-like               439   1e-144   
ref|XP_011030916.1|  PREDICTED: cytochrome P450 CYP82D47-like           440   2e-144   
emb|CAN64371.1|  hypothetical protein VITISV_016844                     439   3e-144   Vitis vinifera
ref|XP_004154826.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    439   3e-144   
ref|XP_006423130.1|  hypothetical protein CICLE_v10030016mg             439   4e-144   
emb|CBI40977.3|  unnamed protein product                                439   4e-144   
ref|XP_010647827.1|  PREDICTED: cytochrome P450 CYP82D47                438   5e-144   
ref|XP_006464300.1|  PREDICTED: cytochrome P450 82C4-like               438   5e-144   
emb|CDP00859.1|  unnamed protein product                                438   6e-144   
ref|XP_004147803.1|  PREDICTED: cytochrome P450 82C4-like               438   7e-144   
ref|XP_009780811.1|  PREDICTED: cytochrome P450 82C4-like               444   9e-144   
gb|KGN59914.1|  hypothetical protein Csa_3G852630                       438   1e-143   
dbj|BAF98469.1|  cytochrome P450                                        437   2e-143   Coptis japonica var. dissecta
gb|KDO42182.1|  hypothetical protein CISIN_1g046041mg                   437   2e-143   
gb|KDO65988.1|  hypothetical protein CISIN_1g011292mg                   436   2e-143   
emb|CBI32510.3|  unnamed protein product                                440   2e-143   
ref|XP_007226598.1|  hypothetical protein PRUPE_ppa023495mg             437   2e-143   
gb|KHG26594.1|  Cytochrome P450                                         437   2e-143   
ref|XP_006464298.1|  PREDICTED: cytochrome P450 82C4-like               436   3e-143   
ref|XP_009364189.1|  PREDICTED: cytochrome P450 82A3-like               436   4e-143   
ref|XP_007017413.1|  Cytochrome P450                                    436   4e-143   
ref|XP_003634362.2|  PREDICTED: cytochrome P450 CYP82D47-like           436   7e-143   
gb|KCW68807.1|  hypothetical protein EUGRSUZ_F02406                     435   7e-143   
ref|XP_002284806.1|  PREDICTED: cytochrome P450 CYP82D47                436   7e-143   Vitis vinifera
ref|XP_010064745.1|  PREDICTED: cytochrome P450 CYP82D47-like           436   8e-143   
ref|XP_007017415.1|  Cytochrome P450, putative                          436   9e-143   
ref|XP_011039260.1|  PREDICTED: cytochrome P450 CYP82D47-like           435   9e-143   
ref|XP_002281361.1|  PREDICTED: cytochrome P450 82C4                    435   9e-143   Vitis vinifera
ref|XP_007134140.1|  hypothetical protein PHAVU_010G022700g             435   1e-142   
ref|XP_002284810.3|  PREDICTED: cytochrome P450 CYP82D47                438   1e-142   Vitis vinifera
gb|KDP38438.1|  hypothetical protein JCGZ_04363                         435   1e-142   
ref|XP_006432711.1|  hypothetical protein CICLE_v10003589mg             432   2e-142   
ref|XP_010526010.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    433   5e-142   
ref|XP_007222622.1|  hypothetical protein PRUPE_ppa004175mg             433   6e-142   
ref|XP_007226343.1|  hypothetical protein PRUPE_ppa022174mg             433   6e-142   
ref|XP_009364169.1|  PREDICTED: cytochrome P450 CYP82D47-like           433   7e-142   
gb|KDP38423.1|  hypothetical protein JCGZ_04348                         434   7e-142   
ref|XP_006432704.1|  hypothetical protein CICLE_v10000846mg             432   9e-142   
ref|XP_006464299.1|  PREDICTED: cytochrome P450 82C4-like               432   1e-141   
ref|XP_006283535.1|  hypothetical protein CARUB_v10004585mg             432   1e-141   
ref|XP_006471151.1|  PREDICTED: cytochrome P450 82C4-like               433   1e-141   
gb|AGO03797.1|  cytochrome P450-like protein                            432   2e-141   
ref|XP_010106079.1|  Cytochrome P450 82A3                               432   2e-141   
ref|XP_010069622.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    430   2e-141   
ref|XP_002869302.1|  CYP82C4                                            431   3e-141   
ref|XP_006465163.1|  PREDICTED: cytochrome P450 82C4-like               431   3e-141   
ref|XP_004238201.1|  PREDICTED: cytochrome P450 CYP82D47-like           431   4e-141   
ref|XP_007151142.1|  hypothetical protein PHAVU_004G021300g             431   4e-141   
gb|KDO39483.1|  hypothetical protein CISIN_1g009723mg                   431   4e-141   
gb|ABB20912.1|  P450 mono-oxygenase                                     431   5e-141   Stevia rebaudiana
ref|XP_010547840.1|  PREDICTED: cytochrome P450 82C4-like               431   6e-141   
gb|KDP38422.1|  hypothetical protein JCGZ_04347                         431   6e-141   
ref|XP_006427755.1|  hypothetical protein CICLE_v10025349mg             430   8e-141   
ref|XP_010664625.1|  PREDICTED: cytochrome P450 CYP82D47-like           429   1e-140   
gb|KDO42181.1|  hypothetical protein CISIN_1g009844mg                   429   1e-140   
ref|XP_010919967.1|  PREDICTED: cytochrome P450 CYP82D47-like           429   2e-140   
emb|CAN76287.1|  hypothetical protein VITISV_027433                     430   2e-140   Vitis vinifera
ref|XP_007017410.1|  Cytochrome P450 82A3, putative                     433   2e-140   
ref|XP_007134139.1|  hypothetical protein PHAVU_010G022600g             429   3e-140   
gb|AGF30366.1|  CYP450 monooxygenase CYP82D62                           428   4e-140   
ref|XP_010526011.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    428   4e-140   
ref|XP_004306669.1|  PREDICTED: cytochrome P450 82A3-like               429   4e-140   
ref|XP_008245476.1|  PREDICTED: cytochrome P450 CYP82D47-like           428   4e-140   
ref|XP_002282133.1|  PREDICTED: cytochrome P450 CYP82D47                428   7e-140   Vitis vinifera
ref|XP_008382594.1|  PREDICTED: cytochrome P450 82G1-like               428   8e-140   
ref|XP_006366471.1|  PREDICTED: cytochrome P450 82A3-like               427   8e-140   
ref|XP_009365841.1|  PREDICTED: cytochrome P450 CYP82D47-like           428   1e-139   
ref|XP_006423133.1|  hypothetical protein CICLE_v10028201mg             427   1e-139   
ref|XP_002282118.1|  PREDICTED: cytochrome P450 CYP82D47-like           427   1e-139   Vitis vinifera
ref|XP_011030958.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    427   1e-139   
gb|KHG29587.1|  Cytochrome P450 protein                                 427   1e-139   
ref|XP_009801068.1|  PREDICTED: cytochrome P450 82C4-like               425   2e-139   
ref|XP_004147802.1|  PREDICTED: cytochrome P450 82A4-like               427   2e-139   
gb|KCW58033.1|  hypothetical protein EUGRSUZ_H00761                     427   2e-139   
ref|NP_194925.1|  cytochrome P450, family 82, subfamily C, polype...    427   2e-139   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28662.1|  unknown                                                 426   2e-139   Arabidopsis thaliana [mouse-ear cress]
gb|KCW85809.1|  hypothetical protein EUGRSUZ_B02554                     425   3e-139   
ref|XP_006375025.1|  hypothetical protein POPTR_0014s03700g             427   3e-139   
ref|XP_008796321.1|  PREDICTED: cytochrome P450 CYP82D47-like           426   4e-139   
gb|AGF30364.1|  CYP450 monooxygenase CYP82D33                           426   4e-139   
emb|CBI37514.3|  unnamed protein product                                443   4e-139   
ref|XP_010046449.1|  PREDICTED: cytochrome P450 CYP82D47-like           426   6e-139   
gb|KHN36186.1|  Cytochrome P450 82A3                                    426   6e-139   
ref|XP_008343753.1|  PREDICTED: cytochrome P450 CYP82D47-like           425   9e-139   
ref|XP_006346673.1|  PREDICTED: cytochrome P450 82C4-like               424   1e-138   
gb|KDP26344.1|  hypothetical protein JCGZ_17502                         425   1e-138   
ref|XP_006471495.1|  PREDICTED: cytochrome P450 82C4-like               424   1e-138   
ref|XP_006573615.1|  PREDICTED: cytochrome P450 82A3-like isoform X2    425   1e-138   
ref|XP_004291926.1|  PREDICTED: cytochrome P450 82A3-like               425   1e-138   
ref|XP_002510297.1|  cytochrome P450, putative                          424   2e-138   Ricinus communis
ref|XP_011030954.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    424   2e-138   
emb|CBI32505.3|  unnamed protein product                                439   2e-138   
ref|XP_010028533.1|  PREDICTED: cytochrome P450 CYP82D47-like           424   2e-138   
gb|AFK79026.1|  cytochrome P450 CYP82T1                                 424   2e-138   
ref|XP_009364774.1|  PREDICTED: cytochrome P450 82A3-like               424   3e-138   
ref|XP_011030947.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    423   5e-138   
ref|XP_010106082.1|  Cytochrome P450 82A3                               423   5e-138   
ref|XP_004147804.1|  PREDICTED: cytochrome P450 82C4-like               423   5e-138   
ref|XP_010061806.1|  PREDICTED: cytochrome P450 CYP82D47-like           423   6e-138   
ref|XP_009336429.1|  PREDICTED: cytochrome P450 82A3-like               423   7e-138   
gb|KCW68808.1|  hypothetical protein EUGRSUZ_F02407                     424   7e-138   
ref|XP_009336967.1|  PREDICTED: cytochrome P450 82A4-like               422   9e-138   
ref|XP_007017404.1|  Cytochrome P450 82A3, putative                     422   1e-137   
ref|XP_010106080.1|  Cytochrome P450 82A3                               426   1e-137   
gb|KGN59915.1|  Cytochrome P450                                         422   1e-137   
ref|XP_010092357.1|  Cytochrome P450 82A3                               422   1e-137   
ref|XP_006471496.1|  PREDICTED: cytochrome P450 82C4-like               422   2e-137   
gb|KDP45301.1|  hypothetical protein JCGZ_15166                         422   2e-137   
ref|XP_009795251.1|  PREDICTED: cytochrome P450 CYP82D47-like           421   2e-137   
ref|XP_010064744.1|  PREDICTED: cytochrome P450 CYP82D47-like           422   2e-137   
gb|KHG24650.1|  Cytochrome P450 protein                                 421   3e-137   
ref|XP_008235427.1|  PREDICTED: cytochrome P450 82G1-like               422   3e-137   
ref|XP_010934114.1|  PREDICTED: cytochrome P450 82C4-like               421   3e-137   
ref|XP_007017414.1|  Cytochrome P450 82A3, putative                     428   3e-137   
ref|XP_004238199.1|  PREDICTED: cytochrome P450 CYP82D47-like           421   4e-137   
ref|XP_007222623.1|  hypothetical protein PRUPE_ppa004179mg             421   5e-137   
ref|XP_007156852.1|  hypothetical protein PHAVU_002G022900g             421   6e-137   
ref|XP_008378401.1|  PREDICTED: cytochrome P450 CYP82D47-like           420   7e-137   
ref|XP_011030924.1|  PREDICTED: cytochrome P450 CYP82D47-like           420   8e-137   
emb|CAN65652.1|  hypothetical protein VITISV_016780                     418   8e-137   
ref|XP_010106088.1|  Cytochrome P450 82A4                               420   8e-137   
ref|XP_004488195.1|  PREDICTED: cytochrome P450 82A3-like               419   9e-137   
gb|KHN13272.1|  Cytochrome P450 82A4                                    420   1e-136   
ref|XP_010028535.1|  PREDICTED: cytochrome P450 CYP82D47-like           419   1e-136   
ref|XP_009364766.1|  PREDICTED: cytochrome P450 82A3-like               420   1e-136   
ref|XP_009341185.1|  PREDICTED: cytochrome P450 CYP82D47-like           420   1e-136   
ref|XP_003543523.2|  PREDICTED: cytochrome P450 82A4-like               420   2e-136   
gb|KDP38432.1|  hypothetical protein JCGZ_04357                         419   2e-136   
gb|KDP38424.1|  hypothetical protein JCGZ_04349                         419   2e-136   
ref|XP_003523886.1|  PREDICTED: cytochrome P450 82A1-like               419   2e-136   
ref|XP_009372222.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    419   2e-136   
ref|XP_009364178.1|  PREDICTED: cytochrome P450 CYP82D47-like           419   2e-136   
ref|XP_007201144.1|  hypothetical protein PRUPE_ppa016050mg             418   2e-136   
gb|KDP38434.1|  hypothetical protein JCGZ_04359                         420   3e-136   
gb|ABK55756.1|  P450 monooxygenase-like protein                         418   4e-136   
emb|CDP15067.1|  unnamed protein product                                417   4e-136   
ref|XP_010106083.1|  Cytochrome P450 82A3                               418   5e-136   
ref|XP_009336448.1|  PREDICTED: cytochrome P450 82A3-like               418   6e-136   
ref|XP_003516592.1|  PREDICTED: cytochrome P450 82A3-like isoform X1    418   6e-136   
ref|XP_008355533.1|  PREDICTED: cytochrome P450 CYP82D47-like           418   7e-136   
ref|XP_008464764.1|  PREDICTED: cytochrome P450 CYP82D47-like           417   7e-136   
ref|XP_008464769.1|  PREDICTED: cytochrome P450 CYP82D47-like           417   7e-136   
ref|XP_007201702.1|  hypothetical protein PRUPE_ppa004095mg             417   8e-136   
gb|AAC39454.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   419   8e-136   
gb|KHN36187.1|  Cytochrome P450 82A3                                    417   9e-136   
gb|KDP38426.1|  hypothetical protein JCGZ_04351                         417   1e-135   
ref|XP_004489343.1|  PREDICTED: cytochrome P450 82A3-like               417   1e-135   
ref|XP_006486180.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    417   1e-135   
ref|XP_008466638.1|  PREDICTED: cytochrome P450 CYP82D47-like           417   1e-135   
ref|XP_003528211.2|  PREDICTED: cytochrome P450 82A1-like               417   1e-135   
ref|XP_008372516.1|  PREDICTED: cytochrome P450 82G1-like               417   1e-135   
ref|XP_008343493.1|  PREDICTED: cytochrome P450 82A3-like               417   2e-135   
ref|XP_008464768.1|  PREDICTED: cytochrome P450 CYP82D47-like           416   2e-135   
ref|XP_007047112.1|  Cytochrome P450                                    422   2e-135   
ref|XP_008355522.1|  PREDICTED: cytochrome P450 CYP82D47-like           417   2e-135   
ref|XP_007224171.1|  hypothetical protein PRUPE_ppa016912mg             416   2e-135   
gb|KCW68806.1|  hypothetical protein EUGRSUZ_F02405                     416   2e-135   
ref|XP_009336438.1|  PREDICTED: cytochrome P450 82A3-like               416   3e-135   
emb|CBI19611.3|  unnamed protein product                                428   4e-135   
ref|XP_008391540.1|  PREDICTED: cytochrome P450 82A4-like               416   4e-135   
ref|XP_009758036.1|  PREDICTED: cytochrome P450 82C4-like               412   7e-135   
ref|XP_008235428.1|  PREDICTED: cytochrome P450 82G1-like               415   7e-135   
gb|KCW68803.1|  hypothetical protein EUGRSUZ_F02402                     415   7e-135   
ref|XP_008220885.1|  PREDICTED: cytochrome P450 82A3-like               429   8e-135   
ref|XP_006473406.1|  PREDICTED: cytochrome P450 82A3-like               415   8e-135   
ref|XP_010064743.1|  PREDICTED: cytochrome P450 CYP82D47-like           415   9e-135   
gb|AJD25201.1|  cytochrome P450 CYP82D71                                414   1e-134   
ref|XP_004291927.1|  PREDICTED: cytochrome P450 82A3-like               414   1e-134   
ref|XP_008345296.1|  PREDICTED: cytochrome P450 CYP82D47-like           415   1e-134   
ref|XP_011005663.1|  PREDICTED: cytochrome P450 CYP82D47-like           414   1e-134   
ref|XP_003554125.1|  PREDICTED: cytochrome P450 82A4-like               414   2e-134   
ref|XP_008236910.1|  PREDICTED: cytochrome P450 CYP82D47-like           414   2e-134   
ref|XP_007207908.1|  hypothetical protein PRUPE_ppa019731mg             413   2e-134   
emb|CDP07595.1|  unnamed protein product                                425   2e-134   
ref|XP_006573616.1|  PREDICTED: cytochrome P450 82A3-like isoform X3    414   3e-134   
gb|AGN54072.1|  cytochrome P450 monooxygenase                           413   4e-134   
ref|XP_004154898.1|  PREDICTED: cytochrome P450 82A3-like               412   4e-134   
ref|XP_003537400.1|  PREDICTED: cytochrome P450 82A3-like               413   4e-134   
ref|XP_008388170.1|  PREDICTED: cytochrome P450 82A3-like               413   5e-134   
ref|XP_006375029.1|  putative cytochrome P450 family protein            413   5e-134   
gb|KDO84377.1|  hypothetical protein CISIN_1g009899mg                   412   7e-134   
ref|XP_007223263.1|  hypothetical protein PRUPE_ppa004464mg             412   7e-134   
ref|XP_004147820.1|  PREDICTED: cytochrome P450 82C4-like               412   8e-134   
ref|XP_008382597.1|  PREDICTED: cytochrome P450 82G1-like               412   1e-133   
ref|XP_008464766.1|  PREDICTED: cytochrome P450 CYP82D47-like           411   2e-133   
ref|XP_006366470.1|  PREDICTED: cytochrome P450 82A3-like               410   2e-133   
gb|KEH18124.1|  cytochrome P450 family 82 protein                       409   2e-133   
ref|XP_003554859.1|  PREDICTED: cytochrome P450 82A4-like               411   3e-133   
ref|XP_006379218.1|  hypothetical protein POPTR_0009s11180g             409   3e-133   
ref|XP_006434891.1|  hypothetical protein CICLE_v10000852mg             410   3e-133   
gb|KHN04536.1|  Cytochrome P450 82A1                                    409   3e-133   
ref|XP_004505090.1|  PREDICTED: cytochrome P450 82A3-like               410   4e-133   
ref|XP_007017411.1|  Cytochrome P450, putative                          410   5e-133   
ref|XP_009348372.1|  PREDICTED: cytochrome P450 82G1-like               410   6e-133   
ref|XP_010696237.1|  PREDICTED: cytochrome P450 82G1                    410   7e-133   
ref|XP_008388075.1|  PREDICTED: cytochrome P450 82A3-like               410   8e-133   
ref|XP_003604789.1|  Cytochrome P450                                    410   8e-133   
gb|KDP38427.1|  hypothetical protein JCGZ_04352                         409   8e-133   
ref|XP_007224041.1|  hypothetical protein PRUPE_ppa015200mg             409   1e-132   
ref|XP_006432669.1|  hypothetical protein CICLE_v10000844mg             409   1e-132   
ref|XP_006471473.1|  PREDICTED: cytochrome P450 82A3-like               409   1e-132   
ref|XP_007151148.1|  hypothetical protein PHAVU_004G021900g             410   1e-132   
gb|KHN34164.1|  Cytochrome P450 82A4                                    409   1e-132   
gb|KHN16363.1|  Cytochrome P450 82A4                                    409   2e-132   
ref|XP_010040235.1|  PREDICTED: cytochrome P450 CYP82D47-like           409   2e-132   
ref|XP_009336944.1|  PREDICTED: cytochrome P450 82A3-like               409   2e-132   
ref|XP_003554118.2|  PREDICTED: cytochrome P450 82A4-like               409   2e-132   
gb|KDP29948.1|  hypothetical protein JCGZ_18517                         408   2e-132   
ref|XP_004238200.1|  PREDICTED: cytochrome P450 CYP82D47-like           408   3e-132   
gb|KHG01223.1|  Cytochrome P450 protein                                 408   3e-132   
gb|KHN42045.1|  Cytochrome P450 82C4                                    406   3e-132   
gb|KHN42044.1|  Cytochrome P450 82A3                                    408   4e-132   
ref|XP_010249368.1|  PREDICTED: cytochrome P450 CYP82D47-like           409   4e-132   
ref|XP_003527704.1|  PREDICTED: cytochrome P450 82A1-like               408   6e-132   
ref|XP_007217488.1|  hypothetical protein PRUPE_ppa027160mg             407   8e-132   
ref|XP_002510311.1|  cytochrome P450, putative                          407   8e-132   
gb|KEH37856.1|  cytochrome P450 family protein                          407   9e-132   
ref|XP_004308852.1|  PREDICTED: cytochrome P450 82A3-like               405   9e-132   
ref|XP_007151143.1|  hypothetical protein PHAVU_004G021400g             407   1e-131   
ref|XP_010060880.1|  PREDICTED: cytochrome P450 CYP82D47-like           407   1e-131   
ref|XP_003517019.1|  PREDICTED: cytochrome P450 82A4-like               407   1e-131   
gb|AAS90126.1|  cytochrome P450                                         406   2e-131   
ref|XP_008228483.1|  PREDICTED: cytochrome P450 CYP82D47-like           405   3e-131   
emb|CAN64501.1|  hypothetical protein VITISV_020341                     403   3e-131   
ref|XP_006366469.1|  PREDICTED: cytochrome P450 82A3-like               403   4e-131   
ref|XP_004291928.1|  PREDICTED: cytochrome P450 82A4-like               405   4e-131   
ref|XP_007151147.1|  hypothetical protein PHAVU_004G021800g             405   4e-131   
ref|XP_007136643.1|  hypothetical protein PHAVU_009G061500g             405   4e-131   
ref|XP_002510308.1|  cytochrome P450, putative                          405   4e-131   
ref|XP_003619137.1|  Cytochrome P450                                    405   5e-131   
gb|KEH30993.1|  cytochrome P450 family protein                          405   5e-131   
ref|XP_007151146.1|  hypothetical protein PHAVU_004G021700g             405   7e-131   
ref|XP_007151145.1|  hypothetical protein PHAVU_004G021600g             405   8e-131   
ref|XP_006471191.1|  PREDICTED: cytochrome P450 82C4-like               404   1e-130   
ref|XP_007222593.1|  hypothetical protein PRUPE_ppa004169mg             403   2e-130   
ref|XP_010040234.1|  PREDICTED: cytochrome P450 CYP82D47-like           404   3e-130   
ref|XP_010527267.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    403   3e-130   
ref|XP_007133366.1|  hypothetical protein PHAVU_011G173200g             402   4e-130   
ref|XP_008351399.1|  PREDICTED: cytochrome P450 82A4-like               402   5e-130   
ref|XP_004147822.1|  PREDICTED: uncharacterized protein LOC101212976    418   5e-130   
ref|XP_006366437.1|  PREDICTED: cytochrome P450 82A3-like               402   5e-130   
ref|XP_003618363.1|  Cytochrome P450                                    402   6e-130   
ref|XP_008378426.1|  PREDICTED: cytochrome P450 CYP82D47-like           402   1e-129   
ref|XP_002522370.1|  cytochrome P450, putative                          401   1e-129   
ref|XP_011073191.1|  PREDICTED: cytochrome P450 82C4-like               401   2e-129   
ref|XP_011099742.1|  PREDICTED: cytochrome P450 CYP82D47-like           401   2e-129   
ref|XP_010036785.1|  PREDICTED: cytochrome P450 82G1                    401   2e-129   
gb|KCW52083.1|  hypothetical protein EUGRSUZ_J01518                     401   2e-129   
gb|KCW45363.1|  hypothetical protein EUGRSUZ_L00956                     400   3e-129   
ref|XP_003618345.1|  Cytochrome P450                                    400   3e-129   
ref|XP_009372223.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    401   4e-129   
ref|XP_009372224.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    400   4e-129   
gb|AES74584.2|  cytochrome P450 family protein                          400   4e-129   
ref|XP_010527268.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    400   6e-129   
ref|XP_006364811.1|  PREDICTED: cytochrome P450 82A3-like               399   8e-129   
ref|XP_009374201.1|  PREDICTED: cytochrome P450 CYP82D47-like           399   8e-129   
gb|KHN19614.1|  Cytochrome P450 82A4                                    399   8e-129   
ref|XP_009624056.1|  PREDICTED: cytochrome P450 82A3-like               399   9e-129   
ref|XP_002510312.1|  cytochrome P450, putative                          399   1e-128   
ref|XP_009372225.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    399   1e-128   
gb|KCW67753.1|  hypothetical protein EUGRSUZ_F01486                     398   1e-128   
ref|XP_007151144.1|  hypothetical protein PHAVU_004G021500g             398   2e-128   
gb|KHN44000.1|  Cytochrome P450 82A4                                    398   2e-128   
ref|XP_010060877.1|  PREDICTED: cytochrome P450 CYP82D47-like           398   2e-128   
ref|XP_003618361.1|  Cytochrome P450                                    398   4e-128   
ref|XP_007216265.1|  hypothetical protein PRUPE_ppa017300mg             397   4e-128   
sp|O49859.1|C82A4_SOYBN  RecName: Full=Cytochrome P450 82A4; AltN...    397   4e-128   
ref|XP_010527271.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    396   5e-128   
ref|XP_010527272.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    396   5e-128   
ref|XP_011099743.1|  PREDICTED: cytochrome P450 CYP82D47-like           397   7e-128   
ref|XP_007151141.1|  hypothetical protein PHAVU_004G021200g             397   7e-128   
ref|XP_007225086.1|  hypothetical protein PRUPE_ppa017464mg             397   8e-128   
ref|XP_010527266.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    397   8e-128   
ref|XP_003618354.1|  Cytochrome P450                                    397   8e-128   
ref|XP_002510306.1|  cytochrome P450, putative                          396   1e-127   
ref|XP_003554857.2|  PREDICTED: cytochrome P450 82A4-like               407   2e-127   
ref|XP_009804510.1|  PREDICTED: cytochrome P450 CYP82D47-like           396   2e-127   
ref|XP_006856215.1|  hypothetical protein AMTR_s00059p00202900          400   2e-127   
ref|XP_010527269.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    396   2e-127   
ref|XP_010527270.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    396   2e-127   
ref|XP_003618365.1|  Cytochrome P450                                    395   2e-127   
gb|AES74583.2|  cytochrome P450 family 82 protein                       395   4e-127   
ref|XP_008219217.1|  PREDICTED: cytochrome P450 82A3-like               395   4e-127   
ref|XP_004489342.1|  PREDICTED: cytochrome P450 82A1-like               395   5e-127   
ref|XP_006581227.1|  PREDICTED: cytochrome P450 82A1-like               395   5e-127   
gb|AII31758.1|  cytochrome P450 monooxygenase                           394   6e-127   
ref|XP_006432705.1|  hypothetical protein CICLE_v10001118mg             392   7e-127   
ref|XP_010686308.1|  PREDICTED: cytochrome P450 CYP82D47-like           394   8e-127   
ref|XP_009364154.1|  PREDICTED: cytochrome P450 CYP82D47-like           394   9e-127   
gb|KEH30997.1|  cytochrome P450 family protein                          394   1e-126   
sp|Q43068.2|C82A1_PEA  RecName: Full=Cytochrome P450 82A1; AltNam...    394   1e-126   
gb|KHG29695.1|  Cytochrome P450                                         394   1e-126   
gb|AAG09208.1|AF175278_1  wound-inducible P450 hydroxylase              394   1e-126   
emb|CDP16080.1|  unnamed protein product                                394   2e-126   
ref|NP_001240972.1|  cytochrome P450 82A3                               393   2e-126   
ref|XP_010527265.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    393   2e-126   
gb|KCW60845.1|  hypothetical protein EUGRSUZ_H03582                     392   3e-126   
gb|AII31759.1|  cytochrome P450 monooxygenase                           392   3e-126   
ref|XP_010089020.1|  Cytochrome P450 82A3                               392   4e-126   
ref|XP_009606708.1|  PREDICTED: cytochrome P450 CYP82D47-like           392   4e-126   
emb|CDP07593.1|  unnamed protein product                                390   4e-126   
gb|KHG29694.1|  Cytochrome P450                                         392   4e-126   
gb|KHG01290.1|  Cytochrome P450                                         392   5e-126   
emb|CAN82329.1|  hypothetical protein VITISV_016031                     389   6e-126   
ref|XP_003619141.1|  Cytochrome P450                                    392   6e-126   
ref|XP_010036784.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    392   6e-126   
ref|XP_010696627.1|  PREDICTED: cytochrome P450 CYP82D47-like           391   8e-126   
gb|KHN22285.1|  Cytochrome P450 82A4                                    392   8e-126   
ref|XP_007041355.1|  Cytochrome P450 82C4, putative isoform 1           394   8e-126   
ref|XP_010036782.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    392   8e-126   
ref|XP_010036783.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    392   9e-126   
ref|XP_010248151.1|  PREDICTED: cytochrome P450 82C4-like               388   2e-125   
ref|XP_010064547.1|  PREDICTED: cytochrome P450 CYP82D47-like           390   3e-125   



>ref|XP_006349946.1| PREDICTED: cytochrome P450 82C2-like [Solanum tuberosum]
Length=531

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/521 (52%), Positives = 364/521 (70%), Gaps = 14/521 (3%)
 Frame = -1

Query  1649  ILGIAALVLLWFSWR--KQSKRLPPEAGGAWPIIGHLHHFRTS--VPLVKTLSEWADKYG  1482
             +L IA +    F W+  K    LPPE  G WP+IGHL  F  +  +PL + L+  ADKYG
Sbjct  14    LLLIAFIFSSIFIWKLLKPQNPLPPEISGGWPVIGHLLQFSGADDIPLSRKLATLADKYG  73

Query  1481  PVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW  1302
             PVFT RLG+  ILVVSS++AV+DC  TNDK  AARP + AG+Y+GY+ A+   +    YW
Sbjct  74    PVFTFRLGLPCILVVSSYDAVKDCLCTNDKAFAARPASLAGEYIGYNNAMLFLANYGPYW  133

Query  1301  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP-KVNMSRWFGH  1125
             R++RK+V++E+LSS RLEKLK V VSE+QT+I ELY+ IS+   N   P KVN++ W   
Sbjct  134   RKIRKIVLQEVLSSSRLEKLKFVRVSEIQTSINELYSLISVAGENVDFPVKVNVTNWIEK  193

Query  1124  LTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD  945
             LTL+LI++++AG+ Y     G   EEA+R KK     MY+  EFV  DA FP+  F+W+D
Sbjct  194   LTLSLIVKMIAGKSYGRVEKGGNEEEAERFKKALKDFMYISMEFVLWDA-FPIALFKWID  252

Query  944   YEGHVKTMKRAAKDVDAILQDWVDA--RRKERRS---NEDQKFIDVMLSMIDDQ-FTQGY  783
             ++GHVK MKR  KD+D +LQ+W+D   ++KER       +Q FIDVMLSM+ ++ F  G+
Sbjct  253   FQGHVKFMKRTFKDIDCVLQNWLDEHLKKKERVDVVDGNEQDFIDVMLSMMSNEDFADGH  312

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
             S  R+T IKA  LSM+ DAS+T A HL W++A LL H + +K+VQ+E+DT +G+ RW E+
Sbjct  313   S--RETTIKATALSMVLDASDTTAIHLNWVMATLLNHRDVMKKVQEELDTKVGRNRWVEE  370

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             SD+KNL Y Q VVKETLR+YP  P L PHE++EDCIV GYHIPKGT+L+VN  +L RDPK
Sbjct  371   SDIKNLVYFQAVVKETLRLYPPAPLLVPHESIEDCIVQGYHIPKGTRLWVNTMKLQRDPK  430

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             IW +P  F PERF+T+  G   + +QY+F+PFG  RRSCPG  YA Q+T +A+A L QGF
Sbjct  431   IWSNPNTFDPERFLTSQAGCDVRGQQYEFIPFGSRRRSCPGITYAIQVTHLAIAHLLQGF  490

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL  120
             +FST  NEPLDM E +G+ + K+ P+EV++TPR    L++ 
Sbjct  491   DFSTPSNEPLDMKEGLGMTMRKVNPIEVMITPRFPSVLYKF  531



>ref|XP_006339196.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=524

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/520 (48%), Positives = 368/520 (71%), Gaps = 16/520 (3%)
 Frame = -1

Query  1658  LSSILGIAALVLLWF-SWRKQSKRLPPEAGGAWPIIGHLHHFR--TSVPLVKTLSEWADK  1488
             L+++L  +  ++LW  +W+  S +LPPE  G+WPIIGHL  F    +VPL +T  + +D+
Sbjct  14    LATLLVFSLSIILWTRNWK--STKLPPEIPGSWPIIGHLRGFGDGKNVPLARTFGKLSDQ  71

Query  1487  YGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNS  1308
             YGP+FTI+LG+ R  V+++WEA +DCF  NDK LAARP + A ++ GY+YA F+F+    
Sbjct  72    YGPIFTIKLGMYRYCVINNWEAAKDCFTINDKELAARPISLAAEHYGYNYARFSFANYGP  131

Query  1307  YWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFG  1128
             Y+ +VRKLV++ +LSS RLEK+KHV  SE++ +IKELY      +N+ +   +N+S+WF 
Sbjct  132   YYCQVRKLVLQNVLSSTRLEKVKHVRTSEVEISIKELYNLCGKGDNSNT---INISKWFE  188

Query  1127  HLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL  948
              LTLN+I++++AG+RY        +EEAQ  +K F+++MYL GEF+  DAI P   F+++
Sbjct  189   KLTLNIIVKMIAGKRYISLEK---DEEAQCFRKAFAKIMYLAGEFILYDAI-PFKIFKYV  244

Query  947   DYEGHVKTMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYS  780
             D++GH+KTMK+  KD+D ILQ WV+   ++++    +N +Q  ID MLS+   +  + Y 
Sbjct  245   DFQGHIKTMKQIYKDLDDILQSWVNEHMEKKKIEGDNNNEQDCIDSMLSVTKLEDFKAYG  304

Query  779   YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS  600
             Y+RDTVIKA VLSM+ D S+T A HLTW++++LL +P  +  VQ EID  +GK+RW E+S
Sbjct  305   YTRDTVIKATVLSMILDGSDTTAVHLTWLMSLLLNNPHVMSHVQKEIDNKVGKDRWVEES  364

Query  599   DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI  420
             D+K+L YLQ +VKE LR+YP  P L PHEAVEDC V GY+IPKGT+L+ N W++ RDP++
Sbjct  365   DIKDLVYLQAIVKEALRLYPPAPLLVPHEAVEDCTVAGYNIPKGTRLFPNAWKIQRDPRV  424

Query  419   WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN  240
             + +P+KF+PERF+       A+ + ++F+PFG GRRSCPG  +ATQ+  + + RL QGFN
Sbjct  425   YSEPDKFMPERFLNEHSNVDARGQHFEFIPFGSGRRSCPGINFATQVAHLTIGRLIQGFN  484

Query  239   FSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL  120
             F T  N P+DM E  GI +PK  P+EV++TPRL+  L+ L
Sbjct  485   FGTPSNLPVDMTEGQGITMPKAKPVEVVITPRLNSMLYEL  524



>ref|XP_009801176.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=517

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/519 (49%), Positives = 367/519 (71%), Gaps = 16/519 (3%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTS---VPLVKTLSEW  1497
               +++G+ A V L    WR+   S++L PE  GAWPIIGHL     +   +P  + L   
Sbjct  5     FQALIGLLAFVFLSIILWRRTLASRKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGAL  64

Query  1496  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST  1317
             ADKYGPVFT+R+G+   L+V++WEA +DC  T+DK LAARPT+ AG+ +GY YA FT++ 
Sbjct  65    ADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDLAARPTSMAGESIGYKYARFTYAN  124

Query  1316  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR  1137
                Y+ +VRKL ++++LSS +LEK+KH+ VSE++T+IKELY+   + NN     KVN+S+
Sbjct  125   FGPYYNQVRKLALQQVLSSTKLEKMKHIRVSEMETSIKELYSLALVKNN---IQKVNISK  181

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI-FPLWF  960
             WF  LTLN+I++ + G+RY   S+   +EEAQR +K F  +MY+ G+ V  DAI FPL  
Sbjct  182   WFEQLTLNIIVKTICGKRY---SNIEEDEEAQRFRKAFKGIMYVVGQIVLYDAIPFPL--  236

Query  959   FRWLDYEGHVKTMKRAAKDVDAILQDWVDARR-KERRSNEDQKFIDVMLSMIDDQFTQGY  783
             F++ D++GH+K MK+  KD+D ILQ W+D    K+  +NEDQ  +D ML +      + Y
Sbjct  237   FKYFDFQGHIKLMKKIYKDLDYILQGWLDDHMMKKDVNNEDQDAMDAMLKVTQLNEFKAY  296

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              +S+ TVIK+ VLS++ D ++T A HL W++++LL +P  +K+ Q+EID  +GKERW ED
Sbjct  297   GFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQAQEEIDMKVGKERWVED  356

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             +D+KNL YLQ +VKETLR+YP  P+L PHEAV+DC V GYHIPKGT+L++N W++HRDP+
Sbjct  357   TDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVAGYHIPKGTRLHINAWKVHRDPE  416

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             IW +PE+F+PERF+T+     A+ + ++F+PFG GRRSCPG  +AT +T +   RL QGF
Sbjct  417   IWSEPERFMPERFLTSKANVDARGQNFEFIPFGSGRRSCPGINFATLVTHLTFGRLLQGF  476

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +FST  N P+DM E VG+ LPK+  +EVL++PRL   L+
Sbjct  477   DFSTPSNTPIDMTEGVGVTLPKVNQVEVLISPRLPSKLY  515



>ref|XP_009761500.1| PREDICTED: cytochrome P450 82C2-like [Nicotiana sylvestris]
Length=555

 Score =   533 bits (1373),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 263/530 (50%), Positives = 362/530 (68%), Gaps = 30/530 (6%)
 Frame = -1

Query  1625  LLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTS--VPLVKTLSEWADKYGPVFTIRLGIS  1452
             L +F   K    LPPE  G WP+IGHL  F  +  +PL + L+  A+KYGPVFT RLG+ 
Sbjct  28    LKYFKLSKPLNPLPPEISGGWPVIGHLLQFSGADDIPLSRKLATLAEKYGPVFTFRLGLP  87

Query  1451  RILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEE  1272
             R+LVVSS++AVRDC   NDK  AARP + AG+Y+GY+ A+   S+   YWR++RK+V++E
Sbjct  88    RVLVVSSYDAVRDCLNANDKAFAARPASLAGEYIGYNNAMLFLSSYGPYWRKIRKIVLQE  147

Query  1271  ILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP--------------------K  1152
             +LSS RLEKLK+V VSELQT+IKEL++   +  ++ S                      K
Sbjct  148   VLSSSRLEKLKNVRVSELQTSIKELFSLFPVTGDHSSVTGDHSSITGDNLPVTGDYVPVK  207

Query  1151  VNMSRWFGHLTLNLIMQIVAGRRY-EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI  975
             +N++ W   LTL+LI++++AG+ Y          EEA+R KK     MY+  EFV  DA 
Sbjct  208   LNLTNWIEKLTLSLIVKMIAGKSYGRLNEKAEDEEEAERFKKALKDFMYISMEFVLWDA-  266

Query  974   FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR-----SNEDQKFIDVMLSM  810
             FP+  F+W+D++GHVK MKR  KD+D +LQ+W+D   K+R      +  +Q FIDVMLSM
Sbjct  267   FPIPLFKWIDFQGHVKFMKRTFKDIDCVLQNWLDEHVKKREGVDVVAGNEQDFIDVMLSM  326

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
             + ++     SY+R+T IKA  LSM+ DAS+T A HL W++A+LL H + +K+VQ+E+DT 
Sbjct  327   MSNE-DFADSYTRETTIKATALSMVLDASDTTAIHLNWVMAILLNHRDVMKKVQEELDTK  385

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             I + RW E+SD+KNL Y Q V+KETLR+YP  P L PHE+VEDCIV GYHIPKGT+L+VN
Sbjct  386   ISRNRWVEESDIKNLVYFQAVIKETLRLYPPAPLLVPHESVEDCIVHGYHIPKGTRLWVN  445

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
               +L RDP+IW +P+ F PERF+T+  G   + +QY+F+PFG GRRSCPG  YATQ+T +
Sbjct  446   TMKLQRDPEIWSNPDTFDPERFLTSQAGFDVRGQQYEFIPFGSGRRSCPGITYATQVTHL  505

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL  120
             A+A L QGF+FST+ NEPLDM E +G+ + K+ P+EVL+ PRL   L++ 
Sbjct  506   AIAHLLQGFDFSTLLNEPLDMKEGLGMTMRKVNPIEVLIMPRLPSVLYKF  555



>ref|XP_009606611.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=548

 Score =   531 bits (1369),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 264/523 (50%), Positives = 363/523 (69%), Gaps = 23/523 (4%)
 Frame = -1

Query  1625  LLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTS--VPLVKTLSEWADKYGPVFTIRLGIS  1452
             L +F+  K    LPPE  G WP+IGHL  F  +  +PL + L+  A+KYGPVFT RLG+ 
Sbjct  28    LKYFNRSKPLNPLPPEISGGWPVIGHLLQFFGADDIPLSRKLATLAEKYGPVFTFRLGLP  87

Query  1451  RILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEE  1272
             RILVVSS+EAVRDC  TNDK  AARP + AG+Y+GY+ A+   ++   YWR++RK+V++E
Sbjct  88    RILVVSSYEAVRDCLNTNDKAFAARPASLAGEYIGYNNAMLFLASYGPYWRKIRKIVLQE  147

Query  1271  ILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP-------------KVNMSRWF  1131
             +LSS RLEKLK V VSE+QT+IKEL++   +  ++ S               K+N++ W 
Sbjct  148   VLSSSRLEKLKIVRVSEVQTSIKELFSLFPVTGDHSSITGDNFPVTGDYVPVKLNLTNWI  207

Query  1130  GHLTLNLIMQIVAGRRY-EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR  954
               LTL+LI++++AG+ Y      G   EEA+R KK     MY+  EFV  DA FP+  F+
Sbjct  208   EKLTLSLIVKMIAGKSYGRLNEKGEDEEEAERFKKALKDFMYISMEFVLWDA-FPIPLFK  266

Query  953   WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR-----SNEDQKFIDVMLSMIDDQFTQ  789
             W+D++GHVK MKR  KD+D +LQ+W+D   K+R      +  +Q FIDVMLSM+ ++   
Sbjct  267   WIDFQGHVKFMKRTFKDIDCVLQNWLDEHMKKREEVDVVAGNEQDFIDVMLSMMSNE-DF  325

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
               SY+R+T IKA  LSM+ DAS+T A HL W++A LL H + +K+VQ+E+DT +G+ RW 
Sbjct  326   ADSYTRETTIKATALSMVLDASDTTAIHLNWVMATLLNHRDVMKKVQEELDTKVGRNRWV  385

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
             E+SD+KNL Y Q V+KETLR+YP  P L PHE+VEDCIV GYHIPKGT+L+VN  +L RD
Sbjct  386   EESDIKNLVYFQAVIKETLRLYPPAPLLVPHESVEDCIVHGYHIPKGTRLWVNTMKLQRD  445

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ  249
             P+IW DP+ F PERF+T   G   + +QY+F+PFG GRRSCPG  YA+Q+T +A+A L Q
Sbjct  446   PEIWSDPDTFDPERFLTCQAGFDVRGQQYEFIPFGSGRRSCPGITYASQVTHLAIAHLLQ  505

Query  248   GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL  120
             GF+F+T  NEPL+M E +G+ + K+ P+EVL+TPRL   L++ 
Sbjct  506   GFDFTTPFNEPLEMKEGLGMTMRKVNPIEVLITPRLPSVLYKF  548



>gb|ABC69375.1| CYP82M1v4 [Nicotiana tabacum]
Length=521

 Score =   528 bits (1360),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 254/519 (49%), Positives = 362/519 (70%), Gaps = 16/519 (3%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTS---VPLVKTLSEW  1497
               ++LG+ A V L    WR+   S++L PE  GAWPIIGHL     +   +P  + L   
Sbjct  9     FQALLGLLAFVFLSIILWRRTLTSRKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGAL  68

Query  1496  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST  1317
             ADKYGPVFT+R+G+   L+V++WEA +DC  T+DK LAARPT+ AG+ +GY YA FT++ 
Sbjct  69    ADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDLAARPTSMAGESIGYKYARFTYAN  128

Query  1316  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR  1137
                Y+ +VRKL ++ +LSS +LEK+KH+ VSEL+T+IKELY+     NN     KVN+S+
Sbjct  129   FGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETSIKELYSLTLGKNN---MQKVNISK  185

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI-FPLWF  960
             WF  LTLN+I++ + G+RY   S+   +EEAQR +K F  +M++ G+ V  DAI FPL  
Sbjct  186   WFEQLTLNIIVKTICGKRY---SNIEEDEEAQRFRKAFKGIMFVVGQIVLYDAIPFPL--  240

Query  959   FRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR-SNEDQKFIDVMLSMIDDQFTQGY  783
             F++ D++GH++ M +  KD+D+ILQ W+D     +  +N+DQ  ID ML +      + Y
Sbjct  241   FKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKDVNNKDQDAIDAMLKVTQLNEFKAY  300

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              +S+ TVIK+ VLS++ D ++T A HL W++++LL +P  +K+ Q+EID  +GKERW ED
Sbjct  301   GFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKVGKERWIED  360

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             +D+KNL YLQ +VKETLR+YP  P+L PHEAV+DC V GYHIPKGT+LY+N W++HRDP+
Sbjct  361   TDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDPE  420

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             IW +PEKF+P RF+T+     A+ + ++F+PFG GRRSCPG  +AT +T +   RL QGF
Sbjct  421   IWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRLLQGF  480

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +FS   N P+DM E VG+ LPK+  +EVL+TPRL   L+
Sbjct  481   DFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>ref|XP_009616319.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=521

 Score =   527 bits (1358),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 253/523 (48%), Positives = 363/523 (69%), Gaps = 16/523 (3%)
 Frame = -1

Query  1670  VPCCLSSILGIAALVLL-WFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTS---VPLVKT  1509
             +     ++LG+ A V L    WR+   S++L PE  GAWPIIGHL     +   +P  + 
Sbjct  5     ISSHFQALLGLLAFVFLSIILWRRTLTSRKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRI  64

Query  1508  LSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVF  1329
             L   ADKYGPVFT+R+G+   L+V++WEA +DC  T+DK  AARPT+ AG+ +GY YA F
Sbjct  65    LGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGYKYARF  124

Query  1328  TFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKV  1149
             T++    Y+ +VRKL ++ +LSS +LEK+KH+ VSEL+T+IKELY+     NN     KV
Sbjct  125   TYANFGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETSIKELYSLTLGKNN---MQKV  181

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI-F  972
             N+S+WF  LTLN+I++ + G+RY   S+   +EEAQR +K F  +M++ G+ V  DAI F
Sbjct  182   NISKWFEQLTLNIIVKTICGKRY---SNIEEDEEAQRFRKAFKGIMFVVGQIVLYDAIPF  238

Query  971   PLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR-SNEDQKFIDVMLSMIDDQF  795
             PL  F++ D++GH++ M +  KD+D+ILQ W+D     +  +N+DQ  ID ML +     
Sbjct  239   PL--FKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKDVNNKDQDAIDAMLKVTQLNE  296

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
              + Y +S+ TVIK+ VLS++ D ++T A HL W++++LL +P  +K+ Q+EID  +GKER
Sbjct  297   FKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKVGKER  356

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W ED+D+KNL YLQ +VKETLR+YP  P+L PHEAV+DC V GYHIPKGT+LY+N W++H
Sbjct  357   WIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVH  416

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP+IW +PEKF+P+RF+T+     A+ + ++F+PFG GRRSCPG  +AT +T +   RL
Sbjct  417   RDPEIWSEPEKFMPDRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRL  476

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGF+FS   N P+DM E VG+ LPK+  +EVL+TPRL   L+
Sbjct  477   LQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>gb|ABC69374.1| CYP82M1v3 [Nicotiana tabacum]
Length=521

 Score =   526 bits (1355),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 253/519 (49%), Positives = 361/519 (70%), Gaps = 16/519 (3%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTS---VPLVKTLSEW  1497
               ++LG+ A V L    WR+   S++L PE  GAWPIIGHL     +   +P  + L   
Sbjct  9     FQALLGLLAFVFLSIILWRRTLTSRKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGAL  68

Query  1496  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST  1317
             ADKYGPVFT+R+G+   L+V++WEA +DC  T+DK  AARPT+ AG+ +GY YA FT++ 
Sbjct  69    ADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGYKYARFTYAN  128

Query  1316  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR  1137
                Y+ +VRKL ++ +LSS +LEK+KH+ VSEL+T+IKELY+     NN     KVN+S+
Sbjct  129   FGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETSIKELYSLTLGKNN---MQKVNISK  185

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI-FPLWF  960
             WF  LTLN+I++ + G+RY   S+   +EEAQR +K F  +M++ G+ V  DAI FPL  
Sbjct  186   WFEQLTLNIIVKTICGKRY---SNIEEDEEAQRFRKAFKGIMFVVGQIVLYDAIPFPL--  240

Query  959   FRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR-SNEDQKFIDVMLSMIDDQFTQGY  783
             F++ D++GH++ M +  KD+D+ILQ W+D     +  +N+DQ  ID ML +      + Y
Sbjct  241   FKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKDVNNKDQDAIDAMLKVTQLNEFKAY  300

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              +S+ TVIK+ VLS++ D ++T A HL W++++LL +P  +K+ Q+EID  +GKERW ED
Sbjct  301   GFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKMGKERWIED  360

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             +D+KNL YLQ +VKETLR+YP  P+L PHEAV+DC V GYHIPKGT+LY+N W++HRDP+
Sbjct  361   TDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDPE  420

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             IW +PEKF+P RF+T+     A+ + ++F+PFG GRRSCPG  +AT +T +   RL QGF
Sbjct  421   IWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRLLQGF  480

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +FS   N P+DM E VG+ LPK+  +EVL+TPRL   L+
Sbjct  481   DFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>ref|XP_006352674.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=520

 Score =   524 bits (1350),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 256/525 (49%), Positives = 360/525 (69%), Gaps = 26/525 (5%)
 Frame = -1

Query  1649  ILGIAALVL---LWFSWR-----KQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             +L IA  V+   L+  W+     K S +    LPPE  GA+  IGHL+ F +  PL   L
Sbjct  5     LLAIAIFVIFVSLYMLWKTKIQAKNSSKVMINLPPEIPGAYFPIGHLYLFISKTPLALIL  64

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
             +  ADKYG +F+IRLGI R ++VS+WE V++CF TNDK+LA RP + AG YLGY+ A F 
Sbjct  65    ANLADKYGHIFSIRLGIHRAIIVSNWEIVKECFTTNDKVLAGRPASSAGIYLGYNNAAFG  124

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFI-SMDNNNPSAPKV  1149
             F+    YWR +RKLV+ E+LSS+RL++ KH+ V+E++TNIKELY+ I    + NPS  KV
Sbjct  125   FADYGPYWRNIRKLVLLEVLSSKRLDQFKHIRVTEVETNIKELYSSILKSGSTNPS--KV  182

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFP  969
             NMS+WF  LTLN+IM+++ G+RY+     T +E+ +   +   + MY   +FV  D I P
Sbjct  183   NMSKWFEQLTLNVIMKMITGKRYK-----TEDEKGRHFTRTTKEYMYESVQFVLSDVI-P  236

Query  968   LWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR---SNEDQKFIDVMLSMIDDQ  798
             L F +W D++G +K+MK+ ++++D I+  W+D    +R     ++DQ FIDVMLS ID+Q
Sbjct  237   LPFLKWFDFQGRIKSMKKLSQEMDKIVTSWIDEHLMKRELAIKDDDQDFIDVMLSKIDEQ  296

Query  797   FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE  618
             F   Y Y+R+T+IKA +L+++   S+T + HLTW+L++L+ +   + + Q+EID  IGKE
Sbjct  297   FM--YGYTRETIIKATILNIILAGSDTTSIHLTWLLSLLVNNKHVMDQAQEEIDMKIGKE  354

Query  617   RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL  438
             RW E+ D+KNL YLQ +VKETLR+YP GP   PH A+EDC V GY +PKGT+L VNVW+L
Sbjct  355   RWVEECDIKNLVYLQAIVKETLRLYPPGPLAIPHAAMEDCTVGGYKVPKGTRLMVNVWKL  414

Query  437   HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR  258
             HRDP+IW DPEKF+PERFM +        + ++F+PFG GRRSCPG  +A Q+T + +AR
Sbjct  415   HRDPQIWSDPEKFMPERFMKSHSEIDISGQNFEFIPFGSGRRSCPGITFAMQVTHLTLAR  474

Query  257   LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             L QGFNFST+ + P+D+     I LPK  PLEV V PRL+P L++
Sbjct  475   LLQGFNFSTLGDLPVDLTVGNSITLPKANPLEVFVMPRLAPMLYQ  519



>gb|ABC69373.1| CYP82M1v2 [Nicotiana tabacum]
Length=521

 Score =   524 bits (1349),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 252/519 (49%), Positives = 360/519 (69%), Gaps = 16/519 (3%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTS---VPLVKTLSEW  1497
               ++LG+ A V L    WR+   S++L PE  GAWPIIGHL     +   +P  + L   
Sbjct  9     FQALLGLLAFVFLSIILWRRTLTSRKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGAL  68

Query  1496  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST  1317
             ADKYGPVFT+R+G+   L+V++WEA +DC  T+DK  AARPT+ AG+ +GY YA FT++ 
Sbjct  69    ADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGYKYARFTYAN  128

Query  1316  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR  1137
                Y+ +VRKL ++ +LSS +LEK+KH+ VSEL+T+IKELY+     NN     KVN+S+
Sbjct  129   FGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETSIKELYSLTLGKNN---MQKVNISK  185

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI-FPLWF  960
             WF  LTLN+I++ + G+RY   S+   +EEAQR +K F  +M++ G+ V  DAI FPL  
Sbjct  186   WFEQLTLNIIVKTICGKRY---SNIEEDEEAQRFRKAFKGIMFVVGQIVLYDAIPFPL--  240

Query  959   FRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR-SNEDQKFIDVMLSMIDDQFTQGY  783
             F++ D++GH++ M +  KD+D+ILQ W+D     +  +N+DQ  ID ML +      + Y
Sbjct  241   FKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKDVNNKDQDAIDAMLKVTQLNEFKAY  300

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              +S+ TVIK+ VLS++ D ++T A HL W++++LL +P  +K+ Q+EID  +GKERW ED
Sbjct  301   GFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKVGKERWIED  360

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             +D+KNL YLQ +VKETLR++P  P+L PHEAV+DC V GYHIPKGT+LY+N W++HRDP+
Sbjct  361   TDIKNLVYLQAIVKETLRLFPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDPE  420

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             IW +PEKF+P RF+T+     A+ + ++F+PFG GRRSCPG  +AT +T +   RL QGF
Sbjct  421   IWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRLLQGF  480

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +FS   N P DM E VG+ LPK+  +EVL+TPRL   L+
Sbjct  481   DFSKPSNTPTDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>gb|ABC69372.1| CYP82M1v1 [Nicotiana tabacum]
Length=521

 Score =   523 bits (1348),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 252/519 (49%), Positives = 360/519 (69%), Gaps = 16/519 (3%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTS---VPLVKTLSEW  1497
               ++LG+ A V L    WR+   S++L PE  GAWPIIGHL     +   +P  + L   
Sbjct  9     FQALLGLLAFVFLSIILWRRTLTSRKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGAL  68

Query  1496  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST  1317
             ADKYGPVFT+R+G+   L+V++WEA +DC  T+DK  AARPT+ AG+ +GY YA FT++ 
Sbjct  69    ADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGYKYARFTYAN  128

Query  1316  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR  1137
                Y+ +VRKL ++ +LSS +LEK+KH+ VSEL+T+IKELY+     NN     KVN+S+
Sbjct  129   FGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETSIKELYSLTLGKNN---MQKVNISK  185

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI-FPLWF  960
             WF  LTLN+I++ + G+RY   S+   +EEAQR +K F  +M++ G+ V  DAI FPL  
Sbjct  186   WFEQLTLNIIVKTICGKRY---SNIEEDEEAQRFRKAFKGIMFVVGQIVLYDAIPFPL--  240

Query  959   FRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR-SNEDQKFIDVMLSMIDDQFTQGY  783
             F++ D++GH++ M +  KD+D+ILQ W+D     +  +N+DQ  ID ML +      + Y
Sbjct  241   FKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKDVNNKDQDAIDAMLKVTQLNEFKAY  300

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              +S+ TVIK+ VLS++ D ++T A HL W++++LL +P  +K+ Q+EID  +GKERW ED
Sbjct  301   GFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKVGKERWIED  360

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             +D+KNL YLQ +VKETLR+YP  P+L PHEAV+DC V GYHIPKGT+LY+N W++HRD +
Sbjct  361   TDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDSE  420

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             IW +PEKF+P RF+T+     A+ + ++F+PFG GRRSCPG  +AT +T +   RL QGF
Sbjct  421   IWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGLGFATLVTHLTFGRLLQGF  480

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +FS   N P+DM E VG+ LPK+  +EVL+TPRL   L+
Sbjct  481   DFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>gb|ABC69376.1| CYP82M1v5 [Nicotiana tabacum]
Length=521

 Score =   523 bits (1348),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 252/519 (49%), Positives = 360/519 (69%), Gaps = 16/519 (3%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTS---VPLVKTLSEW  1497
               ++LG+ A V L    WR+   S++L PE  GAWPIIGHL     +   +P  + L   
Sbjct  9     FQALLGLLAFVFLSIILWRRTLTSRKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGAL  68

Query  1496  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST  1317
             ADKYGPVFT+R+G+   L+V++WEA +DC  T+DK  AARPT+ AG+ +GY YA FT++ 
Sbjct  69    ADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGYKYARFTYAN  128

Query  1316  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR  1137
                Y+ +VRKL ++ + SS +LEK+KH+ VSEL+T+IKELY+     NN     KVN+S+
Sbjct  129   FGPYYNQVRKLALQHVPSSTKLEKMKHIRVSELETSIKELYSLTLGKNN---MQKVNISK  185

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI-FPLWF  960
             WF  LTLN+I++ + G+RY   S+   +EEAQR +K F  +M++ G+ V  DAI FPL  
Sbjct  186   WFEQLTLNIIVKTICGKRY---SNIEEDEEAQRFRKAFKGIMFVVGQIVLYDAIPFPL--  240

Query  959   FRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR-SNEDQKFIDVMLSMIDDQFTQGY  783
             F++ D++GH++ M +  KD+D+ILQ W+D     +  +N+DQ  ID ML +      + Y
Sbjct  241   FKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKDVNNKDQDAIDAMLKVTQLNEFKAY  300

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              +S+ TVIK+ VLS++ D ++T A HL W++++LL +P  +K+ Q+EID  +GKERW ED
Sbjct  301   GFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKVGKERWIED  360

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             +D+KNL YLQ +VKETLR+YP  P+L PHEAV+DC V GYHIPKGT+LY+N W++HRDP+
Sbjct  361   TDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDPE  420

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             IW +PEKF+P RF+T+     A+ + ++F+PFG GRRSCPG  +AT +T +   RL QGF
Sbjct  421   IWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRLLQGF  480

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +FS   N P+DM E VG+ LPK+  +EVL+TPRL   L+
Sbjct  481   DFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>ref|XP_004249377.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=524

 Score =   523 bits (1346),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 245/520 (47%), Positives = 369/520 (71%), Gaps = 16/520 (3%)
 Frame = -1

Query  1658  LSSILGIAALVLLWF-SWRKQSKRLPPEAGGAWPIIGHLHHFR--TSVPLVKTLSEWADK  1488
             L+++L  +  ++LW  +W+  S +LPP+  G+WPIIGHL  F    +VPL +T  + +++
Sbjct  14    LATLLVFSLSIILWTRNWK--STKLPPKIPGSWPIIGHLRGFGDGENVPLARTFGKLSNQ  71

Query  1487  YGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNS  1308
             YGP+FTI+LG+ R  V+++WEA +DCF  NDK LAARP + A ++ GY+YA F+F+    
Sbjct  72    YGPIFTIKLGMYRYCVINNWEAAKDCFTINDKELAARPISLAAEHYGYNYARFSFANYGP  131

Query  1307  YWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFG  1128
             Y+ +VRKLV++ +LSS RLEK+K+V +SE++ +IKELY       N+ +   +N+S+WF 
Sbjct  132   YYCQVRKLVLQNVLSSTRLEKVKNVRISEVEISIKELYNIWGKGENSNT---INISKWFE  188

Query  1127  HLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL  948
              LTLN+I++++AG+RY        ++EAQ  ++ F+++MYL GEF+  DAI P   F+++
Sbjct  189   KLTLNIIVKMIAGKRYISLEK---DQEAQCFRRAFAKIMYLAGEFILYDAI-PFKIFKYV  244

Query  947   DYEGHVKTMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYS  780
             D++GH+KTMK+  KD+D ILQ WV+   ++++    +N +Q  ID MLS+   +  + Y 
Sbjct  245   DFQGHIKTMKQIYKDLDDILQSWVNEHMEKKKIEGDNNNEQDCIDSMLSVTKLEDFKAYG  304

Query  779   YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS  600
             Y+RDTVIKAIVLSM+ D S+T A HLTW++++LL +P  +   Q EID+ +GK+RW E+S
Sbjct  305   YTRDTVIKAIVLSMILDGSDTTAVHLTWLMSLLLNNPRVMNNAQKEIDSKVGKDRWIEES  364

Query  599   DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI  420
             D+K+L YLQ +VKE LR+YP  P L PHEAVEDC V GY+IPKGT+L+ N W++ RDP++
Sbjct  365   DIKDLVYLQAIVKEALRLYPPAPLLVPHEAVEDCTVAGYNIPKGTRLFANAWKIQRDPRV  424

Query  419   WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN  240
             + +P+KF+PERF+       A+ + ++F+PFG GRRSCPG  +ATQ+  + + RL QGF+
Sbjct  425   YSEPDKFIPERFLNEHSNVDARGQHFEFIPFGSGRRSCPGINFATQVAHLTIGRLIQGFS  484

Query  239   FSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL  120
             F T  N P+DM E  GI +PK  P+EV++TPRL+  L+ L
Sbjct  485   FGTPSNLPVDMTEGQGITMPKAKPVEVVITPRLNSMLYEL  524



>dbj|BAM36727.1| nicotine N-demethylase [Nicotiana langsdorffii]
Length=516

 Score =   518 bits (1334),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 249/523 (48%), Positives = 360/523 (69%), Gaps = 24/523 (5%)
 Frame = -1

Query  1658  LSSILGIAALV--LLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVKTL  1506
             + +I G+  LV  L +F W K+S++    LPP+  G WP+IGHL +F       PL + L
Sbjct  5     IEAIAGVVTLVTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKL  64

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
              + ADKYGPV+T RLG+  +LVVSS+EA++DCF+TND + + RP    G+YLGY+ A+  
Sbjct  65    GDLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLF  124

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN  1146
              +    YWR+ RKL+++E+LS+ RLEK KHV ++++QT IK+LY+ I  D N+ +   +N
Sbjct  125   LANYGPYWRKNRKLIIQEVLSASRLEKFKHVRLAKIQTGIKDLYSRI--DGNSST---IN  179

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             ++ W   L   LI++++AG+ YE    G  +E+ +R K  F   M L  EFV  DA FP+
Sbjct  180   LTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMILSMEFVLWDA-FPI  235

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSN---EDQKFIDVMLSMIDDQF  795
               F+W+D++GHVK MKR  KD+D++ Q+W++   K+R  N    +Q FIDV+LS + +++
Sbjct  236   PLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREVNAEGNEQDFIDVVLSKMSNEY  295

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
                  YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EIDT +GK+R
Sbjct  296   LDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDR  354

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L 
Sbjct  355   WVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQ  414

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDPK+WP+P+ F PERF+        + + Y+++PFG GRRSCPG  YA Q+  + +ARL
Sbjct  415   RDPKLWPNPDNFDPERFVA--ADIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMARL  472

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGFN+ T  NEPLDM E  GI + K+ P+EV++TPRL+P L+
Sbjct  473   IQGFNYRTPTNEPLDMKEGAGITIRKVNPVEVIITPRLAPELY  515



>dbj|BAM36724.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   518 bits (1333),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 249/523 (48%), Positives = 363/523 (69%), Gaps = 25/523 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1503
             + +I+G+  L  L +F W K+S++    LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     IEAIVGLVTLTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYGPV+T RLG+  +LVVSS+EA++DCF+TND + + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +    YWR+ RKL+++E+LS+ RLEK KHV ++++QT IK+LY+ I  D N+ +   +N+
Sbjct  125   ANYGPYWRKNRKLIIQEVLSASRLEKFKHVRLAKIQTGIKDLYSRI--DGNSST---INL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R KK F   M L  EFV  DA FP+ 
Sbjct  180   TDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSN---EDQKFIDVMLSMIDDQFT  792
              F+W+D++GHVK MKR  KD+D++ Q+W++   K+R  N    +Q FIDV+LS + +++ 
Sbjct  236   LFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREVNAEGNEQDFIDVVLSKMSNEYL  295

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
                 YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EIDT +GK+RW
Sbjct  296   DE-GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRW  354

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L R
Sbjct  355   VEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQR  414

Query  431   DPKIWPDPEKFLPERFM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             DPK+WP+P+ F PERF+  N++    + + Y+++PFG GRRSCPG  YA Q+  + +ARL
Sbjct  415   DPKLWPNPDNFDPERFVAANID---FRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMARL  471

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGFN+ T   EPLDM E  GI + K+ P+EV++TPRL+P L+
Sbjct  472   IQGFNYRTPTKEPLDMKEGAGITIRKVNPVEVIITPRLAPELY  514



>dbj|BAM36723.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   516 bits (1330),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 248/523 (47%), Positives = 363/523 (69%), Gaps = 25/523 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1503
             + +I+G+  L  L +F W K+S++    LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     IEAIVGLVTLTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYGPV+T RLG+  +LVVSS+EA++DCF+TND + + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +    +WR+ RKL+++E+LS+ RLEK KHV ++++QT IK+LY+ I  D N+ +   +N+
Sbjct  125   ANYGPFWRKNRKLIIQEVLSASRLEKFKHVRLAKIQTGIKDLYSRI--DGNSST---INL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R KK F   M L  EFV  DA FP+ 
Sbjct  180   TDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSN---EDQKFIDVMLSMIDDQFT  792
              F+W+D++GHVK MKR  KD+D++ Q+W++   K+R  N    +Q FIDV+LS + +++ 
Sbjct  236   LFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREVNAEGNEQDFIDVVLSKMSNEYL  295

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
                 YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EIDT +GK+RW
Sbjct  296   DE-GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRW  354

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L R
Sbjct  355   VEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQR  414

Query  431   DPKIWPDPEKFLPERFM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             DPK+WP+P+ F PERF+  N++    + + Y+++PFG GRRSCPG  YA Q+  + +ARL
Sbjct  415   DPKLWPNPDNFDPERFVAANID---FRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMARL  471

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGFN+ T   EPLDM E  GI + K+ P+EV++TPRL+P L+
Sbjct  472   IQGFNYRTPTKEPLDMKEGAGITICKVNPVEVIITPRLAPELY  514



>ref|XP_011089652.1| PREDICTED: cytochrome P450 82C2 [Sesamum indicum]
Length=528

 Score =   516 bits (1330),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 253/503 (50%), Positives = 353/503 (70%), Gaps = 17/503 (3%)
 Frame = -1

Query  1610  WRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRIL  1443
             WRK  +       PE  GAWP+IGHLH     VP+ +TL   AD+YGPVFT+RLG+   L
Sbjct  33    WRKSPQNPKVNSAPEPSGAWPVIGHLHLLGGRVPVYRTLGGLADRYGPVFTVRLGVHTAL  92

Query  1442  VVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILS  1263
             VVSSWEAV+DCF TNDK+L  RP + AGKYLGYDYA F FS + +YWR++RKLV+ E+LS
Sbjct  93    VVSSWEAVKDCFTTNDKILNKRPASSAGKYLGYDYAAFGFS-HGTYWRQMRKLVLLEVLS  151

Query  1262  SRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRR  1083
             +RRLE LK+VW SE+ T+I ELY          S   V +S W   LTLN I+ ++AG+R
Sbjct  152   ARRLESLKNVWESEIHTSINELY-------KKHSGKVVVISEWIERLTLNTIVMMIAGKR  204

Query  1082  YEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKD  903
             Y   + G    EA+  +++  + MY+ G+FV+ DAI P    RW+D++GH+K+MKR +K+
Sbjct  205   YTDSTQGDETVEARSFRELIKEFMYISGQFVASDAI-PFPPLRWMDFQGHIKSMKRISKE  263

Query  902   VDAILQDWVDARRK---ERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ  732
             +  + + W+    +   + R   +Q FIDVMLS ID++FT  + ++R+T+IKA  L+++ 
Sbjct  264   LSTVFERWITEHVRSDCKSRLGNEQDFIDVMLSTIDEKFTS-FGHTRETIIKATALNLIL  322

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
               S+T + HLTW+L++LL + + +++ Q+EID  +GKERW ++SD+KNL YLQ VVKETL
Sbjct  323   AGSDTTSIHLTWLLSLLLNNRQVMQQAQEEIDMKVGKERWVQESDIKNLVYLQAVVKETL  382

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R++P GP   PHEA+EDC V GYH+PKGT+L VNVW+LHRDP+IW +P+ F+PERF+T+ 
Sbjct  383   RLFPPGPLSVPHEAMEDCCVAGYHVPKGTRLLVNVWKLHRDPRIWAEPDNFVPERFLTSH  442

Query  371   EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVG  192
                    + ++FVPFG GRRSCPG  +A Q+T + +ARL QGF+ +T  N P+DM E + 
Sbjct  443   VAVDFTGQNHEFVPFGSGRRSCPGITFAMQVTHLTLARLLQGFDLATPSNGPVDMTEGLS  502

Query  191   IILPKLTPLEVLVTPRLSPTLFR  123
             I LPK TPLEV++TPRLS  L++
Sbjct  503   ITLPKATPLEVVITPRLSDGLYQ  525



>dbj|BAM36725.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   516 bits (1328),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 249/523 (48%), Positives = 362/523 (69%), Gaps = 25/523 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1503
             + +I+G+  L LL +F W K+S++    LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     IEAIVGLVTLTLLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYGPV+T RLG+  +LVVSS+EA++DCF+TND + + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +    YWR+ RKL+++E+LS+ RLEK KHV ++++QT IK+LY+ I  D N+ +   +N+
Sbjct  125   ANYGPYWRKNRKLIIQEVLSASRLEKFKHVRLAKIQTGIKDLYSRI--DGNSST---INL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R K  F   M L  EFV  DA FP+ 
Sbjct  180   TDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMILSMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSN---EDQKFIDVMLSMIDDQFT  792
              F+W+D++GHVK MKR  KD+D++ Q+W++   K+R  N    +Q FIDV+LS + +++ 
Sbjct  236   LFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREVNAEGNEQDFIDVVLSKMSNEYL  295

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
                 YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EIDT +GK+RW
Sbjct  296   DE-GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDRW  354

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L R
Sbjct  355   VEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQR  414

Query  431   DPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             DPK+W +P+KF PERF+    G+   + + Y+++PFG GRRSCPG  YA Q+  + +A L
Sbjct  415   DPKLWSNPDKFDPERFIA---GDIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMAHL  471

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGFN+ T  NEPLDM E  GI + K+ P+EV++TPRL+P L+
Sbjct  472   IQGFNYRTPTNEPLDMKEGAGITIRKVNPVEVIITPRLAPELY  514



>dbj|BAM36726.1| nicotine N-demethylase [Nicotiana alata]
Length=515

 Score =   514 bits (1324),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 249/524 (48%), Positives = 361/524 (69%), Gaps = 26/524 (5%)
 Frame = -1

Query  1658  LSSILGIAALV--LLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVKTL  1506
             + +I+G   L+  L +F W K+S++    LPP+  G WP+IGHL +F       PL + L
Sbjct  5     IEAIVGAVTLITFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKL  64

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
              + ADKYGPV+T RLG+  +LVVSS+EA++DCF+TND + + RP    G+YLGY+  +  
Sbjct  65    GDLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLF  124

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN  1146
              +    YWR+ RKLV++E+LS+ RLEK KHV ++++QT IK+LY+ I  D N+ +   +N
Sbjct  125   LANYGPYWRKNRKLVIQEVLSASRLEKFKHVRLAKIQTGIKDLYSRI--DGNSST---IN  179

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             ++ W   L   LI++++AG+ YE    G  +E+ +R K  F   M L  EFV  DA FP+
Sbjct  180   LTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMILSMEFVLWDA-FPI  235

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSN---EDQKFIDVMLSMIDDQF  795
               F+W+D++GHVK MKR  KD+D++ Q+W++   K+R  N    +Q FIDV+LS + +++
Sbjct  236   PLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREVNAEGNEQDFIDVVLSKMSNEY  295

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
                  YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EIDT +GK+R
Sbjct  296   LDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGKDR  354

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L 
Sbjct  355   WVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQ  414

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR  258
             RDPK+WP+P+KF PERF+    G+   + + Y+++PFG GRRSCPG  YA Q+  + +AR
Sbjct  415   RDPKLWPNPDKFDPERFIA---GDIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMAR  471

Query  257   LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             L QGFN+ T  NEPLDM E  GI + K+ P+EV++TPRL+  L+
Sbjct  472   LIQGFNYRTPTNEPLDMKEGAGITIRKVNPVEVIITPRLAHELY  515



>ref|XP_009609537.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
 gb|ABM46919.1| cytochrome P450 monooxygenase CYP82E3 [Nicotiana tomentosiformis]
Length=518

 Score =   512 bits (1319),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 248/526 (47%), Positives = 357/526 (68%), Gaps = 27/526 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1503
             + +I+G+     L +F W K+S++    LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     VEAIVGLVTFTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYGPVFT RLG+  +LVVSS+EA++DCF+TND + + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +   SYWR+ RKL+++E+LS+ RLEK KHV  + +QT+IK LYT I  D N+ +   +N+
Sbjct  125   ANYGSYWRKNRKLIIQEVLSASRLEKFKHVRFARIQTSIKNLYTRI--DGNSST---INL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R KK F   M L  EFV  DA FP+ 
Sbjct  180   TDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR-------SNEDQKFIDVMLSMID  804
              F+W+D++GHVK MKR  KD+D++ Q+W++   K+R           +Q FIDV+LS + 
Sbjct  236   LFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREKIMEVGTEGNEQDFIDVVLSKMS  295

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
             +++  G  YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EIDT +G
Sbjct  296   NEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVG  354

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             K+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV 
Sbjct  355   KDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVM  414

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             +L RDPK+W +P+KF PERF+          + Y+++PFG GRRSCPG  YA Q+  + +
Sbjct  415   KLQRDPKLWSNPDKFNPERFIA--RDIDFHGQHYEYIPFGSGRRSCPGMTYALQVEHLTM  472

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             A L QGFN+ T  +EPLDM E  GI + K+ P++V++TPRL+P L+
Sbjct  473   AHLIQGFNYRTPTDEPLDMKEGAGITIRKVNPVKVIITPRLAPELY  518



>ref|XP_009757628.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
 gb|ADP65810.1| nicotine N-demethylase [Nicotiana sylvestris]
Length=517

 Score =   509 bits (1312),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 248/525 (47%), Positives = 355/525 (68%), Gaps = 26/525 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFSWR-----KQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1503
             + +I+G+  L LL++  R     K SK LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     VEAIVGLVTLALLFYFIRTKKSQKPSKPLPPKIPGGWPVIGHLFYFDDDSDDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYGPVFT RLG+  +LVVSS+EA++DCF+TND + + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +    YWR+ RKLV++E+L + RLEKLKHV   E+QT+IK LYT I  D N+ +   +N+
Sbjct  125   TKYGPYWRKNRKLVIQEVLCASRLEKLKHVRFGEIQTSIKNLYTRI--DGNSST---INL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R +K F   + L  EFV  DA FP+ 
Sbjct  180   TDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFRKAFKDFIILSMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDD  801
              F+W+D++GHVK MKR  KD+D++ Q+W++   K++   E      +Q FIDV+LS + +
Sbjct  236   LFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHVKKKEKMEVNAEGNEQDFIDVVLSKMSN  295

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             ++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EID  +GK
Sbjct  296   EYLDE-GYSRDTVIKATVFSLVLDAADTVALHMNWGMALLINNQHALKKAQEEIDKKVGK  354

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             +RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +
Sbjct  355   DRWVEESDIKDLVYLQTIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMK  414

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             L RDPK+W +P+KF PERF         + + Y+F+PFG GRRSCPG  YA Q+  + +A
Sbjct  415   LQRDPKLWSNPDKFDPERFFA--ADIDFRGQHYEFIPFGSGRRSCPGMTYAMQVEHLTIA  472

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              L QGFN+ T  +EPLDM E  G+ + K+ P+EV++TPRL+P L+
Sbjct  473   HLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPIEVVITPRLTPELY  517



>gb|ADP65809.1| nicotine N-demethylase [Nicotiana tabacum]
Length=517

 Score =   509 bits (1312),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 248/525 (47%), Positives = 355/525 (68%), Gaps = 26/525 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFSWR-----KQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1503
             + +I+G+  L LL++  R     K SK LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     VEAIVGLVTLTLLFYFIRTKKSQKPSKPLPPKIPGGWPVIGHLFYFDDDSDDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYGPVFT RLG+  +LVVSS+EA++DCF+TND + + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +    YWR+ RKLV++E+L + RLEKLKHV   E+QT+IK LYT I  D N+ +   +N+
Sbjct  125   TKYGPYWRKNRKLVIQEVLCASRLEKLKHVRFGEIQTSIKNLYTRI--DGNSST---INL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R +K F   + L  EFV  DA FP+ 
Sbjct  180   TDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFRKAFKDFIILSMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDD  801
              F+W+D++GHVK MKR  KD+D++ Q+W++   K++   E      +Q FIDV+LS + +
Sbjct  236   LFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHVKKKEKMEVNAEGNEQDFIDVVLSKMSN  295

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             ++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EID  +GK
Sbjct  296   EYLDE-GYSRDTVIKATVFSLVLDAADTVALHMNWGMALLINNQHALKKAQEEIDKKVGK  354

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             +RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +
Sbjct  355   DRWVEESDIKDLVYLQTIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMK  414

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             L RDPK+W +P+KF PERF         + + Y+F+PFG GRRSCPG  YA Q+  + +A
Sbjct  415   LQRDPKLWSNPDKFDPERFFA--ADIDFRGQHYEFIPFGSGRRSCPGMTYAMQVEHLTIA  472

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              L QGFN+ T  +EPLDM E  G+ + K+ P+EV++TPRL+P L+
Sbjct  473   HLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPIEVVITPRLTPELY  517



>ref|XP_009609539.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
 gb|ABM46920.1| cytochrome P450 monooxygenase CYP82E4 [Nicotiana tomentosiformis]
Length=517

 Score =   509 bits (1311),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 252/529 (48%), Positives = 357/529 (67%), Gaps = 31/529 (6%)
 Frame = -1

Query  1658  LSSILGIAALV----LLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVK  1512
             LS I  I  LV    L +F W K+S++    LPP+  G WP+IGHL HF       PL +
Sbjct  2     LSPIEAIVGLVTFTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLAR  61

Query  1511  TLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAV  1332
              L + ADKYGPVFT RLG+  +LVVSS+EAV+DCF+TND + + RP    G YLGY+ A+
Sbjct  62    KLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAM  121

Query  1331  FTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPK  1152
                +    YWR+ RKLV++E+LS+ RLEK KHV  + +Q +IK LYT I  D N+ +   
Sbjct  122   LFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQASIKNLYTRI--DGNSST---  176

Query  1151  VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
             +N++ W   L   LI++++AG+ YE    G  +E+ +R KK F   M L  EFV  DA F
Sbjct  177   INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-F  232

Query  971   PLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLSM  810
             P+  F+W+D++GHVK MKR  KD+D++ Q+W++    +R   E      +Q FIDV+LS 
Sbjct  233   PIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSK  292

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
             + +++  G  YSRDTVIKA V S++ DA++T A H+ W +A+L+ + ++L + Q+EIDT 
Sbjct  293   MSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQKALTKAQEEIDTK  351

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +GK+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ N
Sbjct  352   VGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFAN  411

Query  449   VWRLHRDPKIWPDPEKFLPERFM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             V +L RDPK+W DP+ F PERF+ T+++    + + Y+++PFG GRRSCPG  YA Q+  
Sbjct  412   VMKLQRDPKLWSDPDTFDPERFIATDID---FRGQYYKYIPFGSGRRSCPGMTYALQVEH  468

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + +A L QGFN+ T  +EPLDM E  GI + K+ P+E+++ PRL+P L+
Sbjct  469   LTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPRLAPELY  517



>ref|XP_009619218.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=517

 Score =   508 bits (1309),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 252/525 (48%), Positives = 356/525 (68%), Gaps = 26/525 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQ----SKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1503
             + +I+G+  L LL +F W K+    SK LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     VEAIVGLVTLTLLFYFLWPKKFQIPSKPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYGPVFT RLG+  +LVVSS+EAV+DCF+TND + + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +    YWR+ RKLV++E+LS+ RLEKLKHV   ++QT+IK LYT I  D N+ +   +N+
Sbjct  125   TKYGPYWRKNRKLVIQEVLSASRLEKLKHVRFGKIQTSIKNLYTRI--DGNSST---INL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R +K F   + L  EFV  DA FP+ 
Sbjct  180   TDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFRKAFKDFIILSMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDD  801
              F+W+D++GHVK MKR  KD+D++ Q+W++   K+R   E      +Q FIDV+LS + +
Sbjct  236   LFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHVKKREKMEVNAQGNEQDFIDVVLSKMSN  295

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             ++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EID  +GK
Sbjct  296   EYLDE-GYSRDTVIKATVFSLVLDAADTVALHMNWGMALLINNQHALKKAQEEIDKKVGK  354

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             ERW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +
Sbjct  355   ERWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMK  414

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             L RDPK+W +P+KF PERF  +      Q+  Y+F+PFG GRRSCPG  YA Q+  + +A
Sbjct  415   LQRDPKLWSNPDKFDPERFFADDIDYRGQH--YEFIPFGSGRRSCPGMTYALQVEHLTIA  472

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              L QGFN+ T  +EPLDM E  G+ + K+ P+EV +T RL+P L+
Sbjct  473   HLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPVEVTITARLAPELY  517



>gb|ABX56037.1| CYP82E5v2 [Nicotiana tabacum]
Length=517

 Score =   508 bits (1308),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 252/525 (48%), Positives = 355/525 (68%), Gaps = 26/525 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQ----SKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1503
             + +I+G+  L LL +F W K+    SK LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     VEAIVGLVTLTLLFYFLWPKKFQIPSKPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYGPVFT RLG+  +LVVSS+EAV+DCF+TND + + RP    G+YLGY  A+   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAIFSNRPAFLYGEYLGYSNAMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +    YWR+ RKLV++E+LS+ RLEKLKHV   ++QT+IK LYT I  D N+ +   +N+
Sbjct  125   TKYGPYWRKNRKLVIQEVLSASRLEKLKHVRFGKIQTSIKSLYTRI--DGNSST---INL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R +K F   + L  EFV  DA FP+ 
Sbjct  180   TDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFRKAFKDFIILSMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDD  801
              F+W+D++GHVK MKR  KD+D++ Q+W++   K+R   E      +Q FIDV+LS + +
Sbjct  236   LFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHVKKREKMEVNAQGNEQDFIDVVLSKMSN  295

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             ++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EID  +GK
Sbjct  296   EYLDE-GYSRDTVIKATVFSLVLDAADTVALHMNWGMALLINNQHALKKAQEEIDKKVGK  354

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             ERW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +
Sbjct  355   ERWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMK  414

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             L RDPK+W +P+KF PERF  +      Q+  Y+F+PFG GRRSCPG  YA Q+  + +A
Sbjct  415   LQRDPKLWSNPDKFDPERFFADDIDYRGQH--YEFIPFGSGRRSCPGMTYALQVEHLTIA  472

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              L QGFN+ T  +EPLDM E  G+ + K+ P+EV +T RL+P L+
Sbjct  473   HLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPVEVTITARLAPELY  517



>ref|XP_009778755.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana sylvestris]
Length=515

 Score =   508 bits (1307),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 247/526 (47%), Positives = 349/526 (66%), Gaps = 30/526 (6%)
 Frame = -1

Query  1658  LSSILGIAALV--LLWF----SWRKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTL  1506
             + +I+G   L+  LL+F      +K SK LP +  G WP+IGHL HF       PL + L
Sbjct  5     IEAIVGAVTLITFLLYFLCTKKSQKHSKPLPTKIPGGWPVIGHLFHFNNDGDDRPLARKL  64

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
              + ADKYGPVFT RLG+  +LVVSS+EA++DCF+TND + + RP    G+YLGY+  +  
Sbjct  65    GDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLF  124

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN  1146
              +    YWR+ RKLV++E+LS+ RLEK K V  + +QT+IK LYT I     N ++  +N
Sbjct  125   LANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTSIKNLYTRI-----NGNSSTIN  179

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             +S W   L   LI++++AG+ YE    G  +E+ +R K  F   M L  EFV  DA FP+
Sbjct  180   LSDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMVLSMEFVLWDA-FPI  235

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMID  804
               F+W+D++GH+K MKR  KD+D++ Q+W++    +R   E      +Q FIDV+LS + 
Sbjct  236   PLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREKMEVGAEGNEQDFIDVVLSKLS  295

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
              ++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EIDT +G
Sbjct  296   KEYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVG  354

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             K+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV 
Sbjct  355   KDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVM  414

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             +L RDPK+WP+P+ F PERF+ +  G+      Y+++PFG GRRSCPG  YA Q+  + +
Sbjct  415   KLQRDPKLWPNPDNFDPERFVIDFRGQ-----HYEYIPFGSGRRSCPGMTYALQVEHLTM  469

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             A L QGFN+ T  NEPLDM E  GI + K+  +EVL+ PRL+P L+
Sbjct  470   AHLIQGFNYRTPTNEPLDMKEGAGITIRKVNSVEVLIKPRLAPELY  515



>gb|ABA07807.1| cytochrome P450 monooxygenase CYP82E3 [Nicotiana tabacum]
Length=518

 Score =   508 bits (1307),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 247/526 (47%), Positives = 355/526 (67%), Gaps = 27/526 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1503
             + +I+G+     L +F W K+S++    LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     VEAIVGLVTFTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYGPVFT RLG+  +LVVSS+EA++DCF+TND + + RP    G+YLGY  A+   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYKNAMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +   SYWR+ RKL+++E+LS+ RLEK KHV  + +QT+IK LYT I  D N+ +   +N+
Sbjct  125   ANYGSYWRKNRKLIIQEVLSASRLEKFKHVRFARIQTSIKNLYTRI--DGNSST---INL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R KK F   M L  EFV  DA FP+ 
Sbjct  180   TDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRS-------NEDQKFIDVMLSMID  804
              F+W+D++GHVK MKR  KD+D++ Q+W++   K+R           +Q FIDV+LS + 
Sbjct  236   LFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREKIMEVGTEGNEQDFIDVVLSKMS  295

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
             +++  G  YSRDTVIKA V S++ DA++T A H+   +A+L+ +  +LK+ Q+EIDT +G
Sbjct  296   NEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINCGMALLINNQNALKKAQEEIDTKVG  354

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             K+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV 
Sbjct  355   KDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVM  414

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             +L RDPK+W +P+KF PERF+          + Y+++PFG GRRSCPG  YA Q+  + +
Sbjct  415   KLQRDPKLWSNPDKFNPERFIA--RDIDFHGQHYEYIPFGSGRRSCPGMTYALQVEHLTM  472

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             A L QGFN+ T  +EPLDM E  GI + K+ P++V++TPRL+P L+
Sbjct  473   AHLIQGFNYRTPTDEPLDMKEGAGITIRKVNPVKVIITPRLAPELY  518



>gb|ABD39479.1| CYP82E4v8 [Nicotiana tabacum]
Length=517

 Score =   506 bits (1304),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 246/504 (49%), Positives = 348/504 (69%), Gaps = 23/504 (5%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1437
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1436  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR  1257
             SS+EAV+DCF+TND + + RP    G YLGY+ A+   +    YWR+ RKLV++E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1256  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             RLEK KHV  + +Q +IK LYT I  D N+ +   +N++ W   L   LI++++AG+ YE
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI--DGNSST---INLTDWLEELNFGLIVKMIAGKNYE  201

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
                 G  +E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK MKRA KD+D
Sbjct  202   ---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRAFKDID  257

Query  896   AILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             ++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V S++
Sbjct  258   SVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLV  316

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
              DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +VKE 
Sbjct  317   LDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEV  376

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM-T  378
             LR+YP GP L PHE VEDC+V GYHIPKGT+L+VNV +L RDPK+W DP+ F PERF+ T
Sbjct  377   LRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFVNVMKLQRDPKLWSDPDTFDPERFIAT  436

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
             +++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLDM E 
Sbjct  437   DID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEG  493

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              GI + K+ P+E+++ PRL+P L+
Sbjct  494   AGITIRKVNPVELIIAPRLAPELY  517



>gb|ABD39477.1| CYP82E4v6 [Nicotiana tabacum]
Length=517

 Score =   505 bits (1300),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 245/504 (49%), Positives = 347/504 (69%), Gaps = 23/504 (5%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1437
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1436  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR  1257
             SS+EAV+DCF+TND + + RP    G YLGY+ A+   +    YWR+ RKLV++E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1256  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             RLEK KHV  + +Q +IK LYT I  D N+ +   +N++ W   L   LI++++AG+ YE
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI--DGNSST---INLTDWLEELNFGLIVKMIAGKNYE  201

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
                 G  +E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK MKR  KD+D
Sbjct  202   ---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTFKDID  257

Query  896   AILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             ++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V S++
Sbjct  258   SVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLV  316

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
              DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +VKE 
Sbjct  317   LDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEV  376

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM-T  378
             LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+WPDP+ F PERF+ T
Sbjct  377   LRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLLRDPKLWPDPDTFDPERFIAT  436

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
             +++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLDM E 
Sbjct  437   DID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEG  493

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              GI + K+ P+E+++ PRL+P L+
Sbjct  494   AGITIRKVNPVELIIAPRLAPELY  517



>gb|ABC69371.1| CYP82E5 [Nicotiana tabacum]
Length=517

 Score =   504 bits (1299),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 249/525 (47%), Positives = 356/525 (68%), Gaps = 26/525 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQ----SKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1503
             + +I+G+  L LL +F W K+    SK LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     VEAIVGLVTLTLLFYFLWPKKFQIPSKPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYGPVFT RLG+  +L+VSS+EAV+DCF+TND + + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVFTFRLGLPLVLIVSSYEAVKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +    YWR+ RKLV++E+LS+ RLEKLKHV   ++QT+IK LYT I  D N+ +   +N+
Sbjct  125   TKYGPYWRKNRKLVIQEVLSASRLEKLKHVRFGKIQTSIKSLYTRI--DGNSST---INL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R +K +   + L  EFV  DA FP+ 
Sbjct  180   TDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFRKAYKDFIILSMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDD  801
              F+W+D++G+VK MKR  KD+D++ Q+W++   K+R   E      +Q FIDV+LS + +
Sbjct  236   LFKWVDFQGYVKAMKRTFKDIDSVFQNWLEEHVKKREKMEVNAQGNEQDFIDVVLSKMSN  295

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             ++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EID  +GK
Sbjct  296   EYLDE-GYSRDTVIKATVFSLVLDAADTVALHMNWGMALLINNQHALKKAQEEIDKKVGK  354

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             ERW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +
Sbjct  355   ERWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMK  414

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             L RDPK+W +P+KF PERF  +      Q+  Y+F+PFG GRRSCPG  YA Q+  + +A
Sbjct  415   LQRDPKLWSNPDKFDPERFFADDIDYRGQH--YEFIPFGSGRRSCPGMTYALQVEHLTIA  472

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              L QGFN+ T  +EPLDM E  G+ + K+ P+EV +T RL+P L+
Sbjct  473   HLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPVEVTITARLAPELY  517



>gb|ABD39480.1| CYP82E4v10 [Nicotiana tabacum]
Length=517

 Score =   504 bits (1297),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 244/503 (49%), Positives = 342/503 (68%), Gaps = 21/503 (4%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1437
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1436  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR  1257
             SS+EAV+DCF+TND + + RP    G YLGY+ A+   +    YWR+ RKLV++E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1256  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             RLEK KHV  + +Q +IK LYT I  D N+ +   +N++ W   L   LI++++AG+ YE
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI--DGNSST---INLTDWLEELNFGLIVKMIAGKNYE  201

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
                 G  +E+ +R KK F   M L  EFV  D+ FP+  F+W+D++GHVK MKR  KD+D
Sbjct  202   ---SGKGDEQVERFKKAFKDFMILSMEFVLWDS-FPIPLFKWVDFQGHVKAMKRTFKDID  257

Query  896   AILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             ++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V S++
Sbjct  258   SVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLV  316

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
              DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +VKE 
Sbjct  317   LDAADTVALHINWGMALLMNNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEV  376

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTN  375
             LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PERF+  
Sbjct  377   LRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIAT  436

Query  374   LEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV  195
               G   Q   Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLDM E  
Sbjct  437   DIGFRGQ--YYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGA  494

Query  194   GIILPKLTPLEVLVTPRLSPTLF  126
             GI + K+ P+E+++ PRL+P L+
Sbjct  495   GITIRKVNPVELIIAPRLAPELY  517



>gb|ABA07805.1| cytochrome P450 monooxygenase CYP82E4v1 [Nicotiana tabacum]
Length=517

 Score =   503 bits (1296),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 244/504 (48%), Positives = 346/504 (69%), Gaps = 23/504 (5%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1437
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1436  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR  1257
             SS+EAV+DCF+TND + + RP    G YLGY+ A+   +    YWR+ RKLV++E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1256  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             RLEK KHV  + +Q +IK LYT I  D N+ +   +N++ W   L   LI++++AG+ YE
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI--DGNSST---INLTDWLEELNFGLIVKMIAGKNYE  201

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
                 G  +E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK MKR  KD+D
Sbjct  202   ---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTFKDID  257

Query  896   AILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             ++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V S++
Sbjct  258   SVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLV  316

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
              DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +VKE 
Sbjct  317   LDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEV  376

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM-T  378
             LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PERF+ T
Sbjct  377   LRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIAT  436

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
             +++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLDM E 
Sbjct  437   DID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEG  493

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              GI + K+ P+E+++ PRL+P L+
Sbjct  494   AGITIRKVNPVELIIAPRLAPELY  517



>gb|ABA07804.1| cytochrome P450 monooxygenase CYP82E4v2 [Nicotiana tabacum]
 gb|ABB36475.1| nicotine demethylase [Nicotiana tabacum]
 gb|ABN42695.1| cytochrome P450 CYP82E4v2 nicotine demethylase [Nicotiana tabacum]
Length=517

 Score =   503 bits (1296),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 244/504 (48%), Positives = 346/504 (69%), Gaps = 23/504 (5%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1437
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1436  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR  1257
             SS+EAV+DCF+TND + + RP    G YLGY+ A+   +    YWR+ RKLV++E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1256  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             RLEK KHV  + +Q +IK LYT I  D N+ +   +N++ W   L   LI++++AG+ YE
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI--DGNSST---INLTDWLEELNFGLIVKMIAGKNYE  201

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
                 G  +E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK MKR  KD+D
Sbjct  202   ---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTFKDID  257

Query  896   AILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             ++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V S++
Sbjct  258   SVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLV  316

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
              DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +VKE 
Sbjct  317   LDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEV  376

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM-T  378
             LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PERF+ T
Sbjct  377   LRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIAT  436

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
             +++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLDM E 
Sbjct  437   DID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEG  493

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              GI + K+ P+E+++ PRL+P L+
Sbjct  494   AGITIRKVNPVELIIAPRLAPELY  517



>ref|XP_009627979.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=517

 Score =   503 bits (1296),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 243/525 (46%), Positives = 355/525 (68%), Gaps = 26/525 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLL-WFSWRKQSKR----LPPEAGGAWPIIGHLHHFR---TSVPLVKTLS  1503
             + +I+G+     L +F W K+S++    LPP+  G WP+IGHL HF       PL + L 
Sbjct  5     IEAIVGLVTFTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFHFNDDGNDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYG VFT RLG+  +LVVSS+EA++DCF+TND + + RP    G+Y+GY+ A+   
Sbjct  65    DLADKYGLVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYIGYNNAMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +    YWR+ RKLV++E+LS+ RL+K KHV  + +QT+IK LYT I  D N+ +   +N+
Sbjct  125   ANYGPYWRKNRKLVIQEVLSASRLKKFKHVRFARIQTSIKNLYTRI--DRNSST---INL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R KK F   M +  EFV  DA FP+ 
Sbjct  180   TDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKKAFKDFMIISMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDD  801
              F+W+D++GHVK MKR  KD+D++ Q+W++    +R   E      +Q FIDV+LS + +
Sbjct  236   LFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSN  295

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             ++  G  YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EIDT +GK
Sbjct  296   EYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVGK  354

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             +RW E+SD+K+L YLQ +VKE LR+YP GP L PHE +EDC+V GY+I KGT+L+ NV +
Sbjct  355   DRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENIEDCVVSGYYISKGTRLFANVMK  414

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             L RDPK+WP+P+ F PERF+    G   + + Y+++PFG GRRSCPG  YA Q+  + +A
Sbjct  415   LQRDPKLWPNPDNFDPERFVA--AGIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMA  472

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              L QGFN+ST  +EPLDM E  GI + K+ P+EV++  RL+P L+
Sbjct  473   HLIQGFNYSTPNDEPLDMKEGAGITIRKVNPVEVIIMSRLAPELY  517



>gb|ABD39478.1| CYP82E4v7 [Nicotiana tabacum]
Length=517

 Score =   503 bits (1295),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 243/504 (48%), Positives = 346/504 (69%), Gaps = 23/504 (5%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1437
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1436  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR  1257
             SS+EAV+DCF+TND + + RP    G YLGY+ A+   +    YWR+ RKLV++E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1256  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             RLEK KHV  + +Q +IK LYT I  D N+ +   +N++ W   L   L+++++AG+ YE
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI--DGNSST---INLTDWLEELNFGLVVKMIAGKNYE  201

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
                 G  +E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK MKR  KD+D
Sbjct  202   ---SGKGDEQVERFKKAFEDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTFKDID  257

Query  896   AILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             ++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V S++
Sbjct  258   SVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLV  316

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
              DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +VKE 
Sbjct  317   LDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEV  376

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM-T  378
             LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PERF+ T
Sbjct  377   LRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIAT  436

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
             +++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLDM E 
Sbjct  437   DID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEG  493

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              GI + K+ P+E+++ PRL+P L+
Sbjct  494   AGITIRKVNPVELIIAPRLAPELY  517



>gb|ABD39476.1| CYP82E4v5 [Nicotiana tabacum]
Length=517

 Score =   503 bits (1294),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 244/504 (48%), Positives = 346/504 (69%), Gaps = 23/504 (5%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1437
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1436  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR  1257
             SS+EAV+DCF+TND + + RP    G YLGY+ A+   +    YWR+ RKLV++E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1256  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             RLEK KHV  + +Q +IK LYT I  D N+ +   +N++ W   L   LI++++AG+ YE
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI--DGNSST---INLTDWLEELNFGLIVKMIAGKNYE  201

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
                 G  +E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK MKR  KD+D
Sbjct  202   ---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTFKDID  257

Query  896   AILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             ++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V S++
Sbjct  258   SVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLV  316

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
              DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +VKE 
Sbjct  317   LDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEV  376

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM-T  378
             LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PERF+ T
Sbjct  377   LRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVVKLQRDPKLWSDPDTFDPERFIAT  436

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
             +++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLDM E 
Sbjct  437   DID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEG  493

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              GI + K+ P+E+++ PRL+P L+
Sbjct  494   AGITIRKVNPVELIIAPRLAPELY  517



>ref|XP_004248527.2| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=521

 Score =   502 bits (1292),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 247/523 (47%), Positives = 360/523 (69%), Gaps = 20/523 (4%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFS-WRKQ----SKRLPPEAGGAWPIIGHLHHFR---TSVPLVKTLS  1503
             L +ILGI A V      WR+     +++L P+  GAWPIIGHLH       +VP   TL+
Sbjct  5     LEAILGILAFVFFAIIIWRRSNTLTTEKLAPQVPGAWPIIGHLHQLSGIDKNVPFAHTLA  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
               ADKYGP+FT+R+G+   L++++WE  +DC  T+DK  AARPT+ AG+ +GY YA FT+
Sbjct  65    ALADKYGPIFTLRMGMYPYLIINNWEGAKDCLTTHDKDFAARPTSMAGQSIGYKYARFTY  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             S    Y+  VRKL + ++LSS +LEK++H+ V EL+ +IK+LY+   + N N     +N+
Sbjct  125   SNFGLYYNHVRKLALTQVLSSTKLEKMRHIRVVELENSIKDLYSLTQVANKNNEV--INI  182

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI-FPL  966
             ++WF  LTLN I++ + G+RY   ++   +EEA+R +K F  +MY+ G+ V  D + FPL
Sbjct  183   TQWFHQLTLNTIVKTICGKRY---NNIEKDEEAKRFRKAFKGIMYVVGQIVLYDVVPFPL  239

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVD--ARRKERRSNEDQKFIDVML-SMIDDQF  795
               F+++D++GH+K M    KD+D+ILQ W++   ++K+  +++D+  ID ML +   D+F
Sbjct  240   --FKYVDFQGHIKLMNNIYKDLDSILQGWLEDHMKKKDLNNDDDEDAIDAMLKATYVDEF  297

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
              + Y YS+ TVIK+ +LS++ D S+T A H+ WI+++LL +P ++K+ Q+EIDT +GK R
Sbjct  298   -KAYGYSQATVIKSTILSLILDGSDTTAVHMIWIMSLLLNNPHAMKQAQEEIDTKVGKSR  356

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W  +SDVKNL YLQ +VKET R+YP  P L PHEAV+DC V GY IPKGT+ Y+N W++H
Sbjct  357   WVGESDVKNLVYLQAIVKETSRLYPPVPLLLPHEAVQDCKVAGYDIPKGTRTYINAWKIH  416

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDPKIW + EKF+PERF+T+     A+ + ++F+PFG GRRSCPG  +AT +T +  ARL
Sbjct  417   RDPKIWSESEKFMPERFLTSKSSVDARGQHFEFIPFGSGRRSCPGINFATLVTHLTFARL  476

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGF FST  N P+DM E VGI LPK+  +E+LVTPRLS   +
Sbjct  477   LQGFAFSTSSNTPIDMTEGVGITLPKVNQVEILVTPRLSSNFY  519



>gb|ABD39475.1| CYP82E4v4 [Nicotiana tabacum]
Length=517

 Score =   501 bits (1289),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 243/504 (48%), Positives = 345/504 (68%), Gaps = 23/504 (5%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1437
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPV T RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVLTFRLGLPLVLVV  86

Query  1436  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR  1257
             SS+EAV+DCF+TND + + RP    G YLGY+ A+   +    YWR+ RKLV++E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1256  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             RLEK KHV  + +Q +IK LYT I  D N+ +   +N++ W   L   LI++++AG+ YE
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI--DGNSST---INLTDWLEELNFGLIVKMIAGKNYE  201

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
                 G  +E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK MKR  KD+D
Sbjct  202   ---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTFKDID  257

Query  896   AILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             ++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V S++
Sbjct  258   SVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLV  316

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
              DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +VKE 
Sbjct  317   LDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEV  376

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM-T  378
             LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PERF+ T
Sbjct  377   LRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIAT  436

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
             +++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLDM E 
Sbjct  437   DID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEG  493

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              GI + K+ P+E+++ PRL+P L+
Sbjct  494   AGITIRKVNPVELIIAPRLAPELY  517



>ref|XP_007200049.1| hypothetical protein PRUPE_ppa023510mg [Prunus persica]
 gb|EMJ01248.1| hypothetical protein PRUPE_ppa023510mg [Prunus persica]
Length=517

 Score =   501 bits (1289),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 251/517 (49%), Positives = 348/517 (67%), Gaps = 20/517 (4%)
 Frame = -1

Query  1658  LSSILGIAAL-VLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1500
             LS  L IA L VL+ + WR      K    L P+  GA PIIGHLH  R  VP+ KTL+ 
Sbjct  4     LSHPLAIAGLLVLVLYLWRVRIQSHKIKGMLAPQPSGALPIIGHLHKLR--VPVFKTLAA  61

Query  1499  WADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFS  1320
              ADKYGP+FTI LG   +LV+S+++AV+ CF  ND + A RP +  GKYLGY+YA F FS
Sbjct  62    MADKYGPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFATRPRSSHGKYLGYNYAGFGFS  121

Query  1319  TNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP-KVNM  1143
                 YWR +RK+V+ E+LS RRL+ LKHV +SE+   IK L+     +  N   P KV +
Sbjct  122   PYGPYWRDMRKMVMVELLSIRRLQNLKHVQISEVDAFIKGLFLLCKTEGLNGLNPTKVVI  181

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             S W  HLTLN+I +++AG+RY   SD     + QR  K+  + MY+ G  V+ D I    
Sbjct  182   SDWIEHLTLNVITRMIAGKRYFDSSD---EGDEQRFGKIVKEFMYVSGNPVAADVI---G  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQFTQ  789
             F  W+D++G VK MKR  K++D+++  WV+    +KE  S ++  FIDVM+S+I+D  T 
Sbjct  236   FPSWIDFKGQVKAMKRIMKELDSVMGSWVEEHYAKKETNSRDEHDFIDVMMSVIEDNSTL  295

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
             GY+  R+T+IKA  ++++   SET A +L WIL++LL +  +LK  Q+E+D  +G++RW 
Sbjct  296   GYT--RETIIKATSMNLILAGSETTAINLIWILSLLLNNRHALKLAQEELDLKVGRDRWI  353

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
             ED+D++NLPYLQ +VKETLR+YP GP   PHEA++DC V G+HIPKGT+L+VN+W+LHRD
Sbjct  354   EDTDIENLPYLQAIVKETLRLYPPGPLSVPHEAMQDCQVCGFHIPKGTRLFVNLWKLHRD  413

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ  249
             P +WPDPE F PERF+T   G  A  + ++F+PFG GRRSCPG  +A Q+T + + RL Q
Sbjct  414   PCLWPDPEVFCPERFLTTHVGIDASGKHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQ  473

Query  248   GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
             GF  +T  + P+D+ E +GI +PK T LEV++TPRLS
Sbjct  474   GFELATPMDMPVDLTEGLGITMPKATSLEVILTPRLS  510



>gb|ABD39474.1| CYP82E4v3 [Nicotiana tabacum]
Length=517

 Score =   501 bits (1289),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 243/504 (48%), Positives = 345/504 (68%), Gaps = 23/504 (5%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1437
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1436  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR  1257
             SS+EAV+DCF+TND + + RP    G YLGY+ A+   +    YWR+ RKLV++E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1256  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             RLEK KHV  + +Q +IK LYT I  D N+ +   +N++ W   L   LI++++AG+ YE
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI--DGNSST---INLTDWLEELNFGLIVKMIAGKNYE  201

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
                 G  +E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK MKR  KD+D
Sbjct  202   ---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTFKDID  257

Query  896   AILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             ++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V S++
Sbjct  258   SVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLV  316

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
              DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +VKE 
Sbjct  317   LDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEV  376

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM-T  378
             LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PERF+ T
Sbjct  377   LRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIAT  436

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
             +++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EP DM E 
Sbjct  437   DID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPSDMKEG  493

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              GI + K+ P+E+++ PRL+P L+
Sbjct  494   AGITIRKVNPVELIIAPRLAPELY  517



>gb|ABD39481.1| CYP82E4v11 [Nicotiana tabacum]
Length=517

 Score =   501 bits (1289),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 242/504 (48%), Positives = 345/504 (68%), Gaps = 23/504 (5%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1437
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLAQKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1436  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR  1257
             SS+EAV+DCF+T+D + + RP    G YLGY+ A+   +    YWR+ RKLV++E+LS+ 
Sbjct  87    SSYEAVKDCFSTDDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1256  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             RLEK KHV  + +Q +IK LYT I  D N+ +   +N++ W   L   LI++++AG+ YE
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI--DGNSST---INLTDWLEELNFGLIVKMIAGKNYE  201

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
                 G  +E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK MKR  KD+D
Sbjct  202   ---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTFKDID  257

Query  896   AILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             ++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V  ++
Sbjct  258   SVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFGLV  316

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
              DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +VKE 
Sbjct  317   LDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEV  376

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM-T  378
             LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PERF+ T
Sbjct  377   LRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIAT  436

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
             +++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLDM E 
Sbjct  437   DID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTIAHLIQGFNYRTPNDEPLDMKEG  493

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              GI + K+ P+E+++ PRL+P L+
Sbjct  494   AGITIRKVNPVELIIAPRLAPELY  517



>ref|XP_004236938.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=530

 Score =   499 bits (1285),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 241/525 (46%), Positives = 350/525 (67%), Gaps = 25/525 (5%)
 Frame = -1

Query  1664  CCLSSILGIAALVLLWFSWRKQSKR-LPPEAGGAWPIIGHLHHFRT--SVPLVKTLSEWA  1494
               + ++L +A L     S +K SK  LPPE  G WP+IGHL +F    + PL + LS+ A
Sbjct  15    AAIVALLTLAFLFYFILSTKKSSKLPLPPEIAGGWPVIGHLFYFNDGDNRPLARKLSDLA  74

Query  1493  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN  1314
             DKYGPVFT RLG+ R+LV+SS++AV++C+  ND + A RP    G+Y+GY+ A+   +  
Sbjct  75    DKYGPVFTFRLGLHRMLVISSYDAVKECYTKNDAVFANRPACLYGEYIGYNNAILFLANY  134

Query  1313  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW  1134
              SYWR +RKL+++E+LS+ RLEKLKHV + +++  IK L + I    N+     +N++ W
Sbjct  135   GSYWRNIRKLIIQEVLSNSRLEKLKHVKIEKIRNEIKNLNSRIQ---NSEVKSVINLTDW  191

Query  1133  FGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR  954
                +   LI++++AG+ YE   DG  +EE +R ++ F + + L  EFV  DA FP+  F+
Sbjct  192   LEKMNFGLIVKMIAGKNYESGGDG--DEEVERFRETFKKFLVLSMEFVLWDA-FPIRLFK  248

Query  953   WLDYEGHVKTMKRAAKDVDAILQDWVDAR-RKERRSNEDQK----FIDVMLS-MIDDQFT  792
             W+D++GHVK MK   KD+D+I Q W+D   ++    NED+K    FIDVMLS M D++  
Sbjct  249   WIDFQGHVKLMKETFKDIDSISQRWLDEHVKRNTEVNEDEKYERDFIDVMLSKMSDERLH  308

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
             QG+S  RD  IKA + SM+ DA++T   H+ W + +L+ +   LK+ Q+EIDT +GK RW
Sbjct  309   QGHS--RDNAIKATIFSMVMDAADTVPHHINWGMTLLINNQHVLKKAQEEIDTKVGKARW  366

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              +D+D+KNL YLQ +VKETLR+YP  P L PHE  E+C+V GY IPKGT+LY NV +L  
Sbjct  367   IDDNDIKNLVYLQAIVKETLRLYPPSPLLVPHENTEECVVSGYRIPKGTRLYANVMKLQL  426

Query  431   DPKIWPDPEKFLPERFMT---NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             DPK+WP+PE+F P+RF++   N  G+      Y+F+PFG GRRSCPG  YA Q+  + + 
Sbjct  427   DPKVWPNPEQFNPDRFLSTDINFRGQ-----DYEFIPFGSGRRSCPGISYALQMEHLTIG  481

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              L QGFN+ T  NEPLD+ E +G+ +PK+ P+EV++TPRL+  L+
Sbjct  482   HLIQGFNYQTPSNEPLDLQEGIGMTMPKVNPVEVIITPRLATELY  526



>gb|AGD93125.1| CYP450 nicotine N-demethylase [Nicotiana tabacum]
Length=517

 Score =   498 bits (1283),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 243/506 (48%), Positives = 342/506 (68%), Gaps = 27/506 (5%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1437
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1436  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR  1257
             SS+EAV+DCF+TND + + RP    G YLGY+ A+   +    YWR+ RKLV++E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1256  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             RLEK KHV  + +Q +IK LYT I  D N+ +   +N++ W   L   LI++++AG+ YE
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI--DGNSST---INLTDWLEELNFGLIVKMIAGKNYE  201

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
                 G  +E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK MKR  KD+D
Sbjct  202   ---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTFKDID  257

Query  896   AILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             ++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V S++
Sbjct  258   SVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLV  316

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
              DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +VKE 
Sbjct  317   LDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEV  376

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT-  378
             LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L  DPK+W DP+ F PERF+  
Sbjct  377   LRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQCDPKLWSDPDTFDPERFIAI  436

Query  377   --NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMM  204
               +  G+      Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLDM 
Sbjct  437   DIDFRGQ-----YYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMK  491

Query  203   EDVGIILPKLTPLEVLVTPRLSPTLF  126
             E  GI + K+ P+E+++ PRL+P L+
Sbjct  492   EGAGITIRKVNPVELIIAPRLAPELY  517



>gb|AJD25203.1| cytochrome P450 CYP82V2 [Salvia miltiorrhiza]
Length=534

 Score =   499 bits (1285),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 237/494 (48%), Positives = 343/494 (69%), Gaps = 11/494 (2%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             PE  GAWPIIGHLH     +P+ + L   ADK GPVFT+RLG+ R +VVSS EAV+DCF 
Sbjct  44    PEPSGAWPIIGHLHLLGGKIPISRILGAMADKLGPVFTLRLGVHRTVVVSSREAVKDCFT  103

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
             TND++LA RP++ AG YLGY++A F FS +  YWR VRKLV+ E+L+ RRL+ L+ V  +
Sbjct  104   TNDRVLAKRPSSTAGIYLGYNHAGFGFS-HGPYWREVRKLVLAEVLTPRRLDSLRPVREA  162

Query  1223  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR--SDGTINE  1050
             EL  ++ EL+  +   +++    +V +S W   LTL+ IM ++AG+R   R   D    E
Sbjct  163   ELAASLGELHELVRGSDDDQER-EVAISEWLERLTLDTIMMMLAGKRCAERDGGDAAAEE  221

Query  1049  EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDA  870
             EA+ L+ +  Q MY+ G+FV  D+I P    RWLD +GH+K+MKR A ++  I + W+  
Sbjct  222   EAKSLRHIIKQFMYISGQFVVSDSI-PFPPLRWLDLQGHIKSMKRIADELSEICEGWIGE  280

Query  869   RRKERRSNE-----DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATH  705
               + RR ++     ++ FIDVMLS IDD+F + + ++R+T+IKA +L+++   S+T +TH
Sbjct  281   HVERRRIDDGGLGIERDFIDVMLSAIDDKFMR-FGHTRETIIKATLLNLILAGSDTTSTH  339

Query  704   LTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYL  525
             +TWIL++LL +  ++++ Q EID  +GK+RW ++SD+KNL YLQ VVKE LR++P GP  
Sbjct  340   MTWILSLLLNNTRAMQQTQAEIDDKVGKDRWVQESDIKNLVYLQAVVKEALRLFPPGPLA  399

Query  524   APHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQ  345
              PHEA+EDC V GYH+ +GT++ VNVW+LHRDP++W +P++F+PERF+T           
Sbjct  400   VPHEAMEDCRVAGYHVARGTRILVNVWKLHRDPRVWEEPDEFVPERFLTRHADVDFTGHH  459

Query  344   YQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPL  165
             ++F+PFG GRRSCPG  +ATQ+T + +ARL QGF F T  +EP+DM E +GI LPK T L
Sbjct  460   HEFIPFGSGRRSCPGITFATQVTHLTMARLIQGFEFRTPLDEPVDMTEGLGITLPKATLL  519

Query  164   EVLVTPRLSPTLFR  123
              VLV PRL+P +++
Sbjct  520   RVLVAPRLAPFMYQ  533



>gb|ABD39482.1| CYP82E4v12 [Nicotiana tabacum]
Length=517

 Score =   498 bits (1281),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 242/504 (48%), Positives = 345/504 (68%), Gaps = 23/504 (5%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1437
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1436  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR  1257
             SS+EAV+DCF+TND + + RP    G YLGY+ A+   +    YWR+ RKLV++E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1256  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             RLEK KHV  + +Q +IK LYT I  D N+ +   +N++ W   L   LI++++AG+ YE
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI--DGNSST---INLTDWLEELNFGLIVKMIAGKNYE  201

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
                 G  +E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK MKR  KD+D
Sbjct  202   ---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTFKDID  257

Query  896   AILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             ++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVI+A V S++
Sbjct  258   SVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIEATVFSLV  316

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
              DA++T A H+ W +A+L+ + ++L + Q+EIDT + K+RW E+SD+K+L YLQ +VKE 
Sbjct  317   LDAADTVALHINWGMALLINNQKALTKAQEEIDTKVCKDRWVEESDIKDLVYLQAIVKEV  376

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM-T  378
             LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PERF+ T
Sbjct  377   LRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIAT  436

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
             +++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLDM E 
Sbjct  437   DID---FRGQYYKYIPFGPGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEG  493

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              GI + K+ P+E+++ PRL+P L+
Sbjct  494   AGITIRKVNPVELIIAPRLAPELY  517



>ref|XP_002274740.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=518

 Score =   498 bits (1281),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 250/522 (48%), Positives = 346/522 (66%), Gaps = 16/522 (3%)
 Frame = -1

Query  1667  PCCLSSILGIAALVLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             P  L +I GI  LVLL+  WR      K   R  PE  GAWP +GHL   R   P+ +TL
Sbjct  4     PSQLVAISGILGLVLLYGVWRVMTLAGKSKGRSAPEPSGAWPFLGHLPLLRGQTPIFRTL  63

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
                ADK+GPVF IRLG+ R LVVSS EAV++CF TNDK+ A+RP++ AGK LGY+YA F 
Sbjct  64    GAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFASRPSSSAGKLLGYNYAGFG  123

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN  1146
             F+   + WR +RKL + EILS+RRL+ LKHV +SEL  +IK+LY+ +   ++     KV 
Sbjct  124   FAPYGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKDLYS-LGKGSDWVHPVKVV  182

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             MS WF HL+ N++++++AG+RY + + G   EEA+R      + + L G FV  DAI  +
Sbjct  183   MSEWFQHLSFNIVLKMIAGKRY-FNTSGHGIEEARRAIATIQEFLSLSGAFVLSDAIPGV  241

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQFT  792
                 W+D +G++ +MKR AK+VD+++  WV+    R     +  Q FIDVMLS+++D  T
Sbjct  242   ---EWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEIRLNSEGSRMQDFIDVMLSVLED--T  296

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
               + +SR+TVIKA ++ ++   +ET AT  TW+L+ LL +  +LKR Q+E+D  +G+ RW
Sbjct  297   SMFGHSRETVIKATIVILIVGGTETVATTSTWLLSALLNNKHALKRAQEELDLKVGRGRW  356

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E+SD+ NL YLQ V+KETLR+Y   P   PHEA+EDC V GYHIPKGT+L+VN W+LHR
Sbjct  357   VEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPKGTRLFVNAWKLHR  416

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP +W DPE F PERF+T+        + ++ +PFG GRRSCPG   A ++  + + RL 
Sbjct  417   DPSVWSDPEDFQPERFLTSHADLDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIGRLL  476

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             QGF+ ST  N P+DM E + I L KLTPLEV++TPRL P+ F
Sbjct  477   QGFDLSTPLNAPVDMREGLSITLAKLTPLEVILTPRL-PSQF  517



>ref|XP_008235431.1| PREDICTED: cytochrome P450 82C4-like [Prunus mume]
Length=517

 Score =   497 bits (1279),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 245/511 (48%), Positives = 345/511 (68%), Gaps = 17/511 (3%)
 Frame = -1

Query  1652  SILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1485
             +I G+  LVL  +  R QS +    L P+  GA PIIGHLH  R   P+ KTL+  ADKY
Sbjct  9     AIAGLLVLVLYLWRLRIQSHKIKGMLAPQPSGALPIIGHLHKLRG--PIFKTLAAMADKY  66

Query  1484  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY  1305
             GP+FTI LG   +LV+S+++AV+ CF  ND + A RP +  GKYLGY+YA F FS    Y
Sbjct  67    GPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFATRPRSSHGKYLGYNYAGFGFSPYGPY  126

Query  1304  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP-KVNMSRWFG  1128
             WR +RK+V+ E+LSSRRL+ LKHV +SE+   IK L+     + +N   P KV +S W  
Sbjct  127   WRDMRKMVMVELLSSRRLQNLKHVQISEVDAFIKGLFLLCKTEEHNGLNPTKVVISDWIE  186

Query  1127  HLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL  948
             HLTLN+I +++AG+RY    D +   + QR  K+  + MY+ G  V+ D I    F  W+
Sbjct  187   HLTLNVITRMIAGKRY---FDSSYEGDEQRFGKIVKEFMYVSGNPVASDVI---GFPSWI  240

Query  947   DYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQFTQGYSYS  774
             D++G +K MKR  K++D+++  WV+    +K+  S +D  FIDVM+S+I+D  T GY+  
Sbjct  241   DFKGQIKAMKRIMKELDSVMGSWVEEHYAKKQTDSRDDHDFIDVMISVIEDNSTLGYT--  298

Query  773   RDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDV  594
             R+T+IKA  L+++   SET A +L WIL++LL +   LK  Q+E+D  +G++RW ED+D+
Sbjct  299   RETIIKATSLNLILAGSETTAINLIWILSLLLNNRHVLKLAQEELDLKVGRDRWIEDTDI  358

Query  593   KNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWP  414
             +NLPYLQ +VKETLR+YP GP   PHEA++DC V G+ IPKGT+L+VN+W+LHRDP +WP
Sbjct  359   ENLPYLQAMVKETLRLYPPGPLSVPHEAMQDCQVCGFDIPKGTRLFVNLWKLHRDPSLWP  418

Query  413   DPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS  234
             DPE F PERF+T   G  A  + ++F+PFG GRRSCPG  +A Q+T + + RL QGF  +
Sbjct  419   DPEVFCPERFLTTHVGIDASGKHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGFELA  478

Query  233   TVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
             T  + P+D+ E +GI +PK T LEV++TPRL
Sbjct  479   TPLDMPVDLTEGLGITMPKATSLEVILTPRL  509



>ref|XP_002274509.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=543

 Score =   495 bits (1274),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 247/519 (48%), Positives = 348/519 (67%), Gaps = 16/519 (3%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEW  1497
             L +I GI  LVLL+  WR      K   R  PE  GAWP +GHL   R   P+ +TL   
Sbjct  32    LVAISGILGLVLLYGVWRVMILAGKSKGRSAPEPFGAWPFLGHLPILRGQTPIFRTLGAM  91

Query  1496  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST  1317
             ADK+GPVF IRLG+ R LVVSS EAV++CF TNDK+ A+RP++ AGK LGY++A F F+ 
Sbjct  92    ADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFASRPSSSAGKILGYNHAGFGFAP  151

Query  1316  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR  1137
               + WR +RKL + EILS+RRL+ LKHV +SEL  +IK+LY+ +   ++     KV MS 
Sbjct  152   YGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKDLYS-LGKGSDWFHPVKVVMSE  210

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
             WF HL+ N++++++AG+RY + + G  NEEA+R      ++++L G FV  DAI  +   
Sbjct  211   WFQHLSFNIVLKMIAGKRY-FNTSGHGNEEARRAIATIQKLLFLTGAFVLSDAIPGV---  266

Query  956   RWLDYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQFTQGY  783
              W+D +G++ +MK+ AK+VD+++  WV+    R     N+ Q FIDVMLS+++D  T  +
Sbjct  267   EWMDSQGYLGSMKQVAKEVDSLVGGWVEEHEMRLNSEGNKRQDFIDVMLSVLED--TSMF  324

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              +SR+TVIKA ++ ++   ++T +T  TW+L+ LL +  +LK  Q+E+D  +G+ RW E+
Sbjct  325   GHSRETVIKATIMILIVGGTDTVSTTSTWLLSALLNNKHALKCAQEELDLKVGRGRWVEE  384

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             SD+ NL YLQ V+KETLR+Y   P  APHEA+EDC V GYHIPKGT+L+VN W+LHRDP 
Sbjct  385   SDIPNLLYLQAVIKETLRLYTATPLSAPHEAMEDCHVAGYHIPKGTRLFVNAWKLHRDPS  444

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             +W DPE F PERF+T         + ++ +PFG GRRSCPG   A ++  + + RL QGF
Sbjct  445   VWSDPEDFQPERFLTTHADLDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIGRLLQGF  504

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + ST  N P+DM E + I L KLTPLEV++TPRL P+ F
Sbjct  505   DLSTPLNAPVDMREGLSITLAKLTPLEVMLTPRL-PSQF  542



>ref|XP_007201695.1| hypothetical protein PRUPE_ppa004301mg [Prunus persica]
 gb|EMJ02894.1| hypothetical protein PRUPE_ppa004301mg [Prunus persica]
Length=517

 Score =   493 bits (1270),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 249/517 (48%), Positives = 346/517 (67%), Gaps = 20/517 (4%)
 Frame = -1

Query  1652  SILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1485
             +I G+  LVL  +  R QS +    L P+  GA PIIGHLH  R   P+ KTL+  ADKY
Sbjct  9     AIAGLLVLVLYLWRLRIQSHKIKGMLAPQPSGALPIIGHLHKLRG--PIFKTLAAMADKY  66

Query  1484  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY  1305
             GP+FTI LG   +LV+S+++AV+ CF  ND + A R  +  GKYLGY+YA F FS   +Y
Sbjct  67    GPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFATRSRSTVGKYLGYNYAGFGFSPYGTY  126

Query  1304  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP-KVNMSRWFG  1128
             WR +RK+V+ E+LSSRRLE LK V +SE+   IK L+     + +N   P KV +S W  
Sbjct  127   WRDMRKMVMVELLSSRRLETLKRVQISEVDAFIKGLFLLCKTEGHNGLNPTKVVISDWIE  186

Query  1127  HLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI-FPLWFFRW  951
             HLTLN+I +++AG+RY   SD     + QR  K+  + MY+ G  V+ D I FP     W
Sbjct  187   HLTLNVITRMIAGKRYFDSSD---EGDEQRFGKILKEFMYVSGNPVAADVIGFP----SW  239

Query  950   LDYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQFTQGYSY  777
             +D++G VK MKR  K++D+++  WV+    +KE  S ++  FIDVM+S+I+D  T GY+ 
Sbjct  240   IDFKGQVKAMKRIMKELDSVMGSWVEEHYAKKETNSRDEHDFIDVMISVIEDNSTLGYT-  298

Query  776   SRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSD  597
              R+T+IKA  L+++   SET A +L WIL++LL +   LK  Q+E+D  +G++RW ED+D
Sbjct  299   -RETIIKATSLNLILAGSETTAINLIWILSLLLNNRHVLKLAQEELDLKVGRDRWIEDTD  357

Query  596   VKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW  417
             ++NLPYLQ +VKETLR+YP  P   PHEA++DC V G+HI KGT L+VN+W+LHRDP +W
Sbjct  358   IENLPYLQAIVKETLRLYPPAPLSVPHEAMQDCQVCGFHIQKGTLLFVNLWKLHRDPSLW  417

Query  416   PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF  237
             PDPE F PERF+T   G  A  + ++F+PFG GRRSCPG  +A Q+T + + RL QGF  
Sbjct  418   PDPEVFCPERFLTTHVGIDASGQHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGFEL  477

Query  236   STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +T  + P+D+ E VGI +PK T LEV++TPRL P +F
Sbjct  478   ATPMDMPVDLTEGVGITMPKSTSLEVILTPRL-PLVF  513



>gb|ABD39485.1| CYP82E2v4 [Nicotiana tabacum]
Length=517

 Score =   490 bits (1262),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 239/526 (45%), Positives = 347/526 (66%), Gaps = 28/526 (5%)
 Frame = -1

Query  1658  LSSILGIAALV-LLWFSWRKQSKRLP----PEAGGAWPIIGHLHHFRTSV---PLVKTLS  1503
             + + +G+     LL+F W K+S++LP    P+  G WP+IGHL HF       PL + L 
Sbjct  5     IEAFVGLVTFTFLLYFLWTKKSQKLPKPLLPKIPGGWPVIGHLFHFNNDGDDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYGPVFT RLG+  +LVVSS+EA++DCF+TND + + RP    G+YLGY+  +   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +    YWR+ RKLV++E+LS+ RLEK K V  + +QT+IK LYT I     N ++  +N+
Sbjct  125   ANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTSIKNLYTRI-----NGNSSTINL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R K  F   M L  EFV  DA FP+ 
Sbjct  180   TDWLEELDFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMVLSMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDD  801
              F+W+D++GH+K MKR  KD+D++ Q+W++    +R   E      +Q FIDV+LS +  
Sbjct  236   LFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREKMEVGAEGNEQDFIDVVLSKLSK  295

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             ++     YSRDTVIKA V S++ DA++T A H+ W + +L+ +  +L + Q+EIDT +GK
Sbjct  296   EYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMTLLINNQNALMKAQEEIDTKVGK  354

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
              RW E+SD+K+L YLQ +VK+ LR+YP GP L PHE V+DC+V GYHIPKGT+L+ NV +
Sbjct  355   YRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHEYVKDCVVSGYHIPKGTRLFANVMK  414

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             L RDPK+  +P+KF PERF+    G+   +   Y+F+PFG GRRSCPG  YA Q+  + +
Sbjct  415   LQRDPKLLSNPDKFDPERFIA---GDIDFRGHHYEFIPFGSGRRSCPGMTYALQVEHLTM  471

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             A L QGFN+ T  +E LDM E  GI + K+ P+E+++TPRL+P L+
Sbjct  472   AHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPRLAPELY  517



>ref|XP_011101555.1| PREDICTED: cytochrome P450 CYP82D47-like [Sesamum indicum]
Length=519

 Score =   489 bits (1259),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 241/520 (46%), Positives = 340/520 (65%), Gaps = 18/520 (3%)
 Frame = -1

Query  1664  CCLSSILGIAALVL-LWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADK  1488
               LS++L I  L+  LW  + ++  + PP+  GAWPIIGHLH     + +  TL+E ADK
Sbjct  10    ATLSALLFIIVLLYNLWRRYPRKGAQSPPQPSGAWPIIGHLHLLDPELNIAHTLAELADK  69

Query  1487  YGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNS  1308
             YGPVFT+  G  R +VVSS EAV +CF  NDK  A RP T AG++L YD+A F FS N  
Sbjct  70    YGPVFTLWFGAQRAVVVSSREAVFECFTRNDKSFANRPITSAGEHLVYDHASFGFS-NGP  128

Query  1307  YWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELY--TFISMDNNNPSAPKVNMSRW  1134
             YWR +RKLV  E+LS+RRLE ++++ V+E+ T+I ELY  T        P   KV MS W
Sbjct  129   YWREMRKLVSSEVLSARRLEAMRNLRVTEIATSIGELYLETTTKTRGQQPLPSKVVMSSW  188

Query  1133  FGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR  954
                +TLN+I++ +AG+RY     G    E +  +K+  +   L GEFV  D I P+ F R
Sbjct  189   VEKMTLNIIVKTIAGKRY-----GKGAAEVESFRKLIREFTVLSGEFVPSDVI-PIPFLR  242

Query  953   WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE----DQKFIDVMLSMIDDQFTQG  786
             W+D +GH+K+MKR +K++D I++ WV+   K R   E    +Q FID MLS IDD+F   
Sbjct  243   WIDPKGHIKSMKRVSKELDVIIEKWVEEHMKRRGKGEGCTEEQDFIDAMLSTIDDKF---  299

Query  785   YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAE  606
              +  + T+IKA VL+++    +T + HLTW+L++L+ +  ++   + EID  +G +RW +
Sbjct  300   -AIPKLTIIKATVLNVILGGFDTTSVHLTWVLSLLVNNKHAMNLARQEIDDKVGNQRWVQ  358

Query  605   DSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDP  426
             +SD+ NLPYLQ ++KE+LR+YP  P   PH+AVEDC +  Y IPKGT L+VN+W+LH D 
Sbjct  359   ESDINNLPYLQAIIKESLRLYPPLPLSIPHQAVEDCHLSNYLIPKGTLLFVNIWKLHHDA  418

Query  425   KIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQG  246
             + WP+P +F+PERF+T         +QY+++PFG GRRSCPG  +A Q+T + VARL QG
Sbjct  419   RFWPEPNRFMPERFLTGHTQVDVMGQQYEYIPFGTGRRSCPGTTFAMQVTSLTVARLIQG  478

Query  245   FNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             F+F+T  NE +DM E +GI +P+  PLEVLVTPRL   L+
Sbjct  479   FDFATEGNEAVDMAEGIGITMPRKNPLEVLVTPRLPSQLY  518



>ref|XP_009758062.1| PREDICTED: cytochrome P450 82C4-like, partial [Nicotiana sylvestris]
Length=485

 Score =   488 bits (1255),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 234/498 (47%), Positives = 333/498 (67%), Gaps = 23/498 (5%)
 Frame = -1

Query  1589  LPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAV  1419
             LP +  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVVSS+EA+
Sbjct  1     LPTKIPGGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAI  60

Query  1418  RDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLK  1239
             +DCF+TND + + RP    G+YLGY+  +   +    YWR+ RKLV++E+LS+ RLEK K
Sbjct  61    KDCFSTNDAIFSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFK  120

Query  1238  HVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGT  1059
              V  + +QT+IK LYT I     N ++  +N+S W   L   LI++++AG+ YE    G 
Sbjct  121   QVRFTRIQTSIKNLYTRI-----NGNSSTINLSDWLEELNFGLIVKMIAGKNYE---SGK  172

Query  1058  INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW  879
              +E+ +R K  F   M L  EFV  DA FP+  F+W+D++GH+K MKR  KD+D++ Q+W
Sbjct  173   GDEQVERFKNAFKDFMVLSMEFVLWDA-FPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNW  231

Query  878   VDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET  717
             ++    +R   E      +Q FIDV+LS +  ++     YSRDTVIKA V S++ DA++T
Sbjct  232   LEEHINKREKMEVGAEGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSLVLDAADT  290

Query  716   FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ  537
              A H+ W + +L+ +  +L + Q+EIDT +GK+RW E+SD+K+L YLQ +VKE LR+YP 
Sbjct  291   VALHINWGMTLLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPP  350

Query  536   GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA  357
             GP L PHE V+DC+V GYHIPKGT+L+ NV +L RDPK+W +P+KF PERF+    G+  
Sbjct  351   GPLLVPHENVKDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFIA---GDID  407

Query  356   -QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILP  180
              +   Y+F+PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +E LDM E  GI + 
Sbjct  408   FRGHHYEFIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIR  467

Query  179   KLTPLEVLVTPRLSPTLF  126
             K+ P+E+++TPRL+P L+
Sbjct  468   KVNPVELIITPRLAPELY  485



>gb|ABR57311.1| cytochrome P450 monooxygenase [Nicotiana sylvestris]
Length=517

 Score =   488 bits (1257),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 240/526 (46%), Positives = 347/526 (66%), Gaps = 28/526 (5%)
 Frame = -1

Query  1658  LSSILGIAALV-LLWFSWRKQSKRLPPEAG----GAWPIIGHLHHFRTSV---PLVKTLS  1503
             + + +G+     LL+F W K+S++LP        G WP+IGHL HF       PL + L 
Sbjct  5     IEAFVGLVTFTFLLYFLWTKKSQKLPKPLPPKIPGGWPVIGHLFHFNNDGDDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYGPVFT RLG+  +LVVSS+EA++DCF+TND + + RP    G+YLGY+  +   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +    YWR+ RKLV++E+LS+ RLEK K V  + +QT+IK LYT I     N ++  +N+
Sbjct  125   ANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTSIKNLYTRI-----NGNSSTINL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R K  F   M L  EFV  DA FP+ 
Sbjct  180   TDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMVLSMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDD  801
              F+W+D++GH+K MKR  KD+D++ Q+W++    +R   E      +Q FIDV+LS +  
Sbjct  236   LFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREKMEVGAEGNEQDFIDVVLSKLSK  295

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             ++     YSRDTVIKA V S++ DA++T A H+ W + +L+ +  +L + Q+EIDT +GK
Sbjct  296   EYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMTLLINNQNALMKAQEEIDTKVGK  354

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             +RW E+SD+K+L YLQ +VKE LR+YP GP L PHE V+DC+V GYHIPKGT+L+ NV +
Sbjct  355   DRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVKDCVVSGYHIPKGTRLFANVMK  414

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             L RDPK+W +P+KF PERF+    G+   +   Y+F+PFG GRRSCPG  YA Q+  + +
Sbjct  415   LQRDPKLWSNPDKFDPERFIA---GDIDFRGHHYEFIPFGSGRRSCPGMTYALQVEHLTM  471

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             A L QGFN+ T  +E LDM E  GI + K+ P+E+++TPRL+P L+
Sbjct  472   AHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPRLAPELY  517



>ref|XP_003635525.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=518

 Score =   488 bits (1256),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 246/519 (47%), Positives = 339/519 (65%), Gaps = 15/519 (3%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFSWRKQS------KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEW  1497
             L +I G   L+LL+  WR +S       R  PE  GAWP +GHLH      P+ +TL+  
Sbjct  7     LLAIAGFMGLLLLYNVWRVRSFAHGGKGRSAPEPSGAWPFVGHLHLLSGPTPIFRTLAAM  66

Query  1496  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST  1317
             ADK+GPVF IRLG+ R LVVSS EAV++C  TNDK  A+RP++ AGK LGY+YA F F+ 
Sbjct  67    ADKHGPVFMIRLGMHRALVVSSHEAVKECLTTNDKAFASRPSSSAGKLLGYNYAGFGFAP  126

Query  1316  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR  1137
                 WR +RKL V E+LS+R L +LKHV VSEL   I++LY+ +  + N  +  KV MS 
Sbjct  127   YGPLWREMRKLSVTELLSNRPLNELKHVLVSELDVCIRDLYS-LGKETNWVNPIKVAMSE  185

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
             W   LT N+++++VAG+RY + +    NEEA+    V  + ++L G FV+ DAI    F 
Sbjct  186   WLEQLTFNVVLRMVAGKRY-FGNGVHGNEEARHAIAVIKKFIFLTGVFVASDAIP---FV  241

Query  956   RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNED--QKFIDVMLSMIDDQFTQGY  783
              W+D +GH+ +MKR A+ +D  ++ WV+    + +S+    Q FIDVMLS++ D     +
Sbjct  242   EWMDLQGHLGSMKRVAEQLDPFVEGWVEEHVTKLKSDPSSRQDFIDVMLSVLKDNSM--F  299

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              + R+TVIKA V++++   SET +    WIL+ LL +  +LKR Q+E+D  +G+ RW E+
Sbjct  300   GHRRETVIKATVMTLIVGGSETTSIASIWILSALLNNRHTLKRAQEELDLKVGRGRWVEE  359

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             SD++NL YLQ  VKETLR+YP GP L PHEA++DC V GYHIPKGT+L VNVW+LHRDP 
Sbjct  360   SDIQNLIYLQAAVKETLRLYPPGPLLVPHEAIQDCSVCGYHIPKGTRLLVNVWKLHRDPD  419

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
              W DPE+F PERF+T         +  + +PF  GRRSCPG   A QI  + VARL QG+
Sbjct  420   AWSDPEEFQPERFLTTHANLNVFGQHSELIPFSSGRRSCPGIALALQILHLTVARLLQGY  479

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + +T  N P+DM E +G+ +PK TPLEV++TPRL   L+
Sbjct  480   DMTTPLNAPVDMTEGIGLAMPKETPLEVMLTPRLPSLLY  518



>gb|KDP26345.1| hypothetical protein JCGZ_17503 [Jatropha curcas]
Length=532

 Score =   488 bits (1255),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 247/540 (46%), Positives = 357/540 (66%), Gaps = 32/540 (6%)
 Frame = -1

Query  1679  MDAVPCCLSSILGIAALVLLW--FSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSV  1524
             MD     L+  + ++ +++L+    WR      K    L PE  GA PI+GHLH      
Sbjct  1     MDISSHLLAISVAVSVILVLYKYNQWRLRDHSHKNKGLLAPEPFGALPILGHLHLLGAEK  60

Query  1523  PLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGY  1344
              L +TL+  ADKYGP+FTI LG+ R + VSS EA+++CF  NDK+LA+RP +  GKYL Y
Sbjct  61    TLARTLALLADKYGPIFTIWLGVHRTVEVSSHEAIKECFTANDKVLASRPKSSHGKYLSY  120

Query  1343  DYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNP  1164
             +YA F F++   YWR +RKLVV ++LSS RL+ LKHV VSE+ T IK+LY  +S+  N P
Sbjct  121   NYAAFGFASYGPYWRDMRKLVVIQLLSSHRLKSLKHVQVSEVNTLIKDLY-LLSL--NQP  177

Query  1163  SAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSG  984
             S+ K+ +S +F HLTLN+I +++AG+RY    +G  +EE  R+ K+  + MY+ G FV  
Sbjct  178   SSNKIVISEFFEHLTLNMITRMIAGKRY-CNCNGGNDEEGIRIGKLMKEFMYVSGVFVPS  236

Query  983   DAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARR----KERRS---------NE  843
             D I  LW   W+++ G VK MKR +K++D++LQ W+D  +     +RR          N 
Sbjct  237   DVIPFLW---WMNFLGPVKAMKRLSKELDSLLQTWIDEHKLKGINKRRDGGGGGGDFKNI  293

Query  842   DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPES  663
             ++ FIDVMLS+++D F   + +SRD +IK  V++++   ++T +  LTWIL+ LL +  +
Sbjct  294   EEDFIDVMLSILEDNF---FGHSRDDIIKGTVMTLIIAGADTTSITLTWILSNLLNNRHA  350

Query  662   LKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGY  483
             L+  Q E+D  +GKER  +DSD++NL YLQ VVKETLR+YP GP   PHEA+ DC + GY
Sbjct  351   LELAQQELDLKVGKERCVQDSDIENLVYLQAVVKETLRLYPPGPLAVPHEAINDCYISGY  410

Query  482   HIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSC  306
             +IPKGT++  N+W+LHRDP IW +P+KFLPERF+ N +       + ++++PFG GRRSC
Sbjct  411   YIPKGTRVLANLWKLHRDPNIWSNPDKFLPERFLANRDNNVDFSGQNFEYLPFGSGRRSC  470

Query  305   PGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             PG  +A Q   + +ARL Q F+ +T+ N+P+DM E +GI LPK TPLE+ +TPRLS  L+
Sbjct  471   PGLNFAIQAIHLTLARLLQAFSLTTLFNQPVDMTEGLGITLPKATPLEIQITPRLSSELY  530



>emb|CBI36491.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   488 bits (1255),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 244/511 (48%), Positives = 337/511 (66%), Gaps = 15/511 (3%)
 Frame = -1

Query  1667  PCCLSSILGIAALVLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             P  L +I GI  LVLL+  WR      K   R  PE  GAWP +GHL   R   P+ +TL
Sbjct  30    PSQLVAISGILGLVLLYGVWRVMTLAGKSKGRSAPEPSGAWPFLGHLPLLRGQTPIFRTL  89

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
                ADK+GPVF IRLG+ R LVVSS EAV++CF TNDK+ A+RP++ AGK LGY+YA F 
Sbjct  90    GAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFASRPSSSAGKLLGYNYAGFG  149

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN  1146
             F+   + WR +RKL + EILS+RRL+ LKHV +SEL  +IK+LY+ +   ++     KV 
Sbjct  150   FAPYGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKDLYS-LGKGSDWVHPVKVV  208

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             MS WF HL+ N++++++AG+RY + + G   EEA+R      + + L G FV  DAI  +
Sbjct  209   MSEWFQHLSFNIVLKMIAGKRY-FNTSGHGIEEARRAIATIQEFLSLSGAFVLSDAIPGV  267

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQFT  792
                 W+D +G++ +MKR AK+VD+++  WV+    R     +  Q FIDVMLS+++D  T
Sbjct  268   ---EWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEIRLNSEGSRMQDFIDVMLSVLED--T  322

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
               + +SR+TVIKA ++ ++   +ET AT  TW+L+ LL +  +LKR Q+E+D  +G+ RW
Sbjct  323   SMFGHSRETVIKATIVILIVGGTETVATTSTWLLSALLNNKHALKRAQEELDLKVGRGRW  382

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E+SD+ NL YLQ V+KETLR+Y   P   PHEA+EDC V GYHIPKGT+L+VN W+LHR
Sbjct  383   VEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPKGTRLFVNAWKLHR  442

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP +W DPE F PERF+T+        + ++ +PFG GRRSCPG   A ++  + + RL 
Sbjct  443   DPSVWSDPEDFQPERFLTSHADLDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIGRLL  502

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEV  159
             QGF+ ST  N P+DM E + I L KLTPLEV
Sbjct  503   QGFDLSTPLNAPVDMREGLSITLAKLTPLEV  533



>emb|CDP15065.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   484 bits (1247),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 229/487 (47%), Positives = 337/487 (69%), Gaps = 13/487 (3%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             PEA G WP IGHL     +VP+ + L   ADKYGPVF++RLG+ + LVVSSWEAV++CF 
Sbjct  39    PEAAGGWPFIGHLLQLSPNVPIARNLGAMADKYGPVFSLRLGMRQTLVVSSWEAVKECFT  98

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
             TNDK  + RP +   +Y+GY+YA   F+    YWR +RK+V+ E+LS+RRLE+LKHV +S
Sbjct  99    TNDKAFSYRPPSSFNEYVGYNYAAIGFAPYGPYWREIRKIVMLELLSNRRLERLKHVRIS  158

Query  1223  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEA  1044
             E++ NIK L+      +N+P A KVNM +WF  L LN++++ ++G RY     G+  +  
Sbjct  159   EIENNIKVLFDGWKSSSNDPPA-KVNMGKWFEDLFLNIMVRKISGTRYTDSEVGS--KRN  215

Query  1043  QRLKKVFSQVMYLWGEFVSGDAI-FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR  867
              + ++V  + ++  G+FV  D I FPL   +W+D +GH+K++KR +K++D+I+Q W+D  
Sbjct  216   AQFRRVVKEFVHFLGQFVVSDVIPFPL--LKWIDMQGHLKSIKRVSKELDSIIQIWIDEH  273

Query  866   RKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHL  702
              + R     + +E Q FID +LS+  D++   + +SR+TVIKA ++S++  A ET + HL
Sbjct  274   NERRMKISEQGDEQQDFIDALLSVTKDEYL--FGHSRETVIKATLMSLVIAAFETTSIHL  331

Query  701   TWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLA  522
             TW L++LL +   +++ Q+EID+N+GKERWAE+SD+ NL YLQ +VKE++R+YP  P   
Sbjct  332   TWTLSLLLNNKHVMRQAQEEIDSNVGKERWAEESDINNLVYLQAIVKESIRLYPPAPLSL  391

Query  521   PHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQY  342
             P +A+EDC V GY I  GTQL+VNVW+L RDP+IW +P++FLPERF+      + +N ++
Sbjct  392   PRQAMEDCNVSGYRISMGTQLFVNVWKLQRDPRIWSEPDQFLPERFLNGEVDFSGKNFEF  451

Query  341   QFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLE  162
              F PFG GRRSCPG   ATQ+T + +ARL QGF+ +T  + P+DM ED  I + K TPLE
Sbjct  452   SFTPFGSGRRSCPGIPLATQVTHLTLARLLQGFDLTTPSDLPVDMTEDTSISMGKATPLE  511

Query  161   VLVTPRL  141
             V++ PRL
Sbjct  512   VVILPRL  518



>gb|ABD39483.1| CYP82E2v2 [Nicotiana tabacum]
Length=517

 Score =   484 bits (1246),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 242/529 (46%), Positives = 346/529 (65%), Gaps = 31/529 (6%)
 Frame = -1

Query  1658  LSSILGIAALV----LLWFSWRKQSKRLPPEAG----GAWPIIGHLHHFRTSV---PLVK  1512
             LS I     LV    LL+F W K+S++LP        G WP+IGHL HF       PL +
Sbjct  2     LSPIEAFVGLVTFTFLLYFLWTKKSQKLPKPLPPKIPGGWPVIGHLFHFNNDGDDRPLAR  61

Query  1511  TLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAV  1332
              L + ADKYGPVFT RLG+  +LVVSS+EA++DCF+TND + + RP    G+YLGY+  +
Sbjct  62    KLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPALLYGEYLGYNNTM  121

Query  1331  FTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPK  1152
                +    YWR+ RKLV++E+LS+ RLEK K V  + +QT+IK LYT I     N ++  
Sbjct  122   LFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTSIKNLYTRI-----NGNSST  176

Query  1151  VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
             +N++ W   L   LI++++AG+ YE    G  +E+ +R K  F   M L  EFV  DA F
Sbjct  177   INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMVLSMEFVLWDA-F  232

Query  971   PLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLSM  810
             P+  F+W+D++GH+K MKR  KD+D++ Q+W++    +R   E      +Q FIDV+LS 
Sbjct  233   PIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREKIEVGAEGNEQDFIDVVLSK  292

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
             +  ++     YSRDTVIKA V S++ DA++T A H+ W + +L+ +  +L + Q+EIDT 
Sbjct  293   LSKEYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMTLLINNQNALMKAQEEIDTK  351

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +GK+RW E+SD+K+L YLQ +VK+ LR+YP GP L PHE V+DC+V GYHIPKGT+L+ N
Sbjct  352   VGKDRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHENVKDCVVSGYHIPKGTRLFAN  411

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             V +L RDPK+  +P+KF PERF+    G+   +   Y+F+PFG GRRSCPG  YA Q+  
Sbjct  412   VMKLQRDPKLLSNPDKFDPERFIA---GDIDFRGHHYEFIPFGSGRRSCPGMTYALQVEH  468

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + +A L QGFN+ T  +E LDM E  GI + K+ P+E+++TPRL+P L+
Sbjct  469   LTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPRLAPELY  517



>ref|XP_006375022.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
 gb|ERP52819.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
Length=519

 Score =   484 bits (1246),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 235/492 (48%), Positives = 328/492 (67%), Gaps = 11/492 (2%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCF  1407
             PE  GAWPIIGHLH       L+ +TL   ADK+G  FTIRLG  R  VVSSWE V++CF
Sbjct  31    PEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKHGSAFTIRLGSRRAFVVSSWEVVKECF  90

Query  1406  ATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWV  1227
               N K LA+RPTT A K++GY+YAVF F+  +S+WR +RK+   E+LS+RRLE LKHV  
Sbjct  91    TINAKALASRPTTVAAKHMGYNYAVFGFAPYSSFWREMRKIATLELLSNRRLEMLKHVRA  150

Query  1226  SELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEE  1047
             SE+   I+ELY   S  NN+ S   V + +W   LTLN+++++VAG+RY   +  + + E
Sbjct  151   SEVDIGIRELYN--SWANNSSSPVVVELKQWLEDLTLNVVVRMVAGKRYFGSAAASDDGE  208

Query  1046  AQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR  867
             A+R +K  +Q   L G FV  DA   L F  WLD +GH + MK  AK++DAIL+ W+D  
Sbjct  209   ARRCQKAINQFFRLIGIFVVSDA---LPFLGWLDLQGHERAMKNTAKELDAILEGWLDEH  265

Query  866   RKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHL  702
             R+ R     +   +Q FIDVMLS+ ++     + Y  +T IK+  L+++   S+T A  L
Sbjct  266   RQRRVSAGIKDEGEQDFIDVMLSLKEEGQLSNFQYDANTSIKSTCLALILGGSDTTAGTL  325

Query  701   TWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLA  522
             TW +++LL +   LK+ Q+E+D ++GKER  EDSDVKNL YLQ ++KETLR+YP GP L 
Sbjct  326   TWAISLLLNNRHMLKKAQEELDLHVGKERQVEDSDVKNLVYLQAIIKETLRLYPAGPLLG  385

Query  521   PHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQY  342
             P EA+EDC V GYH+P GT+L VNVW++ RDP++W +P  FLPERF+T+      + +Q+
Sbjct  386   PREAMEDCKVAGYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSHGDVDVRGQQF  445

Query  341   QFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLE  162
             + +PFG GRRSCPG  +A Q+  + +ARL   F  +T  ++P+D+ E  G+ +PK TPLE
Sbjct  446   ELIPFGSGRRSCPGVSFALQVLHLTLARLLHSFELATPMDQPVDLTESSGLTIPKATPLE  505

Query  161   VLVTPRLSPTLF  126
             V++TPRL P L+
Sbjct  506   VILTPRLPPKLY  517



>ref|XP_011030904.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=526

 Score =   484 bits (1245),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 234/492 (48%), Positives = 329/492 (67%), Gaps = 11/492 (2%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCF  1407
             PE  GAWPIIGHLH       L+ +TL   ADK+G  FTIRLG  R  VVSSWE V++CF
Sbjct  38    PEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKHGSAFTIRLGSRRAFVVSSWEVVKECF  97

Query  1406  ATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWV  1227
               NDK LA+RPTT A K++GY+YAVF F+  +++WR +RK+   E+LS+RRLE LKHV  
Sbjct  98    TINDKALASRPTTVAAKHMGYNYAVFGFAPYSAFWREMRKIATIELLSNRRLEMLKHVRA  157

Query  1226  SELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEE  1047
             SE+   I+ELY   S  NN+ S   V + +W   LTLN+++++VAG+RY   +  + + E
Sbjct  158   SEVDIGIRELYN--SWANNSSSPVVVELKQWLEDLTLNVVVRMVAGKRYFGSAAASDDGE  215

Query  1046  AQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR  867
             A+R +K  +Q   L G F+  DA   L F  WLD +GH + MK  AK++DAIL+ W+D  
Sbjct  216   ARRCQKAINQFFRLIGIFLVSDA---LPFLGWLDLQGHERAMKNTAKELDAILEGWLDEH  272

Query  866   RKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHL  702
             R+ R     +  ++Q FIDVMLS+ ++     + Y  +T IK+  L+++   S+T A  L
Sbjct  273   RQRRVSAGIKDEDEQDFIDVMLSLKEEGQLSNFQYDANTSIKSTCLALILGGSDTTAGTL  332

Query  701   TWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLA  522
             TW +++LL +   LK+ Q+E+D  +GKER  EDSDVKNL YLQ ++KETLR+YP GP L 
Sbjct  333   TWAISLLLNNRHMLKKAQEELDLLVGKERQVEDSDVKNLVYLQAIIKETLRLYPAGPLLG  392

Query  521   PHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQY  342
             P EA+EDC V GYH+P GT+L VNVW++ RDP++W +P  FLPERF+T+      + +Q+
Sbjct  393   PREAMEDCKVAGYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSHGDVDVRGQQF  452

Query  341   QFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLE  162
             + +PFG GRRSCPG  +A Q+  + +ARL   F  +T  ++P+D+ E  G+ +PK TPLE
Sbjct  453   ELIPFGSGRRSCPGVSFALQVLHLTLARLLHSFQLATPMDQPVDLTESSGLTIPKATPLE  512

Query  161   VLVTPRLSPTLF  126
             V++TPRL P L+
Sbjct  513   VILTPRLPPKLY  524



>gb|ABA07806.2| cytochrome P450 monooxygenase CYP82E2 [Nicotiana tabacum]
Length=517

 Score =   483 bits (1244),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 238/526 (45%), Positives = 346/526 (66%), Gaps = 28/526 (5%)
 Frame = -1

Query  1658  LSSILGIAALV-LLWFSWRKQSKRLPPEAG----GAWPIIGHLHHFRTSV---PLVKTLS  1503
             + + +G+     LL+F W K+S++LP        G WP+IGHL HF       PL + L 
Sbjct  5     IEAFVGLVTFTFLLYFLWTKKSQKLPKPLPPKIPGGWPVIGHLFHFNNDGDDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYGPVFT RLG+  +LVVSS+EA++DCF+TND + + RP    G+YLGY+  +   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +    YWR+ RKLV++E+LS+ RLEK K V  + +QT+IK LYT I     N ++  +N+
Sbjct  125   ANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTSIKNLYTRI-----NGNSSTINL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R K  F   M L  EFV  DA FP+ 
Sbjct  180   TDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMVLSMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDD  801
              F+W+D++GH+K MKR  KD+D++ Q+W++    +R   E      +Q FIDV+LS +  
Sbjct  236   LFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREKMEVGAEGNEQDFIDVVLSKLSK  295

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             ++     YSRDTVIKA V S++ DA++T A H+ W + +L+ +  +L + Q+EIDT +GK
Sbjct  296   EYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMTLLINNQNALMKAQEEIDTKVGK  354

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             +RW E+SD+K+L YLQ +VK+ LR+YP GP L PHE V+DC+V GYHIPKGT+L+ NV +
Sbjct  355   DRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHENVKDCVVSGYHIPKGTRLFANVMK  414

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             L RDPK+  +P+KF PERF+    G+   +   Y+F+PFG GRRSCPG  YA Q+  + +
Sbjct  415   LQRDPKLLSNPDKFDPERFIA---GDIDFRGHHYEFIPFGSGRRSCPGMTYALQVEHLTM  471

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             A L QGFN+ T  +E LDM E  GI + K+ P+E+++TPRL+P L+
Sbjct  472   AHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPRLAPELY  517



>emb|CAN61061.1| hypothetical protein VITISV_018742 [Vitis vinifera]
Length=542

 Score =   484 bits (1246),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 250/546 (46%), Positives = 346/546 (63%), Gaps = 40/546 (7%)
 Frame = -1

Query  1667  PCCLSSILGIAALVLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             P  L +I GI  LVLL+  WR      K   R  PE  GAWP +GHL   R   P+ +TL
Sbjct  4     PSQLVAISGILGLVLLYGVWRVMTLAGKSKGRSAPEPSGAWPFLGHLPLLRGQTPIFRTL  63

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
                ADK+GPVF IRLG+ R LVVSS EAV++CF TNDK+ A+RP++ AGK LGY+YA F 
Sbjct  64    GAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFASRPSSSAGKLLGYNYAGFG  123

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN  1146
             F+   + WR +RKL + EILS+RRL+ LKHV +SEL  +IK+LY+ +   ++     KV 
Sbjct  124   FAPYGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKDLYS-LGKGSDWVHPVKVV  182

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             MS WF HL+ N++++++AG+RY + + G   EEA+R      + + L G FV  DAI  +
Sbjct  183   MSEWFQHLSFNIVLKMIAGKRY-FNTSGHGIEEARRAIATIQEFLSLSGAFVLSDAIPGV  241

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQFT  792
                 W+D +G++ +MKR AK+VD+++  WV+    R     +  Q FIDVMLS+++D  T
Sbjct  242   ---EWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEIRLNSEGSRMQDFIDVMLSVLED--T  296

Query  791   QGYSYSRDTVIKAIVLS------------------------MLQDASETFATHLTWILAV  684
               + +SR+TVIKA ++                         ++   +ET AT  TW+L+ 
Sbjct  297   SMFGHSRETVIKATIVVRSSPIHELLLLSWKSVFLQPTLKILIVGGTETVATTSTWLLSA  356

Query  683   LLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVE  504
             LL +  +LKR Q+E+D  +G+ RW E+SD+ NL YLQ V+KETLR+Y   P   PHEA+E
Sbjct  357   LLNNKHALKRAQEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAME  416

Query  503   DCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFG  324
             DC V GYHIPKGT+L+VN W+LHRDP +W DPE F PERF+T+        + ++ +PFG
Sbjct  417   DCHVAGYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPERFLTSHADFDVLGQHFELIPFG  476

Query  323   LGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPR  144
              GRRSCPG   A ++  + + RL QGF+ ST  N P+DM E + I L KLTPLEV++TPR
Sbjct  477   SGRRSCPGITMALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVILTPR  536

Query  143   LSPTLF  126
             L P+ F
Sbjct  537   L-PSQF  541



>ref|XP_002264790.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   482 bits (1241),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 239/522 (46%), Positives = 337/522 (65%), Gaps = 19/522 (4%)
 Frame = -1

Query  1655  SSILGIAALVL---LWFS-WR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             S  L IA L+L   LW++ WR      K     PPE  GAWP +GHLH  +  VP+ +TL
Sbjct  5     SHFLAIAGLILGLVLWYNHWRGKTLTHKSKGMSPPEPSGAWPFVGHLHLLQGKVPVFRTL  64

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
                ADK GPVF IRLG+ R LVVS+ EA ++CF TNDK+ A+RP++ A K LGY+Y  F 
Sbjct  65    GAMADKVGPVFVIRLGMYRALVVSNHEAAKECFTTNDKVFASRPSSSASKILGYNYVAFG  124

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN  1146
              +     WR +RKL + EILS+RRL  L HV VSEL   IK+LY  +  D N  +  KV 
Sbjct  125   LAPYGPLWREIRKLCMLEILSTRRLSDLMHVHVSELHAGIKDLY-ILGKDYNWVNPKKVV  183

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             +S WF HL  N+++++VAG+RY + +     EEA     V  +++ L G FV+ D I   
Sbjct  184   ISEWFEHLNFNVVLRMVAGKRY-FNNVVHGGEEAGSATAVIKKLVPLAGAFVASDVIP--  240

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQFT  792
              F  W+D +GH+ +MK+ AK++D++L+ WV+    R    ++  Q FID+ML+ + D   
Sbjct  241   -FLEWVDLQGHLSSMKQVAKEMDSVLESWVEEHTGRLNSEASSRQDFIDIMLTKLKD--A  297

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
               + YSR+T+IKA V+ ++   S+T +   TW+L+ LL +   +K  Q+E+D  +G++RW
Sbjct  298   SLFGYSRETIIKATVMMLIVAGSDTTSITSTWLLSALLNNRHVMKHAQEELDLKVGRDRW  357

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E SD++NL YL+ +VKETLR+YP  P L PHEA+EDC V GYHIPKGT+L VN W+LHR
Sbjct  358   VEQSDIQNLVYLKAIVKETLRLYPAVPLLVPHEAMEDCHVGGYHIPKGTRLLVNAWKLHR  417

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP +W +PE+F PERF+T+        + ++ +PFG GRRSCPG   A Q+  + +A+L 
Sbjct  418   DPAVWSNPEEFQPERFLTSHATVDVLGQNFELIPFGSGRRSCPGINMALQMLHLTIAQLL  477

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             QGF+ +T  N P+DM E + I +PKLTPLEV++TPRL   L+
Sbjct  478   QGFDMATPSNSPVDMAEAISITMPKLTPLEVMLTPRLPAELY  519



>ref|XP_007136644.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
 gb|ESW08638.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
Length=528

 Score =   482 bits (1240),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 239/522 (46%), Positives = 337/522 (65%), Gaps = 22/522 (4%)
 Frame = -1

Query  1646  LGIAALVLLWFSW---------RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEW  1497
             + ++ LV LW ++         R  SK  P   G AWP+IGHLH       L+ +TL   
Sbjct  12    ISVSLLVFLWHAFLGKKRNKGGRNNSKEAPVPVG-AWPLIGHLHLLGGDDQLLYRTLGTM  70

Query  1496  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST  1317
             AD+YGP F I LG  R  VVSSWE  ++CF TNDK LA+RPTT A K++GY+YAVF F+ 
Sbjct  71    ADQYGPAFNIWLGTRRAFVVSSWEVAKECFTTNDKALASRPTTVAAKHMGYNYAVFGFAP  130

Query  1316  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSR  1137
              + +WR +RK+   E+LS+RRLE LKHV VSEL T IKELY     + + P    V ++R
Sbjct  131   YSPFWREMRKIATLELLSNRRLEMLKHVRVSELNTGIKELYNSWVQNRSQPVV--VELNR  188

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
             W   LTLN+++++VAG+RY   S    ++EA+R +K  +Q  +L G FV  DA   L F 
Sbjct  189   WLEDLTLNMVVRMVAGKRYFGASATCDDDEARRCQKAINQFFHLIGIFVVSDA---LPFL  245

Query  956   RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDVMLSMIDDQFT  792
             RW D +GH + MK+ AK++D+IL+ W+   R +R   E     +Q FIDVML +      
Sbjct  246   RWFDLQGHERAMKKTAKELDSILEGWLQEHRMQRVDGEVKVEGEQDFIDVMLDLQKTGHL  305

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
               + Y  DT IK+  L+++   S+T A  LTW +++LL + ++LK+ Q+E+D N+G ER 
Sbjct  306   SNFQYDSDTSIKSTCLAIILGGSDTSAGTLTWAISLLLNNRQALKKAQEELDLNVGMERQ  365

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E+SD++NL YLQ ++KETLR+YP GP L P EA EDC V GY +P GT+L VN+W++HR
Sbjct  366   VEESDIRNLAYLQAIIKETLRLYPAGPLLGPREAQEDCNVGGYDVPAGTRLVVNLWKIHR  425

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP++W +P  F PERF+T+ +    + + ++ +PFG GRRSCPG  +A Q+  + +ARL 
Sbjct  426   DPRVWEEPSAFRPERFLTS-DAVDVRGQNFELIPFGSGRRSCPGMSFALQVLHLTLARLL  484

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
               F F+T  +EP+DM E  G+ +PK TPLEVL+TPRL P L+
Sbjct  485   HAFEFATPSDEPVDMTESPGLTIPKATPLEVLLTPRLPPQLY  526



>ref|XP_004241385.1| PREDICTED: cytochrome P450 82C2-like [Solanum lycopersicum]
Length=543

 Score =   482 bits (1240),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 244/513 (48%), Positives = 332/513 (65%), Gaps = 23/513 (4%)
 Frame = -1

Query  1604  KQSKRL---PPEAGGAWPIIGHLHHFRTS-------------VPLVKTLSEWADKYGPVF  1473
             K SK+    PP+  GAWPIIGHL    ++             +PL  TL   ADKYGPVF
Sbjct  32    KNSKKFGPAPPQLPGAWPIIGHLPQILSNTLDGRNRINKDGEIPLAHTLGALADKYGPVF  91

Query  1472  TIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRV  1293
             T+R G+  I VVSS+EA+++CF T DK LA R  TC+ KYLGYD+A  TF+    YWR V
Sbjct  92    TVRQGMFPIAVVSSYEAIKECFTTQDKNLANRVATCSCKYLGYDHANLTFANYGPYWRMV  151

Query  1292  RKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLN  1113
             RKLVV  +LSS+ LE+LKHV +SE++++IKELYT    +       KV++  WF  + LN
Sbjct  152   RKLVVNNLLSSKSLERLKHVRISEVESSIKELYTLFVANEAKNVPTKVDIGHWFDDMMLN  211

Query  1112  LIMQIVAGRRY-EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG  936
             + ++++ G+RY +  +     EEA+R +K F++ MY +   V  +  FP    +WLD +G
Sbjct  212   ITVKMIGGKRYSQVNNKEEEKEEAERFRKAFNETMY-YIAIVGIEDAFPFPLLQWLDLQG  270

Query  935   HVKTMKRAAKDVDAILQDWVD---ARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDT  765
             ++K MKR A ++D ILQ W+D    +RK   SN+DQ  ID+ML+ +D    Q Y YSR+T
Sbjct  271   NIKVMKRIADEMDVILQRWLDDHTNKRKNNESNDDQDLIDIMLTELDKDDFQ-YGYSRET  329

Query  764   VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL  585
             +IKA +L+++ DA+ T A HL WI+A LL +   L++V +EIDT +GK+RW EDSD+KNL
Sbjct  330   IIKATMLTIVSDATHTTAVHLIWIIACLLNNKHVLEKVHEEIDTKVGKDRWVEDSDIKNL  389

Query  584   PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE  405
              Y Q  +KE LR+YP  P L  HEA+ DC V GYHI KGT+L+VNVW+L +D K WP+PE
Sbjct  390   MYFQATIKEVLRLYPPSPMLV-HEALADCQVLGYHISKGTRLFVNVWKLQKDSKFWPEPE  448

Query  404   KFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVP  225
             KFLPERF+T         +  +F+PFG GRRSCPG   A Q+T +++ARL Q F+F    
Sbjct  449   KFLPERFLTTKAKVDVYGKDLEFIPFGSGRRSCPGITMAMQVTYLSIARLLQAFDFDLPN  508

Query  224   NEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             N+PLDM E  G    K  PLEV+V PR+ P  +
Sbjct  509   NDPLDMTEGPGFTAVKKVPLEVVVKPRMLPMYY  541



>emb|CAN77159.1| hypothetical protein VITISV_019026 [Vitis vinifera]
Length=604

 Score =   483 bits (1243),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 248/522 (48%), Positives = 340/522 (65%), Gaps = 18/522 (3%)
 Frame = -1

Query  1658  LSSILGIAA---LVLLWFSWRKQS------KRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             LS +L +A    LVLL   WR +S       R  PE  GAWP IGHLH   + +P+ +TL
Sbjct  90    LSHLLAVAGFMWLVLLCNVWRVKSFAHRGKGRSAPEPSGAWPFIGHLHLLNSPMPIFRTL  149

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
             +  AD +GPVF IRLG+ R LVVSS +AV++C  TNDK  A+RP + AGK LGY+YA F 
Sbjct  150   TAMADXHGPVFMIRLGMXRALVVSSHKAVKECLTTNDKAFASRPISSAGKLLGYNYAGFG  209

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN  1146
             F+     WR +RKL V E+LS+RRL++LKHV VSEL   I++LY+ +  + N  +  KV 
Sbjct  210   FAPYGPLWREMRKLSVTELLSNRRLDELKHVLVSELDVCIRDLYS-LGKETNWVNPIKVA  268

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             MS W    T N+++++VAG+RY + +    NEEA+    V  + + L G FV+ D I   
Sbjct  269   MSEWLEQXTFNVVLRMVAGKRY-FGNGVHGNEEARHAIAVIKKFLSLTGAFVASDVIP--  325

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNED--QKFIDVMLSMIDDQFT  792
              F  W+D +GH+ +MKR A  +D  ++ WV+    +  S+    Q FIDVMLS++ D   
Sbjct  326   -FVEWMDLQGHLGSMKRVAGQLDPFVEGWVEEHVTKLNSDPSSRQDFIDVMLSVLKDNSI  384

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
               + ++R+TVIKA V++++   SET +   TWIL+ LL +  +LKR Q+EID  +G+ RW
Sbjct  385   --FGHTRETVIKATVMTLIVGGSETTSIVSTWILSALLNNRHALKRAQEEIDLKVGRGRW  442

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E+SD++NL YLQ VVKETLR+YP  P   PHEAVEDC V  YHIPKGT+L+VNVW+LHR
Sbjct  443   VEESDIZNLIYLQAVVKETLRLYPPAPLSIPHEAVEDCNVCEYHIPKGTRLFVNVWKLHR  502

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP +W DPE+F PERF+T         + ++ +PF  GRRSCPG   A QI  + VARL 
Sbjct  503   DPGVWSDPEEFQPERFLTTNANLNVFGQHFELIPFSSGRRSCPGIALALQILHLTVARLL  562

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             QG++ +T  N P+DM E +GI +P+ TPLEV++TPRL   L+
Sbjct  563   QGYDMTTPLNAPVDMTEGIGITMPRATPLEVMLTPRLPSLLY  604



>gb|ABD39484.1| CYP82E2v3 [Nicotiana tabacum]
Length=517

 Score =   479 bits (1234),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 238/526 (45%), Positives = 345/526 (66%), Gaps = 28/526 (5%)
 Frame = -1

Query  1658  LSSILGIAALV-LLWFSWRKQSKRLPPEAG----GAWPIIGHLHHFRTSV---PLVKTLS  1503
             + + +G+     LL+F W K+S++LP        G WP+IGHL HF       PL + L 
Sbjct  5     IEAFVGLVTFTFLLYFLWTKKSQKLPKPLPPKIPGGWPVIGHLFHFNNDGDDRPLARKLG  64

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             + ADKYGPVFT RLG+  +LVVSS+EA +DCF+TND + + RP    G+YLGY+  +   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEATKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLFL  124

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +    YWR+ RKLV++E+LS+ RLEK K V  + +QT+IK LYT I     N ++  +N+
Sbjct  125   ANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTSIKNLYTRI-----NGNSSTINL  179

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L   LI++++AG+ YE    G  +E+ +R K  F   M L  EFV  DA FP+ 
Sbjct  180   TDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMVLSMEFVLWDA-FPIP  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDD  801
              F+W+D++GH+KTMKR  KD+D++ Q+W++    +R   E      +Q FIDV+LS +  
Sbjct  236   LFKWVDFQGHIKTMKRTFKDIDSVFQNWLEEHINKREKMEVGAEGNEQDFIDVVLSKLSK  295

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             ++     YSRDTVIKA V S++ DA++T A H+ W + +L+ +  +L + Q+EIDT +GK
Sbjct  296   EYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMTLLINNQNALMKAQEEIDTKVGK  354

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             +RW E+SD+K+L YLQ +VK+ LR+YP GP L PHE V+DC+V GYHIPKGT+L+ NV +
Sbjct  355   DRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHENVKDCVVSGYHIPKGTRLFANVMK  414

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             L RDPK+  +P+KF PERF+    G+   +   Y+F+P G GRRSCPG  YA Q+  + +
Sbjct  415   LQRDPKLLSNPDKFDPERFIA---GDIDFRGHHYEFIPSGSGRRSCPGMTYALQVEHLTM  471

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             A L QGFN+ T  +E LDM E  GI + K+ P+E+++TPRL+P L+
Sbjct  472   AHLIQGFNYKTPNDEVLDMKEGAGITIRKVNPVELIITPRLAPELY  517



>ref|XP_002264464.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   477 bits (1228),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 239/522 (46%), Positives = 334/522 (64%), Gaps = 19/522 (4%)
 Frame = -1

Query  1655  SSILGIAALVL---LWFS-WR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             S  L IA L+L   LW++ WR      K     PPE  GAWP +GHLH     VP+ +TL
Sbjct  5     SHFLAIAGLILGLVLWYNHWRGKTLTHKSKGMSPPEPSGAWPFVGHLHLLHGKVPVFRTL  64

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
                ADK GPVF IRLG+ R LVVS+ EA ++CF TNDK+ A+RP + A K LGY+YA F 
Sbjct  65    GAMADKVGPVFVIRLGMYRTLVVSNREAAKECFTTNDKIFASRPNSSAAKILGYNYAAFA  124

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN  1146
             F+ +  YWR +RKL + EILS+RRL  L HV VSEL   IK+LY  +  DNN  +  KV 
Sbjct  125   FAPHGPYWREMRKLSMLEILSTRRLGDLMHVQVSELHAGIKDLY-ILGKDNNWVNPKKVV  183

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             +S WF HLT N+++++VAG+RY + +     EEA+       +V+ L G  V+ D I P 
Sbjct  184   ISEWFEHLTFNVVLRMVAGKRY-FNNVVHGGEEARSAIAAIKKVLLLVGASVASDVI-P-  240

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQFT  792
              F  W+D +GH+ +MK  AK++D++++ WV     R    ++    FID+ML+ + D   
Sbjct  241   -FLEWVDLQGHLSSMKLVAKEMDSLIESWVKEHTGRLNSEASSSLDFIDIMLTKLKD--A  297

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
               + YSR+T+IKA VL+M+   S+T +   TW+L+ LL +   +K  Q+E+D  +G++RW
Sbjct  298   SLFGYSRETIIKATVLTMIVAGSDTTSLTSTWLLSALLNNKHVMKHAQEELDLKVGRDRW  357

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E SD++NL Y++ +VKETLR+Y   P L PHEA+EDC V GYHI KGT+L VN W+LHR
Sbjct  358   VEQSDIQNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCHVGGYHISKGTRLLVNAWKLHR  417

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP +W +PE+F PERF+T+        + ++ +PFG GRRSCPG     Q+  + +ARL 
Sbjct  418   DPAVWSNPEEFQPERFLTSHANVDVFGQHFELIPFGSGRRSCPGLNMGLQMLHLTIARLL  477

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             QGF+ +   N P+DM E + + L KLTPLEV++TPRL   L+
Sbjct  478   QGFDMTKPSNSPVDMTEGISVALSKLTPLEVMLTPRLPAELY  519



>ref|XP_004517185.1| PREDICTED: cytochrome P450 82C4-like [Cicer arietinum]
Length=522

 Score =   476 bits (1226),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 235/529 (44%), Positives = 352/529 (67%), Gaps = 19/529 (4%)
 Frame = -1

Query  1679  MDAVPCCLSSILGIAALVLLWFSWR-------KQSKRLPPEAGGAWPIIGHLHHFRTSVP  1521
             M+  P   ++I+   ALV+L+  WR       K   + PP+   A P IGHLH      P
Sbjct  1     MEYFPSQQTTIVLAIALVVLYNIWRIKKHSNNKLKGKQPPQPSYALPFIGHLHLLGNQTP  60

Query  1520  LVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYD  1341
             L +  + +ADKYGP+F I LG    LV+S+ E++++CF TNDK+LA+RP +  G YLGY+
Sbjct  61    LARIFASFADKYGPIFQIYLGSYPALVISNQESIKECFTTNDKILASRPKSSHGIYLGYN  120

Query  1340  YAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPS  1161
             YA F F+   +Y+ ++RKL + E+LSSRR+E L+H++ SE+ T + +L+ ++   +NN  
Sbjct  121   YAGFGFAPYGTYFTKLRKLTMLELLSSRRIESLRHLYESEIDTLVNDLWLYVK--DNNKV  178

Query  1160  APKVNMSRWFGHLTLNLIMQIVAGRRY-EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSG  984
                V +S+W   LT N+I ++++G+RY EY  D   + EA  + K+  + M++ GEFV  
Sbjct  179   TKAVVISKWLEKLTFNIITKMISGKRYFEYLQD-VDDVEAHGIVKLIKEFMHISGEFVPS  237

Query  983   DAIFPLWFFRWLDYEGHV-KTMKRAAKDVDAILQDWVD--ARRKERRSNEDQKFIDVMLS  813
             D I P+    W  +EG V K+MKR  +D+D ++  WVD   ++ +   NE   FIDVMLS
Sbjct  238   DLI-PI--IGWFGFEGQVLKSMKRVGRDLDKVVGRWVDEHVQKIDDGVNEKHDFIDVMLS  294

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
             +I+D  + G+   RDT+IKA +++++   S+T +T +TWILA+LL +  +LKR Q+EI+ 
Sbjct  295   VIEDDPSSGHD--RDTIIKANIMNLMLAGSDTTSTTMTWILAILLNNTNALKRAQEEINH  352

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
             +IGK+R  E SD+KNL YLQ ++KETLR+YP GP L PHEA +DC + GY++PKGT+++ 
Sbjct  353   HIGKKRRVESSDIKNLVYLQAIMKETLRLYPPGPLLVPHEATKDCYIQGYNVPKGTRVFA  412

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             NVW+LHRDP IW + EKF PERF+    GE  +   ++++PFGLGRR+CPG+++ATQ+  
Sbjct  413   NVWKLHRDPSIWLEAEKFSPERFINEKNGELYEGHNFEYLPFGLGRRACPGSMFATQVCL  472

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + +ARL  GF+      E +DM E +GI LPKLTPL V++TPRL+  L+
Sbjct  473   ITLARLIHGFDLEVPMGEDVDMREGLGITLPKLTPLNVILTPRLTYELY  521



>ref|XP_006473405.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   476 bits (1225),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 234/523 (45%), Positives = 340/523 (65%), Gaps = 19/523 (4%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFS----WRKQSK----RLPPEAGGAWPIIGHLHHFRTSVPLV-KTL  1506
             LSSI+ + +L+L  ++     RK S     +  PE  GAWPIIGHLH       L+ +TL
Sbjct  7     LSSIVVVFSLLLFLYNASLRGRKSSNVRKTKKAPEPAGAWPIIGHLHLLGGGDQLLYRTL  66

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
                ADK+GP F IRLG     VVSSWE V++CF  NDK LA+RP T A K++GYDYAVF 
Sbjct  67    GAMADKWGPAFNIRLGSRSAFVVSSWEVVKECFTINDKALASRPKTAAAKHMGYDYAVFG  126

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN  1146
             F+    +WR +RK+   E+LS+RRLE LKHV +SE++  ++EL+   + +N+ P    V 
Sbjct  127   FAPYTPFWREMRKIATLELLSNRRLEALKHVRISEVEMGLRELHGLWAKNNSRPVL--VE  184

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             + +W   +TLN+++++VAG+RY   S    + EA++ +K  +Q  +L G F   DA   L
Sbjct  185   LKKWLEDMTLNMVVRMVAGKRYFGASATCDDSEARQCQKAINQFFHLIGIFTVSDA---L  241

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKER-----RSNEDQKFIDVMLSMIDD  801
              FF WLD++GH   MK+ AK++DAIL+ W++  R+ R      S  +Q FIDVMLS+ ++
Sbjct  242   PFFWWLDWQGHEMAMKKTAKELDAILEGWLEEHRQRRVSGGIESESEQDFIDVMLSLQEE  301

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
                  + +S D  IK+  L+++   S+T +  LTW +++LL +P  LK+ Q+E+D  IG 
Sbjct  302   GHLSQFQHSADISIKSTCLALILGGSDTTSGTLTWAISLLLNNPNMLKKAQEELDQQIGM  361

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             +R  +DSD+KNL YLQ ++KETLR+YP GP L P EA+EDC V GYHIP GT+L VNVW+
Sbjct  362   DRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHIPAGTRLIVNVWK  421

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             + RDP++W +P  F PERF+T+      + +Q++ +PFG GRRSCPG  +A Q+  + +A
Sbjct  422   IQRDPRVWKNPSAFQPERFLTSHTDVDFRGQQFELIPFGSGRRSCPGASFALQVLHLTLA  481

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPT  132
             RL   F  +T  ++P+DM E  G+ +PK TPLEV+++PRL P 
Sbjct  482   RLLHAFELATPSDQPVDMTESPGLTIPKATPLEVVLSPRLPPN  524



>ref|XP_002300088.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa]
 gb|EEE84893.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa]
Length=527

 Score =   476 bits (1225),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 228/527 (43%), Positives = 348/527 (66%), Gaps = 25/527 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFSWRK--QSKR------LPPEAGGAWPIIGHLHHFRTSVPLVKTLS  1503
             L ++  + ALVL W++ R+  +S+R       PPE  GA P+IGHLH       L +TL+
Sbjct  7     LLAVSTVLALVL-WYTLRRVRESRRKTEKGLQPPEPSGALPLIGHLHLLGAQKTLARTLA  65

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
               ADKYGP+FTIRLG    +VVS+ EA+++CF T+D++L++RP +  G++L Y+YA F F
Sbjct  66    AMADKYGPIFTIRLGKHPTVVVSNLEAIKECFTTHDRILSSRPRSSHGEHLSYNYAAFGF  125

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             + +  +WR +RK+V  ++LSS RL+ L+HV VSE+ T I +LY      +N   + K+++
Sbjct  126   NNSGPFWREMRKIVTIQLLSSHRLKSLRHVQVSEVNTLINDLYLL--SKSNKQGSTKIDI  183

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             S  F  +T+N+I +++AG+RY   ++    +E +R+ K+  + MY+ G FV  D I    
Sbjct  184   SECFERMTINMITRMIAGKRYFSSTEAEKEDEGKRIGKLMKEFMYISGVFVPSDVI---P  240

Query  962   FFRWLD-YEGHVKTMKRAAKDVDAILQDWVDARRKERRSN-------EDQKFIDVMLSMI  807
             F  W++ + G VKTMKR ++++D++++ W+   + +R  +       ED  FIDVMLS++
Sbjct  241   FLGWMNNFLGSVKTMKRLSRELDSLMESWIQEHKLKRLESTENTNKMEDDDFIDVMLSLL  300

Query  806   DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
             DD     + YSR+T+IKA  ++++   ++T +  LTWIL+ LL +  SL+  Q+E+D  +
Sbjct  301   DDSM---FGYSRETIIKATAMTLIIAGADTTSITLTWILSNLLNNRRSLQLAQEELDLKV  357

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             G+ERWAEDSD+ NL Y+Q ++KETLR+YP GP   PHEA +D  V GYHIPKGT+L+ N+
Sbjct  358   GRERWAEDSDIGNLVYIQAIIKETLRLYPPGPLSVPHEATKDFCVAGYHIPKGTRLFANL  417

Query  446   WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             W+LHRDP +W +P++++PERF+T+          ++ +PFG GRRSCPG  +A Q+  + 
Sbjct  418   WKLHRDPNLWSNPDEYMPERFLTDHANVDVLGHHFELIPFGSGRRSCPGITFALQVLHLT  477

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              ARL QGF+  T   E +DM E V I LPK TPLE+ +TPRLSP L+
Sbjct  478   FARLLQGFDMKTPTGESVDMTEGVAITLPKATPLEIQITPRLSPELY  524



>ref|XP_009348373.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=538

 Score =   476 bits (1225),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 237/521 (45%), Positives = 335/521 (64%), Gaps = 17/521 (3%)
 Frame = -1

Query  1670  VPCCLSSILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLS  1503
             +P  L +I GI   +L  +  + QS +    L P+  GA PIIGHLH      PL +TL+
Sbjct  17    LPSHLVAIGGIFLFILYLWRVKIQSHKTKGILTPQPSGALPIIGHLHKLGGKKPLCRTLA  76

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
               ADKYGP+FTIRLG    LV+S+++AV++CF  ND +  ARP +  G+YLGY+YA F F
Sbjct  77    SMADKYGPIFTIRLGKDPALVISNYDAVKECFTKNDIVFGARPKSAHGRYLGYNYAGFGF  136

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             S   +YWR +RK+V+ E+LSSRRL+ LKHV +SE+ + IK LY        N    KV +
Sbjct  137   SPYGTYWRNMRKVVIAELLSSRRLQTLKHVQISEVDSFIKGLYEICKTKGENGQG-KVVI  195

Query  1142  SRWFGHLTLNLIMQIVAGRRY----EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI  975
             S W  HLTLN+I Q++AG+RY    +  +D     E +R++++  + M + G  V  D I
Sbjct  196   SEWIEHLTLNVITQMIAGKRYFDWGKVGNDSDNEGENKRIREIVKEFMLVSGMPVISDMI  255

Query  974   FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR---RKERRSNEDQKFIDVMLSMID  804
                 +  W+D+ G VK MKR  K++D++   W++     RKE  S +   FIDVMLS+I+
Sbjct  256   ---GYPDWIDFLGEVKNMKRIGKELDSLTASWIEEHNNARKEIDSRDKLDFIDVMLSVIE  312

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
             D    GY+  R+T+IKA   +++   S+T A  L W++++LL +   LK  Q+EI+  +G
Sbjct  313   DNTVLGYT--RETIIKATSQNLIIAGSDTTAISLKWVISLLLNNRHVLKHAQEEINLIVG  370

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
              ERW ED+D++NL YLQ +VKETLR+YP GP   PHEA+EDC V G+HIPKGT+L+VN+W
Sbjct  371   TERWVEDTDIENLTYLQAIVKETLRLYPPGPLSVPHEAMEDCQVCGFHIPKGTRLFVNLW  430

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             +LHRDP +W DPE F P+RF+T           ++F+PFG GRRSCPG  +A Q+  + +
Sbjct  431   KLHRDPTVWSDPEMFYPDRFLTTQASIDVSGNHFEFIPFGSGRRSCPGLTFAMQVIHLTL  490

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
              RL QGF  +T  + P+DM E +G+ LPK T LEV++TPRL
Sbjct  491   GRLIQGFELATPLDMPVDMTEGLGVTLPKATSLEVVLTPRL  531



>ref|XP_002531094.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31308.1| cytochrome P450, putative [Ricinus communis]
Length=525

 Score =   475 bits (1223),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 226/510 (44%), Positives = 335/510 (66%), Gaps = 26/510 (5%)
 Frame = -1

Query  1610  WRKQSKR----------LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRL  1461
             WR + KR          L PE  GA PIIGHLH       L +TL   AD YGP+FTI L
Sbjct  25    WRVRVKRQNYESNKSLLLAPEPSGALPIIGHLHLLGKENTLARTLGRLADNYGPIFTIWL  84

Query  1460  GISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLV  1281
             G+ R +VVSS+EA+++CF++ND++LA+RP +  G+YL Y+YA F F++   YW  +RKLV
Sbjct  85    GVHRTVVVSSYEAIKECFSSNDRILASRPRSSHGQYLSYNYAAFGFASYGPYWSHMRKLV  144

Query  1280  VEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQ  1101
               ++LSS R++ LKHV +SE+ T IKELY     +    +   +N+S  F HLTLN+I +
Sbjct  145   AIQLLSSHRIKLLKHVQISEVNTLIKELY-----EKQGSNKKIINISECFEHLTLNMITR  199

Query  1100  IVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTM  921
             ++AG+RY   +D    +E +R+ K+  + MY+ G FV  D I P  F  W+++ G VKTM
Sbjct  200   MIAGKRYFSSADSDSEQEGKRIGKIMKEFMYISGVFVPSDLI-P--FLGWMNFAGPVKTM  256

Query  920   KRAAKDVDAILQDWVDARRKERRSNEDQK-----FIDVMLSMIDDQFTQGYSYSRDTVIK  756
             KR ++++D++ + W+D  + +R  +E+ K     FIDVMLS+++D F   + +S++ +IK
Sbjct  257   KRLSRELDSLTETWIDEHKLKRVKSEESKNMEEDFIDVMLSLLEDDF---FGHSKEDIIK  313

Query  755   AIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYL  576
               V +++   ++T +  LTWIL+ LL +  +L+  Q E+D  +G+ R  +DSD+ NL YL
Sbjct  314   GTVTNLIIAGADTTSITLTWILSNLLNNRRTLELAQQELDLKVGRNRCVQDSDIDNLVYL  373

Query  575   QGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFL  396
               +VKETLR+YP GP   PHEA EDC + GYHIPKGT+++ N+W+LHRDP +W  P +F+
Sbjct  374   NAIVKETLRLYPPGPLAVPHEASEDCSIAGYHIPKGTRVFANLWKLHRDPNVWSSPNEFV  433

Query  395   PERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEP  216
             PERF+T+        + ++++PFG GRRSCPG  +A Q   + +A+L Q F+F+T  N P
Sbjct  434   PERFLTSQANMDVSGQNFEYIPFGSGRRSCPGLNFAIQAIHLTLAKLLQAFSFTTPLNVP  493

Query  215   LDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +DM E +GI LPK TPLE+ + PRLSP L+
Sbjct  494   VDMTEGLGITLPKATPLEIHIIPRLSPELY  523



>ref|XP_010106089.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXC07359.1| Cytochrome P450 82C4 [Morus notabilis]
Length=528

 Score =   475 bits (1223),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 238/517 (46%), Positives = 330/517 (64%), Gaps = 19/517 (4%)
 Frame = -1

Query  1637  AALVLLWFSW-RKQSKRL-------PPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKY  1485
             A+ V+L+++  RK+SK          PE  GAWPIIGHLH       L+ +TL   AD Y
Sbjct  16    ASSVILYYALLRKKSKPTRITPGVQAPEPEGAWPIIGHLHLLGGGDQLLYRTLGAMADNY  75

Query  1484  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY  1305
             GP F IRLG  R  VV+SW+  +DCF  NDK LA+RPTT A K++GY+YAVF F+  + +
Sbjct  76    GPAFNIRLGSRRAFVVNSWDVAKDCFTANDKALASRPTTVAAKHMGYNYAVFGFAPYSPF  135

Query  1304  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH  1125
             WR +RK+   E+LS+RRLE LKHV +SE+ T I++LY  +    N      V +SRW   
Sbjct  136   WREMRKIATLELLSNRRLEMLKHVRISEIDTGIQDLYDRV---QNGAHPVVVELSRWLDE  192

Query  1124  LTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD  945
             LTLN+++++VAG+RY         +EAQR +K   +  +L G FV  DA+  LW   WLD
Sbjct  193   LTLNMVVRMVAGKRYFGALAECNGDEAQRCQKAICEFFHLIGIFVVSDALPFLW---WLD  249

Query  944   YEGHVKTMKRAAKDVDAILQDWVDARRKERRS---NEDQKFIDVMLSMIDDQFTQGYSYS  774
               GH + MKR AK++DAIL  W++  R+ R S   + DQ FIDVMLS+ +      + Y 
Sbjct  250   LHGHERAMKRTAKELDAILGGWLEEHRRRRASKMADSDQDFIDVMLSLQEGGELSNFQYD  309

Query  773   RDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDV  594
              D  IK+  L+++   S+T A  LTW +++LL +  +LK+ Q E+D  +G  R  +DSD+
Sbjct  310   ADISIKSTCLALILGGSDTTAGTLTWAISLLLNNSHALKKAQQELDIEVGTNRLVDDSDI  369

Query  593   KNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWP  414
             KNL YLQ ++KETLR+YP GP L P EA+EDC V GYH+P GT+L VNVW++ RDP +W 
Sbjct  370   KNLVYLQAIIKETLRLYPAGPLLGPREALEDCTVSGYHVPAGTRLVVNVWKIQRDPTVWS  429

Query  413   DPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS  234
             +PE F PERF+T       + +Q++ +PFG GRRSCPG  +A Q+  + +ARL Q F FS
Sbjct  430   NPEAFEPERFLTTHAHVDVRGQQFELIPFGSGRRSCPGASFALQVLHLTLARLLQAFEFS  489

Query  233   T-VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
               +   P+DM E+ G+ +PK  PLEVL++PRL   L+
Sbjct  490   NPLDGRPVDMTENPGLTIPKAHPLEVLLSPRLPRELY  526



>ref|XP_010664626.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=534

 Score =   475 bits (1223),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 233/521 (45%), Positives = 335/521 (64%), Gaps = 20/521 (4%)
 Frame = -1

Query  1652  SILGIAA----LVLLWFSWRKQS---KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWA  1494
             S + +AA    L L +FS   +S   KR  PEA GAWP+IGHLH         KTL   A
Sbjct  21    STIAMAAMFTFLFLYYFSKIAKSSERKRTAPEAAGAWPVIGHLHLLGGPELPHKTLGAMA  80

Query  1493  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN  1314
             DKYGPVF I+LG+ R+L++S+WE  ++CF TNDK+ A RP + A + LGY+YA+F F   
Sbjct  81    DKYGPVFLIKLGVQRVLMLSNWEMAKECFTTNDKVFANRPKSIAVEVLGYNYAMFGFGPY  140

Query  1313  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW  1134
              SYWR+VRK+V   +LS+RRLE +KHVW+SE++ +I+ELY       ++ +   V M  W
Sbjct  141   GSYWRQVRKIVTTGLLSNRRLEIVKHVWISEVKASIRELYELWINKRSDSNMVLVEMKDW  200

Query  1133  FGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR  954
             FG L+LN+++++++G R     D +  EE  R  K+        G F+  DA+ PL   R
Sbjct  201   FGDLSLNMVLRMLSGGR-----DSSSKEERMRCHKLVRDFFQSMGTFLVSDAL-PL--LR  252

Query  953   WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQG-  786
             W D+ G+ K M++ AKD+D +L+ W+   + +R S +   +Q F+DVMLSM+DD  T   
Sbjct  253   WFDFGGYEKAMRKTAKDLDHLLESWLQQHKSKRSSEQADGNQDFMDVMLSMLDDMATDED  312

Query  785   -YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
                +  DT+ KA  L++L   ++T    L W L++LL  P+ LK  ++E+D+++G+ER  
Sbjct  313   LKGFDADTINKATCLTILAGGTDTVTVSLIWALSLLLNKPQVLKTAREELDSHVGRERQV  372

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
             E+ D+KNL YL  +VKETLR+YP GP  APHE+ EDC++ GYHIP GT+L  N+W++HRD
Sbjct  373   EERDMKNLAYLNAIVKETLRLYPAGPLTAPHESTEDCLLGGYHIPAGTRLLANLWKIHRD  432

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ  249
             P IW DP++F PERF+T  +    + + ++ +PFG GRR CPG  +  Q  Q  +A L Q
Sbjct  433   PSIWSDPDEFRPERFLTTHKDVDVKGQHFELIPFGSGRRICPGISFGLQFMQFTLASLIQ  492

Query  248   GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             GF F+T+ +EP+DM E +G+   K TPLEVLV PRLS  L+
Sbjct  493   GFEFATMSDEPVDMTESIGLTNLKATPLEVLVAPRLSSDLY  533



>ref|XP_003523888.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
 gb|KHN04535.1| Cytochrome P450 82C4 [Glycine soja]
Length=526

 Score =   474 bits (1219),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 232/517 (45%), Positives = 336/517 (65%), Gaps = 18/517 (3%)
 Frame = -1

Query  1640  IAALVLLWFSWR-----KQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGP  1479
             ++ LV LW + R     K   +  P   GAWP+IGHLH       L+ +TL   AD+YGP
Sbjct  14    VSLLVFLWHTKRNRGGSKNKSKEAPIPAGAWPLIGHLHLLGGDDQLLYRTLGTMADQYGP  73

Query  1478  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR  1299
              F I LG  R  VVSSWE  ++CF +NDK LA+RPTT A K++GY+YAVF F+  + +WR
Sbjct  74    AFNIWLGTRRAFVVSSWEVAKECFTSNDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWR  133

Query  1298  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT  1119
              +RK+   E+LS+RRLE LKHV VSEL   +++LY     + + P    V ++RW   LT
Sbjct  134   EMRKIATLELLSNRRLEMLKHVMVSELNMVMRDLYNSWVQNRSRPVL--VELNRWLEDLT  191

Query  1118  LNLIMQIVAGRRYEYRSDGTINE-EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY  942
             LN+++++VAG+RY   S    N+ EA+R +K  +Q  +L G FV  DA   L F RW D 
Sbjct  192   LNMVVRMVAGKRYFGASASCDNDDEARRCQKAINQFFHLIGIFVVSDA---LPFLRWFDV  248

Query  941   EGHVKTMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDVMLSMIDDQFTQGYSY  777
             +GH + MK+ AK++DAIL+ W+   R++R   E     +Q FID+MLS+        + Y
Sbjct  249   QGHERAMKKTAKELDAILEGWLKEHREQRVDGEIKAEGEQDFIDIMLSLQKGGHLSNFQY  308

Query  776   SRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSD  597
               DT IK+  L+++   S+T A  +TW +++LL + ++LK+ Q+E+D N+G ER  E+SD
Sbjct  309   DSDTSIKSTCLALILGGSDTTAGTVTWAISLLLNNRQALKKAQEELDLNVGMERQVEESD  368

Query  596   VKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW  417
             ++NL Y+Q ++KETLR+YP GP L P EA EDC V GYH+P GT+L VN+W++HRDP++W
Sbjct  369   IRNLAYVQAIIKETLRLYPAGPLLGPREAQEDCNVAGYHVPAGTRLVVNLWKIHRDPRVW  428

Query  416   PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF  237
              +P  F PERF+T+ +    + + ++ +PFG GRRSCPG  +A Q+  + +ARL   F F
Sbjct  429   QEPSAFRPERFLTS-DAVDVRGQNFELIPFGSGRRSCPGMSFALQVLHLTLARLLHAFEF  487

Query  236   STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +T  ++P+DM E  G+ +PK TPLEVL+TPRL   L+
Sbjct  488   ATPSDQPVDMTESPGLTIPKATPLEVLLTPRLPAKLY  524



>gb|KDP26346.1| hypothetical protein JCGZ_17504 [Jatropha curcas]
Length=515

 Score =   473 bits (1217),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 224/522 (43%), Positives = 347/522 (66%), Gaps = 20/522 (4%)
 Frame = -1

Query  1667  PCCLSSILGIAALVLLWFSWR-----KQSKRLP-PEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             P  + +I G+ +LVLL+  WR      ++K L  PEA GA PIIGHLH       L +T+
Sbjct  4     PSHIVAIAGVISLVLLYNLWRFGKNGTKNKGLSVPEAPGALPIIGHLHRLGGEKTLARTM  63

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
              + ADK GP+FT+RLG  + +++S++EA+++ F TND L ++RP +   KY+GY+YA F 
Sbjct  64    GDLADKCGPIFTVRLGAHKAIIISNYEAMKETFTTNDILFSSRPPSSQAKYIGYNYAAFG  123

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN  1146
             F+   +YWR +RKL++ E+LS +R++ ++HV VSE+   IK+LY+         S  K++
Sbjct  124   FAPYGTYWRNMRKLIMIELLSVQRIKLMRHVQVSEVNNMIKDLYS--------DSKKKID  175

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             MS    HL LN+I ++VAG+RY   +    +E  + + K+  + M++ G  V GD I   
Sbjct  176   MSEMLEHLILNIITRMVAGKRYFDGNSEGRDEHGRPIGKIMREFMFVVGALVPGDLI---  232

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARR-KERRSNEDQKFIDVMLSMIDDQFTQ  789
              F  W D +G  KTMK+ +K++D I+  W++  + K+ +++ ++ FIDVMLS+I+D  T 
Sbjct  233   PFLGWWDIQGIKKTMKKVSKELDVIMSTWIEEHKTKKNKTDSNKDFIDVMLSVIEDDTTF  292

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
             G+    D +IK+  +S++   S+T +  +TW L+ LL + ++L+R+Q+E+D  +G++RW 
Sbjct  293   GHKC--DVIIKSTAMSLIVAGSDTTSITMTWALSSLLNNRKTLERLQEELDQKVGRDRWV  350

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
             +DSD++ L Y   V+KETLR+YP GP   P EA EDC + GYHIPKGT+L+ N+W+LHRD
Sbjct  351   DDSDIEKLDYFSAVIKETLRLYPPGPLGVPREATEDCTIAGYHIPKGTRLFTNLWKLHRD  410

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ  249
             P +W DPE+F PERF+T+        + ++++PFG GRRSCPG  +A Q+  + +ARL Q
Sbjct  411   PNVWADPEEFKPERFLTDNANLDVSGQHFEYLPFGAGRRSCPGLNFAMQVMNITLARLLQ  470

Query  248   GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
              ++F T  NEP+DM E  GI LPK+TPLEV++TPRL+P L++
Sbjct  471   AYDFRTPGNEPVDMTEGKGIALPKITPLEVVLTPRLAPELYQ  512



>ref|XP_008235430.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=517

 Score =   473 bits (1217),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 247/516 (48%), Positives = 342/516 (66%), Gaps = 20/516 (4%)
 Frame = -1

Query  1658  LSSILGIAAL-VLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1500
             LS  L IA L VL  + WR      K    L P+  GA PIIGHLH  R   P+ KTL+ 
Sbjct  4     LSHPLAIAGLLVLALYLWRLRIQSHKIKGMLAPQPSGALPIIGHLHKLRG--PIFKTLAA  61

Query  1499  WADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFS  1320
              ADKYGP+FTI LG   +LV+S+++AV+ CF  ND + A RP +  GKYLGY+YA F FS
Sbjct  62    MADKYGPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFATRPRSTTGKYLGYNYAGFGFS  121

Query  1319  TNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP-KVNM  1143
                +YWR +RK+V+ E+LSSRRLE LKHV +SE+   IK L+     + +N   P KV +
Sbjct  122   PYGTYWRDMRKMVMVELLSSRRLETLKHVQISEVDAFIKGLFLLCKTEGHNGLNPTKVVI  181

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             S W   LTLN+I +++AG+RY   SD     + QR  K+  + MY+ G+ V+ D I    
Sbjct  182   SDWIERLTLNVITRMIAGKRYFDSSD---EGDEQRFGKILKEFMYVSGKPVASDVI---G  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQFTQ  789
             F  W+D++G +K MKR  K++D+ + + V+    +KE  S ++  FIDVM+S+I+D  T 
Sbjct  236   FPSWIDFKGQIKAMKRIMKELDSFMGNLVEEHYAKKETNSRDEHDFIDVMISVIEDNSTL  295

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
             GY+  R+T+IKA  L+++   SET A  L WIL++LL +   LK  Q+E+D  +G++RW 
Sbjct  296   GYT--RETIIKATSLNLILAGSETTAISLIWILSLLLNNRHVLKLAQEELDLKVGRDRWI  353

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
             ED+D++NLPYLQ +VKETLR+YP  P   PHEA++DC V G+HI KGT L+VN+W+LHRD
Sbjct  354   EDTDIENLPYLQAIVKETLRLYPPAPLSVPHEAMQDCQVCGFHIQKGTLLFVNLWKLHRD  413

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ  249
             P +WPDPE F PERF+T   G  A  + ++F+PFG GRRSCPG  +A Q+T + + RL Q
Sbjct  414   PSLWPDPEVFCPERFLTTHVGIDASGQHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQ  473

Query  248   GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
             GF  +T  + P+D+ E +GI +PK T LEV++TPRL
Sbjct  474   GFELATPMDMPVDLTEGLGITMPKSTSLEVILTPRL  509



>ref|XP_007227272.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
 gb|EMJ28471.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
Length=518

 Score =   473 bits (1217),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 236/501 (47%), Positives = 325/501 (65%), Gaps = 19/501 (4%)
 Frame = -1

Query  1592  RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             R  PE  GAWPIIGHLH       L+ +TL   ADKYG  F IRLG  R  VVSSWE  +
Sbjct  24    REAPEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKYGSAFNIRLGSRRAFVVSSWEVAK  83

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +CF  NDK LA+RPTT A K++GY+YAVF F+  + +WR +RK+   E+LS+RRLE LKH
Sbjct  84    ECFTFNDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATIELLSNRRLEMLKH  143

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS----  1068
             V  SEL T IKEL   + + N +     V ++RW   LTLN+++++VAG+RY   S    
Sbjct  144   VRTSELDTGIKELQN-LWVQNGSSRPVVVELNRWLEELTLNVVVRMVAGKRYFGASAKCD  202

Query  1067  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL  888
             DG   +EA+R +K   Q  +L G FV  DA+  LW   WLD +GH K MK+ AKD+DAIL
Sbjct  203   DG---DEARRCQKAIGQFFHLIGIFVVSDALPFLW---WLDLQGHEKAMKKTAKDLDAIL  256

Query  887   QDWVDARRKER-------RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD  729
               W+D  R+ R       ++  D+ FIDVMLS+ ++     + +S DT IK+  L+++  
Sbjct  257   GGWLDEHRQRRVLSHEKGKTEADEDFIDVMLSLQEEGQLSNFQHSSDTSIKSTCLAIILG  316

Query  728   ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR  549
              S+T A  LTW +++LL +P  +K+ Q+E++  +G ER  ++SD+KNL YLQ ++KETLR
Sbjct  317   GSDTTAGTLTWAISLLLNNPHVMKKAQEELELQVGTERQVDESDIKNLVYLQAIIKETLR  376

Query  548   MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE  369
             +YP GP L P EA+EDC V GYH+P GT+L VNVW++ RDP +W +P  F PERF+T+  
Sbjct  377   LYPAGPLLGPREALEDCTVAGYHVPAGTRLVVNVWKIQRDPSVWENPSAFEPERFLTSHG  436

Query  368   GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI  189
                 + +Q++ +PFG GRRSCPG  +A Q+  + +ARL   F F T   + +DM E  G+
Sbjct  437   HVDVRGQQFELMPFGSGRRSCPGVSFAMQVLHLTLARLLHAFEFETPLGQRIDMTESPGL  496

Query  188   ILPKLTPLEVLVTPRLSPTLF  126
              +PK TPLEVL+TPRL   L+
Sbjct  497   TIPKATPLEVLLTPRLPGNLY  517



>ref|XP_010069626.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=542

 Score =   474 bits (1219),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 233/511 (46%), Positives = 337/511 (66%), Gaps = 20/511 (4%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW  1428
             + +   LPPE  GAWPIIGH+H      PL +TL+  ADK GP+F IRLG+    ++SS 
Sbjct  29    KPKGTALPPELPGAWPIIGHIHLLGGETPLARTLAAMADKQGPMFRIRLGVHPATIISSR  88

Query  1427  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE  1248
             EAVR+CF T+DK LA+RP + AG +LGY YA F F     +WR +RK+ + E+LS+RRL+
Sbjct  89    EAVRECFTTHDKDLASRPKSKAGIHLGYGYAGFGFVEYGDFWREMRKITMLELLSTRRLD  148

Query  1247  KLKHVWVSELQTNIKELYTFI---SMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
              LKHV  SE+ T +K+L+      S+D  N S+  V +S+    LTLN+I++++A +RY 
Sbjct  149   NLKHVQASEIDTFVKDLHALCRTNSIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRYF  208

Query  1076  YRSDGTI------NEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKR  915
               S  +       +EEA  L++V  + MY+ G F +   + P  F  W D  G VKTMKR
Sbjct  209   GLSSASTGSSADDDEEASHLRRVIKEFMYISG-FPAVSDLVP--FTGWTDCVGTVKTMKR  265

Query  914   AAKDVDAILQDWVDARRKERRSNE--------DQKFIDVMLSMIDDQFTQGYSYSRDTVI  759
              A+++D I+  WV+  + +R  ++         + FIDVMLS+I +     + +S +T+I
Sbjct  266   VARELDEIVGKWVEEHKLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETLI  325

Query  758   KAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPY  579
             KA +++++   S++ + +LTW+L++LL H   LKR Q+EID  +GK+RW +DSD++NL Y
Sbjct  326   KATIVNIIVAGSDSTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDRWVQDSDIENLLY  385

Query  578   LQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKF  399
             LQ +VKETLR+YP GP L PHEA  DC V GY IPKGT+++VN W+LHRDP++W +PEKF
Sbjct  386   LQAIVKETLRLYPPGPLLVPHEARADCNVRGYLIPKGTRIFVNAWKLHRDPQVWSEPEKF  445

Query  398   LPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNE  219
             LPERF+TN  G  A  + ++F+PFG GRR CPG  +A + T + +ARL QGF+ +T  +E
Sbjct  446   LPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLATSLDE  505

Query  218   PLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +DM E +G+ LPK TPL V++ PRL   L+
Sbjct  506   LVDMTEGLGVNLPKATPLRVVLNPRLPSVLY  536



>ref|XP_009599169.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=523

 Score =   473 bits (1216),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 230/515 (45%), Positives = 340/515 (66%), Gaps = 13/515 (3%)
 Frame = -1

Query  1640  IAALVLLWFSWRKQ---SKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVF  1473
             +  ++ L+F ++ +   SK+  PE  GAWPIIGHLH    +  L+ +TL   AD YGP F
Sbjct  10    LGVVIFLYFLFKNKNSTSKKHAPEPAGAWPIIGHLHLLGGAEQLLYRTLGAMADNYGPAF  69

Query  1472  TIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRV  1293
             +IRLG  R  VVSSWE  ++CF  NDK LA+RPTT A K++GY YAVF F+  +++WR +
Sbjct  70    SIRLGSRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFAPYSTFWREM  129

Query  1292  RKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLN  1113
             RK+ + E+LS+RRL+ LKHV VSE++  I+ELY     +N+      V +  WF  LTLN
Sbjct  130   RKIAMYELLSNRRLDTLKHVQVSEVEMGIQELYKLWVNNNSGYRPILVELKHWFEDLTLN  189

Query  1112  LIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGH  933
             +I+++VAG+RY        ++EA+R +K  +Q  +L G FV  DA FP+    W D +GH
Sbjct  190   VIVRMVAGKRYFGAGASCDDDEARRCQKAINQFFHLIGIFVPSDA-FPI--LGWFDIQGH  246

Query  932   VKTMKRAAKDVDAILQDWVDARRKERRSNED-----QKFIDVMLSMIDDQFTQGYSYSRD  768
              K MKR AK++D+IL+ W+   R++RR +E      Q FIDVMLS+ ++     + Y  D
Sbjct  247   EKAMKRTAKELDSILESWLQEHREKRRLSEGKNEGAQDFIDVMLSLQEEGRLSNFQYDAD  306

Query  767   TVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKN  588
             T IK+  L+++   S+T A  LTW +++LL +PE L++ Q+EID ++GK+R  ++SD++N
Sbjct  307   TSIKSTCLALILGGSDTTAGTLTWAISLLLNNPEILRKAQEEIDVHVGKDRQVDESDIQN  366

Query  587   LPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDP  408
             L Y+Q ++KETLR+YP GP L P EA+++C V GY I  GT+L VNVW++ RDP+IW DP
Sbjct  367   LAYIQAIIKETLRLYPAGPLLGPREAMDECEVGGYKITPGTRLIVNVWKIQRDPRIWEDP  426

Query  407   EKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST-  231
             + F P+RF+ +      + + ++ +PFG GRRSCPG   A Q+  + +AR  Q F FS  
Sbjct  427   DSFKPDRFLMSNSNVDVKGQDFELIPFGSGRRSCPGVSLALQVLHLTLARFLQAFEFSKP  486

Query  230   VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             V ++ +D+ E  G+ +PK TPL+VL+TPRL+  L+
Sbjct  487   VGDQLIDLTESPGLTIPKATPLDVLITPRLNANLY  521



>ref|XP_009768110.1| PREDICTED: cytochrome P450 82A4-like [Nicotiana sylvestris]
Length=520

 Score =   473 bits (1216),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 231/529 (44%), Positives = 337/529 (64%), Gaps = 26/529 (5%)
 Frame = -1

Query  1682  VMDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSV----PLV  1515
             ++  +   ++ ++ +A +    +++RK SK LPPE  G WP+IGHL +F+        L 
Sbjct  8     LLSPIEAIIAGLVTLAFVFYFLWNFRKSSKTLPPEIPGGWPVIGHLFYFKNDGDHDRTLA  67

Query  1514  KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYA  1335
             + L + ADK+GPVFT +LG  R LVVSS+EA+++CF TND   + RP    G +L Y+ A
Sbjct  68    QKLGDLADKHGPVFTYKLGFRRFLVVSSYEAIKECFTTNDIRFSNRPALLYGDHLCYNNA  127

Query  1334  VFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP  1155
             +   +    YWR++RKLV +E+LS  RLEK K +  S +Q N+KELY        +    
Sbjct  128   MLFIAKYGPYWRKIRKLVNQEVLSVNRLEKFKCIRFSIVQKNVKELY--------DHCDS  179

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L+ ++I++++AG+ Y        N   + LK  F + M +  EF   D I
Sbjct  180   TINLTDWIDKLSFDIILKMIAGKSYN-------NGHGEILKIAFQKFMVIAMEFELYD-I  231

Query  974   FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDVMLSM  810
             FP+  F+W+D+ G++K +K   KD+D + Q W+D   K+R  NE     ++ FID MLS 
Sbjct  232   FPIPLFKWVDFSGNIKVVKETFKDIDTVFQGWLDEHIKKRERNETLDENEEDFIDSMLSK  291

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
               ++   G ++S +T IKA + S++ DA+ET A H+ W++A+L+ +   +K+ Q EIDT 
Sbjct  292   TSNEHL-GDTHSPNTTIKATIFSLVLDATETLALHIKWVMALLINNKLEMKKAQKEIDTI  350

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +GK+RW E+SD+KNL YLQ +VKE LR+YP  P   PHE+VEDC+V+GYHIPKGT L  N
Sbjct  351   VGKDRWVEESDIKNLVYLQAIVKEALRLYPPAPLSVPHESVEDCVVNGYHIPKGTVLLPN  410

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             V +L RDPKIW DP+KF PERF+T       + + Y+F+PFG GRR+CP   YA Q+  +
Sbjct  411   VMKLQRDPKIWSDPDKFDPERFLTTHAKIDYRGQHYEFIPFGTGRRACPAMTYALQVEYL  470

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             ++A L QGFNF+T  NE LDM E VGI  PK  P+EVL+TPRLS TL++
Sbjct  471   SIAHLIQGFNFNTPSNESLDMKEGVGITSPKKNPIEVLITPRLSTTLYQ  519



>ref|XP_008372514.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=524

 Score =   472 bits (1214),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 237/525 (45%), Positives = 333/525 (63%), Gaps = 18/525 (3%)
 Frame = -1

Query  1667  PCCLSSILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1500
             P  L +I+GI   VL  +  + QS +    L P+  GA PIIGHLH      PL +TL+ 
Sbjct  4     PSHLLAIVGILLFVLYLWRVKIQSHKTKGMLAPQPSGALPIIGHLHKLGGXNPLCRTLAS  63

Query  1499  WADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFS  1320
              ADKYGP+FTI+LG    LV+S+++AV++CF  ND   A R  +  G+YLGY+YA   FS
Sbjct  64    MADKYGPIFTIQLGKHPALVISNYDAVKECFTKNDIAFATRSKSAQGRYLGYNYAALGFS  123

Query  1319  TNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMS  1140
                +YWR +RK+ + E+LSSRRL+ LKHV +SE+ + IK LY        N  + KV +S
Sbjct  124   QYGTYWRNMRKMAIVELLSSRRLQTLKHVQISEVDSFIKGLYEICKTKGENGQS-KVVIS  182

Query  1139  RWFGHLTLNLIMQIVAGRRY----EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
              W  HLTLN+I Q++AG+RY    +  +D     E +R++++  + M + G+ V  D I 
Sbjct  183   EWIEHLTLNVITQMIAGKRYFDWGKVGNDSDNEGENKRIREMVKEFMCVAGKPVVSDVI-  241

Query  971   PLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR---SNEDQKFIDVMLSMIDD  801
                F  W+D  G VK MKR  KD D+++  W++  +  R    S +   FIDVMLS+I+D
Sbjct  242   --GFPDWIDLMGQVKNMKRIGKDFDSLMASWIEEHKNAREEIDSRDKLDFIDVMLSVIED  299

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
                 G+S  R+T+IKA   +++   S+T AT LTWIL++LL +   LK  Q+ I+  +G 
Sbjct  300   NTVLGHS--RETIIKATSQNLILAGSDTTATSLTWILSLLLNNRHILKHAQEXINLQVGT  357

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             ERW ED+D+K+L YLQ +VKETLR+YP  P   PHEA EDC V G+HIPKGT+L+ N+W+
Sbjct  358   ERWVEDTDIKDLTYLQAIVKETLRLYPPAPLSVPHEAXEDCQVCGFHIPKGTRLFANLWK  417

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             LHRDP +W DPE F P+RF+T         + ++F+PFG GRRSCPG  +A Q+  + + 
Sbjct  418   LHRDPSVWSDPEVFCPDRFLTTQASTDVSGQHFEFIPFGSGRRSCPGLTFAMQVIHLTLG  477

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             RL QGF  +T  + P+DM E +GI +PK T LEV++TPRL P+ F
Sbjct  478   RLIQGFELATPLDMPVDMAEGLGITMPKATSLEVVLTPRL-PSQF  521



>ref|XP_010069627.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW58035.1| hypothetical protein EUGRSUZ_H00764 [Eucalyptus grandis]
Length=539

 Score =   473 bits (1216),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 235/502 (47%), Positives = 329/502 (66%), Gaps = 17/502 (3%)
 Frame = -1

Query  1589  LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDC  1410
             LPPE  GAWPIIGHLH  R   PL +TL+  ADK GP+F I LG+    V+SS EAVR+C
Sbjct  35    LPPELPGAWPIIGHLHLLRGETPLARTLAAMADKQGPMFRIWLGVHPTTVISSREAVREC  94

Query  1409  FATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVW  1230
             F T+DK LA+RP + AG +LGY + VF F+     WR +RK+ + E+L +RRL+ LKHV 
Sbjct  95    FTTHDKELASRPKSMAGVHLGYGHTVFVFAEYGDLWREMRKITMLELLCTRRLDNLKHVQ  154

Query  1229  VSELQTNIKELYTFI---SMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY-----EY  1074
              SE+ + +K+L T     + D  N S+  V +S     LTLN++ +++A +RY       
Sbjct  155   ESEIDSFVKDLRTLCMTNTDDAQNGSSKGVVISELLELLTLNIMTRMLASKRYFGQLSAS  214

Query  1073  RSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDA  894
                 T  +EA  L+++    MYL+G  V  D    L F  W D  G VKTMKR A+++D 
Sbjct  215   TGSSTDYDEASHLRELIKDFMYLFGLPVVSDF---LPFPEWTDCTGTVKTMKRVARELDE  271

Query  893   ILQDWVDARRKERRSNEDQK------FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ  732
             I+  WV+  + +R  +  +       FIDVMLSMI +     + +  + +IKA V++ + 
Sbjct  272   IVGKWVEEHKLKRCDHRGEAIDVREDFIDVMLSMIGEDSFAKFGHPPERLIKATVVNNIV  331

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
               S+T    LTW+L++LL H   LKR Q+E+D  +GK++W +DSD++NLPYLQ +VKETL
Sbjct  332   AGSDTTYLTLTWVLSLLLNHKHILKRAQEEMDLMVGKDKWIQDSDIENLPYLQAIVKETL  391

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R+YP  P +APHEA  DC V GY IPKGT++ VNVW+LHRDP++W +PEKFLPERF+TN 
Sbjct  392   RLYPTAPLVAPHEARADCTVSGYRIPKGTRIIVNVWKLHRDPQVWSNPEKFLPERFLTNH  451

Query  371   EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVG  192
              G  A  + ++F+PFG GRRSCPG + A ++T + +ARL QGF+ +T  N+P+DM E +G
Sbjct  452   SGMDALGQHFEFIPFGSGRRSCPGAMLALRVTHLTLARLLQGFDLATPSNKPVDMTEGLG  511

Query  191   IILPKLTPLEVLVTPRLSPTLF  126
             + LPK +PL V++TPRL PTL+
Sbjct  512   VTLPKASPLRVILTPRLPPTLY  533



>gb|KDO84376.1| hypothetical protein CISIN_1g036812mg [Citrus sinensis]
Length=499

 Score =   471 bits (1211),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 224/490 (46%), Positives = 323/490 (66%), Gaps = 11/490 (2%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCF  1407
             PE  GAWPIIGHLH       L+ +TL   ADK+GP F IRLG     VVSSWE V++CF
Sbjct  11    PEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECF  70

Query  1406  ATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWV  1227
               NDK LA+RP T A K++GYDYAVF F+    +WR +RK+   E+LS+RRLE LKHV +
Sbjct  71    TINDKALASRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKIATLELLSNRRLEALKHVRI  130

Query  1226  SELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEE  1047
             SE+   +++L+   + +N+ P    V + +W   +TLN+++++VAG+RY   S    + E
Sbjct  131   SEVDMGLRDLHGLWAKNNSRPVL--VELKKWLEDMTLNMVVRMVAGKRYFGASATCDDSE  188

Query  1046  AQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR  867
             A++ +K  +Q  +L G F   DA   L FF WLD++GH   MK+ AK++DAIL+ W++  
Sbjct  189   ARQCQKAINQFFHLIGIFTVSDA---LPFFWWLDWQGHEMAMKKTAKELDAILEGWLEEH  245

Query  866   RKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHL  702
             R+ R      S  +Q FIDVMLS+ ++     + +S D  IK+  L+++   S+T +  L
Sbjct  246   RQRRVSGGIESESEQDFIDVMLSLQEEGHLSQFQHSADISIKSTCLALILGGSDTTSGTL  305

Query  701   TWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLA  522
             TW +++LL +P  LK+ Q+E+D  IG +R  +DSD+KNL YLQ ++KETLR+YP GP L 
Sbjct  306   TWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLG  365

Query  521   PHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQY  342
             P EA+EDC V GYHIP GT+L VNVW++ RDP++W +P  F PERF+T+      + +Q+
Sbjct  366   PREAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHTDVDFRGQQF  425

Query  341   QFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLE  162
             + +PFG GRRSCPG  +A Q+  + +ARL   F  +T  ++P+DM E  G+ +PK TPLE
Sbjct  426   ELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKATPLE  485

Query  161   VLVTPRLSPT  132
             V+++PRL P 
Sbjct  486   VVLSPRLPPN  495



>ref|XP_006443550.1| hypothetical protein CICLE_v10019727mg [Citrus clementina]
 ref|XP_006479221.1| PREDICTED: cytochrome P450 82G1-like isoform X1 [Citrus sinensis]
 ref|XP_006479222.1| PREDICTED: cytochrome P450 82G1-like isoform X2 [Citrus sinensis]
 gb|ESR56790.1| hypothetical protein CICLE_v10019727mg [Citrus clementina]
Length=520

 Score =   471 bits (1212),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 225/487 (46%), Positives = 325/487 (67%), Gaps = 7/487 (1%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             PE  GAWP+IGHL       P+ K L   ADKYGP++++RLG    L+VSSWE V+DCF 
Sbjct  39    PEPFGAWPLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFT  98

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
             TND++LA RP+  AGKYLGYD AVF  +    YWR +RK+   ++LSS RLE LKHV  S
Sbjct  99    TNDRVLATRPSIAAGKYLGYDNAVFALAPYGRYWRDIRKIATTDLLSSHRLELLKHVRYS  158

Query  1223  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEA  1044
             E+ T IK+LY+  S +  NP+  KV +S+    LT N+ ++++AG+R+  R  G    E 
Sbjct  159   EVDTFIKDLYSRCSENAFNPA--KVVISKLIEQLTFNISLRLIAGKRFSAREFGEQGSEG  216

Query  1043  QRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARR  864
              R+ +   +  YL G FV GDAI P  +  W+D++GH+ +M+R AK +D ++ +W++   
Sbjct  217   WRINRAIKEATYLTGVFVLGDAI-P--WLEWIDFQGHIGSMRRTAKKIDDVIGNWLE-EH  272

Query  863   KERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAV  684
              +R+   +  F+DV+LS I+D  T    ++RDTVIKA  L ++   SE+    + W L++
Sbjct  273   AQRKLQGEGDFMDVLLSKIEDN-TVMSGHTRDTVIKATALILIFTGSESTYLGIIWTLSL  331

Query  683   LLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVE  504
             LL HP+ LK+ Q+E+D ++G++RW  +SD+KNL YL+ +VKETLR+YP GP     EA+E
Sbjct  332   LLNHPKELKKAQEELDVHVGRDRWVNESDMKNLKYLRAIVKETLRIYPPGPVTGIREAME  391

Query  503   DCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFG  324
             DC + GYH+PKGT+L VNVW+LHRDP++W +P +F PERF+T         + ++++PF 
Sbjct  392   DCEIGGYHVPKGTRLIVNVWKLHRDPRMWENPCEFRPERFLTTHADVDVNTQHFEYIPFS  451

Query  323   LGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPR  144
              GRRSCPG     QI Q+ +AR+ QGF+ +TV   P+DM E +GI LPKL P+EV++ PR
Sbjct  452   FGRRSCPGMTSGLQIVQLTLARILQGFDLATVGGIPVDMKEGLGIALPKLNPVEVVIKPR  511

Query  143   LSPTLFR  123
             LS  L++
Sbjct  512   LSDDLYQ  518



>ref|XP_006434890.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
 gb|ESR48130.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
Length=521

 Score =   471 bits (1211),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 224/490 (46%), Positives = 323/490 (66%), Gaps = 11/490 (2%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCF  1407
             PE  GAWPIIGHLH       L+ +TL   ADK+GP F IRLG     VVSSWE V++CF
Sbjct  33    PEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECF  92

Query  1406  ATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWV  1227
               NDK LA+RP T A K++GYDYAVF F+    +WR +RK+   E+LS+RRLE LKHV +
Sbjct  93    TINDKALASRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKIATLELLSNRRLEALKHVRI  152

Query  1226  SELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEE  1047
             SE+   +++LY   + +++ P    V + +W   +TLN+++++VAG+RY   S    + E
Sbjct  153   SEVDMGLRDLYGLWAKNDSRPVL--VELKKWLEDMTLNMVVRMVAGKRYFGASATCDDSE  210

Query  1046  AQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR  867
             A++ +K  +Q  +L G F   DA   L FF WLD++GH   MK+ AK++DAIL+ W++  
Sbjct  211   ARQCQKAINQFFHLIGIFTVSDA---LPFFWWLDWQGHEMAMKKTAKELDAILEGWLEEH  267

Query  866   RKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHL  702
             R+ R      S  +Q FIDVMLS+ ++     + +S D  IK+  L+++   S+T +  L
Sbjct  268   RQRRVSGGIESESEQDFIDVMLSLQEEGHLSQFQHSADISIKSTCLALILGGSDTTSGTL  327

Query  701   TWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLA  522
             TW +++LL +P  LK+ Q+E+D  IG +R  +DSD+KNL YLQ ++KETLR+YP GP L 
Sbjct  328   TWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLG  387

Query  521   PHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQY  342
             P EA+EDC V GYHIP GT+L VNVW++ RDP++W +P  F PERF+T+      + +Q+
Sbjct  388   PREAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHTDVDFRGQQF  447

Query  341   QFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLE  162
             + +PFG GRRSCPG  +A Q+  + +ARL   F  +T  ++P+DM E  G+ +PK TPLE
Sbjct  448   ELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKATPLE  507

Query  161   VLVTPRLSPT  132
             V+++PRL P 
Sbjct  508   VVLSPRLPPN  517



>ref|XP_008372515.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=524

 Score =   470 bits (1210),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 239/525 (46%), Positives = 335/525 (64%), Gaps = 17/525 (3%)
 Frame = -1

Query  1667  PCCLSSILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1500
             P  L +I GI   VL  +  + QS +    L P+  GA PIIGHLH      PL +TL+ 
Sbjct  4     PSHLLAIAGILLFVLYLWRVKIQSHKTKGVLTPQPSGALPIIGHLHKLGGKNPLCRTLAS  63

Query  1499  WADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFS  1320
              ADKYGP+FTIRLG    LV+S+ +AV++CF  ND + AARP +  G+YLGY+YA F FS
Sbjct  64    MADKYGPIFTIRLGKHPALVISNHDAVKECFTKNDIVFAARPKSAHGRYLGYNYAGFGFS  123

Query  1319  TNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMS  1140
                +YWR +RK+V+ E+LSSRRL+ LKHV +SE+ + IK LY        N  + KV +S
Sbjct  124   PYGTYWRNMRKMVIAELLSSRRLQTLKHVQISEVDSFIKGLYEICKTKGXNGQS-KVVIS  182

Query  1139  RWFGHLTLNLIMQIVAGRRY----EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
              W  HLTL +I Q++AG+RY    +  +D     E +R++++  + M + G  V  D I 
Sbjct  183   EWIEHLTLXVITQMIAGKRYFDWGKVGNDSDNEGENKRIREIVKEFMLVSGMPVISDMI-  241

Query  971   PLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR---RKERRSNEDQKFIDVMLSMIDD  801
                +  W+D+ G VK MKR  K++DA+   W++     RKE  S +   FIDVMLS+I+D
Sbjct  242   --GYPDWIDFLGQVKNMKRIGKELDALTASWIEEHNNARKEIDSRDKLDFIDVMLSVIED  299

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
                 G++  R+T+IKA   +++   S+T A  L WI+++LL +   LK  Q+EI+  +G 
Sbjct  300   NTVLGHT--RETIIKATSQNLIIAGSDTTAISLKWIISLLLNNRHVLKHAQEEINLKVGT  357

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             ERW ED+D++NL  LQ +VKETLR+YP GP   PHEA+EDC V G+HI KGT+L+VN+W+
Sbjct  358   ERWVEDTDIENLTXLQAIVKETLRLYPPGPLSVPHEAMEDCQVCGFHIXKGTRLFVNLWK  417

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             LHRDP +W DPE F P+RF+T      A    ++F+PFG GRRSCPG  +A Q+  + + 
Sbjct  418   LHRDPTMWSDPEMFYPDRFLTTQASIDASGNHFEFIPFGSGRRSCPGLTFAMQVIHLTLG  477

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             RL QGF  +T  + P+DM E +G+ LPK T LEV++TPRL   L+
Sbjct  478   RLIQGFELATPLDMPVDMTEGLGVTLPKATSLEVVLTPRLPIELY  522



>ref|XP_009364162.1| PREDICTED: cytochrome P450 82C4-like [Pyrus x bretschneideri]
Length=529

 Score =   470 bits (1209),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 227/502 (45%), Positives = 320/502 (64%), Gaps = 20/502 (4%)
 Frame = -1

Query  1592  RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             R  PE  G WPIIGHLH       L+ +TL   ADKYGP F IRLG  R  VVSSWE  +
Sbjct  34    REAPEPAGGWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSSWEVAK  93

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             DCF  ND+ LA+RPTT A K++GY+YAVF F+  + +WR +RK+   E+LS+RRL+ LKH
Sbjct  94    DCFTVNDRALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLDMLKH  153

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS----  1068
             V  SEL   IKELY  + + N       V ++ W   LTLN+++++VAG+RY   S    
Sbjct  154   VRTSELDMGIKELYN-LGVQNGGLRPAVVELNHWLEELTLNVVVRMVAGKRYFGASAKCE  212

Query  1067  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL  888
             DG   +EA+R +K   Q  +L G FV  DA+  LW   WLD +GH K MK+ AK++D IL
Sbjct  213   DG---DEARRCQKAIGQFFHLIGIFVVADALPFLW---WLDLQGHEKAMKKTAKELDGIL  266

Query  887   QDWVDARRKERRSNE--------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ  732
               W++  R+ R ++         D+ FIDVMLS+ ++     + YS DT IK+  L+++ 
Sbjct  267   GGWLEEHRQRRGASHGKAEDEGGDEDFIDVMLSLEEEGQLSNFQYSSDTSIKSTCLALIL  326

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
               S+T A  LTW +++L+ +P ++K+ Q+E+D ++G ER  E+SD+ NL YLQ ++KETL
Sbjct  327   GGSDTTAGTLTWAISLLINNPHAMKKAQEELDLHVGTERQVEESDITNLVYLQAIIKETL  386

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R+YP GP L P EA+EDC V GY +P GT+L VNVW++ RDP++W  P  F+PERF+ + 
Sbjct  387   RLYPAGPLLGPREALEDCTVAGYRVPAGTRLVVNVWKIQRDPRVWESPSAFVPERFLESH  446

Query  371   EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVG  192
                  + +Q+  +PFG GRRSCPG  +A Q+  + +ARL  GF   T   + +D+ E  G
Sbjct  447   SHVDVRGQQFNLMPFGFGRRSCPGVSFAMQVLHLTLARLLHGFKIETASGQAIDLTESPG  506

Query  191   IILPKLTPLEVLVTPRLSPTLF  126
             + +PK TPLE L++PRL   L+
Sbjct  507   LTIPKATPLEALLSPRLPSELY  528



>ref|XP_006355071.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=525

 Score =   469 bits (1208),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 233/512 (46%), Positives = 334/512 (65%), Gaps = 25/512 (5%)
 Frame = -1

Query  1661  CLSSILGIAALVLLWFSWRKQSKR-LPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWA  1494
              ++++L +A +   + S +K SK  LPPE  G WP+IGHL +F       PL + LS+ A
Sbjct  13    AIAALLTLAFIFYFFLSTKKSSKPPLPPEIAGGWPVIGHLFYFDNDGDDRPLARKLSDLA  72

Query  1493  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN  1314
             DKYGPVFT RLG+ R+LV+SS +AV+DC++ ND + A RP    G+YLGY+ A+   +  
Sbjct  73    DKYGPVFTFRLGLPRVLVISSSDAVKDCYSKNDAVFANRPACLYGEYLGYNNAMLFLANY  132

Query  1313  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW  1134
               YWR +RKLV++E+LS+ RLEKLK + + +++ NIK L++ I    N      VN++ W
Sbjct  133   GPYWRNIRKLVIQEVLSNTRLEKLKQIKLCKIRNNIKNLHSRIQ---NTEEKSVVNLTDW  189

Query  1133  FGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR  954
                L   LI+Q++AG+ YE   DG    E +R K+ F + + L  EFV  DA FP+  F+
Sbjct  190   LEELNFGLIVQMIAGKNYESGGDG----EMERFKEAFRKFLVLSMEFVLWDA-FPIPLFK  244

Query  953   WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSN--------EDQKFIDVMLS-MIDD  801
             W+D++GHVK MK+  KD+D+I Q W+D   K R ++         ++ FIDVMLS M ++
Sbjct  245   WIDFQGHVKLMKKTFKDIDSIFQRWLDEHVKTRETSLMEVNGGGNERDFIDVMLSKMSNE  304

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
                +GYS  RDTVIKA V S++ DA++T + H+ W + +L+ +   LK+ Q+EID  IGK
Sbjct  305   HLHEGYS--RDTVIKATVFSLVLDAADTVSLHINWGMTLLINNQHVLKKAQEEIDMKIGK  362

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             +RW +D+D+K+L YLQ ++KE LR+YP GP L PHE  EDC+V GYHIPKGT+LY NV +
Sbjct  363   DRWIDDNDIKDLVYLQAIIKEVLRLYPPGPLLVPHENTEDCVVSGYHIPKGTRLYTNVMK  422

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             L RD KIW +P++F P+RF T       Q+  Y+F+PFG GRRSCPG  YA Q+  + + 
Sbjct  423   LQRDLKIWSNPDQFNPDRFFTTDIDFRGQD--YEFIPFGSGRRSCPGMTYALQVEYLTIG  480

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPL  165
              L QGF++ T  +EPLDM E  G+ + K+  L
Sbjct  481   HLIQGFDYKTPSDEPLDMKEGPGMTMRKVMVL  512



>ref|XP_007017403.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
 gb|EOY14628.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
Length=527

 Score =   469 bits (1208),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 225/498 (45%), Positives = 327/498 (66%), Gaps = 13/498 (3%)
 Frame = -1

Query  1592  RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             R  P+  GAWPI+GHLH    S  L+ +TL   AD+YGP FTIRLG     VVSSWE  +
Sbjct  36    RTAPQPKGAWPILGHLHLLGGSDQLLYRTLGAMADEYGPAFTIRLGSRCAFVVSSWELAK  95

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +CF  NDK LA+RPTT A K++GY+YAVF F+  + +WR +RK+   E+LS+RRLE LKH
Sbjct  96    ECFTINDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEMLKH  155

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPK-VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGT  1059
             V +SE+   I+ELY   S+ ++N S P  V + +W   LTLN+++++VAG+RY   S   
Sbjct  156   VRISEVDMGIRELY---SLRHDNGSIPVLVELKQWLEDLTLNVVVRMVAGKRYFGASAVC  212

Query  1058  INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW  879
             ++ EA+R +K   +   L G FV  DA+  LW   WLD  GH K MK  AK++D +L+ W
Sbjct  213   VDGEARRCQKAIKEFFRLIGMFVVSDALPLLW---WLDVHGHEKAMKMTAKELDDLLEAW  269

Query  878   VDARRKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
             +   R+ R     ++  +Q FIDVMLS+ ++     + Y  D  IK+  L+++   ++T 
Sbjct  270   LKEHRQRRISGGIKAEGEQDFIDVMLSLQEEGHLANFQYDADISIKSTCLALILGGTDTT  329

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
             A  LTW +++LL +PE LK+ Q+E+D  +G+ER  ++SD++NL YLQ ++KETLR+YP G
Sbjct  330   AGTLTWAISLLLNNPELLKKAQEELDLQVGRERLVDESDIQNLVYLQAIIKETLRLYPAG  389

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P L P EA+ DC V GYH+P GT+L VNVW++ RDP++W +P  F+PERF+T+      +
Sbjct  390   PLLGPREAMNDCTVAGYHVPAGTRLIVNVWKIQRDPRVWSNPSAFVPERFLTSHANVDVR  449

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
              +Q++ +PFG GRRSCPG  +A Q+  + +AR    F  ST  ++P+DM E  G+ +PK 
Sbjct  450   GQQFELIPFGSGRRSCPGASFALQLLHLTLARFLHAFELSTPLDQPVDMTESPGLTIPKA  509

Query  173   TPLEVLVTPRLSPTLFRL  120
             TPLEVL+ PR+   ++ L
Sbjct  510   TPLEVLLKPRVPANVYAL  527



>ref|XP_009348374.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   469 bits (1208),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 234/520 (45%), Positives = 332/520 (64%), Gaps = 17/520 (3%)
 Frame = -1

Query  1667  PCCLSSILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1500
             P  L +I+GI   VL  +  + QS++    L P+A GA PIIGHLH      PL +TL+ 
Sbjct  4     PSHLLAIVGILLFVLYLWRVKVQSRKTKGMLAPQASGALPIIGHLHKLGGKKPLCRTLAS  63

Query  1499  WADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFS  1320
              ADKYGP+FTIRLG    LV+++++AV++CF  ND   A+R  +  G+YLGY+YA F F+
Sbjct  64    MADKYGPIFTIRLGKHPALVINNYDAVKECFTKNDIAFASRSKSAQGRYLGYNYAGFGFA  123

Query  1319  TNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMS  1140
                +YWR +RK+V  E+LSSRRL+ LKHV + E+ + IK LY        N  + KV +S
Sbjct  124   PYGTYWRNMRKMVTVELLSSRRLQTLKHVQICEVDSFIKGLYEICKTKGENGQS-KVVIS  182

Query  1139  RWFGHLTLNLIMQIVAGRRY----EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
              W  HLTLN+I Q++AG+RY       +D     E +R++ +  + M + G+    D I 
Sbjct  183   EWIEHLTLNVITQMIAGKRYFDLGTVGNDSDNEGENKRIRGMVKEFMCVAGKPAVSDVI-  241

Query  971   PLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR---RKERRSNEDQKFIDVMLSMIDD  801
                F  W+D  G VK MKR  KD D+++  W++     RKE  S +   FIDVMLS+I+D
Sbjct  242   --GFPHWIDLMGQVKNMKRIGKDFDSLMAGWIEEHKNARKEIDSRDKLDFIDVMLSVIED  299

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
                 G++  R+T+IKA   +++   S+T AT LTWIL++LL +   LK  Q+EI+  +G 
Sbjct  300   NTVLGHT--RETIIKATSQTLILAGSDTTATSLTWILSLLLNNRHVLKHAQEEINLQVGT  357

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             ERW ED+D+K+L YLQ +VKETLR+YP  P    HEA+EDC V G++IPKGT+L+ N+W+
Sbjct  358   ERWVEDTDIKDLTYLQAIVKETLRLYPPAPLSTSHEAMEDCQVCGFYIPKGTRLFTNLWK  417

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             LHRDP +W DPE F P+RF+T         + ++F+PFG GRRSCPG  +A Q+  + + 
Sbjct  418   LHRDPSVWSDPEVFCPDRFLTTQASIDVSGQHFEFIPFGSGRRSCPGLTFAMQVIHLTLG  477

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
             RL QGF  +T  + P+DM E +G+ +PK T LEV++TPRL
Sbjct  478   RLIQGFELATPLDMPVDMAEGLGVTMPKATSLEVVLTPRL  517



>ref|XP_008378409.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=529

 Score =   468 bits (1204),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 228/502 (45%), Positives = 323/502 (64%), Gaps = 20/502 (4%)
 Frame = -1

Query  1592  RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             R  PE  G WPIIGHLH       L+ +TL   ADKYGP F IRLG  R  VVSSWE  +
Sbjct  34    REAPEPAGGWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSSWEVAK  93

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             DCF  ND+ LA+RPTT A K++GY+YAVF F+  + +WR +RK+   E+LS+RRL+ L+H
Sbjct  94    DCFTVNDRALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLDMLRH  153

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS----  1068
             V  SEL   IKELY+ + + N       V ++ W   LTLN+++++VAG+RY   S    
Sbjct  154   VRTSELDMGIKELYS-LWVQNGGLRPAVVELNHWLEELTLNVVVRMVAGKRYFGASAKCE  212

Query  1067  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL  888
             DG   +EA+R +K   Q  +L G FV  DA+  LW   WLD +GH K MK+ AK++D IL
Sbjct  213   DG---DEARRCQKAIGQFFHLIGIFVVADALPFLW---WLDLQGHEKAMKKTAKELDGIL  266

Query  887   QDWVDARRKERRSNE--------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ  732
               W++  R+ R ++         D+ FIDVMLS+ ++     + YS DT IK+  L+++ 
Sbjct  267   GGWLEEHRQRRGASHGEAEDEGGDEDFIDVMLSLEEEGQLSNFQYSSDTSIKSTCLALIL  326

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
               S+T A  LTW +++LL +P+++K  Q+E+D ++G ER  E+SD+ NL YLQ ++KETL
Sbjct  327   GGSDTTAGTLTWAISLLLNNPDAMKMAQEELDLHVGTERQVEESDITNLVYLQAIIKETL  386

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R+YP GP L P EA+EDC V GY +P GT+L VNVW++ RDP++W +P  F+PERF+ + 
Sbjct  387   RLYPAGPLLGPREALEDCTVAGYRVPAGTRLVVNVWKIQRDPRVWENPSAFVPERFLESH  446

Query  371   EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVG  192
                  + +Q+  +PFG GRRSCPG  +A Q+  + +ARL  GF   T   + +D+ E  G
Sbjct  447   SHVDVRGQQFNLMPFGFGRRSCPGVSFAMQVLHLTLARLLHGFKIETASGQSVDLTESPG  506

Query  191   IILPKLTPLEVLVTPRLSPTLF  126
             + +PK TPLEVL++PRL   L+
Sbjct  507   LTIPKATPLEVLLSPRLPSELY  528



>ref|XP_011045174.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Populus 
euphratica]
Length=531

 Score =   468 bits (1204),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 230/527 (44%), Positives = 346/527 (66%), Gaps = 26/527 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFSWRK--QSKR------LPPEAGGAWPIIGHLHHFRTSVPLVKTLS  1503
             L +I  + ALVL W++ R+  +S+R        PE  GA P+IGHLH       L +TL+
Sbjct  11    LLAISTVLALVL-WYTLRRVRESRRKTEKGLQAPEPSGALPLIGHLHLLGAQKTLARTLA  69

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
               ADKYGP+FTIRLG    +VVS+ EA+++CF T+D++L++RP +  G+YL Y+YA F F
Sbjct  70    AIADKYGPIFTIRLGKHPTVVVSNLEAIKECFTTHDRILSSRPRSSHGEYLSYNYAAFGF  129

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             + +  +WR +RK+V  ++LSS RL+ L+HV VSE+ T I +LY      +N   + K+ +
Sbjct  130   TNSGPFWREMRKIVTIQLLSSHRLKSLRHVQVSEVNTLINDLYLL--SKSNKQGSTKIVI  187

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             S  F  +T+N+I +++AG+RY + S     EE +R+ K+  + MY+ G FV  D I P  
Sbjct  188   SECFERMTINMITRMIAGKRY-FSSTEAEKEEGKRIGKLMKEFMYISGVFVPSDLI-P--  243

Query  962   FFRWLD-YEGHVKTMKRAAKDVDAILQDWVDARRKERRSN-------EDQKFIDVMLSMI  807
             F  W++ + G VKTMKR ++++D++++ W+   + +R  +       +D  FIDVMLS++
Sbjct  244   FLGWINNFLGSVKTMKRLSRELDSLMESWIQEHKLKRLESTENTNKMDDDDFIDVMLSLL  303

Query  806   DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
             DD  +    YSR+T+IKA  ++++   ++T +  LTWIL+ LL +  SL+  Q+E+D  +
Sbjct  304   DDSMS---GYSRETIIKATAMTLIIAGADTTSITLTWILSNLLNNRRSLQLAQEELDLKV  360

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             G+ERWAEDSD+ NL Y+Q ++KETLR+YP GP   PHEA ED  V GYH+PKGT+L+ N+
Sbjct  361   GRERWAEDSDIGNLVYIQAIIKETLRLYPPGPLSVPHEATEDFCVAGYHMPKGTRLFTNL  420

Query  446   WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             W+LHRDP +W +P++++PERF+ +          ++ +PFG GRRSCPG  +A Q+  + 
Sbjct  421   WKLHRDPNLWSNPDEYMPERFLNDHANLDVLGHHFELIPFGSGRRSCPGITFALQVLHLT  480

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              ARL QGF+  T   E +DM E V I LPK TPLE+ +TPRLSP L+
Sbjct  481   FARLLQGFDMKTPRGESVDMTEGVAITLPKATPLEIHITPRLSPELY  527



>ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
 emb|CBI19595.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   468 bits (1204),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 234/500 (47%), Positives = 329/500 (66%), Gaps = 12/500 (2%)
 Frame = -1

Query  1604  KQSK-RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSS  1431
             K SK R  PE GGAWPIIGHLH       L+ +TL   ADKYGP F IRLG  R  VVSS
Sbjct  31    KSSKSRDAPEPGGAWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSS  90

Query  1430  WEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRL  1251
             WE  ++CF  NDK LA RPTT A K++GY+YAVF F+  + +WR +RK+   E+LS+RRL
Sbjct  91    WEVAKECFTINDKALATRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRL  150

Query  1250  EKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR  1071
             E LKHV  SE+   I+ELY     +++ P    V ++RW   +TLN+I+++VAG+RY   
Sbjct  151   EILKHVRTSEVDMGIRELYGLWVKNSSRPLL--VELNRWLEDMTLNVIVRMVAGKRYFGA  208

Query  1070  SDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAI  891
             +  + + EA+R +K  SQ   L G FV  DA+  LW   WLD +GH + MK  AK++D+I
Sbjct  209   AAASDSSEARRCQKAISQFFRLIGIFVVSDALPFLW---WLDLQGHERAMKTTAKELDSI  265

Query  890   LQDWVDARRKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA  726
             L+ W++  R+ R     ++  +Q FIDVMLS+ ++    G+ Y  +T IK+  L+++   
Sbjct  266   LEGWLEEHRQRRVSSLIKAEGEQDFIDVMLSLQEEGRLSGFQYDSETSIKSTCLALILGG  325

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             S+T A  LTW +++LL +  +LK+ Q+E+D  +G ER  E+SDVKNL YLQ ++KETLR+
Sbjct  326   SDTTAGTLTWAISLLLNNRHALKKAQEELDLCVGMERQVEESDVKNLVYLQAIIKETLRL  385

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP GP L P EA++DC V GY++P GT+L VN+W+L RDP +W +P  F PERF+     
Sbjct  386   YPAGPLLGPREALDDCTVAGYNVPAGTRLIVNIWKLQRDPSVWTNPCAFQPERFLNAHAD  445

Query  365   EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII  186
                + +Q++ +PFG GRRSCPG  +A Q+  + +ARL   F  ST  ++P+DM E  G+ 
Sbjct  446   VDVKGQQFELMPFGSGRRSCPGVSFALQVLHLTLARLLHAFELSTPVDQPVDMTESSGLT  505

Query  185   LPKLTPLEVLVTPRLSPTLF  126
             +PK TPLEVL+TPRL+  L+
Sbjct  506   IPKATPLEVLLTPRLNSKLY  525



>gb|KCW58034.1| hypothetical protein EUGRSUZ_H00762, partial [Eucalyptus grandis]
Length=529

 Score =   468 bits (1203),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 230/504 (46%), Positives = 333/504 (66%), Gaps = 20/504 (4%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW  1428
             + +   LPPE  GAWPIIGH+H      PL +TL+  ADK GP+F IRLG+    ++SS 
Sbjct  29    KPKGTALPPELPGAWPIIGHIHLLGGETPLARTLAAMADKQGPMFRIRLGVHPATIISSR  88

Query  1427  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE  1248
             EAVR+CF T+DK LA+RP + AG +LGY YA F F     +WR +RK+ + E+LS+RRL+
Sbjct  89    EAVRECFTTHDKDLASRPKSKAGIHLGYGYAGFGFVEYGDFWREMRKITMLELLSTRRLD  148

Query  1247  KLKHVWVSELQTNIKELYTFI---SMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
              LKHV  SE+ T +K+L+      S+D  N S+  V +S+    LTLN+I++++A +RY 
Sbjct  149   NLKHVQASEIDTFVKDLHALCRTNSIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRYF  208

Query  1076  YRSDGTI------NEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKR  915
               S  +       +EEA  L++V  + MY+ G F +   + P  F  W D  G VKTMKR
Sbjct  209   GLSSASTGSSADDDEEASHLRRVIKEFMYISG-FPAVSDLVP--FTGWTDCVGTVKTMKR  265

Query  914   AAKDVDAILQDWVDARRKERRSNE--------DQKFIDVMLSMIDDQFTQGYSYSRDTVI  759
              A+++D I+  WV+  + +R  ++         + FIDVMLS+I +     + +S +T+I
Sbjct  266   VARELDEIVGKWVEEHKLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETLI  325

Query  758   KAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPY  579
             KA +++++   S++ + +LTW+L++LL H   LKR Q+EID  +GK+RW +DSD++NL Y
Sbjct  326   KATIVNIIVAGSDSTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDRWVQDSDIENLLY  385

Query  578   LQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKF  399
             LQ +VKETLR+YP GP L PHEA  DC V GY IPKGT+++VN W+LHRDP++W +PEKF
Sbjct  386   LQAIVKETLRLYPPGPLLVPHEARADCNVRGYLIPKGTRIFVNAWKLHRDPQVWSEPEKF  445

Query  398   LPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNE  219
             LPERF+TN  G  A  + ++F+PFG GRR CPG  +A + T + +ARL QGF+ +T  +E
Sbjct  446   LPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLATSLDE  505

Query  218   PLDMMEDVGIILPKLTPLEVLVTP  147
              +DM E +G+ LPK TPL V++ P
Sbjct  506   LVDMTEGLGVNLPKATPLRVVLNP  529



>ref|XP_009595933.1| PREDICTED: cytochrome P450 82A4-like [Nicotiana tomentosiformis]
Length=523

 Score =   467 bits (1201),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 234/522 (45%), Positives = 329/522 (63%), Gaps = 33/522 (6%)
 Frame = -1

Query  1640  IAALVLLWF------SWRKQSKRLPPEAGGAWPIIGHLHHFRTSV----PLVKTLSEWAD  1491
             IA LV L F      ++RK SK L PE  G WP+IGHL +F+        L + L + AD
Sbjct  18    IAGLVTLAFVFYFLWNFRKSSKTLAPEIPGGWPVIGHLFYFKNDADHDRTLAQKLGDLAD  77

Query  1490  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN  1311
             K+GPVFT +LG  R LVVSS++A+++CF TND   + RP    G +L Y+ A+   +   
Sbjct  78    KHGPVFTYKLGFRRFLVVSSYDAIKECFTTNDIRFSNRPALLYGDHLCYNNAMLFIAKYG  137

Query  1310  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF  1131
              YWR++RKLV +E+LS  RLEK K++  S +Q N+KELY        +     +N++ W 
Sbjct  138   PYWRKIRKLVNQEVLSVNRLEKFKYIRFSIVQENVKELY--------DHCDSTINLTDWI  189

Query  1130  GHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW  951
               L+ ++I++++AG+ Y        N   + LK  F + M +  EF   D IFP+  F+W
Sbjct  190   DKLSFDIILKMIAGKSYN-------NGHGEILKIAFQKFMVIAMEFELYD-IFPIPLFKW  241

Query  950   LDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNED------QKFIDVMLSMIDDQFTQ  789
             +D+ G+VK +K   KD+D + Q W+D   K+R SN +      Q FID MLS   ++   
Sbjct  242   VDFSGNVKVVKETFKDIDTVFQGWLDEHIKKRESNNEVLDENEQDFIDSMLSKTSNE-RL  300

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
             G +YS  T IKA + S++ DA+ET A H+ W++A+L+ +   +K+ Q+EIDT +GK+RW 
Sbjct  301   GDTYSPSTTIKATIFSLVLDATETLALHIKWVMALLINNKLEMKKAQEEIDTIVGKDRWV  360

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
             E+SD+KNL YLQ +VKE LR+YP  P   PHE+VEDC+V+GYHIPKGT L  NV +L RD
Sbjct  361   EESDIKNLVYLQAIVKEALRLYPPAPLSVPHESVEDCVVNGYHIPKGTVLLPNVMKLQRD  420

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ  249
             PK+W DP KF PERF+T       + + Y+ +PFG GRR+CP   YA Q+  +++A L Q
Sbjct  421   PKMWLDPNKFDPERFLTTHAKIDYRGQHYELIPFGTGRRACPAMTYALQVEYLSIAHLIQ  480

Query  248   GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             GFNF+T  NEPLDM E VGI  PK  P+EVL+TPRL   L++
Sbjct  481   GFNFNTPSNEPLDMKEGVGITSPKKNPIEVLITPRLPTMLYQ  522



>ref|XP_011040244.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=544

 Score =   467 bits (1202),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 235/524 (45%), Positives = 339/524 (65%), Gaps = 25/524 (5%)
 Frame = -1

Query  1655  SSILGIAALVL-----LWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD  1491
             S  LG+  L +     L  S ++    LPPE  GAWP+IGHL    + +PL +TL + AD
Sbjct  32    SFFLGLVLLCMIIWRILSTSHKRNKTLLPPEPSGAWPLIGHLRILNSQIPLFRTLGDLAD  91

Query  1490  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN  1311
             K+GPVF+IRLG+ R LV+SSWE+V++CF TND+    RP+  A KY+GYD A F F    
Sbjct  92    KHGPVFSIRLGMRRTLVISSWESVKECFKTNDRKFLNRPSVAASKYMGYDDAFFGFHPYG  151

Query  1310  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF  1131
              YW  +RK+  +E+LS+ RLE LKHV VSE++T IKEL+T  S    N S   ++MS+WF
Sbjct  152   EYWLEMRKIATQELLSNSRLELLKHVRVSEIETCIKELHTTCS----NGSV-LLDMSQWF  206

Query  1130  GHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW  951
               +  N++ +++AG+RY     G   +++    ++  +  YL G  V+ D I P  F  W
Sbjct  207   SCIVANVMFRLIAGKRY----CGGTGKDSGACGRLIKEFFYLSGVLVTSDLI-P--FTEW  259

Query  950   LDYEGHVKTMKRAAKDVDAILQ-DWVDARRKERRSN----EDQKFIDVMLSMIDDQFTQG  786
             +D++GH+K+MKR AK++D ++   W+    + R       E++ F+DVML  +D      
Sbjct  260   MDFQGHLKSMKRVAKELDDVVSGQWLVEHLQRREEGLVRKEEKDFMDVMLESLDSLAIGE  319

Query  785   ---YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
                + Y R+T++KA  L++L    +T +  LTW L++LL H E LKR Q EID ++G  R
Sbjct  320   EPIFVYKRETIVKATALNLLLAGIDTTSITLTWALSLLLNHTEVLKRAQKEIDIHVGTTR  379

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W E+SD+KNL YLQ +VKETLR+YP GP L P E++EDC VDGY +P+GTQL VN W+LH
Sbjct  380   WVEESDIKNLVYLQAIVKETLRLYPPGPLLVPRESLEDCYVDGYLVPRGTQLLVNAWKLH  439

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RD +IW +P +F PERF+T+      + +Q+++VPFG GRRSCPG   + Q+  + ++RL
Sbjct  440   RDARIWENPYEFHPERFLTSHGSTDVRGQQFEYVPFGSGRRSCPGISSSLQMLHLTLSRL  499

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
              QGFNFST  N  +DM E +G+ +PK TPLEV++TPRL   +++
Sbjct  500   LQGFNFSTPMNAQVDMSEGLGLTMPKATPLEVVLTPRLENEIYQ  543



>ref|XP_010069621.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Eucalyptus 
grandis]
Length=542

 Score =   467 bits (1201),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 232/511 (45%), Positives = 331/511 (65%), Gaps = 20/511 (4%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW  1428
             + +   LPPE  GAWPIIGHLH      PL +TL+  ADK GP+F IRLG+    ++SS 
Sbjct  29    KPKGTALPPELPGAWPIIGHLHLLGGETPLARTLAAMADKQGPMFRIRLGVHPATIISSQ  88

Query  1427  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE  1248
             EAVR CF T+DK LA+RP +  G + GY YA F F+     WR +RK+ + E+LS+RRL+
Sbjct  89    EAVRKCFTTHDKDLASRPKSKVGIHFGYGYAGFGFAEYGDLWREMRKITMLELLSTRRLD  148

Query  1247  KLKHVWVSELQTNIKELYTFI---SMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY-  1080
              LKHV  SE+ T +K+L+      ++D  N S+  V +S+    LTLN+I++++A +RY 
Sbjct  149   NLKHVQASEIDTFVKDLHALCRTNAIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRYF  208

Query  1079  -----EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKR  915
                     S    +EEA  L+KV  + MY+ G F +   + P  F  W D  G VKTMKR
Sbjct  209   GLLSASTGSSTDDDEEASHLRKVIKEFMYISG-FPTVSELVP--FTGWTDCVGTVKTMKR  265

Query  914   AAKDVDAILQDWVDARRKERRSNE--------DQKFIDVMLSMIDDQFTQGYSYSRDTVI  759
              A+++D I+  WV+  + +R  ++         + FIDVMLS+I +     + +S +T+I
Sbjct  266   VAREMDEIVGKWVEEHKLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETLI  325

Query  758   KAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPY  579
             KA V++++   S+T + +LTW+L++LL H   LKR Q+EID  +GK++W +DSD+ +L Y
Sbjct  326   KATVVNIIVAGSDTTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDKWVQDSDIGSLHY  385

Query  578   LQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKF  399
             LQ +VKETLR+YP GP   PHEA  DC V GY IPKGT+++VNVW+LHRDP++W DPEKF
Sbjct  386   LQAIVKETLRLYPPGPLSIPHEARADCNVRGYLIPKGTRIFVNVWKLHRDPQVWSDPEKF  445

Query  398   LPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNE  219
             LPERF+TN  G  A  + ++F+PFG GRR CPG  +A + T + +ARL QGF+ +   +E
Sbjct  446   LPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLAISSDE  505

Query  218   PLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +DM E +G+ LPK TPL V++ PRL   L+
Sbjct  506   LVDMTEGIGLNLPKATPLRVVLNPRLPSMLY  536



>ref|XP_009792748.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   466 bits (1199),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 237/529 (45%), Positives = 339/529 (64%), Gaps = 32/529 (6%)
 Frame = -1

Query  1658  LSSILGIAALV----LLWFSW-RKQSK---RLPPEAGGAWPIIGHLHHFRTSVP----LV  1515
             LS I  I  LV    LL+F W +KQSK    LPP+  G WP+IGHL +F+ +        
Sbjct  5     LSPIEAIVGLVTFAFLLYFLWTKKQSKILNPLPPKIPGGWPVIGHLFYFKNNGDDDRHFS  64

Query  1514  KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYA  1335
             + L + ADKYGPVFT RLG  R L VSS+EA+++CF+TND   A RP    G+YL Y+ A
Sbjct  65    QKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFSTNDIHFADRPALLYGEYLCYNNA  124

Query  1334  VFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP  1155
             +   +    YW++ RKLV +E+LS  RLEK KHV  S +Q NIKELY     D ++P   
Sbjct  125   MLAVAKYGPYWKKNRKLVNQELLSVSRLEKFKHVRFSIVQKNIKELY-----DGDSPMV-  178

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI  975
             K+N+S W   LT ++I+++V G+ Y        N   + LK  F + M    E    D +
Sbjct  179   KINLSDWIDKLTFDIILKMVVGKTYN-------NGHGEILKAAFQKFMVQAMEIELYD-V  230

Query  974   FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDVMLSM  810
             F + FF+WLD  G++K MK+  KD+D I+Q W+D   K+R + +     +Q FIDV+LS 
Sbjct  231   FHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDEHIKKRETKDVGGENEQDFIDVVLSK  290

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
               ++   G  YS DT IKA V +++ DA++T A H+ W++A+++ +   +K+ Q+E+DT 
Sbjct  291   RSNEHL-GDGYSHDTTIKATVFTLVLDATDTLALHIKWVMALMINNKNVMKKAQEEMDTI  349

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +G++RW E+SD+KNL YLQ +VKE LR++P  P    H +V+DC+V+GYHIPKGT L  N
Sbjct  350   VGRDRWVEESDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSVKDCVVNGYHIPKGTALLTN  409

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             + +L RDP+IW DP+KF PERF+T       + + Y+ +PFG GRR+CP   Y+ Q+  +
Sbjct  410   IMKLQRDPQIWADPDKFDPERFLTTHAAIDYRGQHYELIPFGTGRRACPAMNYSLQVEHL  469

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             ++A + QGFNF+T  NEPLDM + VG+ LPK T +EVL+TPRL PTL++
Sbjct  470   SIAHMIQGFNFATTTNEPLDMKQGVGLTLPKKTDVEVLITPRLPPTLYQ  518



>ref|XP_009770601.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   465 bits (1197),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 236/529 (45%), Positives = 339/529 (64%), Gaps = 32/529 (6%)
 Frame = -1

Query  1658  LSSILGIAALV----LLWFSW-RKQSK---RLPPEAGGAWPIIGHLHHFRTSVP----LV  1515
             LS I  I  LV    LL+F W +KQSK    LPP+  G WP+IGHL +F+ +        
Sbjct  5     LSPIEAIVGLVTFAFLLYFLWTKKQSKILNPLPPKIPGGWPVIGHLFYFKNNGDDDRHFS  64

Query  1514  KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYA  1335
             + L + ADKYGPVFT RLG  R L VSS+EA+++CF+TND   A RP    G+YL Y+ A
Sbjct  65    QKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFSTNDIHFADRPALLYGEYLCYNNA  124

Query  1334  VFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP  1155
             +   +    YW++ RKLV +E+LS  RLEK KHV  S +Q NIKELY     D ++P   
Sbjct  125   MLAVAKYGPYWKKNRKLVNQELLSVSRLEKFKHVRFSIVQKNIKELY-----DGDSPMV-  178

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI  975
             K+N+S W   LT ++I++++ G+ Y        N   + LK  F + M    E    D +
Sbjct  179   KINLSDWIDKLTFDIILKMIVGKTYN-------NGHGEILKAAFQKFMVQAMEIELYD-V  230

Query  974   FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDVMLSM  810
             F + FF+WLD  G++K MK+  KD+D I+Q W+D   K+R + +     +Q FIDV+LS 
Sbjct  231   FHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDEHIKKRETKDVGGENEQDFIDVVLSK  290

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
               ++   G  YS DT IKA V +++ DA++T A H+ W++A+++ +   +K+ Q+E+DT 
Sbjct  291   RSNEHL-GDGYSHDTTIKATVFTLVLDATDTLALHIKWVMALMINNKNVMKKAQEEMDTI  349

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +G++RW E+SD+KNL YLQ +VKE LR++P  P    H +V+DC+V+GYHIPKGT L  N
Sbjct  350   VGRDRWVEESDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSVKDCVVNGYHIPKGTALLTN  409

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             + +L RDP+IW DP+KF PERF+T       + + Y+ +PFG GRR+CP   Y+ Q+  +
Sbjct  410   IMKLQRDPQIWADPDKFDPERFLTTHAAIDYRGQHYELIPFGTGRRACPAMNYSLQVEHL  469

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             ++A + QGFNF+T  NEPLDM + VG+ LPK T +EVL+TPRL PTL++
Sbjct  470   SIAHMIQGFNFATTTNEPLDMKQGVGLTLPKKTDVEVLITPRLPPTLYQ  518



>emb|CAN75482.1| hypothetical protein VITISV_020998 [Vitis vinifera]
Length=500

 Score =   464 bits (1194),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 239/525 (46%), Positives = 331/525 (63%), Gaps = 38/525 (7%)
 Frame = -1

Query  1670  VPCCLSSILGIAALVLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKT  1509
              P  L +I GI  LVLL+  WR      K   +  PE  GAWP +GHL   R   P+ +T
Sbjct  3     TPSQLVAISGILGLVLLYGVWRVMTLAGKSKGKSAPEPSGAWPFLGHLPLLRGQTPIFRT  62

Query  1508  LSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVF  1329
             L   ADK+GPVF IRLG+ R LVVSS EAV++CF TNDK  A+RP++ AGK LGY++A F
Sbjct  63    LGAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKAFASRPSSSAGKILGYNHAGF  122

Query  1328  TFSTNNSYWRRVRKLVVEEILSSRRLEKLKHV--WVSELQTNIKELYTFISMDNNNPSAP  1155
              F+   + WR +RKL + EILS+   + +K    WV  +                     
Sbjct  123   GFAPYGALWREMRKLSMMEILSASSPQCVKSCSDWVHPV---------------------  161

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI  975
             KV MS WF HL+ N++++++AG+R    SD   NEEA+R      ++++L G FV  DAI
Sbjct  162   KVVMSEWFQHLSFNIVLKMIAGKRSFNTSDHG-NEEARRAIATIHKLLFLTGAFVLSDAI  220

Query  974   FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDD  801
               +    W+D +G++ +MKR AK+VD+++  WV+    R  R  N+ Q FIDVMLS+++D
Sbjct  221   PGV---EWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEMRLNREGNKRQDFIDVMLSVLED  277

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
               T  + YSR+TVIKA ++ ++   ++T +T  TW+L+ LL +  +LK  Q+E+D  +G+
Sbjct  278   --TSMFGYSRETVIKATIMILIVGGTDTLSTTSTWLLSALLNNKHALKCAQEELDLKVGR  335

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
              RW E+SD+ NL YLQ V+KETLR+Y   P  APHEA+EDC V GYHIPKGT+L+VN W+
Sbjct  336   GRWVEESDIPNLLYLQAVIKETLRLYTATPLSAPHEAMEDCHVAGYHIPKGTRLFVNAWK  395

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             LHRDP +W DPE F PERF+T         + ++ +PFG GRRSCPG   A ++  + + 
Sbjct  396   LHRDPSVWSDPEDFQPERFLTTHADLDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIG  455

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             RL QGF+ ST  N P+DM E + I L KLTPLEV++TPRL P+ F
Sbjct  456   RLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVMLTPRL-PSQF  499



>ref|XP_006443549.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
 ref|XP_006479223.1| PREDICTED: cytochrome P450 82G1-like [Citrus sinensis]
 gb|ESR56789.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
Length=525

 Score =   465 bits (1196),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 221/520 (43%), Positives = 330/520 (63%), Gaps = 17/520 (3%)
 Frame = -1

Query  1649  ILGIAALVLLWFSWR-------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD  1491
             I  + +L++++  WR       K+ K   PE  GAWP+IGHL       P+ K L   AD
Sbjct  10    IFELLSLLIVYCFWRIIAKSINKREKNTAPEPSGAWPLIGHLPLLNGQEPICKILGALAD  69

Query  1490  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN  1311
             KYGP++++RLG   IL+VSSWE V+DCF TND++LA R    AGK +GYD A+F  +   
Sbjct  70    KYGPIYSLRLGKHPILIVSSWEIVKDCFTTNDRILATRAKIVAGKLMGYDNAIFALAPYG  129

Query  1310  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF  1131
              YWR +RK+   E+LSS RLE LKHV  SE+ T IK+LY+  S +  NP+  KV +S+  
Sbjct  130   PYWRDIRKIATTELLSSHRLELLKHVRYSEVDTFIKDLYSLCSENAFNPA--KVVISKLI  187

Query  1130  GHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW  951
               LT N+ ++++AG+R+  +       EA R+ +   +  +L+G F+ GDAI    +  W
Sbjct  188   EQLTFNISLKLIAGKRFSAKDYEEQGSEAWRINRAIKEATHLFGVFILGDAIP---WLEW  244

Query  950   LDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQK----FIDVMLSMIDDQFTQGY  783
             +D++GHV +MK  AK++D ++ +W+  R + +   E        IDV+LS + +    G 
Sbjct  245   IDFQGHVGSMKSTAKEIDDVIGNWLKERLQNKLQGEGHNGKGDLIDVLLSKLQEDAVMG-  303

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              ++RDTV+KA  L ++   SE+    + W +++LL HP+ LK+ Q+E+D ++G++RW  +
Sbjct  304   GHTRDTVVKATALILILTGSESTYLGIIWTMSLLLNHPKELKKAQEELDVHVGRDRWVNE  363

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             SD+K L YL+ +VKETLR+YP GP     EA+EDC + GYH+PKGT+L VN+W+LHRDP+
Sbjct  364   SDMKKLKYLRAIVKETLRIYPPGPVTGIREAMEDCEIGGYHVPKGTRLIVNIWKLHRDPR  423

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             +W +P +F PERF+T         + +++VPF  GRRSCPG     QI Q+ +AR+ QGF
Sbjct  424   MWENPCEFRPERFLTTHADVDVNTQHFEYVPFSFGRRSCPGMTSGLQIVQLTLARILQGF  483

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             + +TV   P+DM   +G+ LPK  PLEV++ PRL+  LFR
Sbjct  484   DLATVGGTPVDMQIGLGLALPKSNPLEVIIKPRLAEDLFR  523



>ref|XP_002323130.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
 gb|EEF04891.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
Length=499

 Score =   464 bits (1193),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 232/499 (46%), Positives = 332/499 (67%), Gaps = 17/499 (3%)
 Frame = -1

Query  1604  KQSKRLPP-EAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW  1428
             K++K LPP E  GAWP+IGHL    + +P  + L + A K+GPVF+IRLG+ R LV+SSW
Sbjct  12    KRNKTLPPPEPSGAWPLIGHLRILNSQIPFFRILGDLAVKHGPVFSIRLGMRRTLVISSW  71

Query  1427  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE  1248
             E+V++CF TND+    RP+  A KY+GYD A F F     YW  +RK+  +E+LS+RRLE
Sbjct  72    ESVKECFKTNDRKFLNRPSFAASKYMGYDDAFFGFHPYGEYWLEMRKIATQELLSNRRLE  131

Query  1247  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
              LKHV VSE++T IKEL+T  S    N S   V+MS+WF  +  N++ +++AG+RY    
Sbjct  132   LLKHVRVSEIETCIKELHTTCS----NGSV-LVDMSQWFSCVVANVMFRLIAGKRY----  182

Query  1067  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL  888
                I +++    ++  +  YL G  V  D I P  F  W+D +GHVK+MKR AK++D ++
Sbjct  183   CSGIGKDSGAFGRLVREFFYLGGVLVISDLI-P--FTEWMDLQGHVKSMKRVAKELDHVV  239

Query  887   QDWVD---ARRKERRSNEDQK-FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASE  720
               W+     RR+E R  +++K F+DVML  +       + Y R+T++KA  L+++   ++
Sbjct  240   SGWLVEHLQRREEGRVRKEEKDFMDVMLESLAVGDDPIFGYKRETIVKATALNLILAGTD  299

Query  719   TFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYP  540
             T +  LTW L++LL H E LKR Q EID ++G  RW E+SD+KNL YLQ +VKETLR+YP
Sbjct  300   TTSVTLTWALSLLLNHTEVLKRAQKEIDVHVGTTRWVEESDIKNLVYLQAIVKETLRLYP  359

Query  539   QGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA  360
              GP L P E++EDC VDGY +P+GTQL VN W+LHRD +IW +P +F PERF+T+     
Sbjct  360   PGPLLVPRESLEDCYVDGYLVPRGTQLLVNAWKLHRDARIWENPYEFHPERFLTSHGSTD  419

Query  359   AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILP  180
              + +Q+++VPFG GRR CPG   + Q+  + ++RL QGFNFST  N  +DM E +G+ LP
Sbjct  420   VRGQQFEYVPFGSGRRLCPGISSSLQMLHLTLSRLLQGFNFSTPMNAQVDMSEGLGLTLP  479

Query  179   KLTPLEVLVTPRLSPTLFR  123
             K TPLEV++TPRL   +++
Sbjct  480   KATPLEVVLTPRLENEIYQ  498



>ref|XP_006376421.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP54218.1| cytochrome P450 family protein [Populus trichocarpa]
Length=511

 Score =   463 bits (1191),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 230/515 (45%), Positives = 323/515 (63%), Gaps = 13/515 (3%)
 Frame = -1

Query  1649  ILGIAALVLLWFSWR-----KQSKRLP--PEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD  1491
             ILG   L++L+  W+     ++SK+L   PE  GAWP+IGHL   R   P  KTL+  AD
Sbjct  2     ILGALVLLILYGFWKTLARERESKKLARAPEPSGAWPVIGHLPRLRGQDPACKTLAAIAD  61

Query  1490  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN  1311
             KYGP++++RLG  RI+VVSSWE V+DC  TND++LA R    AGK++GY+ A F  S   
Sbjct  62    KYGPIYSLRLGSHRIVVVSSWETVKDCLTTNDRILATRANIAAGKHMGYNNAAFALSPYG  121

Query  1310  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF  1131
              YWR VRKLV  ++LS+ RLE LKHV V E+   IK L+   +     P+  KV MS+ F
Sbjct  122   KYWRDVRKLVTLQLLSNHRLEMLKHVRVLEVDAFIKGLHNSYAETAEYPA--KVTMSKLF  179

Query  1130  GHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW  951
               LT N+ ++ + G+RY        N E  R KK   + +YL G FV  DAI    +  W
Sbjct  180   ESLTFNISLRTIVGKRYCSSLYDKENSEPWRYKKAIEKALYLSGIFVMSDAIP---WLEW  236

Query  950   LDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSR  771
             +D++GH+  MKR AK++DA++  W++   K+    E   F+DV++S + D   +   YSR
Sbjct  237   IDFQGHISAMKRTAKELDAVIGSWLEEHLKKEIQGESD-FMDVIISNLADGAAEMSGYSR  295

Query  770   DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVK  591
             D VIKA  L +    + + A  LTW L++LL HP  LK  Q+E+D  +G+E+W E+SD++
Sbjct  296   DVVIKATTLILTLTGAGSTAVTLTWALSLLLNHPSVLKAAQEELDKQVGREKWVEESDIQ  355

Query  590   NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPD  411
             NL YLQ +VKETLR+YP GP     EA+EDC + GY++PKGT+L VN+W+LHRDP++W +
Sbjct  356   NLMYLQAIVKETLRLYPPGPLTGIREAMEDCHICGYYVPKGTRLVVNIWKLHRDPRVWKN  415

Query  410   PEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST  231
             P+ F PERF+T       + + ++F+PF  GRRSCP       +  + +ARL QGF+ +T
Sbjct  416   PDDFQPERFLTTHADLDFRGQDFEFIPFSSGRRSCPAINLGMAVVHLTLARLLQGFDLTT  475

Query  230   VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             V   P+DM E  GI LPKL PLE ++ PRL   L+
Sbjct  476   VAGLPVDMNEGPGIALPKLIPLEAVIKPRLGLPLY  510



>ref|XP_004292356.1| PREDICTED: cytochrome P450 82C4-like [Fragaria vesca subsp. vesca]
Length=492

 Score =   462 bits (1189),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 226/493 (46%), Positives = 325/493 (66%), Gaps = 12/493 (2%)
 Frame = -1

Query  1589  LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDC  1410
             + PE  GA PI+GHLH      PL +TL+  ADKYGP+FTI LG +R LV+S++EA ++C
Sbjct  5     MSPEPYGALPILGHLHQLGGRNPLFQTLANMADKYGPIFTIWLGKNRALVISNYEAAKEC  64

Query  1409  FATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVW  1230
             F TND++ A RP++  GKYLGY+YA F  S    YWR  RKLVV E+LSSRRLE LKHV 
Sbjct  65    FTTNDRVFATRPSSAQGKYLGYNYAAFGVSPYGKYWRDTRKLVVMELLSSRRLETLKHVQ  124

Query  1229  VSELQTNIKELYT-FISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTIN  1053
             +SE+   +  LY+ + +  ++ PS  KV +S    HLT N++ +I+AG+RY        +
Sbjct  125   ISEVDAFVIGLYSVWKNKGHDGPS--KVVISTGIEHLTCNVMTKIIAGKRYFGVKSDEFD  182

Query  1052  EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVD  873
              E ++++K+  + MY     V+    + +    W+D++GH++TMK     +D+++  WV+
Sbjct  183   GEVKKIRKLMKEFMY---AAVNRVVSYVVGIPEWIDFKGHLRTMKNVGGQLDSLMTSWVE  239

Query  872   ----ARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATH  705
                  +RK   SNE+Q FIDV+LS I+D    G++  RDT+IK+  L ++   SET +  
Sbjct  240   EHNTKKRKNDSSNEEQDFIDVLLSEIEDGSMLGHT--RDTIIKSTALILVLAGSETTSVS  297

Query  704   LTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYL  525
             LTW+L++LL +  +LK  Q+E+D  +G+ RW ED+D+KNL YLQ + KETLR+YP GP  
Sbjct  298   LTWMLSLLLNNRRTLKLAQEELDRIVGRHRWVEDTDIKNLVYLQAIAKETLRLYPPGPLS  357

Query  524   APHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQ  345
              PHEA+EDC V G+H+PKGT LYVN+W+LHRDP +WPDPE F PERF+T      A  + 
Sbjct  358   VPHEAMEDCKVGGFHVPKGTHLYVNLWKLHRDPNVWPDPEVFSPERFLTTQASVDAFGQH  417

Query  344   YQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPL  165
             ++F+PFG GRR CPG   A Q+  + VARL QGF  +T  ++ +DM E  G+ + + T L
Sbjct  418   FEFIPFGAGRRICPGITLAFQLMHLTVARLIQGFELATPLDKAVDMTEGSGLSMARATAL  477

Query  164   EVLVTPRLSPTLF  126
             EV++T RL+  L+
Sbjct  478   EVVLTARLAYELY  490



>ref|XP_007134137.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris]
 gb|ESW06131.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris]
Length=526

 Score =   463 bits (1191),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 229/507 (45%), Positives = 337/507 (66%), Gaps = 21/507 (4%)
 Frame = -1

Query  1628  VLLWFSWRKQSKRL------PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTI  1467
             +L++ +WRK+          PPE  GA P+IGHLH      PL +T +  ADKYGP+F I
Sbjct  18    ILIYNTWRKKKGSQKSKGAEPPEPSGALPLIGHLHLLGAQTPLARTFAALADKYGPMFQI  77

Query  1466  RLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRK  1287
             RLG    LV+ + EA+++CF TNDK+LA+RP +  G +LGY++A F F+   +YW ++RK
Sbjct  78    RLGAYPALVICNQEAIKECFTTNDKVLASRPKSSHGVHLGYNFAGFGFAPYGTYWTKIRK  137

Query  1286  LVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLI  1107
             L + E+LS+RRL+ L HV+ SE+ T +K+L+ ++       +  KV +S W    T N+I
Sbjct  138   LTMLELLSARRLQFLSHVYESEIDTLVKDLWLYL----GGKTHVKVTISEWLERFTFNII  193

Query  1106  MQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV-  930
             ++++AG+RY    +   + EA  + K+  + M++ GEFV  D I  L    W    G V 
Sbjct  194   IKMIAGKRYFSYLEDVDDAEAHGVVKLIKEFMHISGEFVPSDLIPVLG---WFGVHGKVL  250

Query  929   KTMKRAAKDVDAILQDWVDARRKE----RRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTV  762
             K+MKR AKD+D+++  WV+  +       +S E   FIDVMLS+I D    G+   RDT+
Sbjct  251   KSMKRIAKDLDSLVGGWVEEHKNSDPLRNKSLEKHDFIDVMLSVIQDDPLSGHD--RDTI  308

Query  761   IKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLP  582
             IKA V +++   S+T +T +TWILA+L+K+PE+LKR Q+EI+  +G+ER  E  D+KNL 
Sbjct  309   IKANVTNLVLAGSDTTSTTMTWILAMLMKNPEALKRAQEEIEDEVGRERKVEACDLKNLI  368

Query  581   YLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEK  402
             YLQ VVKETLR+YP GP L PHEA EDC + GY +PKGT+++ NVW+LHRDP++W + EK
Sbjct  369   YLQAVVKETLRLYPPGPLLVPHEAREDCCIQGYRVPKGTRVFANVWKLHRDPRVWSEAEK  428

Query  401   FLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN  222
             F PERF+ N  GE  + ++++++PFG GRR+CPG+ +ATQ+T + +ARL Q F+     +
Sbjct  429   FSPERFL-NENGEVDEGQRFEYLPFGSGRRACPGSTFATQLTLITLARLLQAFHLDEPLD  487

Query  221   EPLDMMEDVGIILPKLTPLEVLVTPRL  141
             EP+D+ E +GI LPK+ PL++L T RL
Sbjct  488   EPVDLEEGLGITLPKINPLQILFTSRL  514



>gb|ABC69420.1| CYP82E8 [Nicotiana tabacum]
Length=519

 Score =   462 bits (1190),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 336/529 (64%), Gaps = 32/529 (6%)
 Frame = -1

Query  1658  LSSILGIAALV----LLWFSW-RKQSK---RLPPEAGGAWPIIGHLHHFRTSVP----LV  1515
             LS I  I   V    L +F W +KQSK    LPP+  G WP+IGHL +F+ +        
Sbjct  5     LSPIEAIVGFVTFSFLFYFLWTKKQSKILNPLPPKIPGGWPVIGHLFYFKNNGDEDRHFS  64

Query  1514  KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYA  1335
             + L + ADKYGPVFT RLG  R L VSS+EA+++CF TND   A RP+   G+YL Y+ A
Sbjct  65    QKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFTTNDIHFADRPSLLYGEYLCYNNA  124

Query  1334  VFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP  1155
             +   +    YW++ RKLV +E+LS  RLEK KHV  S +Q NIK+LY      N +    
Sbjct  125   MLAVAKYGPYWKKNRKLVNQEVLSVSRLEKFKHVRFSIIQKNIKQLY------NCDSPMV  178

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI  975
             K+N+S W   LT ++I+++V G+ Y        N   + LK  F + M    E    D +
Sbjct  179   KINLSDWIDKLTFDIILKMVVGKNYN-------NGHGEILKVAFQKFMVQAMEMELYD-V  230

Query  974   FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDVMLSM  810
             F + FF+WLD  G++K MK+  KD+D I+Q W+D   K+R + +     +Q FIDV+LS 
Sbjct  231   FHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDEHIKKRETKDVGGENEQDFIDVVLSK  290

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
             + D+   G  YS DT IKA V +++ DA++T A H+ W++A+++ +   +K+ Q+E+DT 
Sbjct  291   MSDEHL-GEGYSHDTTIKATVFTLVLDATDTLALHIKWVMALMINNKHVMKKAQEEMDTI  349

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +G++RW E+SD+KNL YLQ +VKE LR++P  P    H +VEDC+V+GYHIPKGT L  N
Sbjct  350   VGRDRWVEESDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSVEDCVVNGYHIPKGTALLTN  409

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             + +L RDP+ WP+P+KF PERF+T       + + Y+ +PFG GRR+CP   Y+ Q+  +
Sbjct  410   IMKLQRDPQTWPNPDKFDPERFLTTHATIDYRGQHYESIPFGTGRRACPAMNYSLQVEHL  469

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             ++A + QGF+F+T  NEPLDM + VG+ LPK T +EVL+TPRL PTL++
Sbjct  470   SIAHMIQGFSFATTTNEPLDMKQGVGLTLPKKTDVEVLITPRLPPTLYQ  518



>ref|XP_010264712.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   463 bits (1191),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 230/500 (46%), Positives = 322/500 (64%), Gaps = 13/500 (3%)
 Frame = -1

Query  1601  QSKRLPPEAGGAWPIIGHLHHFRT-SVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWE  1425
             + +++ PEA GAWP+IGHL       +P + TL   ADKYGP FTIRLG+ R LVVS WE
Sbjct  35    KKRKMAPEAAGAWPVIGHLPLLGGPELPHI-TLGAMADKYGPAFTIRLGVRRALVVSDWE  93

Query  1424  AVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEK  1245
               ++CF  ND+ LA RP+  A K++GY+YA+F F+    YWR VRK+   E+LS+RRLE 
Sbjct  94    VAKECFTINDRALATRPSGVAMKHMGYNYAMFAFAPYGPYWREVRKIATLELLSNRRLEM  153

Query  1244  LKHVWVSELQTNIKELYTFISMDNNNPSAP--KVNMSRWFGHLTLNLIMQIVAGRRYEYR  1071
             LKHV VSE+  +++ELY     + N   A   KV M RWFG LTLN ++++VAG+RY   
Sbjct  154   LKHVRVSEVNMSVRELYGLWLKNKNATGADSVKVEMKRWFGDLTLNNVLRMVAGKRYFGA  213

Query  1070  SDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAI  891
             +    + EA R + V      L G+FV  DAI    F  WLD +GH K MKR AK++D+I
Sbjct  214   TAACGSAEAVRCQTVMRSFFRLVGQFVIADAI---PFLGWLDMQGHEKAMKRTAKELDSI  270

Query  890   LQDWVDARRKERRSNED----QKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
             L+ W++  RK R SN++    Q F+DVMLS++ D    GY    DT+ KA  ++++   +
Sbjct  271   LEGWMEEHRKMRLSNDEANGEQDFMDVMLSILKDSKLSGYDA--DTINKATCMNLILGGN  328

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             +T    LTW L++L+ + E LKRVQDE+D ++GK+R  E+SD+K L YLQ VVKE LR+Y
Sbjct  329   DTIKVCLTWALSLLVNNQEVLKRVQDELDRHVGKDRNVEESDMKKLEYLQAVVKEALRLY  388

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P  P   PHEA+E+C V GYH+P GT++ VN+ ++ RDP++W DP +F PERF+T+  G 
Sbjct  389   PPAPLSGPHEAMEECTVAGYHVPVGTRILVNLSKIQRDPRVWSDPLEFRPERFLTSHVGV  448

Query  362   AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
                 + ++ +PFG GRR+CPG     ++  +A+ARL   F+  T    P+DM E  G+  
Sbjct  449   DVLGQHFELIPFGSGRRACPGTSLGLKVVHLALARLLHAFHLHTPSGAPVDMTESFGLTN  508

Query  182   PKLTPLEVLVTPRLSPTLFR  123
              K TPLEVL+ PRL   L++
Sbjct  509   LKATPLEVLLLPRLPSHLYQ  528



>ref|XP_010918630.1| PREDICTED: cytochrome P450 82C4-like [Elaeis guineensis]
Length=493

 Score =   461 bits (1185),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 228/499 (46%), Positives = 322/499 (65%), Gaps = 14/499 (3%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW  1428
             +K   + PP+  G+WPIIGHLH  R+  PL     E ADKYGPVF + LG+ R LVV+SW
Sbjct  3     KKTKIKEPPKPSGSWPIIGHLHLLRSQKPLAHLFGEMADKYGPVFMLHLGMRRTLVVNSW  62

Query  1427  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE  1248
             EA ++C ATNDK+ A RP   AGK+LGY+YA+  F+   SYWR VRK+++ E+LS+ RLE
Sbjct  63    EAAKECLATNDKVFATRPGNAAGKHLGYNYAMVGFAPYGSYWRSVRKIIMVELLSNARLE  122

Query  1247  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
              LKHV   E+ T I+ELY     +N  P   KV M RW G L  N+++++VAG+R  Y  
Sbjct  123   TLKHVRSMEMDTCIRELYELWLRNNRRPV--KVEMKRWLGGLAYNIVVRVVAGKR--YFG  178

Query  1067  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL  888
              GT ++EA R +K  S++  L   FV+ D +FP    +W+D+ GH   MK  A++VD+I+
Sbjct  179   SGTGSDEAWRFRKAISRLFGLLDAFVASD-MFPC--LKWMDWRGHESAMKNTAQEVDSIM  235

Query  887   QDWVDARRKERRSNED----QKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASE  720
                ++  R+ R S +     Q F+DVMLS+++D    G     D VIKA  L+++   ++
Sbjct  236   AGLLEEHRQRRLSGKATGGPQDFMDVMLSIVEDAEFSGMDV--DAVIKATSLALIMGGTD  293

Query  719   TFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYP  540
             T  T L W LA+L+K+P+ LK+ QDEID  +GK+R  E+SDVKNL YLQ +VKE LR+YP
Sbjct  294   TTTTSLAWTLALLVKNPQVLKKAQDEIDAVVGKDRHVEESDVKNLLYLQAIVKEVLRLYP  353

Query  539   QGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE-GE  363
                 L  HEA+ DC + GY +  GT+L+VNVW+L RDP +W +P +F PERF++    G 
Sbjct  354   AAKLLVQHEAMADCRIGGYDVAAGTRLHVNVWKLQRDPLVWSEPNEFRPERFLSAPHAGV  413

Query  362   AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
               + + ++ +PFG GRRSCPG  +A Q+  + +ARL QGF   T    P +M +D+G+  
Sbjct  414   DVRGQHFELIPFGSGRRSCPGISFALQVMHLTLARLIQGFELETPGGGPSEMADDLGLPY  473

Query  182   PKLTPLEVLVTPRLSPTLF  126
             P  TPLEVL++PRL+  L+
Sbjct  474   PNTTPLEVLLSPRLADMLY  492



>ref|XP_002531093.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31307.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   462 bits (1188),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 219/520 (42%), Positives = 338/520 (65%), Gaps = 15/520 (3%)
 Frame = -1

Query  1652  SILGIAALVLLWFSWRKQSKRLP------PEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD  1491
             +I G++ L+ L+  WR  +++        PE  GAWP+IGH H      P  + L + AD
Sbjct  7     TITGLSTLLFLFVLWRSLARKSKSKNINVPEPTGAWPLIGHFHLLARQEPACRILGDIAD  66

Query  1490  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN  1311
             K GP++++RLGI+RI+V S WE V++CF TND++ A R +  AGKY+GY+ A+F  +   
Sbjct  67    KTGPLYSLRLGINRIMVASGWEVVKECFTTNDRIFATRASIAAGKYIGYNNAIFALAPYG  126

Query  1310  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF  1131
              YWR VRKL   ++LSS RLEKLKHV +SE+ T +K+L+  + +++ + +  KV ++  F
Sbjct  127   QYWRDVRKLATLKLLSSNRLEKLKHVRLSEVDTFLKDLHN-LYVESADSNHAKVIINTLF  185

Query  1130  GHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW  951
               LT N+ ++++ G+++   + G  N E  R KK   + +YL G FV  DAI P  +  W
Sbjct  186   ERLTFNISLRMIVGKQFSSSTYGEENSEPWRYKKAIEEAVYLSGTFVMSDAI-P--WLEW  242

Query  950   LDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQK----FIDVMLSMIDDQFTQGY  783
             +D++GH+  MKR AK++DA+++ W++   K+R S+E  K    F+DVMLS +D+      
Sbjct  243   IDHQGHISAMKRTAKELDAVIETWLEEHIKKRSSDECHKGENDFMDVMLSDLDEDAVMS-  301

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              +SRDTVIKA  + +    S + A  LTW L++LL +P  LK  Q+E+D ++G+E+W ++
Sbjct  302   GHSRDTVIKATAMILTLTGSGSTAVTLTWALSLLLNNPGVLKAAQEELDIHVGREKWVQE  361

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             SD++NL YLQ +VKETLR+YP GP     EA EDC + GY +PKGT+L +N+W+L RDP+
Sbjct  362   SDIENLKYLQAIVKETLRLYPPGPLTGIREASEDCNLGGYFVPKGTRLIINIWQLQRDPR  421

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             +W DP +F PERF+T       + + ++F+PF  GRRSCP   +  Q+  + +AR+ QGF
Sbjct  422   VWKDPGEFQPERFLTTHSDVDFRGQNFEFIPFSSGRRSCPAITFGLQVVHLTLARVLQGF  481

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             + +T+   P+DM E +GI LPK+ P+EV++ PRL   L++
Sbjct  482   DLTTIGGLPVDMTEGLGIALPKVNPVEVIIKPRLGLELYQ  521



>ref|XP_010104162.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXB99094.1| Cytochrome P450 82C4 [Morus notabilis]
Length=482

 Score =   460 bits (1183),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 222/489 (45%), Positives = 325/489 (66%), Gaps = 35/489 (7%)
 Frame = -1

Query  1508  LSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCA-----------  1362
             +++ ADKYGP+F  RLG++ +LV+S++EAV++CF TND   A+RP+ CA           
Sbjct  1     MADIADKYGPIFLFRLGMNPVLVISNYEAVKECFTTNDITFASRPSFCAKPSTIRAGAPC  60

Query  1361  ----------------GKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVW  1230
                             G +LGYD+A F F+    YWR +RKLV+ E+LS+RRLE L+HV 
Sbjct  61    GPVQPTPAFMRSWSTHGTHLGYDFAAFGFAPYGPYWRTMRKLVMIELLSNRRLETLRHVQ  120

Query  1229  VSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINE  1050
             VSE++T +  LY     +   P+  +V +S W  H TLN+I +++AG+RY   S   +  
Sbjct  121   VSEVETLVNGLYGQCKKNGFGPT--EVVISEWIEHFTLNIITEMIAGKRYFDSSGKVVGG  178

Query  1049  EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDA  870
             EA+R+ KV  + M + G F+  D I P+   +W+D+ G++K MKR  +++D ++Q WV+ 
Sbjct  179   EAERIGKVIKEYMCISGAFIVSDLI-PVP--KWVDFNGNLKAMKRIGREIDVLIQSWVEE  235

Query  869   RRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWIL  690
              ++   S++ Q FID+MLS+I++    GY+  RDT+IK  V +++   S+T A +LTWIL
Sbjct  236   HKRSEASDK-QDFIDIMLSLIEENHELGYA--RDTIIKGTVSTLIIAGSDTTAINLTWIL  292

Query  689   AVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEA  510
             A+LL +  +L R Q+E+D  +GKERW E SD+KNL YLQ +VKETLR+YP GP   PH+A
Sbjct  293   ALLLNNRRALNRAQEELDLIVGKERWVEGSDIKNLVYLQAIVKETLRLYPPGPLAVPHQA  352

Query  509   VEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVP  330
              EDC V G+H+ KGT+L+VN+W+LHRDP  WPDPE F PERF+T+  G     + ++ +P
Sbjct  353   REDCTVCGFHVRKGTRLFVNLWKLHRDPNTWPDPEAFSPERFLTSHAGIDVLGQHFELIP  412

Query  329   FGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVT  150
             FG GRRSCPG  +A Q+T +A+ARL QGF F+T  +EP+DM E +GI LP+ TP+E ++T
Sbjct  413   FGSGRRSCPGMAFALQVTHLALARLLQGFVFATKLDEPVDMSEGLGITLPRATPVEAVLT  472

Query  149   PRLSPTLFR  123
             PRL   L++
Sbjct  473   PRLPAELYQ  481



>emb|CAN66023.1| hypothetical protein VITISV_042713 [Vitis vinifera]
Length=491

 Score =   458 bits (1179),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 228/491 (46%), Positives = 316/491 (64%), Gaps = 15/491 (3%)
 Frame = -1

Query  1670  VPCCLSSILGIAALVLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKT  1509
              P  L +I GI  LVLL+  WR      K   R  PE  GAWP +GHL   R   P+ +T
Sbjct  3     TPSQLVAISGILGLVLLYGVWRVMTLAGKSKGRSAPEPSGAWPFLGHLPLLRGQTPIFRT  62

Query  1508  LSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVF  1329
             L   ADK+GPVF IRLG+ R LVVSS EAV++CF TNDK+ A+RP+  AGK LGY+ A F
Sbjct  63    LGAMADKHGPVFMIRLGVQRALVVSSREAVKECFTTNDKVFASRPSXSAGKJLGYNXAGF  122

Query  1328  TFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKV  1149
              F+   + WR +RKL + EILS+RRL+  KHV +SEL  +IK+LY+ +   ++     KV
Sbjct  123   XFAPYGALWREMRKLSMMEILSARRLDAJKHVQISELDLSIKDLYS-LGKGSDWVHPVKV  181

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFP  969
              MS WF HL+ N+ ++++ G+RY + + G   EEA+R      + + L G FV  DAI  
Sbjct  182   VMSEWFQHLSFNIXLKMIXGKRY-FNTSGHGIEEARRAIATIQEFLSLXGAFVLSDAIPG  240

Query  968   LWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQF  795
             +    W+D +G++ +MKR AK+ D+++  WV+    R     N+ Q FIDVMLS+++D  
Sbjct  241   V---EWMDLQGYLGSMKRVAKEXDSLVGGWVEEHEXRLNSEGNKXQDFIDVMLSVLED--  295

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
             T  + +SR+TVIKA ++ ++   +ET AT  TW+L+ LL    +LKR Q+E+D  +G+ R
Sbjct  296   TSMFGHSRETVIKATIMILIVGGTETVATTSTWLLSALLNXKHALKRAQEELDLKVGRGR  355

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W E+SD+ NL YLQ V+KETLR+Y   P   PHEA+EDC V GYHIPKGT+L+VN W+LH
Sbjct  356   WVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPKGTRLFVNAWKLH  415

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP +W DPE F PERF+T+        + ++ +PFG GRRSCPG   A ++  + + RL
Sbjct  416   RDPSVWSDPEDFQPERFLTSHADXDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIGRL  475

Query  254   FQGFNFSTVPN  222
              QGF+ ST  N
Sbjct  476   LQGFDLSTPLN  486



>ref|XP_004510285.1| PREDICTED: uncharacterized protein LOC101505071 [Cicer arietinum]
Length=1052

 Score =   476 bits (1225),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 235/529 (44%), Positives = 352/529 (67%), Gaps = 19/529 (4%)
 Frame = -1

Query  1679  MDAVPCCLSSILGIAALVLLWFSWR-------KQSKRLPPEAGGAWPIIGHLHHFRTSVP  1521
             M+  P   ++I+   ALV+L+  WR       K   + PP+   A P IGHLH      P
Sbjct  531   MEYFPSQQTTIVLAIALVVLYNIWRIKKHSNNKLKGKQPPQPSYALPFIGHLHLLGNQTP  590

Query  1520  LVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYD  1341
             L +  + +ADKYGP+F I LG    LV+S+ E++++CF TNDK+LA+RP +  G YLGY+
Sbjct  591   LARIFASFADKYGPIFQIYLGSYPALVISNQESIKECFTTNDKILASRPKSSHGIYLGYN  650

Query  1340  YAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPS  1161
             YA F F+   +Y+ ++RKL + E+LSSRR+E L+H++ SE+ T + +L+ ++   +NN  
Sbjct  651   YAGFGFAPYGTYFTKLRKLTMLELLSSRRIESLRHLYESEIDTLVNDLWLYVK--DNNKV  708

Query  1160  APKVNMSRWFGHLTLNLIMQIVAGRRY-EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSG  984
                V +S+W   LT N+I ++++G+RY EY  D   + EA  + K+  + M++ GEFV  
Sbjct  709   TKAVVISKWLEKLTFNIITKMISGKRYFEYLQD-VDDVEAHGIVKLIKEFMHISGEFVPS  767

Query  983   DAIFPLWFFRWLDYEGHV-KTMKRAAKDVDAILQDWVD--ARRKERRSNEDQKFIDVMLS  813
             D I P+    W  +EG V K+MKR  +D+D ++  WVD   ++ +   NE   FIDVMLS
Sbjct  768   DLI-PI--IGWFGFEGQVLKSMKRVGRDLDKVVGRWVDEHVQKIDDGVNEKHDFIDVMLS  824

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
             +I+D  + G+   RDT+IKA +++++   S+T +T +TWILA+LL +  +LKR Q+EI+ 
Sbjct  825   VIEDDPSSGHD--RDTIIKANIMNLMLAGSDTTSTTMTWILAILLNNTNALKRAQEEINH  882

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
             +IGK+R  E SD+KNL YLQ ++KETLR+YP GP L PHEA +DC + GY++PKGT+++ 
Sbjct  883   HIGKKRRVESSDIKNLVYLQAIMKETLRLYPPGPLLVPHEATKDCYIQGYNVPKGTRVFA  942

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             NVW+LHRDP IW + EKF PERF+    GE  +   ++++PFGLGRR+CPG+++ATQ+  
Sbjct  943   NVWKLHRDPSIWLEAEKFSPERFINEKNGELYEGHNFEYLPFGLGRRACPGSMFATQVCL  1002

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + +ARL  GF+      E +DM E +GI LPKLTPL V++TPRL+  L+
Sbjct  1003  ITLARLIHGFDLEVPMGEDVDMREGLGITLPKLTPLNVILTPRLTYELY  1051


 Score =   437 bits (1125),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 216/494 (44%), Positives = 314/494 (64%), Gaps = 13/494 (3%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             PE  G+ P IGHLH   T VP  +T S  A+KYG +F++RLG  + LVVSS E  R+C  
Sbjct  24    PEPCGSLPFIGHLHLLSTQVPYFRTFSTMAEKYGSIFSLRLGCHKTLVVSSREIARECLT  83

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
             TNDK+ A+RP   AG+YLGY+ A+   +   +YWR +RK+   E+LSS RLEKL HV  S
Sbjct  84    TNDKVFASRPNISAGRYLGYNNAILALAPYGNYWRDMRKISTLELLSSHRLEKLMHVRDS  143

Query  1223  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEA  1044
             E+ + +K+LYTF+  +NN+    +V +S++  H+T N+I++++AG+R+   +    + EA
Sbjct  144   EIFSLVKDLYTFLK-NNNSNGLIEVPISKFLDHMTFNIIVRMIAGKRFRGETIYQEDSEA  202

Query  1043  QRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARR  864
              RL+       YL G FV GDAI    F  W D++GHV  MKR  K++D IL  W+  R 
Sbjct  203   WRLRNAIKDTTYLSGVFVVGDAI---PFLSWFDFQGHVGFMKRTFKEMDFILDKWM--RE  257

Query  863   KERRSNEDQK------FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHL  702
                + NE Q       F+DV++SM D  + +   + R+ VIKA  + ++  AS + A  L
Sbjct  258   HYTKINEGQHGKYENDFMDVLISMFDG-YDEICGHKREIVIKATTMILILTASGSTAITL  316

Query  701   TWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLA  522
             TW L++LL +P  LK+ Q E+D NIGK +W ++S++KNL YLQ ++KETLR+YP  P   
Sbjct  317   TWALSLLLNNPRVLKQAQQELDNNIGKHKWVQESNIKNLKYLQAIIKETLRLYPPAPLTG  376

Query  521   PHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQY  342
               E+++DC V GYH+PKGT+L +N+W+L RDP IWP+P +F PERF+T+     +Q+  +
Sbjct  377   LRESIDDCHVAGYHVPKGTRLLINIWKLQRDPHIWPNPNEFQPERFLTSNGQIDSQHYDF  436

Query  341   QFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLE  162
              FVPF  GRRSC G+ +  Q+  + +ARL QGF+  T     +DM E VG+ LPK  PL 
Sbjct  437   GFVPFSYGRRSCVGSTFGLQVLHLTLARLIQGFDIYTKDGGVVDMSEGVGLALPKENPLS  496

Query  161   VLVTPRLSPTLFRL  120
             +++ PRL   L+ +
Sbjct  497   LMLQPRLPLDLYEI  510



>ref|XP_007049681.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX93838.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   459 bits (1182),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 219/527 (42%), Positives = 335/527 (64%), Gaps = 15/527 (3%)
 Frame = -1

Query  1679  MDAVPCCLSSILGIAALVLLWFSWR----KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVK  1512
             MD    C+ +I G+ AL++L+  WR      +K   PE  G+WP+IGHLH       L K
Sbjct  1     MDLFYNCVQAIEGLLALLVLYVIWRYIARNSNKSRIPEPSGSWPLIGHLHLLGGKETLCK  60

Query  1511  TLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAV  1332
              L   ADKYGP+++++LG  R+LVVSSWE  +DC   ND+ LA RP+  AG+++GY+ A+
Sbjct  61    KLGAMADKYGPLYSLKLGHRRVLVVSSWEIAKDCLTNNDRALATRPSIAAGRHIGYNNAI  120

Query  1331  FTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPK  1152
             F  +    YWR +RK+V  E+LSS RLEKLKH+  SE+   IKEL+     + +N    +
Sbjct  121   FALAPYGEYWRNIRKIVTIELLSSYRLEKLKHIRFSEMDLFIKELFRLCVENADN--CAQ  178

Query  1151  VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
             V MS     LT N+ ++++ G+R+   S    + +  R +K   Q +YL G FV  DA  
Sbjct  179   VTMSEVLERLTFNINLRMLVGKRFASSSYAQAHSQPWRYEKAIKQTLYLSGIFVLADA--  236

Query  971   PLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDA---RRKERRSNEDQKFIDVMLSMI-D  804
              L F  W+D +GHV++MK+ AK++D+I+  W++    R++E + + +  F+DVML+ +  
Sbjct  237   -LPFLEWMDIQGHVRSMKQTAKELDSIISVWLENHLRRKRESQGSCESDFMDVMLANLPQ  295

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
             D    G++  RDT++KA  L +     E+ +  +TW+L++LL HP  LK  Q E+D ++G
Sbjct  296   DAVISGHT--RDTIVKATTLILTMTGGESTSVTMTWVLSLLLNHPSVLKAAQQELDLHVG  353

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
              +RW E+SD+K+L YLQ +VKETLR+YP GP     EA+EDC + GYH+PKGT+L VN+W
Sbjct  354   IDRWVEESDIKSLKYLQAIVKETLRLYPPGPLTGIREAMEDCCIAGYHVPKGTRLIVNLW  413

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             +L RDP++W +P +F PERF+T       + + ++++PF  GRRSCP   +  Q+  + +
Sbjct  414   KLQRDPRVWENPGEFQPERFLTTHADFDVRGQNFEYIPFSSGRRSCPAITFGLQVVHLTL  473

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             A+L QGF+  T   +P+DM E +G+ LPK TPL+V++TPRL+   ++
Sbjct  474   AKLLQGFDIRTPDGKPVDMGEGLGLALPKRTPLDVVLTPRLAHEFYK  520



>ref|XP_011045172.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
 ref|XP_011045173.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
Length=541

 Score =   460 bits (1183),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 230/537 (43%), Positives = 346/537 (64%), Gaps = 36/537 (7%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFSWRK--QSKR------LPPEAGGAWPIIGHLHHFRTSVPLVKTLS  1503
             L +I  + ALVL W++ R+  +S+R        PE  GA P+IGHLH       L +TL+
Sbjct  11    LLAISTVLALVL-WYTLRRVRESRRKTEKGLQAPEPSGALPLIGHLHLLGAQKTLARTLA  69

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
               ADKYGP+FTIRLG    +VVS+ EA+++CF T+D++L++RP +  G+YL Y+YA F F
Sbjct  70    AIADKYGPIFTIRLGKHPTVVVSNLEAIKECFTTHDRILSSRPRSSHGEYLSYNYAAFGF  129

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             + +  +WR +RK+V  ++LSS RL+ L+HV VSE+ T I +LY      +N   + K+ +
Sbjct  130   TNSGPFWREMRKIVTIQLLSSHRLKSLRHVQVSEVNTLINDLYLL--SKSNKQGSTKIVI  187

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             S  F  +T+N+I +++AG+RY + S     EE +R+ K+  + MY+ G FV  D I P  
Sbjct  188   SECFERMTINMITRMIAGKRY-FSSTEAEKEEGKRIGKLMKEFMYISGVFVPSDLI-P--  243

Query  962   FFRWLD-YEGHVKTMKRAAKDVDAILQDWVDARRKERRSN-------EDQKFIDVMLSMI  807
             F  W++ + G VKTMKR ++++D++++ W+   + +R  +       +D  FIDVMLS++
Sbjct  244   FLGWINNFLGSVKTMKRLSRELDSLMESWIQEHKLKRLESTENTNKMDDDDFIDVMLSLL  303

Query  806   DDQFTQGYSYSRDTVIKAIVL----------SMLQDASETFATHLTWILAVLLKHPESLK  657
             DD  +    YSR+T+IKA  +          +++   ++T +  LTWIL+ LL +  SL+
Sbjct  304   DDSMS---GYSRETIIKATAMDQDVLFLHEQTLIIAGADTTSITLTWILSNLLNNRRSLQ  360

Query  656   RVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHI  477
               Q+E+D  +G+ERWAEDSD+ NL Y+Q ++KETLR+YP GP   PHEA ED  V GYH+
Sbjct  361   LAQEELDLKVGRERWAEDSDIGNLVYIQAIIKETLRLYPPGPLSVPHEATEDFCVAGYHM  420

Query  476   PKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGN  297
             PKGT+L+ N+W+LHRDP +W +P++++PERF+ +          ++ +PFG GRRSCPG 
Sbjct  421   PKGTRLFTNLWKLHRDPNLWSNPDEYMPERFLNDHANLDVLGHHFELIPFGSGRRSCPGI  480

Query  296   LYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +A Q+  +  ARL QGF+  T   E +DM E V I LPK TPLE+ +TPRLSP L+
Sbjct  481   TFALQVLHLTFARLLQGFDMKTPRGESVDMTEGVAITLPKATPLEIHITPRLSPELY  537



>ref|XP_007017417.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
 gb|EOY14642.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
Length=528

 Score =   459 bits (1180),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 223/490 (46%), Positives = 318/490 (65%), Gaps = 9/490 (2%)
 Frame = -1

Query  1595  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             KR  PEA GA P +GHLH    S P    L + AD YGP+FTIRLG+   LVVS+WE  +
Sbjct  38    KRKAPEASGARPFLGHLHLLGGSKPAHVVLGDLADTYGPIFTIRLGVRLTLVVSNWEIAK  97

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +CF TNDK  A RP T A + LGY+YA+F FS    YWR++RK+V  E+LS+ RLEKLKH
Sbjct  98    ECFTTNDKAFANRPRTLAAELLGYNYAMFGFSPYGPYWRQIRKIVTLEVLSNHRLEKLKH  157

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPKV--NMSRWFGHLTLNLIMQIVAGRRYEYRSDG  1062
             +  SE++T+IKELY       +N S+ KV   M RWF  L +N++ ++V G+RY      
Sbjct  158   IRESEVRTSIKELYKLGVEGVSNSSSGKVLVEMKRWFWTLNINMVFKMVVGKRYSEAETS  217

Query  1061  TINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQD  882
                +E  R +K       L G F  GD+   L F RWLD  GH K MK+ AK++D IL++
Sbjct  218   HGKDENDRRRKALRDFFELTGTFTVGDS---LPFLRWLDLGGHEKAMKKTAKELDHILEE  274

Query  881   WVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
             W++  +++R S     +  F+ +MLS+++D   +  SY  DT+ KA  LS++  AS+T  
Sbjct  275   WLEEHKQKRNSGNAESEHDFMGMMLSLLNDA-AELPSYDADTINKATCLSLILAASDTTM  333

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
               LTW L++LL +  +LK+ Q+E+D ++G+++  E+SD+K L YLQ ++KETLR+YP  P
Sbjct  334   VTLTWALSLLLNNRNALKKAQEELDIHVGRDKLVEESDIKKLVYLQAIIKETLRLYPAAP  393

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN  351
                PHE++EDC+V GYHIP GT+L +N++++HRDP  W DP +F PERF+T  +    + 
Sbjct  394   LSVPHESMEDCVVSGYHIPAGTRLLINLYKIHRDPHAWSDPCEFQPERFLTTYKDFDVRG  453

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
             + ++ +PFG GRR CPG   A Q+ ++ +A L QGF   T  +EP+DM E +GI   K++
Sbjct  454   QNFELIPFGSGRRMCPGVSLALQVLELTLANLLQGFELGTPLDEPVDMGEAIGITNLKVS  513

Query  170   PLEVLVTPRL  141
             PLEVL+TPRL
Sbjct  514   PLEVLITPRL  523



>ref|XP_010253830.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   458 bits (1178),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 227/499 (45%), Positives = 327/499 (66%), Gaps = 16/499 (3%)
 Frame = -1

Query  1592  RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRD  1413
             R  P+  GAWPIIGHLH FR S  L   L   ADKYGP F +RLG+ R LVVSSW+A + 
Sbjct  35    RQAPQPSGAWPIIGHLHLFRASELLHPKLGAMADKYGPAFMLRLGMRRALVVSSWDAAKQ  94

Query  1412  CFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHV  1233
             CF TNDK+ + RP T A K++GY+YA+  F+    YWR +RK+   E+LS RRL+  KH+
Sbjct  95    CFTTNDKVFSTRPRTVAIKHMGYNYALPGFAPYGPYWREMRKISTVELLSHRRLDMFKHI  154

Query  1232  WVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGT--  1059
               SE+  ++K+LYT   + N + S   V M +WF  LT+N++ +++AG+RY   ++ T  
Sbjct  155   RTSEIDLSMKDLYTRW-VKNGHGSPVLVEMKQWFSDLTMNIVTRMIAGKRYFGAANYTDF  213

Query  1058  INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW  879
               EE Q+ KK  ++ M+L G FV  DA   L F  WLD +GH + MKR AK +D +L+ W
Sbjct  214   SEEEVQKCKKAITEFMHLVGIFVVSDA---LPFLGWLDLQGHERAMKRTAKQLDHMLESW  270

Query  878   VDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET  717
             +   R ++R++E      ++ F+DV+LS++DD   Q   Y  DTV+KA  L ++   S+T
Sbjct  271   LKEHRCKKRASEGIATADERDFMDVLLSILDDH--QCIGYGTDTVVKATCLGLILGGSDT  328

Query  716   FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ  537
              +  LTW L++LL + ++LK+ QDE+DT +G++   E+SD++NL YLQ +VKETLR+YP 
Sbjct  329   TSVTLTWALSLLLNNRQALKKAQDELDTKVGRDGLVEESDIRNLVYLQAIVKETLRLYPA  388

Query  536   GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA-  360
                 AP EA+EDC V G+HIP GTQL VN+W+L RDP IWP P +F PERF+T+   +  
Sbjct  389   AAVSAPREAMEDCTVAGFHIPAGTQLLVNIWKLQRDPSIWPHPCEFSPERFLTSHAADID  448

Query  359   AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST-VPNEPLDMMEDVGIIL  183
              + + ++ +PFG GRR+CPG  +A Q+  + +ARL QGF+  T   +  +DM + +G+  
Sbjct  449   VRGQHFELLPFGSGRRACPGISFAIQVLHLTLARLIQGFDLGTPCCDAMVDMTQGIGLTN  508

Query  182   PKLTPLEVLVTPRLSPTLF  126
              K TPL+VL+TPRL P L+
Sbjct  509   HKKTPLDVLLTPRLHPLLY  527



>ref|XP_010437977.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=525

 Score =   457 bits (1177),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 226/499 (45%), Positives = 324/499 (65%), Gaps = 20/499 (4%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCF  1407
             P+  GAWPIIGHLH       L+ +TL   AD+YGPV ++RLG S   VVSS+E  +DCF
Sbjct  33    PKLSGAWPIIGHLHLLVGKEQLLYRTLGRMADRYGPVMSLRLGSSEAFVVSSFEVAKDCF  92

Query  1406  ATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWV  1227
               NDK LA+RP T A K++GY+YAVF F+  N++WR +RK+   E+LS+RRL+ LKHV V
Sbjct  93    TVNDKALASRPMTAAAKHMGYNYAVFGFAPYNAFWREMRKIATIELLSNRRLQMLKHVSV  152

Query  1226  SELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTIN--  1053
             SE+   +K+LY+ + + N       V++ RW  ++TLN+I+++VAG+RY     G+ +  
Sbjct  153   SEISMGVKDLYS-LWVKNGGSEPVMVDLKRWLDNMTLNMIVRMVAGKRYFGGVVGSESSE  211

Query  1052  --EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW  879
               EEA++ K   S+  +L G F   DA FP    RW D++GH K MK+   ++D IL+ W
Sbjct  212   DTEEARQCKMAISKFFHLIGIFTVSDA-FPR--LRWFDFQGHEKEMKQTGSELDVILERW  268

Query  878   VDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
             +D  R+ER+       D  FIDVMLS+ +        Y  +  IK+  L+++   SET +
Sbjct  269   IDNHRQERKVSGTKENDSDFIDVMLSLAEQGKLSHLQYDANISIKSTCLALILGGSETTS  328

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
             + LTW +A+LL + E LK+ QDEID ++G++R  EDSD+ NL YLQ ++KETLR+YP GP
Sbjct  329   STLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRLYPAGP  388

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ-  354
              L P EA+EDC V GY++  GT+L VNVW++ RDPK++ +P +F PERF+T   GEA + 
Sbjct  389   LLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYKEPNEFRPERFIT---GEAKEF  445

Query  353   ---NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
                 + ++ +PFG GRRSCPG+  A Q+  + +AR    F   TV + P+DM E  G+ +
Sbjct  446   DVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMTESPGLTI  505

Query  182   PKLTPLEVLVTPRLSPTLF  126
             PK TPLEVL++PRL+   F
Sbjct  506   PKATPLEVLISPRLNEHFF  524



>ref|XP_006435895.1| hypothetical protein CICLE_v10031217mg [Citrus clementina]
 gb|ESR49135.1| hypothetical protein CICLE_v10031217mg [Citrus clementina]
Length=528

 Score =   457 bits (1177),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 224/496 (45%), Positives = 328/496 (66%), Gaps = 12/496 (2%)
 Frame = -1

Query  1604  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWE  1425
             KQ+K+  P AGGAWP+IGHLH  R   P  + L   ADKYG +FT++LG+ + LVVS+WE
Sbjct  41    KQAKQ-APVAGGAWPLIGHLHLLRGPEPAHRVLGNLADKYGTIFTMKLGVKQALVVSNWE  99

Query  1424  AVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEK  1245
               ++CF TNDK  A RP T A + +GY++ V  F+   +YWR+ RK+V  E+LS+RRLEK
Sbjct  100   IAKECFTTNDKAFAGRPKTMAVELMGYNFLVIGFAPYGNYWRQSRKIVTIELLSNRRLEK  159

Query  1244  LKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSD  1065
             LKHV  SE++ +I+ LY      +++     V M  W     L++I++I+AG+R+  +S 
Sbjct  160   LKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMIHWLEGTALDIILRIIAGKRHTSQS-  218

Query  1064  GTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQ  885
                 EEA   ++  +++  L+G+FV  DA   L F R LD  G+ + M + AK  D ILQ
Sbjct  219   ----EEANDWQQQITKIAALFGQFVVSDA---LPFLRRLDIGGYERLMSKTAKYFDIILQ  271

Query  884   DWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
             +WVD  + +R S E   D+ FI V+LS++DD   Q      DTVIKAI L+++  A++T 
Sbjct  272   EWVDEHKMKRVSGEIKGDEDFIYVLLSLLDDNAEQLPDRDADTVIKAICLTLIVAATDTT  331

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
             A  LTW +A+LL +P+ LK+ QDE+D  +G ER   +SD++NL YLQ ++KET+R+YP G
Sbjct  332   AVTLTWAIALLLNNPDVLKKAQDELDIQVGTERQVNESDMRNLVYLQAIIKETMRLYPAG  391

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P L PHE++E+CIV+GY +P GTQL+VN W++ RDP +W +P +F PERF+T  +     
Sbjct  392   PLLLPHESIEECIVNGYLVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVG  451

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
              + ++ +PFG GRR CP   +  Q+ Q+ +A L  GF+F+T  +EP+DM E +G+ + K 
Sbjct  452   GQDFELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTIAKA  511

Query  173   TPLEVLVTPRLSPTLF  126
             TPLEVLV+PRLS +L+
Sbjct  512   TPLEVLVSPRLSASLY  527



>dbj|BAA35080.1| putative cytochrome P450 [Nicotiana tabacum]
 gb|AAK62347.1| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=519

 Score =   457 bits (1175),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 334/529 (63%), Gaps = 32/529 (6%)
 Frame = -1

Query  1658  LSSILGIAALV----LLWFSW-RKQSK---RLPPEAGGAWPIIGHLHHFRTSVP----LV  1515
             LS I  I  LV    LL+  W +KQSK    LPP+  G WP+IGHL +F  +        
Sbjct  5     LSPIEAIVGLVTFAFLLYLLWTKKQSKILNPLPPKIPGGWPVIGHLFYFNNNGDDDRHFS  64

Query  1514  KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYA  1335
             + L + ADKYGPVFT RLG  R L VSS+EA+++CF+TND   A RP    G+YL Y+ A
Sbjct  65    QKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFSTNDIHFADRPALLYGEYLCYNNA  124

Query  1334  VFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP  1155
             +   +    YW++ RKLV +E+LS  RLEK KHV  S +Q NIK+LY      N +    
Sbjct  125   MLAVAKYGPYWKKNRKLVNQELLSVSRLEKFKHVRFSIVQKNIKQLY------NCDSPMV  178

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI  975
             K+N+S W   LT ++I+++V G+ Y        N   + LK  F + M    E    D +
Sbjct  179   KINLSDWIDKLTFDIILKMVVGKTYN-------NGHGEILKAAFQKFMVQAMEIELYD-V  230

Query  974   FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDVMLSM  810
             F + FF+WLD  G++K MK+  KD+D I+Q W+D   K+R + +     +Q FIDV+LS 
Sbjct  231   FHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDEHIKKRETKDVGGENEQDFIDVLLSK  290

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
               ++   G  YS DT IKA V +++ DA++T A H+ W++A+++ +   +K+ Q+E+DT 
Sbjct  291   RSNEHL-GDGYSHDTTIKATVFTLVLDATDTLALHIKWVMALMINNKNVMKKAQEEMDTI  349

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +G++RW E++D+KNL YLQ +VKE LR++P  P    H +V+DC+V+GYHIPKGT L  N
Sbjct  350   VGRDRWVEENDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSVKDCVVNGYHIPKGTALLTN  409

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             + +L RDP+IW DP+ F PERF+T       + + Y+ +PFG GRR+CP   Y+ Q+  +
Sbjct  410   IMKLQRDPQIWVDPDTFDPERFLTTNAAIDYRGQHYELIPFGSGRRACPAMNYSLQVEHL  469

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             ++A L QGFNF+T  NEPLDM + VG+ LPK T +EVL+TPRL PTL++
Sbjct  470   SIAHLIQGFNFATTTNEPLDMKQGVGLTLPKKTDVEVLITPRLPPTLYQ  518



>ref|XP_011008137.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
Length=516

 Score =   457 bits (1175),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 230/521 (44%), Positives = 328/521 (63%), Gaps = 19/521 (4%)
 Frame = -1

Query  1649  ILGIAALVLLWFSWR--------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWA  1494
             IL    LV L+  W+        K+S R  PE  GAWP+ GHL       P  KTL   A
Sbjct  2     ILEALILVFLYCFWKILARNSESKKSTR-APEPSGAWPLFGHLPSLVGKDPACKTLGAIA  60

Query  1493  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN  1314
             DKYGP+++++ GI R LVVSSWE V+DC  TND++LA R    AGK++ Y+ A F  +T 
Sbjct  61    DKYGPIYSLKFGIHRTLVVSSWETVKDCLNTNDRVLATRAGIAAGKHMFYNNAAFALATY  120

Query  1313  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW  1134
               YWR VRKL   ++LS++RLE LKHV VSE+ T IK L++F +   ++P+  KVN+S+ 
Sbjct  121   GQYWRDVRKLATLQLLSNQRLEMLKHVRVSEVDTFIKGLHSFYAGSVDSPA--KVNISKL  178

Query  1133  FGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR  954
                LT N+ ++ + G+RY   +    N E  R KK   + +YL G FV  DAI P  F  
Sbjct  179   LESLTFNINLRTIVGKRYCSSTYDKENSEPWRYKKAIKKALYLSGIFVMSDAI-P--FLE  235

Query  953   WLDYEGHVKTMKRAAKDVDAILQDWVDARRKER-----RSNEDQKFIDVMLSMIDDQFTQ  789
             WLDY+GHV  MK+ AK++DA++++W+D   K++      S+ +  F+DVM+S + +   +
Sbjct  236   WLDYQGHVSAMKKTAKELDAVIRNWLDEHLKKKIDGELGSDRESDFMDVMISNLAEGPDK  295

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
                YSRD VIKA  L +    + + AT L W L++LL +P  LK  Q+E+D  +G+ERW 
Sbjct  296   ISGYSRDVVIKATALILTLTGAGSTATTLVWTLSLLLNNPTVLKAAQEELDKQVGRERWV  355

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
             E+SD+++L YLQ +VKETLR+YP GP     EA+EDC + GY +PKGT+L VN+W+LHRD
Sbjct  356   EESDIQDLKYLQAIVKETLRLYPPGPLTGIREAMEDCSIGGYDVPKGTRLVVNIWKLHRD  415

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ  249
             P++W +P +F P+RF+T       + +  +F+PF  GRRSCP       +  + +AR+ Q
Sbjct  416   PRVWKNPNEFKPDRFLTTHADLDFRGQNMEFIPFSSGRRSCPAINLGLIVVHLTLARILQ  475

Query  248   GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             GF+ +TV   P+DM+E  GI LPK TPLEV++ PRL   L+
Sbjct  476   GFDLTTVAGLPVDMIEGPGIALPKETPLEVVIKPRLGLELY  516



>ref|XP_007049687.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOX93844.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=527

 Score =   457 bits (1175),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 234/525 (45%), Positives = 332/525 (63%), Gaps = 21/525 (4%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFSWRKQSKR-------LPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1500
             L +I G   LVL +  W+K +         L PE  GA PIIGH+H       L +TL  
Sbjct  7     LFAIAGFLGLVLFYKLWKKGTPSHQRKGILLAPEPPGALPIIGHIHLLGGKRTLAQTLGA  66

Query  1499  WADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFS  1320
              ADKYGP+F+IR G    L++S+ EAV++CF TND++LA+RP + AG YLGYD+A F F+
Sbjct  67    MADKYGPIFSIRFGAFPALIISNHEAVKECFTTNDRVLASRPKSNAGTYLGYDHAGFGFA  126

Query  1319  TNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSA-PKVNM  1143
                 YWR  RKL V E+LSS RLE  KHV   E+   IK LY F     N P A PK  +
Sbjct  127   PYGEYWRETRKLAVVELLSSHRLETSKHVLDFEVNAFIKNLYLFCK--KNGPDANPKAVI  184

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             S  F  LTLN I +++AG+RY    D   + EA+ + KV    MY+ G     +A   + 
Sbjct  185   SHKFEALTLNTITRMIAGKRYISDGDEEDDVEARHVIKVIKDFMYVSGLIAPSEA---MP  241

Query  962   FFRWLD--YEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE----DQKFIDVMLSMIDD  801
             F  W++  + G VK+MKR AK++D+I+  WVD  + +R  +E    +Q FID++LS I +
Sbjct  242   FLGWMESIFGGPVKSMKRVAKEIDSIIGRWVDEHKLKRLMSEADHNNQDFIDLLLSAIGE  301

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
                  + Y+R+T+IKA V+++    ++T +  LTWIL+ L+ +  +LK  Q+E+D  +G+
Sbjct  302   D--SMFGYTRETIIKATVMNLFLAGADTTSIALTWILSNLMNNRHTLKTAQEELDLTVGR  359

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             ++W +DSD++ L YLQ V+KETLR+YP GP   PHEA EDC + GYH+ KGT++ VN+ R
Sbjct  360   DKWVQDSDIEKLVYLQAVIKETLRLYPPGPISVPHEAREDCSISGYHVQKGTRVIVNLRR  419

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             LHRDP+IW +P++F PERF+T+        + ++ +PFG GRRSCPG   A QIT + +A
Sbjct  420   LHRDPRIWSNPDEFQPERFLTSHANVDVLGQHFELIPFGSGRRSCPGMPLALQITHLTIA  479

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             R  QGF+ +T  NE +DM E +GI +PK TPL+VL++PRL   L+
Sbjct  480   RTLQGFDLTTPFNESVDMTEGLGITMPKATPLDVLLSPRLPAALY  524



>ref|XP_010447469.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=527

 Score =   455 bits (1170),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 231/526 (44%), Positives = 336/526 (64%), Gaps = 26/526 (5%)
 Frame = -1

Query  1646  LGIAALVLLWFSWRKQSKR------LPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADK  1488
             L +  +V ++ +  K+SK+       PP+  GAWPIIGHLH       L+ +TL   AD+
Sbjct  8     LFVPIIVFVFIALFKKSKKPKHVLVKPPKPSGAWPIIGHLHLLVGKEQLLYRTLGRLADR  67

Query  1487  YGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNS  1308
             YGP  ++RLG S   VVSS+E  +DCF  NDK LA+RP T A K++GY+YAVF F+  N+
Sbjct  68    YGPTMSLRLGSSEAFVVSSFEVAKDCFTVNDKALASRPMTAAAKHMGYNYAVFGFAPYNA  127

Query  1307  YWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFG  1128
             +WR +RK+   E+LS+RRL+ LKHV VSE+   +K+LY+ + + N       V++ RW  
Sbjct  128   FWREMRKIATIELLSNRRLQMLKHVSVSEISMGVKDLYS-LWVKNGGSEPVMVDLRRWLD  186

Query  1127  HLTLNLIMQIVAGRRYEYRSDGTIN----EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWF  960
             ++TLN+I+++VAG+RY     G+ +    EE ++ K   S+  +L G F   DA FP   
Sbjct  187   NMTLNMIVRMVAGKRYFGGVVGSESSEDTEEGRQCKTAISKFFHLIGIFTVSDA-FP--S  243

Query  959   FRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE----DQKFIDVMLSMIDDQFT  792
              RW D++GH K MK+   ++D IL+ W+D  R+ER+ +     D  FI VMLS+ +    
Sbjct  244   LRWFDFQGHEKEMKQTGSELDVILEKWIDNHRQERKVSGTEEIDSDFIHVMLSLAEQGKL  303

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
                 Y  +  IK+  L+++   SET ++ LTW +A+LL + E LK+ QDEID ++G++R 
Sbjct  304   SHLQYDANISIKSTCLALILGGSETTSSTLTWAIALLLNNKEMLKKAQDEIDLHVGRDRN  363

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E SD+ NL YLQ VVKETLR+YP GP L P EA+EDC V GY++ +GT+L VNVW++ R
Sbjct  364   VEVSDINNLVYLQAVVKETLRLYPAGPLLGPREAMEDCTVAGYNVTRGTRLIVNVWKIQR  423

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             DPK++ +P +F PERF+T   GEA +     + ++ +PFG GRRSCPG+  A Q+  + +
Sbjct  424   DPKVYKEPNEFRPERFIT---GEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGL  480

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             AR    F   TV + P+DM E  G+ +PK TPLEVL++PRL+  LF
Sbjct  481   ARFLHSFEVKTVLDMPVDMTESPGLTIPKATPLEVLISPRLNEHLF  526



>ref|XP_002283952.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   455 bits (1170),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 228/524 (44%), Positives = 337/524 (64%), Gaps = 15/524 (3%)
 Frame = -1

Query  1679  MDAVPCCLSSIL-GIAALVLLWFS---WRKQS--KRLPPEAGGAWPIIGHLHHFRTSVPL  1518
             MD +  CL+ ++ G  A+++L +    WR  +   R+ PEA GAWPIIGHLH    S  L
Sbjct  1     MDFLLQCLNPVMVGAFAILVLSYHLLLWRTGAGKSRMAPEASGAWPIIGHLHLLGGSKNL  60

Query  1517  VKTL-SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYD  1341
                L    ADKYGPVF+IRLG+ R +VV+SWE  ++CF T+D  LA+RP   A KYLGY+
Sbjct  61    PHLLFGTMADKYGPVFSIRLGLKRAVVVNSWEMAKECFTTHDLALASRPEVEAAKYLGYN  120

Query  1340  YAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPS  1161
             YA+F FS + +YWR VRK+   E+LS+RRLE LK+V +SE++T +KELY   +   N   
Sbjct  121   YAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMKELYKLWAEKKNEAG  180

Query  1160  APKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGD  981
                V+M  WFGHLTLN+I+ +VAG+RY   +  +  +EAQ+ +K   +   LWG FV  D
Sbjct  181   VVLVDMKEWFGHLTLNVILMMVAGKRYFGYTGESKEKEAQQCRKAIREFFRLWGLFVVSD  240

Query  980   AIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLSM  810
             AI P  FF WLD  GH+K MK+ AK++D I Q+W++  R+ + S E   +Q F+DV LS+
Sbjct  241   AI-P--FFGWLDVGGHLKAMKKTAKELDGIAQEWLEEHRQRKDSGEADGNQDFMDVTLSI  297

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
             +  +      Y  DT+ KA  L ++   ++T +  LTW++++LL +P+ L++ Q+E+D +
Sbjct  298   LGGRDIT--DYDADTINKATALILIGGGTDTTSATLTWVISLLLNNPDVLRKAQEELDAH  355

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +GKER   + D+  L YLQ +VKETLR+ P  P   P + ++D I+ GYHI KGT+L +N
Sbjct  356   VGKERLVNEMDISKLVYLQAIVKETLRINPTAPLSGPRQFIQDSILGGYHISKGTRLILN  415

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             + ++ RDP++W +P +F P+RF+T  +    + +Q++  PFG GRR CPG ++A Q+  +
Sbjct  416   LTKIQRDPRVWLNPMEFQPDRFLTTHKDVDVRGKQFELTPFGGGRRICPGAVFALQVLHL  475

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
              +A     F  ST  + P+DM E  G+   K TPLEVL++PRL+
Sbjct  476   TLANFLHRFQLSTPSDAPVDMSESFGLTNIKSTPLEVLISPRLA  519



>ref|XP_002510298.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52485.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   455 bits (1170),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 234/524 (45%), Positives = 332/524 (63%), Gaps = 22/524 (4%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFSWRKQSK-------RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLS  1503
             L++I  I + + +  +W +  K       R  PE  G+WPIIGHLH    +  L+ +TL 
Sbjct  7     LTAIAVIISFIFVCSTWLRGKKKSVGSKSREAPEPAGSWPIIGHLHLLGGADKLLHRTLG  66

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
               ADKYGP F IR+G  R LVV+S E  ++CF  NDK LA+R TT A K++ YD+AVF F
Sbjct  67    SLADKYGPAFNIRIGSHRALVVASKELAKECFTINDKTLASRSTTAATKHMCYDHAVFGF  126

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +  +S+WR +RK+V+ E+LS+RRLE +KHV  SE+   I++LY   + +   P    V +
Sbjct  127   APYSSHWREMRKIVMLELLSNRRLEMVKHVQASEVDLGIRKLYNLWAQNRCLPVI--VEL  184

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
              ++F  LTL++I+++VAG+RY   SD   ++EA++ +K  SQ  +L G FV  DA   L 
Sbjct  185   KQFFEDLTLDVIVRVVAGKRYTGSSD---DDEARQYQKAISQFFHLMGIFVVSDA---LP  238

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDVMLSMIDDQ  798
             F RWLD EGH K MK+ AKD+DA+L  W+D  R+ R S E     DQ FIDVMLS+ +  
Sbjct  239   FLRWLDLEGHEKAMKKTAKDLDAVLAGWLDEHRRRRVSGEVKSEGDQDFIDVMLSLEEKG  298

Query  797   FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE  618
                G+ Y  DT IK+  L+++  AS+T  T L W +++LL +  +LK  ++E++ +IG E
Sbjct  299   HLSGFQYDADTSIKSTCLALIAGASDTTTTTLVWAISLLLNNQLALKNAKEELEKHIGTE  358

Query  617   RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL  438
             R  ++SD+KNL YLQ V+KETLR+YP  P L P E VEDC V GYH+P GT+L VNVW++
Sbjct  359   RQVDESDLKNLVYLQAVIKETLRLYPVAP-LIPREFVEDCRVGGYHVPAGTRLLVNVWKI  417

Query  437   HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR  258
              RDP +W     F PERF+T+      +   ++ +PFG GRRSCPG  +A     + +AR
Sbjct  418   QRDPMLWTKASAFQPERFLTSHADIDVRGHHFELLPFGSGRRSCPGASFALHALHLTLAR  477

Query  257   LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
                 F+ +T  ++P+DM E  G  LPK TPLEVL++PRL   L+
Sbjct  478   FLHAFDVATPMDQPVDMTERSGTTLPKATPLEVLLSPRLPAKLY  521



>gb|KEH25406.1| cytochrome P450 family protein [Medicago truncatula]
Length=516

 Score =   454 bits (1169),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 231/511 (45%), Positives = 341/511 (67%), Gaps = 19/511 (4%)
 Frame = -1

Query  1631  LVLLWFSWR--KQSKRL----PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT  1470
             LVL++  W+  K S +     PPE   A P+IGHLH     +PL +  + ++DKYGPVF 
Sbjct  17    LVLIYNIWKIKKPSNKFKGMKPPEPLFALPLIGHLHLLGKQIPLARIFASFSDKYGPVFQ  76

Query  1469  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR  1290
             IRLG    L++S+ EA+++CF TNDK+LA+RP +  G +LGY+YA F+F+ +  Y+ +++
Sbjct  77    IRLGAYPALIISNKEAIKECFTTNDKILASRPKSSHGIHLGYNYAGFSFAPSGPYFSKLK  136

Query  1289  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNL  1110
             K+ + E+LSSRRLE L+HV+ SE+ T IK+L  ++  +NN     KV +S W   L+ N 
Sbjct  137   KITMVELLSSRRLESLRHVYESEIHTWIKDLSFYVKGNNN----VKVVISEWLKRLSFNT  192

Query  1109  IMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV  930
             I +++ G+RY    +    E    +  +  + M + G+FV  D I P+    W  +EG V
Sbjct  193   ITKMIGGKRYFENLNVEDVEAHGNIVNLIREFMLIAGDFVPKDLI-PI--IGWFGFEGQV  249

Query  929   -KTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKA  753
              K+MKR  KD++ ++  W++       SNE   FIDVMLS+I+D   + Y ++RDT+IKA
Sbjct  250   LKSMKRVGKDLETLVGSWIE-EHIVNNSNEKHDFIDVMLSVIEDD--RVYGHNRDTIIKA  306

Query  752   IVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQ  573
              +  ++   S++ +T LTWI+A+LL +   LKR Q+EID +IGK R  E SD+KNL YLQ
Sbjct  307   NITDLMLAGSDSTSTTLTWIVALLLNNRNVLKRAQEEIDHHIGKGRRVESSDIKNLVYLQ  366

Query  572   GVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLP  393
              ++KETLR+YP  P LAPHEA EDC + GY++PKGT+++ NVW+LHRDP IW +PEKFLP
Sbjct  367   AILKETLRLYPAAPLLAPHEATEDCNIQGYYVPKGTRVFFNVWKLHRDPSIWSEPEKFLP  426

Query  392   ERFMTNLEGEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEP  216
             ERF+ N  GE   ++  ++++PFGLGRR+CPG+L+ATQ + + +A L  GF+     +E 
Sbjct  427   ERFI-NENGEIDHESHHFEYLPFGLGRRACPGSLFATQNSLITLACLLHGFDLEVPMDEV  485

Query  215   LDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             +DM E +GI LPKLTPL+V++TPRL   L++
Sbjct  486   VDMREGLGITLPKLTPLQVVLTPRLPFELYQ  516



>ref|XP_002305292.2| hypothetical protein POPTR_0004s10630g [Populus trichocarpa]
 gb|EEE85803.2| hypothetical protein POPTR_0004s10630g [Populus trichocarpa]
Length=516

 Score =   454 bits (1169),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 228/521 (44%), Positives = 327/521 (63%), Gaps = 19/521 (4%)
 Frame = -1

Query  1649  ILGIAALVLLWFSWR--------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWA  1494
             IL    LV L+  W+        K+S R  PE  GAWP+ GHL       P  KTL   A
Sbjct  2     ILEALILVFLYGFWKILARNSEGKKSTR-APEPSGAWPLFGHLPSLVGKDPACKTLGAIA  60

Query  1493  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN  1314
             DKYGP+++++ GI R LVVSSWE V+DC  TND++LA R    AGK++ Y+ A F  +  
Sbjct  61    DKYGPIYSLKFGIHRTLVVSSWETVKDCLNTNDRVLATRAGIAAGKHMFYNNAAFALAPY  120

Query  1313  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW  1134
               YWR VRKL   ++LS++RLE LKHV VSE+ T IK L++F + + ++P+  KVN+S+ 
Sbjct  121   GQYWRDVRKLATLQLLSNQRLEMLKHVRVSEVDTFIKGLHSFYAGNVDSPA--KVNISKL  178

Query  1133  FGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR  954
                LT N+ ++ + G+RY   +    N E  R KK   + +YL G FV  DAI    F  
Sbjct  179   LESLTFNINLRTIVGKRYCSSTYDKENSEPWRYKKAIKKALYLSGIFVMSDAIP---FLE  235

Query  953   WLDYEGHVKTMKRAAKDVDAILQDWVDARRKER-----RSNEDQKFIDVMLSMIDDQFTQ  789
             WLDY+GHV  MK+ AK++DA++++W++   K++      S+ +  F+DVM+S + +   +
Sbjct  236   WLDYQGHVSAMKKTAKELDAVIRNWLEEHLKKKIDGELGSDRESDFMDVMISNLAEGPDK  295

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
                YSRD VIKA  L +    + + AT L W L++LL +P  LK  Q+E+D  +G+ERW 
Sbjct  296   ISGYSRDVVIKATALILTLTGAGSTATTLVWTLSLLLNNPTVLKAAQEELDKQVGRERWV  355

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
             E+SD++NL YLQ +VKETLR+YP GP     EA+EDC + GY +PKGT+L VN+W+LHRD
Sbjct  356   EESDIQNLKYLQAIVKETLRLYPPGPLTGIREAMEDCSIGGYDVPKGTRLVVNIWKLHRD  415

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ  249
             P++W +P +F P+RF+T       + +  +F+PF  GRRSCP       +  + +AR+ Q
Sbjct  416   PRVWKNPNEFKPDRFLTTHADLDFRGQNMEFIPFSSGRRSCPAINLGLIVVHLTLARILQ  475

Query  248   GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             GF+ +TV   P+DM+E  GI LPK TPLEV++ PRL   L+
Sbjct  476   GFDLTTVAGLPVDMIEGPGIALPKETPLEVVIKPRLGLELY  516



>ref|XP_004247061.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=518

 Score =   454 bits (1167),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 224/513 (44%), Positives = 328/513 (64%), Gaps = 21/513 (4%)
 Frame = -1

Query  1646  LGIAALVLLWFSWRKQSKRL---PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPV  1476
             L IA  + ++ + + +S+ +    P+A GAWP IGHLH     +P+ +TL   ADKYGP+
Sbjct  20    LSIAWFLAVFIARKYKSRNITSAAPKAPGAWPFIGHLHLLSGHLPVCRTLGLMADKYGPI  79

Query  1475  FTIRLGISRILVVSSWEAVRDCF-ATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR  1299
             F ++LG    +VVS+WE V+DCF A NDK+ A+RP     KYLGY+ A+F  +    YWR
Sbjct  80    FQLQLGDHPAIVVSNWEMVKDCFTAKNDKIFASRPNMAISKYLGYNGAIFALAPYGPYWR  139

Query  1298  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT  1119
              +RK+V  E+L++ RLEKLKHV  SE+ + IKELY+     NN P   +VN+S WF ++T
Sbjct  140   NIRKMVTLELLTNSRLEKLKHVRTSEVNSCIKELYS-----NNCPG--QVNLSSWFENIT  192

Query  1118  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYE  939
              N+I++++AG+R+      T + E    K+   + +YL G FV  D+I P  +F W+D  
Sbjct  193   CNIIIRMLAGKRF------TGSAEEMNFKESIKKALYLGGTFVFSDSI-P--WFEWMDIG  243

Query  938   GHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVI  759
             GH+K MK   K+VD++   W+          E   FID+MLS + ++      Y+RD +I
Sbjct  244   GHIKAMKDTYKEVDSVFDSWLKQHINSIGDGEQSDFIDIMLSTLPEETNMESGYNRDAII  303

Query  758   KAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPY  579
             KA  L ++  ASE+ A  L W L++LL +  SLK  QDE+D +IG+ +W E+SD+KNLPY
Sbjct  304   KATTLILIMTASESTAETLIWALSLLLNNTHSLKLAQDELDEHIGRNKWVEESDIKNLPY  363

Query  578   LQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKF  399
             LQ +VKETLR+YP GP   P EA+EDC VD YHI KGT+L VN+W+L RD +IW DP +F
Sbjct  364   LQAIVKETLRLYPPGPLAGPREALEDCYVDKYHIKKGTRLIVNLWKLQRDSRIWKDPNEF  423

Query  398   LPER-FMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN  222
              PER F+        + + ++++PF  GRR CPG  + +Q+  + +A+L  GFN S +  
Sbjct  424   KPERWFLKEHTNINFRGQNFEYIPFSSGRRMCPGLTFGSQVVHLTLAKLLHGFNVSMLKE  483

Query  221   EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             EP+D+ E +GI LPK+ PL+ L++PRL+  L++
Sbjct  484   EPVDLSEGLGIALPKVKPLQPLLSPRLAVELYQ  516



>ref|XP_006486179.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   453 bits (1166),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 219/499 (44%), Positives = 325/499 (65%), Gaps = 11/499 (2%)
 Frame = -1

Query  1613  SWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVS  1434
             + +K+  +  PEAGGAWP+IGHLH  R S P  + L   ADKYGP+FT++LG+ + LVVS
Sbjct  37    TLKKKQAQQAPEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVS  96

Query  1433  SWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRR  1254
             +WE  ++CF TNDK  A RP T A + LGY++ V  F+   +YWR+ RK+   E+LS+RR
Sbjct  97    NWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRR  156

Query  1253  LEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEY  1074
             LEKLKHV  SE++ +I+ LY      +++     V M  W     L++I++I+AG+RY  
Sbjct  157   LEKLKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMIHWLEGTVLDIILRIIAGKRYTS  216

Query  1073  RSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDA  894
             +S   +N+  Q++ K  +    L G+FV  DA   L F RWLD  G+ + M + AK  D 
Sbjct  217   QSQ-EVNDWQQQITKFTA----LSGQFVVSDA---LPFLRWLDIGGYERLMSKTAKYFDI  268

Query  893   ILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
             ILQ+W+D  + +R S +   D+ F+ V+LS++DD   Q      D VIKAI ++++  A+
Sbjct  269   ILQEWLDEHKMKRDSGDAKGDEDFMYVLLSLLDDNAEQLPDRDADAVIKAICVTLIVAAA  328

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             +T    LTW +A+L+ + + LK+ QDE+D  +G ER   +SD +NL YLQ ++KET+R+Y
Sbjct  329   DTSVVTLTWAIALLVNNRDVLKKAQDELDIQVGTERPVNESDARNLVYLQAIIKETMRLY  388

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P  P L PHE +E+CIV+GYH+P GTQL+VN W++ RDP +W +P +F PERF+T  +  
Sbjct  389   PAAPLLLPHECIEECIVNGYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDI  448

Query  362   AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
                 + ++ +PFG GRR CP   +  Q+ Q+ +A L  GF+F+T  +EP+DM E +G+ +
Sbjct  449   DVGGQDFELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTI  508

Query  182   PKLTPLEVLVTPRLSPTLF  126
              K TPLEVLV+PRLS +L+
Sbjct  509   AKATPLEVLVSPRLSASLY  527



>ref|XP_002282035.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=528

 Score =   453 bits (1165),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 232/514 (45%), Positives = 325/514 (63%), Gaps = 15/514 (3%)
 Frame = -1

Query  1652  SILGIAALVLLWFSW-------RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWA  1494
             +I  I  L +L+ S+       R   +R+ PEA GAWPIIGHLH    S     TL   A
Sbjct  14    NITTIGVLGILFLSYYLLVRRSRAGKRRIAPEAAGAWPIIGHLHLLGGSQLPHVTLGTMA  73

Query  1493  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN  1314
             DKYGP+FTIRLG+ R LVVSS E  ++CF TND  ++ RP   A ++LGY+YA+F FS  
Sbjct  74    DKYGPIFTIRLGVHRALVVSSREVAKECFTTNDSAVSGRPKLVAPEHLGYNYAMFAFSPY  133

Query  1313  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRW  1134
             ++YWR VRK+V  E+LS+RRLE LK V  SE++T+IKELY   +   N      V M +W
Sbjct  134   DAYWREVRKIVNTELLSNRRLELLKDVRASEVETSIKELYKLWAEKKNELGHVLVEMKQW  193

Query  1133  FGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR  954
             FG L++N+I+++V G+RY     G   EEA+R +K   +   L G FV  D I  L    
Sbjct  194   FGDLSMNVILRMVVGKRYFGVGAGGEEEEARRCQKAIREFFRLLGLFVVKDGIPSLG---  250

Query  953   WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNED---QKFIDVMLSMIDDQFTQGY  783
             WLD  GH K MK+ AK++D+I Q+W++  R+ +   ED     F+DV+LS++D +     
Sbjct  251   WLDLGGHEKAMKKTAKEIDSIAQEWLEEHRRRKDWGEDNGMHDFMDVLLSVLDGKALP--  308

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              Y  DT+ KA  ++++   ++T    LTW L+++L + E+LK+ ++E+DT++GKER    
Sbjct  309   EYDADTINKATSMALISGGTDTMTVTLTWALSLILNNRETLKKAKEELDTHVGKERLVNA  368

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             SD+  L YLQ +VKETLR+ P GP   P +  EDCI+ GYH+PKGT+L +N+ +LHRDP 
Sbjct  369   SDISKLVYLQAIVKETLRLRPPGPLSGPRQFTEDCIIGGYHVPKGTRLVLNLSKLHRDPS  428

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             +W DPE+F PERF+T      A+ + +Q +PFG GRRSCPG  +A Q+  +A+A    GF
Sbjct  429   VWLDPEEFQPERFLTTHRDVDARGQHFQLLPFGAGRRSCPGITFALQMLHLALASFLHGF  488

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
               ST  N P+DM E  G+   K TPLE+L+ PRL
Sbjct  489   EVSTPSNAPVDMSEIPGLTNIKSTPLEILIAPRL  522



>emb|CAN74205.1| hypothetical protein VITISV_031127 [Vitis vinifera]
Length=525

 Score =   452 bits (1163),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 230/525 (44%), Positives = 329/525 (63%), Gaps = 17/525 (3%)
 Frame = -1

Query  1679  MDAVPCCLS-------SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVP  1521
             MD +  CL+       +IL ++  +LLW S   +S R+ PEA GAWPIIGHLH    S  
Sbjct  1     MDFLLQCLNPVMVGAFAILVLSYHLLLWRSGAGKS-RMAPEASGAWPIIGHLHLLGGSKN  59

Query  1520  LVKTL-SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGY  1344
             L   L    ADKYGPVF+IRLG  R +VVSSWE  ++CF T+D  LA+RP   A KYLGY
Sbjct  60    LPHLLFGTMADKYGPVFSIRLGXKRAVVVSSWEMAKECFTTHDLALASRPEVVAAKYLGY  119

Query  1343  DYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNP  1164
             +YA+F FS + +YWR VRK+   E+LS+RRLE LK+V +SE++T +KELY   +   +  
Sbjct  120   NYAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMKELYKLWAEKKSEA  179

Query  1163  SAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSG  984
                 V+M +WFGHL+LN+I+++V G+RY   +  +  +EAQ+ +K   +   L G FV  
Sbjct  180   GVVLVDMKQWFGHLSLNVILKMVVGKRYFGYAAESKEKEAQQCQKAIREFFRLLGLFVVS  239

Query  983   DAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLS  813
             DA   L F  WLD  GHVK MK+ AK++D I Q+W++  R+ + S E   DQ F+DVMLS
Sbjct  240   DA---LPFLGWLDVGGHVKAMKKTAKELDGIAQEWLEEHRRRKDSGEADGDQDFMDVMLS  296

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
             ++      GY    D + KA  L ++   ++T +  LTW +++LL +P  L++ Q+E+DT
Sbjct  297   ILGATDPNGYD--ADXINKATSLILIAGGTDTTSXTLTWAISLLLNNPHVLRKAQEELDT  354

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
             ++GKER   + D+  L YLQ +VKETLR+YP  P     + ++D ++ GYHIPKGT+L +
Sbjct  355   HVGKERLVNEMDISKLVYLQAIVKETLRLYPAAPLSGQRQFIQDSVLGGYHIPKGTRLLL  414

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             N+ ++ RDP++W +P  F P RF+T  +    + + +   PFG GRR CPG  +A Q+  
Sbjct  415   NLTKIQRDPRVWLNPTXFQPSRFLTTYKDVDVKGKHFVLTPFGGGRRICPGAAFALQVLP  474

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
             + +A     F  ST  N P+DM E  GI   K TPLEVL++PRL+
Sbjct  475   LTLANFLHKFQLSTPSNSPIDMSESFGITNIKSTPLEVLISPRLA  519



>emb|CBI29738.3| unnamed protein product [Vitis vinifera]
Length=727

 Score =   459 bits (1180),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 232/509 (46%), Positives = 323/509 (63%), Gaps = 21/509 (4%)
 Frame = -1

Query  1655  SSILGIAALVL---LWFS-WR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             S  L IA L+L   LW++ WR      K     PPE  GAWP +GHLH     VP+ +TL
Sbjct  5     SHFLAIAGLILGLVLWYNHWRGKTLTHKSKGMSPPEPSGAWPFVGHLHLLHGKVPVFRTL  64

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
                ADK GPVF IRLG+ R LVVS+ EA ++CF TNDK+ A+RP + A K LGY+YA F 
Sbjct  65    GAMADKVGPVFVIRLGMYRTLVVSNREAAKECFTTNDKIFASRPNSSAAKILGYNYAAFA  124

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN  1146
             F+ +  YWR +RKL + EILS+RRL  L HV VSEL   IK+LY  +  DNN  +  KV 
Sbjct  125   FAPHGPYWREMRKLSMLEILSTRRLGDLMHVQVSELHAGIKDLY-ILGKDNNWVNPKKVV  183

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             +S WF HLT N+++++VAG+RY + +     EEA+       +V+ L G  V+ D I P 
Sbjct  184   ISEWFEHLTFNVVLRMVAGKRY-FNNVVHGGEEARSAIAAIKKVLLLVGASVASDVI-P-  240

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQFT  792
              F  W+D +GH+ +MK  AK++D++++ WV     R    ++    FID+ML+ + D   
Sbjct  241   -FLEWVDLQGHLSSMKLVAKEMDSLIESWVKEHTGRLNSEASSSLDFIDIMLTKLKD--A  297

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
               + YSR+T+IKA VL+M+   S+T +   TW+L+ LL +   +K  Q+E+D  +G++RW
Sbjct  298   SLFGYSRETIIKATVLTMIVAGSDTTSLTSTWLLSALLNNKHVMKHAQEELDLKVGRDRW  357

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E SD++NL Y++ +VKETLR+Y   P L PHEA+EDC V GYHI KGT+L VN W+LHR
Sbjct  358   VEQSDIQNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCHVGGYHISKGTRLLVNAWKLHR  417

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP +W +PE+F PERF+T+        + ++ +PFG GRRSCPG     Q+  + +ARL 
Sbjct  418   DPAVWSNPEEFQPERFLTSHANVDVFGQHFELIPFGSGRRSCPGLNMGLQMLHLTIARLL  477

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPL  165
             QGF+ +   N P+DM E  GI + KL PL
Sbjct  478   QGFDMTKPSNSPVDMTE--GITIKKLVPL  504


 Score =   164 bits (415),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 98/265 (37%), Positives = 152/265 (57%), Gaps = 23/265 (9%)
 Frame = -1

Query  1196  YTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTIN-EEAQRLKKVFS  1020
             +  I   +   S P +NM     HLT+  ++Q   G      S+  ++  E   +KK+  
Sbjct  447   FELIPFGSGRRSCPGLNMGLQMLHLTIARLLQ---GFDMTKPSNSPVDMTEGITIKKLVP  503

Query  1019  QVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSN  846
                 L G FV+ D I P  F  W+D +GH+ +MK+ AK++D++L+ WV+    R    ++
Sbjct  504   ----LAGAFVASDLI-P--FLEWVDLQGHLSSMKQVAKEMDSVLESWVEEHTGRLNTEAS  556

Query  845   EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPE  666
               Q FID+ML+ + D     + YSR+T+IKA VL ++   S+T +   TW+L+ LL +  
Sbjct  557   SRQDFIDIMLTKLKD--ASLFGYSRETIIKATVLILIVVGSDTTSITSTWLLSALLNNRH  614

Query  665   SLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVD-  489
              +K  Q+E+D  +G++RW E SD++NL YL+ +VKETLR+ P  P L P EA+ED  V  
Sbjct  615   VMKHAQEELDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLCPAIPLLVPLEAMEDYHVGY  674

Query  488   -----GYHIPKGTQLYVN--VWRLH  435
                  GYHIPKGT+L  +  +W +H
Sbjct  675   HSNSPGYHIPKGTRLLSHFLLWNVH  699



>emb|CDP03915.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   450 bits (1157),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 216/435 (50%), Positives = 309/435 (71%), Gaps = 10/435 (2%)
 Frame = -1

Query  1601  QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEA  1422
             ++++ PPE  GAWP+IGHL    +   L +T    ADKYGPVF+IRLG++R LVVS+WEA
Sbjct  36    KARKQPPEPSGAWPVIGHLLQLNSHDTLARTFGALADKYGPVFSIRLGMTRALVVSNWEA  95

Query  1421  VRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKL  1242
             V++CF TNDK+LA+RP + AG YLGY+ A F F+    +WR++RKLV+ ++LS+RRLE L
Sbjct  96    VKECFTTNDKVLASRPDSNAGVYLGYNNAAFGFAPYGHFWRQMRKLVLLQVLSNRRLETL  155

Query  1241  KHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDG  1062
             +HV VSE+QT+ +EL++ I+ + N P+  KV +S W   LTLN+I++ VAG+RY     G
Sbjct  156   RHVRVSEIQTSTRELFSVINREENAPA--KVVISEWVEQLTLNIIVRTVAGKRYSDSEAG  213

Query  1061  TINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQD  882
                 +AQ  KKV  + MY+ G+    D I P    RWLD  GH+K+MKR  K++DAI+Q 
Sbjct  214   N-RIDAQYFKKVVKEYMYVTGQLDLSDVI-PFPPLRWLDPLGHIKSMKRLFKELDAIMQI  271

Query  881   WVDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
             W+D   ++RR    S ++Q FIDV+LS+I+D F  G    R+T+IKA + +++   S+T 
Sbjct  272   WIDEHVEKRRTKSISGDEQSFIDVLLSVIEDDFALGQP--RETLIKATINNLILAGSDTT  329

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
             + HLTW+L++L+ + + +++ Q+EID+++GKERW  +SD+KNL YLQ +VKE LR+YP G
Sbjct  330   SVHLTWLLSLLVNNRQVMEQAQEEIDSSVGKERWVNESDIKNLVYLQAIVKEALRLYPPG  389

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P   PH A EDC V GYH+PKGT+++VNVW+LHRDP+IW +P+KF PERFMT+       
Sbjct  390   PLSVPHLAREDCEVSGYHVPKGTRVFVNVWKLHRDPRIWSEPDKFCPERFMTSHAEVDVS  449

Query  353   NRQYQFVPFGLGRRS  309
              + ++F PFG GRRS
Sbjct  450   GQHFEFTPFGSGRRS  464



>emb|CAN81014.1| hypothetical protein VITISV_025152 [Vitis vinifera]
Length=519

 Score =   452 bits (1162),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 231/523 (44%), Positives = 336/523 (64%), Gaps = 19/523 (4%)
 Frame = -1

Query  1658  LSSILGIAAL---VLLWFS-WR-----KQSKRL-PPEAGGAWPIIGHLHHFRTSVPLVKT  1509
             L+ +L  A L   +L W++ WR       SK +  P+  GAWPIIGHLH     VP+ +T
Sbjct  4     LTHLLAFAGLFLGLLXWYNRWRVRXLTHNSKGISAPKPPGAWPIIGHLHLLSGQVPIFRT  63

Query  1508  LSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVF  1329
             L   ADK+GPVF I+LG+   +VVSS EAV++CF TNDK+ A+RP +   K LGY+YA F
Sbjct  64    LGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFTTNDKVFASRPRSSVSKLLGYNYAGF  123

Query  1328  TFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKV  1149
              F+    +WR +RKL V EILS+RRL +LK V +SEL   I++LY+ +  DNN  S  +V
Sbjct  124   GFAPYGPFWREMRKLSVVEILSARRLNELKDVRISELDACIQDLYS-LGKDNNWISPIEV  182

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFP  969
              MS WF HLT N +++++AG+RY + +    NEEA+       + + L G FV  D +FP
Sbjct  183   VMSEWFEHLTFNFVLRMIAGKRY-FDNAVHGNEEARGAIIAIKKFLSLSGAFVPSD-VFP  240

Query  968   LWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQF  795
               F   LD +G++ +MK  A+++D ++  WV+    R +        FIDV+LS + D  
Sbjct  241   --FLERLDLKGYLGSMKHVAEELDCLVGSWVEEHVMRLKSEPGSRHDFIDVLLSAVQD--  296

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
             T  + +SR+TVIKA + +++   S++ +   TWIL+ LL + E++K  Q+E+D  +G+ R
Sbjct  297   TSMFGHSRETVIKATIGNLIVGGSDSTSITSTWILSALLNNREAMKXAQEELDLKVGRSR  356

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W E+SD++ L YL+ ++KE+LR+Y   P L PHEA +DC V GYHIPKGT+L+VN W+LH
Sbjct  357   WVEESDIQKLDYLRAIIKESLRLYXAAPLLVPHEATQDCHVCGYHIPKGTRLFVNAWKLH  416

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP++W +PE+F PERF+ +         Q++ +PFG GRR+CPG   A Q+  +  ARL
Sbjct  417   RDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINMALQMLHLTFARL  476

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGF+ +T  N P+DM E +   +PKLTPL V++TPRL   L+
Sbjct  477   LQGFDMATPSNAPVDMTEGISFTMPKLTPLXVMLTPRLPSHLY  519



>gb|AJD25202.1| cytochrome P450 CYP82U4 [Salvia miltiorrhiza]
Length=522

 Score =   451 bits (1161),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 218/510 (43%), Positives = 330/510 (65%), Gaps = 13/510 (3%)
 Frame = -1

Query  1634  ALVLLWFSWRKQSKRL--PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRL  1461
             A +L+ +S+   +K++  PPE  GAWP+IGHLH      P+ +TL   AD++GPVF++RL
Sbjct  18    ATILIIYSYFSSTKKVTTPPEPPGAWPLIGHLHLLDGLSPVARTLGAMADRHGPVFSLRL  77

Query  1460  GISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLV  1281
             G  R LVVSSWEA+++C   ND++ A RP+    KYLGY  A F  +    YWR VRK+V
Sbjct  78    GSHRGLVVSSWEAIKECLTANDRVFATRPSIAVAKYLGYGGASFGLAPYGPYWRDVRKMV  137

Query  1280  VEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQ  1101
               ++L++R L+   HV  +E+   +K+L++     N   S   V +S     LT N+I++
Sbjct  138   TVDLLTARHLDDFSHVRTAEVDGFVKDLHSMCGGGNGGESKMVVALSGRIELLTFNIILR  197

Query  1100  IVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTM  921
             ++ G+R+ + S G  +++  R ++   +V+YL G FV  DAI  L    WLD  G++K+M
Sbjct  198   MLVGKRFSF-SKGD-DDKNWRFQEAIKKVLYLGGVFVFSDAIPSL---EWLDIGGYIKSM  252

Query  920   KRAAKDVDAILQDWVDAR---RKERRSNEDQKFIDVMLSMID-DQFTQGYSYSRDTVIKA  753
             K+  K VD +L+DWV  R   RK++ +  D  F+DVMLS ID ++   GY+  R+TVIKA
Sbjct  253   KQTFKQVDNVLEDWVQERIQTRKQKDAQTDSDFMDVMLSTIDKNEMMAGYT--RETVIKA  310

Query  752   IVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQ  573
              +L ++   SE+ +  + W +++LL +P ++K  QDEID NIG++R+ ++SD+ NL YLQ
Sbjct  311   TILMLIMTGSESTSETIIWAISLLLNNPHTMKTAQDEIDNNIGRDRFVQESDINNLTYLQ  370

Query  572   GVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLP  393
              + KETLR+YP GP   P EA+EDC + GYH+P+GT+L +N+W+LHRDP IW +P++F P
Sbjct  371   AIFKETLRLYPPGPLSGPREALEDCHIGGYHVPRGTRLVLNLWKLHRDPNIWFNPDEFRP  430

Query  392   ERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPL  213
             ERF+        + + ++F+PF  GRR CPG  +  Q+  + +ARL Q F+FS    E +
Sbjct  431   ERFLNEKSQMNFKGQYFEFIPFSSGRRMCPGMTFGLQVIHLTLARLLQSFDFSMPNGETV  490

Query  212   DMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             DM E +GI LPKL PL+V++TPRL   L++
Sbjct  491   DMGEGLGIALPKLKPLDVVLTPRLPKKLYQ  520



>emb|CDP15728.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   452 bits (1162),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 218/495 (44%), Positives = 312/495 (63%), Gaps = 13/495 (3%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             PE  GA P IGHLHH    +PL + L   ADK+GP+F++RLG    +VVSSWE V+DCF 
Sbjct  40    PEPPGALPFIGHLHHLGGQLPLARILGSMADKHGPIFSLRLGSRPAIVVSSWEMVKDCFT  99

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
             TNDK  A+RP     KY+G + A+F+ +    YWR VRK+V  E+L+++RLEKLKHV  S
Sbjct  100   TNDKTFASRPNMAVAKYMGNNNAIFSLAPYGPYWRDVRKMVTLELLTNQRLEKLKHVRAS  159

Query  1223  ELQTNIKELYTFISMDNNNPSA---PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTIN  1053
             E    I++LY+  S  N+ P      KV ++ WF  LT NLI++++ GR +   S G  N
Sbjct  160   EFNKWIRDLYSLCS-KNDRPDVDVPTKVVLNEWFELLTFNLILRMLVGRPFSTSSQGNDN  218

Query  1052  EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVD  873
              E +RLK+   + +YL G FV  D I    +  WLD  GH+K+MK+A K++D +L  W+ 
Sbjct  219   SEDRRLKEAIKKALYLSGVFVFSDVIP---WIEWLDIGGHIKSMKKAGKELDEVLGQWLQ  275

Query  872   -----ARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFAT  708
                  A++    S     F+DVMLS I  +  +   + RD +IK+   +++   SE+ A 
Sbjct  276   EHIQKAKQSHPESEAVHDFMDVMLSTIP-EIGEISGHKRDAIIKSTTATLILTGSESTAE  334

Query  707   HLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPY  528
              L W L++LL HP  LK  Q+E+D  +GK+RW E++D+KNL +LQ +VKET R+YP GP 
Sbjct  335   TLIWALSLLLNHPNILKIAQNELDVQVGKQRWIEEADIKNLSFLQAIVKETFRLYPPGPL  394

Query  527   LAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNR  348
               P EA EDC +  + +PKG +L VN+W+LHRDP+IW DP +F PERFM + E  + + +
Sbjct  395   SGPREATEDCYLGNFFVPKGARLIVNLWKLHRDPRIWSDPLEFKPERFMNSHENISLKGQ  454

Query  347   QYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTP  168
              ++++PF  GRR CP   Y   + Q+ +AR+ Q F+ +T    P+DM E +G+ LPKL P
Sbjct  455   SFEYIPFSSGRRMCPAVNYGMNVVQLTLARMLQAFDITTPMGMPVDMGEGLGVALPKLKP  514

Query  167   LEVLVTPRLSPTLFR  123
             LEVL+TPRL   L++
Sbjct  515   LEVLLTPRLPVELYQ  529



>ref|XP_006342717.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=527

 Score =   451 bits (1161),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 231/525 (44%), Positives = 340/525 (65%), Gaps = 26/525 (5%)
 Frame = -1

Query  1646  LGIAALVLLWFSWRKQ---SKRLPPEAGGAWPIIGHLHHFR-TSVPLVKTLSEWADKYGP  1479
             L I  L+ L+F ++ +   + +  PE  GAWPIIGHLH    T   L +TL   AD YGP
Sbjct  9     LIIGVLIFLYFIFKNKNYSTSKQVPEPAGAWPIIGHLHLLGGTEQLLYRTLGAMADNYGP  68

Query  1478  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR  1299
              F +RLG  R  VVSSWE  ++CF  NDK LA+RPTT A K++GY YAVF F+  + +WR
Sbjct  69    AFNLRLGTRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFAPYSPFWR  128

Query  1298  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT  1119
              +RK+ + E+LS+RRL+ LK+V VSE+   I+ELY  + +DNN+     V + RWF  LT
Sbjct  129   EMRKIAMFELLSNRRLDALKYVQVSEVDIGIQELYK-LWVDNNSDRPILVELKRWFEDLT  187

Query  1118  LNLIMQIVAGRRYEYRSDGTIN--EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD  945
             LN+I+++VAG+RY + +  T +  +EA+R +K  +Q  +L G FV  DA FP+    W D
Sbjct  188   LNVIVRMVAGKRY-FGAGATCDNDDEARRCQKAINQFFHLIGIFVPSDA-FPI--LGWFD  243

Query  944   YEGHVKTMKRAAKDVDAILQDWVDARRKERR-------SNED---QKFIDVMLSMIDDQF  795
               GH K MK+ AK++D IL+ W+   R++R+       S  D   Q FIDVMLS+ ++  
Sbjct  244   INGHEKAMKKTAKELDFILEGWLKEHREKRKCTSIEVKSTTDSAVQDFIDVMLSLEEEGR  303

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
                + Y  DT IK+  L+++   S+T A  LTW +++LL +P+ L + Q+EID ++GK R
Sbjct  304   LSNFPYDADTSIKSTCLALILGGSDTTAGTLTWAISLLLNNPKILTKAQEEIDLHVGKNR  363

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
               ++SD+ NL Y+Q ++KETLR+YP GP L P EA+++C + GY I  GT+L VNVW++ 
Sbjct  364   QIDESDINNLIYIQAIIKETLRLYPAGPLLGPREAMDNCEISGYKITPGTRLIVNVWKIQ  423

Query  434   RDPKIWPDPEKFLPERF-MTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR  258
             RDP+IW DP+ F P+RF M+N++    + + ++ +PFG GRRSCPG   A Q+  + +AR
Sbjct  424   RDPRIWEDPDCFNPDRFLMSNVD---VKGKDFELIPFGSGRRSCPGASLALQVLHLTLAR  480

Query  257   LFQGFNFST-VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +   F F+  +  +P+D+ E  G+ +PK TPL+VL+ PRLS  L+
Sbjct  481   ILHAFEFTKPIDGQPIDLTESPGLTIPKATPLDVLIAPRLSANLY  525



>ref|XP_002264473.1| PREDICTED: cytochrome P450 82C4-like [Vitis vinifera]
Length=519

 Score =   451 bits (1160),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 229/523 (44%), Positives = 334/523 (64%), Gaps = 19/523 (4%)
 Frame = -1

Query  1658  LSSILGIAAL---VLLWF------SWRKQSKRL-PPEAGGAWPIIGHLHHFRTSVPLVKT  1509
             L+ +L  A L   +L W+      +    SK +  P+  GAWPIIGHLH     VP+ +T
Sbjct  4     LTQLLAFAGLFLGLLFWYNRWIVRTLTHNSKGISAPKPPGAWPIIGHLHLLSGQVPIFRT  63

Query  1508  LSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVF  1329
             L   ADK+GPVF I+LG+   +VVSS EAV++CF TNDK+ A+RP +   K LGY+YA+F
Sbjct  64    LGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFTTNDKVFASRPRSSVSKLLGYNYAMF  123

Query  1328  TFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKV  1149
               +    +WR +RKL V EILS+RRL +LK V +SEL   IK+LY+ +  DNN  S  KV
Sbjct  124   GSAPYGLFWREMRKLSVVEILSARRLNELKDVRISELDACIKDLYS-LGKDNNWISPIKV  182

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFP  969
              MS WF HLT N  ++++AG+RY + +    NEEA+       + + L G FV  D +FP
Sbjct  183   VMSEWFEHLTFNFALRMIAGKRY-FDNAVHGNEEARGAIITIKKYLSLSGAFVPSD-VFP  240

Query  968   LWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNED--QKFIDVMLSMIDDQF  795
               F   LD +G++ +MK   +++D ++  WV+      +S       FIDV+LS + D  
Sbjct  241   --FLERLDLQGYLGSMKHVTEELDCLVGSWVEEHVMRLKSEPGCRHDFIDVLLSTVQD--  296

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
             T  + ++R+TVIKA +++++   S++ +   TWIL+ LL + E++K  Q+E+D  +G+ R
Sbjct  297   TSMFGHTRETVIKATIVNLIVGGSDSTSITSTWILSALLNNREAMKHAQEELDLKVGRSR  356

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W E+SD++ L YL+ ++KE+LR+YP  P L PHEA +DC V GYHIPKGT+L+VN W+LH
Sbjct  357   WVEESDIQKLDYLRAIIKESLRLYPAAPLLVPHEATQDCHVCGYHIPKGTRLFVNAWKLH  416

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP++W +PE+F PERF+ +         Q++ +PFG GRR+CPG   A Q+  +  ARL
Sbjct  417   RDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINMALQMLHLTFARL  476

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGF+ +T  N P+DM E +   +PKLTPL V++TPRL   L+
Sbjct  477   LQGFDMATPSNAPVDMTEGISFTMPKLTPLRVMLTPRLPSHLY  519



>gb|KEH18125.1| cytochrome P450 family protein [Medicago truncatula]
Length=506

 Score =   450 bits (1158),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 230/493 (47%), Positives = 328/493 (67%), Gaps = 28/493 (6%)
 Frame = -1

Query  1586  PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCF  1407
             PPE   A P+IGHLH     +PL +  + ++DKYGP+F I  G    L++S+ EA+++CF
Sbjct  38    PPEPSYALPLIGHLHLLGNQIPLARIFASFSDKYGPIFQIHFGAYPALIISNKEAIKECF  97

Query  1406  ATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWV  1227
              TNDK+LA+RP +  G +LGY+YA F F+    YW ++RKL + E+LSSRRLE L+HV+ 
Sbjct  98    TTNDKILASRPKSSHGIHLGYNYAGFGFAPYGPYWTKLRKLTMLELLSSRRLESLRHVYE  157

Query  1226  SELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEE  1047
             SE+ T IK+L  ++ +        KV +S W               R +EY  D    E 
Sbjct  158   SEIDTLIKDLSLYVKV-----GKVKVVISEWLE-------------RYFEYLKDVDDVEA  199

Query  1046  AQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV-KTMKRAAKDVDAILQDWVDA  870
                + K+  + M++ GEFV  D I P+    W  +EG V K+MKR A+D+DA++  WV+ 
Sbjct  200   HGNIVKLIKEFMHISGEFVPKDLI-PI--LGWFGFEGKVLKSMKRIARDLDAVVGSWVEE  256

Query  869   R--RKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTW  696
                  E +SNE   FIDVMLS+I+D  T G++  RDT+IKA V++++   S+T +T +TW
Sbjct  257   HDVEIESKSNEKYDFIDVMLSVIEDDPTSGHN--RDTIIKANVMNLMLAGSDTTSTTMTW  314

Query  695   ILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPH  516
             ILA+L+ +  +LK  Q+EID +IG++R  E SD+KNL YLQ +VKETLR+YP GP L PH
Sbjct  315   ILAILMNNMNALKHAQEEIDHHIGRDRRVESSDIKNLVYLQAIVKETLRLYPPGPLLVPH  374

Query  515   EAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA-AQNRQYQ  339
             E  EDC +  Y++PKGT+++ NVW+LHRDP IW +PEKFLPERF+ N  GE   ++  ++
Sbjct  375   EVTEDCYIQDYYVPKGTRVFANVWKLHRDPSIWLEPEKFLPERFI-NENGEIDHESHHFE  433

Query  338   FVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEV  159
             ++PFGLGRR+CPG+L+ATQ+  + +ARL  GF+     +E +DM E +GI LPKLTPL+V
Sbjct  434   YLPFGLGRRACPGSLFATQVILITLARLLHGFDLEVPMDEVVDMREGLGITLPKLTPLQV  493

Query  158   LVTPRLSPTLFRL  120
             ++TPRLS  L+RL
Sbjct  494   VLTPRLSCELYRL  506



>ref|XP_006435903.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
 gb|ESR49143.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
Length=528

 Score =   451 bits (1160),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 218/499 (44%), Positives = 324/499 (65%), Gaps = 11/499 (2%)
 Frame = -1

Query  1613  SWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVS  1434
             + +K+  +  PEAGGAWP+IGHLH  R S P  + L   ADKYGP+FT++LG+ + LVVS
Sbjct  37    TLKKKQAQQAPEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVS  96

Query  1433  SWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRR  1254
             +WE  ++CF TNDK  A RP T A + LGY++ V  F+   +YWR+ RK+   E+LS+RR
Sbjct  97    NWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRR  156

Query  1253  LEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEY  1074
             LEKLKHV  SE++ +I+ LY      +++     V M  W     L++I++I+AG+RY  
Sbjct  157   LEKLKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMIHWLEGTVLDIILRIIAGKRYTS  216

Query  1073  RSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDA  894
             +S   +N+  Q++ K  +    L G+FV  DA   L F RWLD  G+ + M + AK  D 
Sbjct  217   QSQ-EVNDWQQQITKFTA----LSGQFVVSDA---LPFLRWLDIGGYERLMSKTAKYFDI  268

Query  893   ILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
             ILQ+W+D  + +R S +   D+ F+ V+LS++DD   Q      D VIKAI ++++  A+
Sbjct  269   ILQEWLDEHKMKRDSGDAKGDEDFMYVLLSLLDDNAEQLPDRDADAVIKAICVTLIVAAA  328

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             +T    LTW +A+L+ + + LK+ QDE+D  +G ER   +SD +NL YLQ ++KET+R+Y
Sbjct  329   DTSVVTLTWAIALLVNNRDVLKKAQDELDIQVGTERPVNESDARNLVYLQAIIKETMRLY  388

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P  P L PHE +E+CIV+GYH+P GTQL+VN W++ RDP +W +P +F PERF+T  +  
Sbjct  389   PAAPLLLPHECIEECIVNGYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDI  448

Query  362   AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
                 + ++ +PFG GRR CP   +  Q+ Q+ +A L  GF+F+T  +EP+DM E +G+ +
Sbjct  449   DVGGQDFELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTI  508

Query  182   PKLTPLEVLVTPRLSPTLF  126
              K TPLEVLV+PR S +L+
Sbjct  509   AKATPLEVLVSPRHSASLY  527



>emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera]
Length=528

 Score =   451 bits (1159),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/492 (45%), Positives = 315/492 (64%), Gaps = 10/492 (2%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             P AGGAWPIIGHLH F       KTL   ADKYGPVFTIRLG++ ILV+SS E  R+CF 
Sbjct  41    PRAGGAWPIIGHLHLFGAQQLTHKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECFT  100

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
             T+D++ + RP+  A K LGYD+A+F F+   SYWR +RK+V  E+LS+ RL+ LKH+  S
Sbjct  101   THDRVFSTRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIRAS  160

Query  1223  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEA  1044
             E+ T+I+ELY     +        V+M RWFG LTLNL +++V G+RY      T   E 
Sbjct  161   EVGTSIRELYEMWVSERGTDGRVFVDMKRWFGDLTLNLAVRLVGGKRYFGAGADTKEGEG  220

Query  1043  QRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARR  864
             +  +KV     +L+G FV  DAI P  F  WLD +G+ K MKR AK++D++   W+   +
Sbjct  221   RTCQKVIRDFAHLFGVFVLSDAI-P--FLSWLDLKGYKKAMKRTAKELDSLFGGWLQEHK  277

Query  863   KER----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTW  696
             ++R       +DQ F+DVML++++D    G  +  DTV KA  L+++   S+T    LTW
Sbjct  278   EKRLLGGEGKDDQDFMDVMLTVLEDVNFSG--FDADTVNKATCLNLILAGSDTTKVTLTW  335

Query  695   ILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPH  516
              L++LL HP  LK+ Q E+D  +GK+R  ++SDVKNL YLQ ++KETLR+YP  P +  H
Sbjct  336   ALSLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPIITLH  395

Query  515   EAVEDC-IVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQ  339
              A+EDC +  GY+I  GTQ+ VN W++HRD ++W +P++F PERFMT+ +    + + ++
Sbjct  396   AAMEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHKDTDVRGQHFE  455

Query  338   FVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEV  159
              +PFG GRRSCPG   A Q+   A+A L   +  +   +  +DM E +G+   K TPLEV
Sbjct  456   LIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKATPLEV  515

Query  158   LVTPRLSPTLFR  123
             L++PRL   L+R
Sbjct  516   LLSPRLKAELYR  527



>ref|XP_010547839.1| PREDICTED: cytochrome P450 82C4-like [Tarenaya hassleriana]
Length=501

 Score =   449 bits (1155),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/503 (45%), Positives = 324/503 (64%), Gaps = 12/503 (2%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSS  1431
             +K + R  PE  G+WP+IGHLH       L+ +TL   AD +GP    R+G  R  VVSS
Sbjct  4     KKPNHRNAPEPAGSWPVIGHLHLLGGKEQLLYRTLGAMADDHGPASPRRVGSRRAFVVSS  63

Query  1430  WEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRL  1251
             WE  ++CF  NDK LA+RP T A K++GY+YAVF F+  +S+WR++RK+   E+LS+RRL
Sbjct  64    WEVAKECFTVNDKALASRPMTVASKHMGYNYAVFGFAPYSSFWRKMRKIATVELLSNRRL  123

Query  1250  EKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR  1071
             + LKHV +SE+ T IK+L+   S    + S   V++ RW   + LN+I+++VAG+RY + 
Sbjct  124   QMLKHVRISEISTGIKDLHGLWSKKGGS-SPVLVDLKRWLEDMNLNMIVKMVAGKRY-FG  181

Query  1070  SDGTIN--EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
             S   +   EEA++ ++  ++  +L G FV  DA   L F  W D +GH K M++ A ++D
Sbjct  182   SSAKMEDAEEARQCQRAIARFFHLIGIFVVSDA---LPFLGWFDLQGHEKEMRKTASELD  238

Query  896   AILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA  726
              IL+ W+D  ++ R S +   D  FIDVMLS+  +       Y   T IK+  L+++   
Sbjct  239   GILERWIDEHQRRRVSGQSEGDSDFIDVMLSLEGEGKLSDLQYDPRTSIKSTCLALILGG  298

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             S+T A  LTW +A+LL + E LK+ Q+EID ++GK R  EDSD++NL YLQ ++KETLR+
Sbjct  299   SDTTAGTLTWAIALLLNNREMLKKAQEEIDIHVGKNRQVEDSDIENLVYLQAIIKETLRL  358

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP GP L P EA+EDC V GY +  GT+L VNVW++ RDPK+W +PE+F PERF+T  E 
Sbjct  359   YPAGPLLGPREAMEDCTVAGYQVAAGTRLIVNVWKIQRDPKVWRNPEEFRPERFLTGKET  418

Query  365   E-AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI  189
             E   + + ++ +PFG GRRSCPG   A Q+  +++AR+   F+  TV +  +DM E  G+
Sbjct  419   EYDVRGQNFELMPFGSGRRSCPGASLALQVLHLSLARVLHSFDLLTVSDSEVDMRESPGL  478

Query  188   ILPKLTPLEVLVTPRLSPTLFRL  120
              +PK TPLEVL+TPRL   L+ L
Sbjct  479   TIPKATPLEVLLTPRLEQELYEL  501



>ref|XP_007017416.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
 gb|EOY14641.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
Length=798

 Score =   459 bits (1181),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 223/495 (45%), Positives = 319/495 (64%), Gaps = 9/495 (2%)
 Frame = -1

Query  1595  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             KR  PEA GA P +GHLH    S P    L + AD YGP+FTIRLG+   LVVS+WE  +
Sbjct  308   KRKAPEASGARPFLGHLHLLGGSKPAHVVLGDLADTYGPIFTIRLGVRLTLVVSNWEIAK  367

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +CF TNDK  A RP T A + LGY+YA+F FS    YWR++RK+V  E+LS+ RLEKLKH
Sbjct  368   ECFTTNDKAFANRPRTLAAELLGYNYAMFGFSPYGPYWRQIRKIVTLEVLSNHRLEKLKH  427

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPKV--NMSRWFGHLTLNLIMQIVAGRRYEYRSDG  1062
             +  SE++T+IKELY       +N S+ KV   M RWF  L +N++ ++V G+RY      
Sbjct  428   IRESEVRTSIKELYKLGVEGVSNSSSGKVLVEMKRWFWTLNINMVFKMVVGKRYSEAETS  487

Query  1061  TINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQD  882
                +E  R +K       L G F  GD+   L F RWLD  GH K MK+ AK++D IL++
Sbjct  488   HGKDENDRRRKALRDFFELTGTFTVGDS---LPFLRWLDLGGHEKAMKKTAKELDHILEE  544

Query  881   WVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
             W++  +++R S     +  F+ +MLS+++D   +  SY  DT+ KA  LS++  AS+T  
Sbjct  545   WLEEHKQKRNSGNAESEHDFMGMMLSLLNDA-AELPSYDADTINKATCLSLILAASDTTM  603

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
               LTW L++LL +  +LK+ Q+E+D ++G+++  E+SD+K L YLQ ++KETLR+YP  P
Sbjct  604   VTLTWALSLLLNNRNALKKAQEELDIHVGRDKLVEESDIKKLVYLQAIIKETLRLYPAAP  663

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN  351
                PHE++EDC+V GYHIP GT+L +N++++HRDP  W DP +F PERF+T  +    + 
Sbjct  664   LSVPHESMEDCVVSGYHIPAGTRLLINLYKIHRDPHAWSDPCEFQPERFLTTYKDFDVRG  723

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
             + ++ +PFG GRR CPG   A Q+ ++ +A L QGF   T  +EP+DM E +GI   K++
Sbjct  724   QNFELIPFGSGRRMCPGVSLALQVLELTLANLLQGFELGTPLDEPVDMGEAIGITNLKVS  783

Query  170   PLEVLVTPRLSPTLF  126
             PLEVL+TPRL    +
Sbjct  784   PLEVLITPRLPAVCY  798


 Score = 98.6 bits (244),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = -1

Query  1604  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWE  1425
             +  KR  PEAG +WP+IGHLH      P    L + A+KYG +FTI++G+ R LVV++WE
Sbjct  179   RDKKRAAPEAGSSWPVIGHLHLLGGPQPPHIVLGDMAEKYGSIFTIKMGVYRALVVNNWE  238

Query  1424  AVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFS  1320
               ++C  TNDK  A+RP T A ++L +++ +  F+
Sbjct  239   TAKECLTTNDKAFASRPKTLAMEFLSFEHTMVGFT  273


 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = -1

Query  1592  RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRD  1413
             R  PE  GA P +GHL     S P    L + AD YGP+FTIRLG+   LVVS+WE  ++
Sbjct  3     RKAPEVSGARPFLGHLQLLGGSKPAQVVLGDLADTYGPIFTIRLGMQSTLVVSNWEMAKE  62

Query  1412  CFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNS  1308
             CF TN K    RP T A + LGY+YA+       S
Sbjct  63    CFTTNHKAFVNRPRTLAAELLGYNYAMMVIGKRYS  97


 Score = 59.3 bits (142),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 48/93 (52%), Gaps = 4/93 (4%)
 Frame = -1

Query  1124  LTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD  945
             L  N  M ++ G+RY         ++  R +      + L G F  GD+   L F RWLD
Sbjct  83    LGYNYAMMVI-GKRYSEVEASHGKDDNDRCRNAVRNFLELTGTFTVGDS---LPFLRWLD  138

Query  944   YEGHVKTMKRAAKDVDAILQDWVDARRKERRSN  846
               GH K MK+ AK++D IL+ W++  +++R S 
Sbjct  139   LGGHEKAMKKTAKELDQILEKWLEEHKQKRNSG  171



>ref|XP_006432712.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
 ref|XP_006471502.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45952.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
Length=537

 Score =   450 bits (1158),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/533 (42%), Positives = 333/533 (62%), Gaps = 23/533 (4%)
 Frame = -1

Query  1673  AVPCCLSSILGIAALVLLWFSWRK----QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             AV   L+ I+ +  L+L  F  R     + KR PPEAGGAWP+IGHLH      PL + L
Sbjct  10    AVAAILTLIIFLYTLLL--FVSRNYASNKKKRGPPEAGGAWPVIGHLH-LLGRFPLHRVL  66

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
              + ADKYGP+FTIR+G+ R LVVS+WE  ++C  T+D++ A+RP     + LG+++++F 
Sbjct  67    GDMADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFASRPKALVAEILGFNFSMFG  126

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTF-------ISMDNNN  1167
             FS    +WR++RK+   E+LS+ RLEKLKHV   E++T +KELY F        S D+NN
Sbjct  127   FSPYGPHWRQIRKIATLELLSNHRLEKLKHVREGEVKTCLKELYEFWERTNNYKSSDHNN  186

Query  1166  PSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVS  987
                  V M++WF  +TLN I+++  G+R    S     +     K+  ++     G+FV 
Sbjct  187   NKKVLVEMNKWFEDVTLNTILRVTVGQRCNSSSSQEDTDHEGAWKEELTKFFAFSGKFVV  246

Query  986   GDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFID  825
              D+   L F RW D  G  + MK+ A+++D + Q W+D  +++R S +       + F+D
Sbjct  247   SDS---LPFLRWFDIGGDERAMKKNARELDVLAQGWLDEHKRKRESGQMINKEGHEDFMD  303

Query  824   VMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQD  645
             VMLS++ D   Q      DT+ KA  L+++  AS+T    LTWIL++LL H + LK+ Q+
Sbjct  304   VMLSILRDDAQQLPGDDADTINKATCLALILAASDTSKITLTWILSLLLNHRDVLKKAQN  363

Query  644   EIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGT  465
             E+D +IGK R   + D+KNL YLQ ++KE +R+YP GP  APH + EDC V+ Y +P GT
Sbjct  364   ELDVHIGKRRQVNELDIKNLVYLQAIIKEAMRLYPAGPLAAPHASTEDCTVNDYFVPAGT  423

Query  464   QLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYAT  285
              LYVNVW++HRDP++WP+P KF PERF+T  +    + + ++ +PF  GRR CPG  +A 
Sbjct  424   VLYVNVWKIHRDPRVWPEPYKFKPERFLTTHKHIDVRGQNFELLPFSSGRRMCPGPSFAI  483

Query  284   QITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +T + +A L  GF+F T  +EP+DM E + + L K TP++VL+TPRLS +L+
Sbjct  484   PVTHLTLATLLHGFDFETPLDEPVDMSEGMSLTLVKTTPVKVLITPRLSASLY  536



>emb|CDY53704.1| BnaC03g67210D [Brassica napus]
Length=523

 Score =   449 bits (1156),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 230/530 (43%), Positives = 332/530 (63%), Gaps = 20/530 (4%)
 Frame = -1

Query  1679  MDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLS  1503
             MDA    L S L +  L+ L+   +K      PE  GAWPIIGHLH       L+ +TL 
Sbjct  1     MDAFLFSLLSPLLVFVLIALFKKKKKPKHVKAPEPSGAWPIIGHLHLLGGKEQLLYRTLG  60

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             E A++YGP  ++RLG S   VVSS+E  ++CF  NDK LA+RP T A K++GY+YAVF F
Sbjct  61    EMANRYGPAMSLRLGSSEAFVVSSFEVAKECFTVNDKALASRPMTAAAKHMGYNYAVFGF  120

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTF-ISMDNNNPSAPKVN  1146
             +  +S+WR +RK+   E+LS+RRL+ LKHV VSE+   +K+LY+  +    + P    VN
Sbjct  121   APYSSFWREMRKIATIELLSNRRLQMLKHVRVSEISMGVKDLYSLWVKKGGSEPVM--VN  178

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGT--INEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
             + RW   +TLN+I+++VAG+RY      T    EEA++ +K  ++  +L G F   DA F
Sbjct  179   LKRWLEDMTLNMIVRMVAGKRYFGGGSTTPEDTEEARQCQKAITKFFHLIGIFTMSDA-F  237

Query  971   PLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMID  804
             P     W D +GH K MK+   ++D IL+ W++  R++R+       D  FIDVMLS+ +
Sbjct  238   PT--LGWFDLQGHEKEMKKTGSELDVILERWIENHRQQRKVSGNKENDSDFIDVMLSLAE  295

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
                     Y  +T IK+  L+++   S+T A+ LTW +A+LL + + LK+ QDEID  +G
Sbjct  296   QGKLSHLQYDANTSIKSTCLALILGGSDTTASTLTWAIALLLNNKDMLKKAQDEIDLQVG  355

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
              +R  EDSD++NL YLQ ++KETLR+YP GP L P EA+EDC + GYH+  GT+L VNVW
Sbjct  356   TDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTIAGYHVSCGTRLIVNVW  415

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYATQIT  276
             ++ RDPK+W +P +F PERF+T   GEA +     + ++ +PFG GRRSCPG+  A Q+ 
Sbjct  416   KIQRDPKVWVEPNEFRPERFLT---GEAKEFDVRGQNFELIPFGSGRRSCPGSSLAMQVL  472

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              + +AR    F+  T  +  +DM E  G+ +PK TPLEV+++PRL   LF
Sbjct  473   HLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEVMISPRLEKHLF  522



>ref|XP_002264520.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=567

 Score =   451 bits (1160),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 222/488 (45%), Positives = 321/488 (66%), Gaps = 9/488 (2%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             P+  GAWPIIGHLH     VP+ +TL   ADK+GPVF I+LG+   +VVSS EAV++CF 
Sbjct  87    PKPPGAWPIIGHLHLLSGQVPIFRTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFT  146

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
             TNDK+ A+RP +   K LGY+YA F F+    +WR +RKL V EILS+RRL +LK V +S
Sbjct  147   TNDKVFASRPRSSVSKLLGYNYAGFGFAPYGPFWREMRKLSVVEILSARRLNELKDVRIS  206

Query  1223  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEA  1044
             EL   I++LY+ +  DNN  S  +V MS WF HLT N +++++AG+RY + +    NEEA
Sbjct  207   ELDACIQDLYS-LGKDNNWISPIEVVMSEWFEHLTFNFVLRMIAGKRY-FDNAVHGNEEA  264

Query  1043  QRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR-  867
             +       + + L G FV  D +FP  F   LD +G++ +MK  A+++D ++  WV+   
Sbjct  265   RGAIIAIKKFLSLSGAFVPSD-VFP--FLERLDLKGYLGSMKHVAEELDCLVGSWVEEHV  321

Query  866   -RKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWIL  690
              R +        FIDV+LS + D  T  + +SR+TVIKA + +++   S++ +   TWIL
Sbjct  322   MRLKSEPGSRHDFIDVLLSAVQD--TSMFGHSRETVIKATIGNLIVGGSDSTSITSTWIL  379

Query  689   AVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEA  510
             + LL + E++KR Q+E+D  +G+ RW E+SD++ L YL+ ++KE+LR+Y   P L PHEA
Sbjct  380   SALLNNREAMKRAQEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYSAAPLLVPHEA  439

Query  509   VEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVP  330
              +DC V GYHIPKGT+L+VN W+LHRDP++W +PE+F PERF+ +         Q++ +P
Sbjct  440   TQDCHVCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIP  499

Query  329   FGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVT  150
             FG GRR+CPG   A Q+  +  ARL QGF+ +T  N P+DM E +   +PKLTPL V++T
Sbjct  500   FGSGRRACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTPLCVMLT  559

Query  149   PRLSPTLF  126
             PRL   L+
Sbjct  560   PRLPSHLY  567



>gb|KDO40892.1| hypothetical protein CISIN_1g009347mg [Citrus sinensis]
Length=537

 Score =   450 bits (1157),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/533 (42%), Positives = 333/533 (62%), Gaps = 23/533 (4%)
 Frame = -1

Query  1673  AVPCCLSSILGIAALVLLWFSWRK----QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             AV   L+ I+ +  L+L  F  R     + KR PPEAGGAWP+IGHLH      PL + L
Sbjct  10    AVAAILTLIIFLYTLLL--FVSRNYASNKKKRGPPEAGGAWPVIGHLH-LLGRFPLHRVL  66

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
              + ADKYGP+FTIR+G+ R LVVS+WE  ++C  T+D++ A+RP     + LG+++++F 
Sbjct  67    GDMADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFASRPKALVAEILGFNFSMFG  126

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTF-------ISMDNNN  1167
             FS    +WR++RK+   E+LS+ RLEKLKHV   E++T +KELY F        S D+NN
Sbjct  127   FSPYGPHWRQIRKIATLELLSNHRLEKLKHVREGEVKTCLKELYDFWERTNNYKSSDHNN  186

Query  1166  PSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVS  987
                  V M++WF  +TLN I+++  G+R    S     +     K+  ++     G+FV 
Sbjct  187   NKKVLVEMNKWFEDVTLNAILRVTVGQRCNSSSSQEDTDHEGAWKEELTKFFAFSGKFVV  246

Query  986   GDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE------DQKFID  825
              D+   L F RW D  G  + MK+ A+++D + Q W+D  +++R S +       + F+D
Sbjct  247   SDS---LPFLRWFDIGGDERAMKKNARELDVLAQGWLDEHKRKRESGQMINKEGHEDFMD  303

Query  824   VMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQD  645
             VMLS++ D   Q      DT+ KA  L+++  AS+T    LTWIL++LL H + LK+ Q+
Sbjct  304   VMLSILRDDAQQLPGDDADTINKATCLALILAASDTSKITLTWILSLLLNHRDVLKKAQN  363

Query  644   EIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGT  465
             E+D +IGK R   + D+KNL YLQ ++KE +R+YP GP  APH + EDC V+ Y +P GT
Sbjct  364   ELDVHIGKRRQVNELDIKNLVYLQAIIKEAMRLYPAGPLAAPHASTEDCTVNDYFVPAGT  423

Query  464   QLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYAT  285
              LYVNVW++HRDP++WP+P KF PERF+T  +    + + ++ +PF  GRR CPG  +A 
Sbjct  424   VLYVNVWKIHRDPRVWPEPYKFKPERFLTTHKHIDVRGQNFELLPFSSGRRMCPGPSFAI  483

Query  284   QITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +T + +A L  GF+F T  +EP+DM E + + L K TP++VL+TPRLS +L+
Sbjct  484   PVTHLTLATLLHGFDFETPLDEPVDMSEGMSLTLVKTTPVKVLITPRLSASLY  536



>ref|XP_006435899.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
 gb|ESR49139.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
Length=528

 Score =   449 bits (1156),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 221/496 (45%), Positives = 324/496 (65%), Gaps = 12/496 (2%)
 Frame = -1

Query  1604  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWE  1425
             KQS++  P AGGAWP+IGHLH  R   P  + L   ADKYG +FT++LG+ + LVVS+WE
Sbjct  41    KQSQQ-APVAGGAWPLIGHLHLLRGPEPAHRVLGNLADKYGTIFTMKLGVKQALVVSNWE  99

Query  1424  AVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEK  1245
               ++CF TNDK  A+RP   A + +GY+++V  F+    YWR+ RK+V  E+LS+RRLEK
Sbjct  100   IAKECFTTNDKAFASRPKRMAVELMGYNFSVIGFAPYGKYWRQSRKIVTIELLSNRRLEK  159

Query  1244  LKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSD  1065
             LKHV  SE++ +I+ LY      +++     V M  W     L++I++I+AG+R+  +S 
Sbjct  160   LKHVRESEVKASIQRLYKNCISSSSSRKVVSVEMIHWLEGTALDIILRIIAGKRHTSQS-  218

Query  1064  GTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQ  885
                 EEA   ++  +++  L+G+FV  DA   L F R LD  G+ + M + AK  D ILQ
Sbjct  219   ----EEANDWQQQITKIAALFGQFVVSDA---LPFLRRLDIGGYERLMSKTAKYFDIILQ  271

Query  884   DWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
             +W+D  + +R S E   D+ FI V+LS++DD   Q      DTVIKAI LS++   ++T 
Sbjct  272   EWLDEHKMKRVSGEVKGDEDFIYVLLSLLDDNAEQLPDRDADTVIKAICLSLIVAGTQTT  331

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
                LTW +A+LL +PE LK+ +DEID  +G ER   +SD +NL YLQ ++KET+R+YP G
Sbjct  332   VVTLTWAIALLLNNPEVLKKARDEIDIQVGTERPVNESDTRNLVYLQAIIKETMRLYPAG  391

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P L PHE++E+CIV+GYH+P GTQL+VN W++ RDP +W +P +F PERF+T  +     
Sbjct  392   PLLLPHESIEECIVNGYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVG  451

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
              + ++ +PFG GRR CP   Y  Q+  + +A L +GF+F+T   EP+DM E +G+ + K 
Sbjct  452   GQDFELIPFGSGRRMCPAVSYGLQVMPLMLASLVRGFDFTTPSGEPVDMGESMGLSIAKA  511

Query  173   TPLEVLVTPRLSPTLF  126
             TPLEVL++PRLS + +
Sbjct  512   TPLEVLLSPRLSASSY  527



>emb|CDY23316.1| BnaA08g12300D [Brassica napus]
Length=523

 Score =   449 bits (1155),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 230/530 (43%), Positives = 332/530 (63%), Gaps = 20/530 (4%)
 Frame = -1

Query  1679  MDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLS  1503
             MDA    L S L +  L+ L+   +K      PE  G+WPIIGHLH       L+ +TL 
Sbjct  1     MDAFLFSLLSPLLVFVLIALFKKTKKPKHVKAPEPSGSWPIIGHLHLLGGKEQLLYRTLG  60

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             E A++YGP  ++RLG S   VVSS+E  ++CF  NDK LA+RP T A K++GY+YAVF F
Sbjct  61    EMANRYGPAMSLRLGSSEAFVVSSFEVAKECFTVNDKALASRPMTAAAKHMGYNYAVFGF  120

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTF-ISMDNNNPSAPKVN  1146
             +  +S+WR +RK+   E+LS+RRL+ LKHV VSE+   +K+LY+  +    + P    VN
Sbjct  121   APYSSFWREMRKIATIELLSNRRLQMLKHVRVSEISMGVKDLYSLWVKKGGSEPVM--VN  178

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGT--INEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
             + RW   +TLN+I+++VAG+RY      T    EEA++ +K  ++  +L G F   DA F
Sbjct  179   LKRWLEDMTLNMIVRMVAGKRYFGGGSTTPEDTEEARQCQKAITKFFHLIGIFTMSDA-F  237

Query  971   PLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMID  804
             P     W D +GH K MK+   ++D IL+ W++  R++R+       D  FIDVMLS+ +
Sbjct  238   PT--LGWFDLQGHEKEMKKTGSELDVILERWIENHRQQRKVSGNKENDSDFIDVMLSLAE  295

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
                     Y  +T IK+  L+++   S+T A+ LTW +A+LL + + LK+ QDEID  +G
Sbjct  296   QGKLSHLQYDANTSIKSTCLALILGGSDTTASTLTWAIALLLNNKDMLKKAQDEIDLQVG  355

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
              +R  EDSD++NL YLQ ++KETLR+YP GP L P EA+EDC V GYH+  GT+L VNVW
Sbjct  356   TDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHVACGTRLIVNVW  415

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYATQIT  276
             ++ RDPK+W +P +F PERF+T   GEA +     + ++ +PFG GRRSCPG+  A Q+ 
Sbjct  416   KIQRDPKVWVEPNEFRPERFLT---GEAKEFDVRGQNFELIPFGSGRRSCPGSSLAMQVL  472

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              + +AR    F+  T  +  +DM E  G+ +PK TPLEV+++PRL   LF
Sbjct  473   HLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEVMISPRLEKHLF  522



>ref|XP_011037409.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
 ref|XP_011037412.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
Length=511

 Score =   448 bits (1153),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 224/495 (45%), Positives = 309/495 (62%), Gaps = 8/495 (2%)
 Frame = -1

Query  1604  KQSKRLP--PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSS  1431
             ++SK+L   PE  GAWP+IGHL   R   P  KTL+   DKYGP++++RLG  RI+VVSS
Sbjct  22    RESKKLARVPEPSGAWPVIGHLPCLRGQDPACKTLAAIDDKYGPIYSLRLGSHRIVVVSS  81

Query  1430  WEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRL  1251
              E V+DC  TND++LA R    AGK++GY+ A F  S    YWR VRKLV  ++LS+ RL
Sbjct  82    RETVKDCLTTNDRILATRANIAAGKHMGYNNAAFALSPYGKYWRDVRKLVTLQLLSNHRL  141

Query  1250  EKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR  1071
             E LKHV   E+   IK L+   +     P+  KV MS+ F  LT N+ ++ + G+RY   
Sbjct  142   EMLKHVRKLEVDAFIKGLHNSYAETAEYPA--KVTMSKLFESLTFNISLRTIVGKRYCST  199

Query  1070  SDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAI  891
                  N E  R KK   + +YL G FV  DAI    +  W+D++GHV  MKR AK++DA+
Sbjct  200   IYDKENSEPWRYKKAIEKALYLSGIFVMSDAIP---WLEWIDFQGHVSAMKRTAKELDAV  256

Query  890   LQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
             +  W++   K+    E   F+DVM+S + D   +   YSRD VIKA  L +    + + A
Sbjct  257   IGSWLEEHLKKEIQGESD-FMDVMISNLADGAAEMSGYSRDVVIKATTLILTLTGAGSTA  315

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
               LTW L++LL HP  LK  Q+E+D  +G+E+W E+SD++NL YLQ +VKETLR+YP GP
Sbjct  316   VTLTWALSLLLNHPSVLKAAQEELDKQVGREKWVEESDIQNLVYLQAIVKETLRLYPPGP  375

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN  351
                  EA+EDC + GY++PKGT+L VN+W+LHRDP++W +P  F PERF+T       + 
Sbjct  376   LTGIREAMEDCHICGYYVPKGTRLVVNIWKLHRDPRVWKNPNDFQPERFLTTHADLDFRG  435

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
             + ++F+PF  GRRSCP       +  + +ARL QGF+ +TV   P+DM E  GI LPKL 
Sbjct  436   QDFEFIPFSSGRRSCPAINLGMAVVHLTLARLLQGFDLTTVAGLPVDMNEGPGIALPKLI  495

Query  170   PLEVLVTPRLSPTLF  126
             PLE +V PRL   L+
Sbjct  496   PLEAVVKPRLGLRLY  510



>ref|XP_006366435.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=517

 Score =   448 bits (1153),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 217/504 (43%), Positives = 322/504 (64%), Gaps = 16/504 (3%)
 Frame = -1

Query  1622  LWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRIL  1443
             L+FS +KQSK +P EA GAWPIIGHLH         K   + A+KYGP+F ++LG++ ++
Sbjct  23    LFFSAKKQSKNVP-EAAGAWPIIGHLHLLNGPQMPHKIFGQMAEKYGPIFRLKLGVNDVV  81

Query  1442  VVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILS  1263
             +VS  +  ++CF TNDK  A RP + A + LGY+YA+F       YWR +RK+V  E LS
Sbjct  82    IVSDHKIAKECFTTNDKAFANRPKSIASEILGYNYAMFGLGPYGPYWREIRKIVTTEFLS  141

Query  1262  SRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRR  1083
             +RR+E LKHV   E+++ +KE Y +  + NN   A K+ M  WFG+L +N +++++ G +
Sbjct  142   ARRIEMLKHVREFEVKSAVKETYEYW-LKNNLNGAVKIEMKEWFGNLIMNTMVKLLFGVQ  200

Query  1082  YEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKD  903
             Y     G  +EE  +  K   +++ L G FV  D    L + RWLD  GH K MK  AK+
Sbjct  201   YT----GNEDEERSKAHKAIQRLLELLGAFVVADF---LPYLRWLDIGGHEKIMKSTAKE  253

Query  902   VDAILQDWVDARRKERR-----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSM  738
             +D I++DW+   R++R+       +++ F+DVMLS+ +D+   G+    D +IKA  +++
Sbjct  254   IDFIVEDWLAEHRRKRKLRGNNCGDEEDFMDVMLSICEDKNLHGFD--TDAIIKATCMAL  311

Query  737   LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE  558
                 ++T    L WIL++LL + E+LK+ QDE+DT+IGK RW ++SD+KNL YLQ +VKE
Sbjct  312   QTAGTDTTIVTLIWILSLLLNNYEALKKAQDELDTHIGKNRWVQESDIKNLVYLQAIVKE  371

Query  557   TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT  378
             + R+YP  P + PHE++EDC+V GY IPKGT+L VNVW+L  DP+IWP+P +F PERF+T
Sbjct  372   SFRLYPAAPLMLPHESIEDCVVSGYDIPKGTRLLVNVWKLQYDPEIWPNPHEFKPERFLT  431

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
               +    +   ++ +PFG GRR CPG   A Q+ Q  V+ L QGF+     +E +DM E 
Sbjct  432   THKDVDVRGNHFELIPFGSGRRMCPGVSLALQVLQYVVSVLLQGFDIKRPSDEAIDMSES  491

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              G+ + K +PLEV +TPRL   L+
Sbjct  492   FGLTILKASPLEVQLTPRLDSNLY  515



>ref|XP_002282111.2| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera]
Length=525

 Score =   448 bits (1153),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 229/525 (44%), Positives = 334/525 (64%), Gaps = 17/525 (3%)
 Frame = -1

Query  1679  MDAVPCCLS-------SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVP  1521
             MD +  CL+       +IL ++  +LLW S   +S R+ PEA GAWPIIGHLH    S  
Sbjct  1     MDFLLQCLNPVMVGAFAILVLSYHLLLWRSGAGKS-RMAPEASGAWPIIGHLHLLGGSKN  59

Query  1520  LVKTL-SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGY  1344
             L   L    ADKYGPVF+IRLG+ R +VVSSWE  ++CF T+D  LA+RP   A KYLGY
Sbjct  60    LPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKECFTTHDLALASRPELVAAKYLGY  119

Query  1343  DYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNP  1164
             +YA+F  S + +YWR VRK+   E+LS+RRLE LK+V +SE++T +KELY   +   +  
Sbjct  120   NYAMFGLSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMKELYELWAKKKSEA  179

Query  1163  SAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSG  984
                 V+M +WFGHL+LN+I+++V G+RY   +  +  +EAQ+ +K   +   L G FV  
Sbjct  180   GVVLVDMKQWFGHLSLNVILKMVVGKRYFGYAAESKEKEAQQFQKAIREFFRLMGLFVVS  239

Query  983   DAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLS  813
             DAI P  F  WLD  GHVK MK+ AK++D I Q+W++  R+ + S E   DQ F+DVMLS
Sbjct  240   DAI-P--FLGWLDVGGHVKAMKKTAKELDGITQEWLEEHRRRKDSGEADGDQDFMDVMLS  296

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
             ++  + T    Y  DT+ KA  L M+   ++T +  LTW +++LL +P  L++ Q+E+D 
Sbjct  297   ILGGRDTT--DYDADTINKATSLVMIGGGADTTSGTLTWAVSLLLNNPHILRKAQEELDA  354

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
             ++GKER   + D+  L YLQ +VKETLR+ P  P   P + ++D I+ GYHI KGT+L +
Sbjct  355   HVGKERLVNEMDISKLVYLQAIVKETLRLNPIAPLSGPRQFIQDSILGGYHISKGTRLIL  414

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             N+ ++ RDP++W +P +F P+RF+T  +    + + ++  PFG GRR CPG ++A Q+  
Sbjct  415   NLTKIQRDPRVWLNPMEFQPDRFLTTHKDVDVRGKHFELTPFGGGRRICPGIVFALQVLH  474

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
             + +A     F  ST  + P+DM E  G+   K TPLEVL++PRL+
Sbjct  475   LTLANFLHRFQLSTPSDAPVDMSEGFGLTNIKSTPLEVLISPRLA  519



>ref|XP_004252778.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=527

 Score =   447 bits (1151),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 230/523 (44%), Positives = 337/523 (64%), Gaps = 25/523 (5%)
 Frame = -1

Query  1640  IAALVLLWFSWRKQ----SKRLPPEAGGAWPIIGHLHHFR-TSVPLVKTLSEWADKYGPV  1476
             I  L+ L+F ++K     + +  PE  GAWPIIGHL     T   L +TL   AD YGP 
Sbjct  10    IGVLIFLYFIFKKNKNCSTSKQAPEPAGAWPIIGHLPLLGGTDQLLYRTLGAMADNYGPA  69

Query  1475  FTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR  1296
             F +RLG  R  VVSSWE  ++CF  NDK LA+RPTT A K++GY YAVF F+  + +WR 
Sbjct  70    FNLRLGTRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFAPYSPFWRE  129

Query  1295  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL  1116
             +RK+ + E+LS+RRL+ LK+V VSE+   I+ LY  + +DNN+     V + RWF  LTL
Sbjct  130   MRKIAMFELLSNRRLDTLKYVQVSEVDMGIQALYK-LWVDNNSDRPILVELKRWFEDLTL  188

Query  1115  NLIMQIVAGRRYEYRSDGTIN--EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY  942
             N+I+++VAG+RY + +  T +  +EA+R +K  +Q  +L G FV  DA FP+  F  LD 
Sbjct  189   NVIVRMVAGKRY-FGAGATCDNDDEARRCQKAINQFFHLIGIFVPSDA-FPILGF--LDI  244

Query  941   EGHVKTMKRAAKDVDAILQDWVDARRKERR-------SNED---QKFIDVMLSMIDDQFT  792
              GH K MK+ AK++D IL+ W+   R++R+       S  D   Q FIDVMLS+ ++   
Sbjct  245   NGHEKAMKKTAKELDFILEGWLKEHREKRKCTSIEAKSTTDSAVQDFIDVMLSLEEEGRL  304

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
               + Y  DT IK+  L+++   S+T A  LTW +++LL +P+ L++ Q+EID +IGK R 
Sbjct  305   SNFPYDADTSIKSTCLALILGGSDTTAGTLTWAISLLLNNPKILRKAQEEIDNHIGKNRQ  364

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              ++SD+ NL Y+Q ++KETLR+YP GP L P EA+++C + GY I  GT+L VNVW++ R
Sbjct  365   IDESDINNLIYIQAIIKETLRLYPAGPLLGPREAMDNCEISGYKITPGTRLIVNVWKIQR  424

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP+IW +P  F P+RF+T+      + + ++ +PFG GRRSCPG   A Q+  + +AR+ 
Sbjct  425   DPRIWENPNCFNPDRFLTS--NVDVKGKDFELIPFGSGRRSCPGASLALQVLHLTLARIL  482

Query  251   QGFNFST-VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
               F F+  + ++P+D+ E  G+ +PK TPL+VLV PRLS  L+
Sbjct  483   HAFEFTKPIDDQPIDLTESPGLTIPKATPLDVLVAPRLSANLY  525



>ref|XP_006486181.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
Length=526

 Score =   447 bits (1150),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 215/497 (43%), Positives = 327/497 (66%), Gaps = 12/497 (2%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW  1428
             +KQ++R  P AGGAWP++GHLH      P  + L + ADKYGP+FT++LG+ + L+VS+W
Sbjct  38    KKQAQR-APRAGGAWPLVGHLHLLGGPEPAHRVLGDMADKYGPIFTMKLGVKQALMVSNW  96

Query  1427  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE  1248
             E  ++CF TNDK  A+RP T A + L Y+++V +F+   +YWR+  K+   E+LSS RLE
Sbjct  97    EIAKECFTTNDKAFASRPKTMAMELLEYNFSVISFAPYGNYWRQSLKIATIELLSSHRLE  156

Query  1247  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
             KLKHV   E++ +I+ LY      +++     V+M  W     L+++++I+AG+R+  +S
Sbjct  157   KLKHVREYEVKASIQRLYKNCVSSSSSRKVVLVDMIHWLEGTVLDVVLRIIAGKRHTSQS  216

Query  1067  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL  888
                  +E    ++  ++   L G+FV  DA   L F RWLD  G+ + M + AK  D IL
Sbjct  217   -----QEINDWQRQITKFTALTGQFVVSDA---LPFLRWLDIGGYERLMSKTAKYFDIIL  268

Query  887   QDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET  717
             Q+W+D  + +R S E   D+ FI V+LS++DD   Q      DTVIKAI ++++  A++T
Sbjct  269   QEWLDEHKMKRVSGEVKGDEDFIYVLLSLLDDNAEQLPDRDADTVIKAICVTLIVAATDT  328

Query  716   FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ  537
              A  LTW +A+LL +P+ LK+ QDE+D  +G ER   +SD++NL YLQ ++KET+R+YP 
Sbjct  329   TAVTLTWAIALLLNNPDVLKKAQDELDIQVGTERQVNESDMRNLVYLQAIIKETMRLYPA  388

Query  536   GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA  357
             GP L PHE++E+CIV+GY +P GTQL+VN W++ RDP +W +P +F PERF+T  +    
Sbjct  389   GPLLLPHESIEECIVNGYLVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDV  448

Query  356   QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPK  177
               + ++ +PFG GRR CP   +  Q+ Q+ +A L  GF+F+T  +EP+DM E +G+ + K
Sbjct  449   GGQDFELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTIAK  508

Query  176   LTPLEVLVTPRLSPTLF  126
              TPLEVLV+PRLS +L+
Sbjct  509   ATPLEVLVSPRLSASLY  525



>ref|XP_008464765.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=523

 Score =   447 bits (1150),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 231/520 (44%), Positives = 318/520 (61%), Gaps = 19/520 (4%)
 Frame = -1

Query  1652  SILGIAALVLLWFSWRK---------QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1500
             ++ GI AL++  ++  K           KRLPPE GGA P+IGHLH    + P  KT ++
Sbjct  11    TVTGIFALIIFLYALFKIYRGGVGARHRKRLPPEVGGALPLIGHLHLLAKNEPAHKTFAK  70

Query  1499  WADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFS  1320
              AD YGP+FT+RLG+   L+VS+WE  R+CF TNDK+ A+RP   A K LGYDYA+F  S
Sbjct  71    MADAYGPIFTLRLGLYTNLIVSNWEIARECFTTNDKIFASRPKLVASKLLGYDYAMFGLS  130

Query  1319  TNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMS  1140
                 +WR VRKL + E+LS+ RLEKL+H+ VSE+QT++K LY     +  N     V M 
Sbjct  131   PYGPHWRHVRKLAMLELLSNYRLEKLQHIRVSEVQTSMKNLYELCLKNKKNAL---VEMK  187

Query  1139  RWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWF  960
              WFG +TLN I +IV G+++    D + N E +  +K        +G FV  D+ FP  F
Sbjct  188   TWFGDITLNTISRIVVGKKFSTAVDAS-NNENEEYRKALRDFFEWFGVFVPSDS-FP--F  243

Query  959   FRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKE--RRSNEDQKFIDVMLSMIDDQFTQG  786
              +WLD  GH K MK+ AK +D +   W+   +        E+  F+DVMLS + D   Q 
Sbjct  244   LKWLDLGGHEKAMKKTAKVLDEVFDKWIQDHKNNLGEVKMEEHDFMDVMLSNVRDD-GQL  302

Query  785   YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAE  606
               Y   TV KA  LS++   S+T    + W L++LL + E LKR Q E+D  +G++R  +
Sbjct  303   SKYDAHTVTKATCLSLILAGSDTTTVTMIWALSLLLNNQEVLKRAQLELDERVGRQRQVK  362

Query  605   DSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDP  426
             +SDVKNL YLQ +VKETLR+YP  P L PHE+V+DC+V GYHIP GT+L VNV +L RDP
Sbjct  363   ESDVKNLLYLQAIVKETLRLYPAAPILVPHESVDDCVVAGYHIPVGTRLIVNVQKLQRDP  422

Query  425   KIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQG  246
             +IW DP +F PERF+T+ +    + +  + +PFG GRR CPG  +A Q+  +A+A L  G
Sbjct  423   QIWEDPCEFRPERFLTSAKDFDVRGQNPRLIPFGSGRRMCPGISFALQVMHLALANLLHG  482

Query  245   FNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             F  S    E LDM E  G+   +  PLEV++TPRL P ++
Sbjct  483   FEISRPSKEFLDMEESAGMTSIRKNPLEVVLTPRLPPHVY  522



>emb|CDP15727.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   449 bits (1154),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 216/495 (44%), Positives = 311/495 (63%), Gaps = 13/495 (3%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             PEA GA P IGHLHH    +PL + L   ADKYGP F++RLG    +VVSSWE V++CF 
Sbjct  87    PEAPGALPFIGHLHHLGGQLPLARILGSMADKYGPTFSLRLGSRPAIVVSSWEMVKECFT  146

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
              NDK  A+RP T   KY+G + A+F  +    YWR VRK+V  E+L+++RLEKLKHV  S
Sbjct  147   INDKTFASRPNTALAKYMGNNNAIFALAPYGPYWRDVRKMVTLELLTNQRLEKLKHVRAS  206

Query  1223  ELQTNIKELYTFISMDNNNPSA---PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTIN  1053
             E    I++LY+  S  N+ P      KV ++ WF  LT NLI++++ GR +   S G  N
Sbjct  207   EFNKWIRDLYSLCS-KNDRPDVDVPTKVVLNEWFELLTFNLILRMLVGRPFSTSSQGNDN  265

Query  1052  EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVD  873
              E +R+K+   +++YL G FV  D I    +  WLD  GH+K+MK+A K++D +L  W+ 
Sbjct  266   SEDRRMKEAIKKMLYLGGVFVFSDVI---PWIEWLDIGGHIKSMKKAGKELDEVLGQWLQ  322

Query  872   -----ARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFAT  708
                  A++    S     F+DVMLS I +   +   + RD +IK+   +++   SE+ A 
Sbjct  323   EHIQKAKQSHPESEAVHDFMDVMLSTIPET-GEISGHKRDAIIKSTTATLIMTGSESTAE  381

Query  707   HLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPY  528
              L W L++LL HP  LK  Q+E+D  +GK+RW E++D+KNL +LQ +VKET R+YP GP 
Sbjct  382   TLIWALSLLLNHPNILKIAQNELDVQVGKQRWIEEADIKNLSFLQAIVKETFRLYPPGPL  441

Query  527   LAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNR  348
               P EA EDC +  + +PKG +L VN+W+LHRDP+IW DP +F PERF+ +    + + +
Sbjct  442   SGPREATEDCYLGNFFVPKGARLIVNLWKLHRDPRIWSDPLEFKPERFLNSHANISLKGQ  501

Query  347   QYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTP  168
              ++++PF  GRR CP   Y   + Q+ +AR+ Q F+ +T    P+DM E +G+ LPKL P
Sbjct  502   SFEYIPFSSGRRMCPAVNYGMNVVQLTLARMLQAFDIATPMGMPVDMGEGLGVALPKLKP  561

Query  167   LEVLVTPRLSPTLFR  123
             LEVL+TPRL   L++
Sbjct  562   LEVLLTPRLPVELYQ  576



>gb|KFK29809.1| hypothetical protein AALP_AA7G181800 [Arabis alpina]
Length=524

 Score =   446 bits (1148),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/501 (44%), Positives = 321/501 (64%), Gaps = 25/501 (5%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCF  1407
             PE  GAWPIIGHLH       L+ +TL E AD YGP  ++RLG S   VVSS+E  +DCF
Sbjct  33    PEPSGAWPIIGHLHLLGGKDQLLYRTLGEMADHYGPAMSLRLGSSEAFVVSSFEVAKDCF  92

Query  1406  ATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWV  1227
              TNDK LA+RP T A K++GY++AVF F+  +S+WR +RK+   E+LS+RRL+ LKHV V
Sbjct  93    TTNDKALASRPMTAAAKHMGYNFAVFGFAPYSSFWREMRKIATVELLSNRRLQMLKHVRV  152

Query  1226  SELQTNIKELYTF-ISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY----EYRSDG  1062
             SE+   +++LY+  +    + P    V++  W   +TLN+I+++VAG+RY       S+ 
Sbjct  153   SEIAMGVQDLYSLWVKKGGSEPVM--VDLKTWLEDMTLNMIVRMVAGKRYFGCGSVSSED  210

Query  1061  TINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQD  882
             T  +EA++ KK  ++  +L G F   DA FP     W D +GH K MKR   ++D IL+ 
Sbjct  211   T--DEARQCKKAIAKFFHLIGIFTVSDA-FPT--LTWFDLQGHEKKMKRTGSELDVILER  265

Query  881   WVDARRKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET  717
             W++  +++R     + N D  FIDVMLS+ +        Y  DT IK+  L+++   S+T
Sbjct  266   WIENHKQQRNDSGTKENNDSDFIDVMLSLAEQGKLSHLQYDADTSIKSTCLALILGGSDT  325

Query  716   FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ  537
              A+ LTW +A+LL + E LK+ QDEID  +G +R  EDSD++NL YLQ ++KETLR+YP 
Sbjct  326   TASTLTWAIALLLNNKEMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPA  385

Query  536   GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA  357
             GP L P EA+E+C V GY++ +G +L VNVW++ RDPK++ +P +F PERF+T   GEA 
Sbjct  386   GPLLGPREALENCTVAGYNVSRGKRLIVNVWKIQRDPKVYMEPNEFRPERFIT---GEAK  442

Query  356   Q----NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI  189
             +     + ++ +PFG GRRSCPG+  A Q+  + +AR    F   T+ + P+DM E  G+
Sbjct  443   EFDVRGKNFELIPFGSGRRSCPGSSLALQVLHLGLARFLHSFEVKTILDLPVDMSESPGL  502

Query  188   ILPKLTPLEVLVTPRLSPTLF  126
              +PK TP EVL++PRL   LF
Sbjct  503   TIPKATPFEVLISPRLEKQLF  523



>ref|XP_006375032.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
 gb|ERP52829.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
Length=538

 Score =   447 bits (1149),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 221/500 (44%), Positives = 316/500 (63%), Gaps = 15/500 (3%)
 Frame = -1

Query  1595  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             K+  P+AGGAWP+IGHLH    + P  K L   A+KYGP+FTI++G+ R LVVS+WE  +
Sbjct  42    KKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAK  101

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +CF T+DK  + RP T A + L YD A+  FS    YWR+VRK+   E+LS+ RLEKLK 
Sbjct  102   ECFTTHDKAFSGRPRTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKD  161

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPK-------VNMSRWFGHLTLNLIMQIVAGRRYE  1077
             V  SE++  +KELY     D N  SA K       V M RWFG LTLN++++ + G+   
Sbjct  162   VRESEVRAFLKELYKL--WDENRCSASKSKSSLVLVEMKRWFGDLTLNIVLRTIVGKTVG  219

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
             Y S+    E  +  KK      +  G F   DA   L F R+LD  GH + MK+ AK++D
Sbjct  220   YISNVEDEESVEGWKKGLKDFFHWTGVFSVSDA---LPFLRFLDLGGHGEAMKKTAKELD  276

Query  896   AILQDWVDARRKERRSN---EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA  726
              +++DW+   +++R +      + F+D+ML + D+          DT IKA  L+++  A
Sbjct  277   LVVEDWLQEHKRKRAAGIVKGKEDFMDLMLDVFDNDAEAVQGGDSDTTIKATSLALILAA  336

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             S T A  L W L++L+ +P  LK+ Q E+DT++GKER  E+SDV+NL YL+ V+KETLR+
Sbjct  337   SNTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETLRL  396

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP GP L PHEA+EDC +DGYH+P+GT+L +NV ++HRD ++W +P +F PERF+T   G
Sbjct  397   YPAGPLLVPHEAIEDCTIDGYHVPRGTRLLINVPKIHRDERVWSNPNEFDPERFLTTHRG  456

Query  365   EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII  186
                + + ++F PFG GRR CPG  +A  +  +A+A L  GF+F+T   EP+DM E  G+ 
Sbjct  457   FDVRGKNFEFFPFGSGRRKCPGVSFALHVMDLALATLLHGFDFATPSGEPVDMHESSGLT  516

Query  185   LPKLTPLEVLVTPRLSPTLF  126
               + TPLEVL++PRL   L+
Sbjct  517   NLRATPLEVLLSPRLPSRLY  536



>ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52500.1| cytochrome P450, putative [Ricinus communis]
Length=528

 Score =   445 bits (1145),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 212/523 (41%), Positives = 323/523 (62%), Gaps = 11/523 (2%)
 Frame = -1

Query  1676  DAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEW  1497
             +A+   ++ ++ + ++  +  S +K  K+  PEAGGAWP+IGHLH  R   P        
Sbjct  10    NAIATAVAFLIFVCSVFCITRSMKK--KKAAPEAGGAWPLIGHLHLLRGPQPSHIVFGNM  67

Query  1496  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST  1317
             ADKYGP+FTI++G+   LV S+WE  ++CF TNDK  A RP   A   LGY  ++F FS 
Sbjct  68    ADKYGPIFTIKMGVHPTLVASNWEMAKECFTTNDKAFANRPNILAMDLLGYGRSMFAFSP  127

Query  1316  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKV--NM  1143
               +YWR++RK+   E+LS+ RL+   HV  SE+ T +KELY     +    S  KV   M
Sbjct  128   YGNYWRQIRKISTLELLSNHRLQMFNHVRESEVGTALKELYKLWEKNKTTNSNNKVLVEM  187

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
              RWFG +TLN+I++I+ G+   Y +     E  +  K+      +L G F++ DA+ P  
Sbjct  188   KRWFGDITLNIILRIIVGKFIGYETADEGKESNEGWKQALRDFFHLSGRFIAADAV-P--  244

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSN----EDQKFIDVMLSMIDDQF  795
             F RWLD  GH KTMK  A  +D ++ +W++  ++++ S      ++ F+D++L ++DD+ 
Sbjct  245   FLRWLDIGGHEKTMKHTANKLDIVVTEWLNEHKEKKASGCVKKGEEDFMDLILDIMDDEA  304

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
                 S   DT+ KA  L++   AS+T +  L W L++L+ +P+ LK+ QDE+D  +G+ER
Sbjct  305   EATLSRDSDTINKATCLALTLAASDTTSVTLIWALSLLVNNPDVLKKAQDELDVQVGRER  364

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
                +SDV NL +L+ +VKETLR+YP GP   PHE+++DC V GYHIP GT+L  N+ ++H
Sbjct  365   QVHESDVNNLIFLKAIVKETLRLYPAGPLSVPHESMKDCTVAGYHIPAGTRLVTNLSKIH  424

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP++W +P ++  ERF+T+ +    + + ++F+PFG GRR CPG  +A Q+  + +A L
Sbjct  425   RDPRVWSNPSEYQQERFLTSHQDFDVRGKTFEFIPFGSGRRMCPGVSFALQVLHITLATL  484

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
               GFNF T   EPLDM E+ G+   + TPLEV + PRL P L+
Sbjct  485   LHGFNFGTPTGEPLDMTENFGLTNLRATPLEVAINPRLGPHLY  527



>ref|XP_006375031.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
 gb|ERP52828.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
Length=538

 Score =   445 bits (1145),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 221/500 (44%), Positives = 316/500 (63%), Gaps = 15/500 (3%)
 Frame = -1

Query  1595  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             K+  P+AGGAWP+IGHLH    + P  K L   A+KYGP+FTI++G+ R LVVS+WE  +
Sbjct  42    KKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGNMAEKYGPIFTIKMGVHRALVVSNWETAK  101

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +CF T+DK  + RP T A + L YD A+  FS    YWR+VRK+   E+LS+ RLEKLK 
Sbjct  102   ECFTTHDKAFSGRPRTLASELLTYDGAMVGFSPYGPYWRQVRKITTVELLSNYRLEKLKD  161

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPK-------VNMSRWFGHLTLNLIMQIVAGRRYE  1077
             V  SE++  +KELY     D N  SA K       V M RWFG LTLN++++ + G+   
Sbjct  162   VRESEVRAFLKELYKL--WDENRGSASKSKSNLALVEMKRWFGDLTLNIVLRTIVGKTVG  219

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
             Y ++    E  +  KK      +  G F   DA   L F R+LD  GH + MK+ AK++D
Sbjct  220   YITNVEDEESVEGWKKGLKDFFHWTGVFSVSDA---LPFLRFLDLGGHGEAMKKTAKELD  276

Query  896   AILQDWVDARRKERRSN---EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA  726
              +++DW+   +++R +      + F+DVML + D+          DT IKA  L+++  A
Sbjct  277   LVVEDWLKEHKRKRAAGIVKGKEDFMDVMLDVFDNDAEAVQGGDSDTTIKATSLALILAA  336

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             S+T A  L W L++L+ +P  LK+ Q E+DT++GKER  E+SDV+NL YL+ V+KETLR+
Sbjct  337   SDTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETLRL  396

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP GP L PHEA+EDC +DGYH+P+GT+L VNV ++HRD ++W +P +F PERF+T   G
Sbjct  397   YPAGPLLVPHEAIEDCTIDGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPERFLTTHRG  456

Query  365   EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII  186
                + + ++F PFG GRR CPG  +A  +  +A+A L  G +F+T   EP+DM E  G+ 
Sbjct  457   FDVRGKNFEFFPFGSGRRMCPGVSFALHVMDLALATLLHGLDFATPSGEPVDMHESSGLT  516

Query  185   LPKLTPLEVLVTPRLSPTLF  126
               + TPLEVL++PRL   L+
Sbjct  517   NLRATPLEVLLSPRLPSRLY  536



>ref|XP_003548652.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
Length=521

 Score =   444 bits (1143),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 230/519 (44%), Positives = 339/519 (65%), Gaps = 23/519 (4%)
 Frame = -1

Query  1640  IAALVLLWFSWRKQSKRL-------PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYG  1482
             +  +VLL+  WRK+S  +       PPE   A P+IGHLH      PL +  +  ADKYG
Sbjct  13    VITIVLLYNIWRKKSSTIHKIKGLQPPEPSFALPLIGHLHLLGAKTPLARIFASLADKYG  72

Query  1481  PVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW  1302
             P+F I LG    LV+ + EA+++CF TNDK+LA+RP +  G +L Y++A F F+   SYW
Sbjct  73    PIFQIHLGAYPALVICNQEAIKECFTTNDKVLASRPKSSHGVHLSYNFAGFGFAPYGSYW  132

Query  1301  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHL  1122
              ++RKL + E+LS+RRLE L+ V+ SE+ T I++L+ ++       S  KV +S W   L
Sbjct  133   IKLRKLTMLELLSARRLEFLRPVYESEIDTLIRDLWMYL----GGKSDVKVTISEWLERL  188

Query  1121  TLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY  942
             T N+I +++AG+RY        + EA  + K+  + M++ GEFV  D I PL    WL  
Sbjct  189   TFNMITKMIAGKRYFSYLQDVDDVEAHGIVKLIKEFMHISGEFVLSDLI-PL--LGWLGV  245

Query  941   EGHV-KTMKRAAKDVDAILQDWVDARRKE----RRSNEDQKFIDVMLSMIDDQFTQGYSY  777
              G V K MKR AKD+D ++  WV+   K      +S E   FIDVMLS+I+D    G  +
Sbjct  246   HGTVLKNMKRIAKDLDTLVGGWVEEHMKSDTLTNKSWEKHDFIDVMLSVIEDDSVSG--H  303

Query  776   SRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE-RWAEDS  600
             +RDT+IKA V++++   S+T +T +TW LA+L+K+P +LKR Q+EID  +G+E R  E  
Sbjct  304   TRDTIIKANVMNLMLAGSDTTSTTMTWTLAMLMKNPHALKRAQEEIDHQVGRERRRVEAR  363

Query  599   DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI  420
             D+K+L YLQ +VKETLR+YP GP L PHEA EDC + GYH+PKGT+++ NVW+LHRDP +
Sbjct  364   DIKDLIYLQAIVKETLRLYPPGPVLVPHEAREDCNIQGYHVPKGTRVFANVWKLHRDPSL  423

Query  419   WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN  240
             W +PEKF PERF++   GE  +   ++++PFG GRR+CPG+ +ATQ+  + ++RL QGF+
Sbjct  424   WSEPEKFSPERFISE-NGELDEVHHFEYLPFGSGRRACPGSTFATQVCLLTLSRLLQGFD  482

Query  239   FSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
                  +EP+D+ E +GI LPK+ PL+++++PRL    ++
Sbjct  483   LHVPMDEPVDLEEGLGITLPKMNPLQIVLSPRLPSEFYQ  521



>ref|NP_194922.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
 sp|Q9SZ46.1|C82C4_ARATH RecName: Full=Cytochrome P450 82C4 [Arabidopsis thaliana]
 emb|CAA16595.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79912.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE85981.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
Length=524

 Score =   445 bits (1144),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 217/499 (43%), Positives = 324/499 (65%), Gaps = 21/499 (4%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCF  1407
             P   GAWPIIGHLH       L+ +TL + AD YGP  +++LG +   VVSS+E  +DCF
Sbjct  33    PAPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGPAMSLQLGSNEAFVVSSFEVAKDCF  92

Query  1406  ATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWV  1227
               NDK LA+RP T A K++GY++AVF F+  +++WR +RK+   E+LS+RRL+ LKHV V
Sbjct  93    TVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1226  SELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTIN--  1053
             SE+   +K+LY+ +   N       V++  W   +TLN+I+++VAG+RY +   G+++  
Sbjct  153   SEITMGVKDLYS-LWFKNGGTKPVMVDLKSWLEDMTLNMIVRMVAGKRY-FGGGGSVSSE  210

Query  1052  --EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW  879
               EEA + KK  ++  +L G F   DA   L FF   D +GH K MK+   ++D IL+ W
Sbjct  211   DTEEAMQCKKAIAKFFHLIGIFTVSDAFPTLSFF---DLQGHEKEMKQTGSELDVILERW  267

Query  878   VDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
             ++  R++R+       D  FIDVM+S+ +        Y  +T IK+  L+++   S+T A
Sbjct  268   IENHRQQRKFSGTKENDSDFIDVMMSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTSA  327

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
             + LTW +++LL + E LK+ QDEID ++G++R  EDSD++NL YLQ ++KETLR+YP GP
Sbjct  328   STLTWAISLLLNNKEMLKKAQDEIDIHVGRDRNVEDSDIENLVYLQAIIKETLRLYPAGP  387

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ-  354
              L P EA+EDC V GY++P GT+L VNVW++ RDPK++ +P +F PERF+T   GEA + 
Sbjct  388   LLGPREAMEDCTVAGYYVPCGTRLIVNVWKIQRDPKVYMEPNEFRPERFIT---GEAKEF  444

Query  353   ---NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
                 + ++ +PFG GRRSCPG+  A Q+  + +AR    F+  TV + P+DM E+ G+ +
Sbjct  445   DVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTVMDMPVDMSENPGLTI  504

Query  182   PKLTPLEVLVTPRLSPTLF  126
             PK TPLEVL++PR+   LF
Sbjct  505   PKATPLEVLISPRIKEELF  523



>ref|XP_009109920.1| PREDICTED: cytochrome P450 82C4 [Brassica rapa]
Length=525

 Score =   444 bits (1143),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 228/529 (43%), Positives = 331/529 (63%), Gaps = 20/529 (4%)
 Frame = -1

Query  1679  MDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLS  1503
             MDA    L S L +  L+ L+   +K      PE  GAWPIIGHLH       L+ +TL 
Sbjct  1     MDAFLFSLLSPLLVFVLIALFKKTKKPKHAKAPEPSGAWPIIGHLHLLGGKEQLLYRTLG  60

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
             E A++YGP  ++RLG +   VVSS+E  ++CF  NDK LA+RP T A K++GY+YAVF F
Sbjct  61    EMANRYGPAMSLRLGSNEAFVVSSFEVAKECFTVNDKALASRPMTAAAKHMGYNYAVFGF  120

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTF-ISMDNNNPSAPKVN  1146
             +  +S+WR +RK+   E+LS+RRL+ LKHV VSE+   +K+LY+  +    + P    V+
Sbjct  121   APYSSFWREMRKIATVELLSNRRLQMLKHVRVSEISMGVKDLYSLWVKKGGSEPII--VD  178

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGT--INEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
             + RW   +TLN+I+++VAG+RY      T    EEA++ +K  ++  +L G F   DA F
Sbjct  179   LKRWLEDMTLNMIVRMVAGKRYFGGGSTTPEDTEEARQCQKAITKFFHLIGIFTMSDA-F  237

Query  971   PLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMID  804
             P     W D +GH K MK+   ++D IL+ W++  R++R+       D  FIDVMLS+ +
Sbjct  238   PT--LGWFDLQGHEKEMKKTGSELDVILERWIENHRQQRKVSGNKENDSDFIDVMLSLAE  295

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
                     Y  +T IK+  L+++   S+T A+ LTW +A+LL + + LK+ QDEID  +G
Sbjct  296   QGKLSHLQYDANTSIKSTCLALILGGSDTTASTLTWAIALLLNNKDMLKKAQDEIDLQVG  355

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
              +R  EDSD++NL YLQ ++KETLR+YP GP L P EA+EDC V GYH+  GT+L VNVW
Sbjct  356   TDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHVACGTRLIVNVW  415

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYATQIT  276
             ++ RDPK+W +P +F PERF+T   GEA +     + ++ +PFG GRRSCPG+  A Q+ 
Sbjct  416   KIQRDPKVWVEPNEFRPERFLT---GEAKEFDVRGQNFELIPFGSGRRSCPGSSLAMQVL  472

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTL  129
              + +AR    F+  T  +  +DM E  G+ +PK TPLEV+++PRL   L
Sbjct  473   HLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEVMISPRLEKHL  521



>ref|XP_003547786.2| PREDICTED: cytochrome P450 82C2-like [Glycine max]
Length=541

 Score =   445 bits (1144),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 225/525 (43%), Positives = 326/525 (62%), Gaps = 18/525 (3%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFSWR--------KQSK-RLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             + +I GI AL++ +  +R        KQ K    PE  GA P IGHLH      P  +T 
Sbjct  18    VQTIAGILALLIAYILFRSVKSPNGSKQRKGNQVPEPRGALPFIGHLHLLNARKPYFRTF  77

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
             S  A+KYGP+F ++LG    LVV+S E  ++C  TNDK+ A+RP T AGK LGY+ AVF 
Sbjct  78    SAIAEKYGPIFILKLGCHPTLVVNSREIAKECLTTNDKVFASRPITSAGKILGYNNAVFG  137

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNN-NPSAPKV  1149
             FS    YWR +RK+ + EILSS +LEKLKHV  +E  + +K+LY+ IS   N N S   V
Sbjct  138   FSPYGKYWREIRKMAILEILSSYKLEKLKHVRDTETLSLVKDLYSSISCPKNVNGSTTHV  197

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFP  969
              +S    H++ N+I++++AG+R+   +    + EA RL+       YL G FV+ DAI  
Sbjct  198   PISNLLEHMSFNIIVRMIAGKRFGGDTVNQEDNEAWRLRNAIKDATYLCGVFVAADAIPS  257

Query  968   LWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQK----FIDVMLSMIDD  801
             L    W+D++G+V  MKR  K++D IL+ W++   ++R   +D K    F+DVM+S   +
Sbjct  258   L---SWIDFQGYVSFMKRTNKEIDLILEKWLEEHLRKRGEEKDGKCESDFMDVMISAFQE  314

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             +  +   Y R+ VIKA  + ++  AS + A  LTW L++LL HP+ LK  Q E+DT++GK
Sbjct  315   E-EEICGYKREMVIKATSVLLILTASGSTAITLTWALSLLLNHPKVLKAAQKELDTHLGK  373

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             ERW ++SD++NL YLQ ++KETLR+YP  P     E +EDC V GYH+PKGT+L +N+W 
Sbjct  374   ERWVQESDIENLTYLQAIIKETLRLYPPAPLTGIREVMEDCCVAGYHVPKGTRLLINLWN  433

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             L RDPK+WP+P KF PERF+T        ++ ++ +PF +GRRSCPG  +  Q+  + +A
Sbjct  434   LQRDPKVWPNPNKFEPERFLTTHHDINFMSQNFELIPFSIGRRSCPGMTFGLQVLHLTLA  493

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             RL QGF+  T     +DM E +G+ LPK   L+V++ PRL   L+
Sbjct  494   RLLQGFDICTKDGAEVDMTEGLGVALPKEHGLQVMLQPRLPLGLY  538



>gb|KHG07864.1| Cytochrome P450 protein [Gossypium arboreum]
Length=515

 Score =   444 bits (1141),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 214/517 (41%), Positives = 327/517 (63%), Gaps = 20/517 (4%)
 Frame = -1

Query  1649  ILGIAALVLLWFSWRKQS-----KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1485
             I  IA+L+L  + + +++     K   PE  G+ P+IGHLH      P+ K L+  ADK+
Sbjct  7     IPSIASLLLFLYIFSRKAPKNSKKNCIPEPTGSLPLIGHLHLLGGKEPICKNLATMADKH  66

Query  1484  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY  1305
             GP+++++LG  RILVVSSWE  +DCF  ND+ LA R    AG+Y+GYD A+F+ +    Y
Sbjct  67    GPLYSLKLGTHRILVVSSWEIAKDCFTNNDRTLATRANIVAGRYMGYDNAIFSLAPYGEY  126

Query  1304  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH  1125
             WR +RK+   E+LSS RLEKLKH+  SE+ + IKELY        + +  KV +S     
Sbjct  127   WRNIRKMATVELLSSHRLEKLKHIRFSEMDSFIKELYGL------SRNGDKVTISEALER  180

Query  1124  LTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD  945
             LT N+ ++++ G+R+     G ++ E  R  K   + +YL+G FV  DA+   W  R+ D
Sbjct  181   LTFNINLRMLFGKRFSGNDYGEVDSEPWRFMKAIKRALYLFGIFVLPDAL--QWLERF-D  237

Query  944   YEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLSMI-DDQFTQGYSY  777
              +GHV++MK  AK++D+I+  W++   K++R N+   +  F+DVML+ + +D    G++ 
Sbjct  238   IQGHVRSMKENAKELDSIINVWLEEHLKKKRENQGASESDFMDVMLTHLREDTVISGHT-  296

Query  776   SRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSD  597
              RDT++KA  L +     E+ +  +TW+L++LL HP  L   Q+EID ++GK+RW E+SD
Sbjct  297   -RDTIVKATTLVLSLTGGESTSVTITWVLSLLLNHPNVLITAQEEIDHHVGKQRWVEESD  355

Query  596   VKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW  417
             +KNL YLQ +VKETLR+YP GP     EA++DC + GY +PKGT+L VN+W+LHRDP++W
Sbjct  356   IKNLKYLQAIVKETLRLYPPGPITGIREAMQDCCIAGYDVPKGTRLIVNIWKLHRDPRVW  415

Query  416   PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF  237
              +  +F PERFMT       + + ++++PF  GRRSCPG  +  Q+  + V++L QGF+ 
Sbjct  416   ENANEFHPERFMTTHVDFDVKGQNFEYMPFSSGRRSCPGMTFGLQVVHLTVSKLIQGFDI  475

Query  236   STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
                    +DM E +G+ LPKL PLEV+++PRL    +
Sbjct  476   RVAEGTAVDMEEGLGLALPKLNPLEVVLSPRLGTEFY  512



>ref|XP_010436299.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   443 bits (1140),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 222/518 (43%), Positives = 325/518 (63%), Gaps = 21/518 (4%)
 Frame = -1

Query  1640  IAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIR  1464
             +   + L+   +K      P+  GAWPIIGHLH       L+ +TL + AD YG   +++
Sbjct  14    LIVFIALFMKSKKPKHVKAPKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQ  73

Query  1463  LGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKL  1284
             LG S   VVSS+E  ++CF  NDK LA+RP T A K++GY++AVF F+  +++WR +RK+
Sbjct  74    LGSSEAFVVSSFEVAKNCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKI  133

Query  1283  VVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIM  1104
                E+LS+RRL+ LKHV VSE+   +K+LY+ + + N       V++  W   +TLN+I+
Sbjct  134   ATIELLSNRRLQMLKHVRVSEISMGVKDLYS-LWVKNGGSEPVIVDLKSWLEDMTLNMIV  192

Query  1103  QIVAGRRYEYRSDGTIN----EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG  936
             ++VAG+RY +   G+ +    EEA + K+  S+  +L G F   DA FP    RW D +G
Sbjct  193   RMVAGKRY-FGGAGSESSEDTEEASQCKRAISKFFHLIGIFTVSDA-FPA--LRWFDLQG  248

Query  935   HVKTMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYSRD  768
             H K MK+   ++D IL+ W++  R+ER+       D  FIDVMLS+          Y   
Sbjct  249   HEKEMKQTGSELDVILERWIENHRQERKVSGTKENDSDFIDVMLSLAKQGKLSHLQYDAT  308

Query  767   TVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKN  588
             T IK+  L+++   S+T A+ LTW +A+LL + E LK  QDEID ++G++R  EDSD+KN
Sbjct  309   TSIKSTCLALILGGSDTTASTLTWAIALLLNNKEMLKNAQDEIDLHVGRDRNVEDSDIKN  368

Query  587   LPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDP  408
             L YLQ ++KETLR+YP GP L P EA+EDC V GY++  GT+L VNVW++ RDPK++ +P
Sbjct  369   LVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYVEP  428

Query  407   EKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN  240
              +F PERF+T   GEA +     + ++ +PFG GRRSCPG+  A Q+  + +AR    F 
Sbjct  429   NEFRPERFIT---GEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFE  485

Query  239   FSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
               TV + P+DM E  G+ +PK TPLEVL++PRL+   F
Sbjct  486   VKTVLDMPVDMSESPGLTIPKATPLEVLISPRLNEQFF  523



>gb|KDP26347.1| hypothetical protein JCGZ_17505 [Jatropha curcas]
Length=526

 Score =   443 bits (1139),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 224/531 (42%), Positives = 335/531 (63%), Gaps = 22/531 (4%)
 Frame = -1

Query  1679  MDAVPCCLSSILGIAALVLLWFSW--------RKQSKRLPPEAGGAWPIIGHLHHFRTSV  1524
             MD      + ILGI AL++ +  W        + +   LPPE  GA P IGHLH      
Sbjct  1     MDYFSSNFTVILGILALLVFYNLWGTRKTPKIKNKGGSLPPEVAGALPFIGHLHKLGDRK  60

Query  1523  PLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGY  1344
             P  + L E AD YGP+FT+RLG    +V+S    +++ + T+DK  A+RP +   KYL Y
Sbjct  61    PFARILGEIADNYGPIFTVRLGKHPTIVISDQNILKEFYTTHDKFFASRPPSSQSKYLAY  120

Query  1343  DYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNP  1164
             +YA F F+  ++YWR VRKL + ++LS  RL+ L+HV V+E+   +++L+     +N N 
Sbjct  121   NYAAFGFAPYSTYWRDVRKLAMVQVLSLHRLKLLQHVRVTEVSHIVQDLF-LKCKENGNC  179

Query  1163  SAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQR-LKKVFSQVMYLWGEFVS  987
             S   V+MS    HL LN+I ++VAG+RY +  + T N+E +R + ++  + MYL G FV+
Sbjct  180   S---VDMSELLEHLVLNIITRMVAGKRY-FDGNSTGNDENRRPIGQIMREFMYLAGVFVA  235

Query  986   GDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWV---DARRKERRSNEDQKFIDVML  816
              D I    F  W ++ G VKTMK+  K+ D I+++W+   +++R    SN  Q FIDV+L
Sbjct  236   SDLI---PFLGWSEFLGPVKTMKKVMKEFDNIIENWIHEHESKRVNGESNVHQDFIDVLL  292

Query  815   SMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEID  636
             S I D  T  +  SR TVIKA +L+++   ++T +  +TWILA LL + ++L+  Q+EID
Sbjct  293   SEIKDDST--FGNSRKTVIKATILTVIVGGADTTSITMTWILANLLNNKKALELAQEEID  350

Query  635   TNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLY  456
               +G++R  E+SD +NL YL+ ++KETLR+YP GP   P E++ DC   GYHIP+GT+  
Sbjct  351   QKVGRDRILEESDCENLVYLKAIIKETLRLYPAGPLAVPRESMVDCNFYGYHIPRGTRFL  410

Query  455   VNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQIT  276
              N+W+LHRDPK+W +P++F PERF+T+        + ++ +PFG GRRSCPG  +A Q+ 
Sbjct  411   TNLWKLHRDPKVWANPDEFKPERFLTSHADVDVVGQNFELLPFGSGRRSCPGLNFAMQVV  470

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             Q+ + RL QGFN  T  NE +DM E + I L K TPLE+++TPRL+P L++
Sbjct  471   QLGIGRLLQGFNLRTPSNELVDMTESLNISLSKETPLEIVLTPRLAPQLYQ  521



>ref|XP_010451089.1| PREDICTED: cytochrome P450 82C4 [Camelina sativa]
Length=524

 Score =   443 bits (1139),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 220/499 (44%), Positives = 322/499 (65%), Gaps = 21/499 (4%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCF  1407
             P+  GAWPIIGHLH       L+ +TL + AD YG   +++LG S   VVSS+E  ++CF
Sbjct  33    PKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNCF  92

Query  1406  ATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWV  1227
               NDK LA+RP T A K++GY++AVF F+  +++WR +RK+   E+LS+RRL+ LKHV V
Sbjct  93    TVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1226  SELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGT----  1059
             SE+   +K+LY+ + + N       V++  W   +TLN+I+++VAG+RY +   G+    
Sbjct  153   SEISMGVKDLYS-LWVKNGGSEPVIVDLKSWLEDMTLNMIVRMVAGKRY-FGGTGSETSE  210

Query  1058  INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW  879
               EEA++ K   S+  +L G F   DA FP    RW D +GH K MK+   ++D IL+ W
Sbjct  211   DTEEARQCKIAISKFFHLIGIFTVSDA-FPA--LRWFDLQGHEKEMKQTGSELDVILEKW  267

Query  878   VDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
             ++  R++R+       D  FIDVMLS+ +        Y  +T IK+  L+++   S+T A
Sbjct  268   IENHRQQRKVSGTKENDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTTA  327

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
             + LTW +A+LL + E LK+ QDEID ++G++R  EDSD+KNL YLQ ++KETLR+YP GP
Sbjct  328   STLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDIKNLVYLQAIIKETLRLYPAGP  387

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ-  354
              L P EA+EDC V GY++  GT+L VNVW++ RDPK++ +P +F PERF+T   GEA + 
Sbjct  388   LLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYMEPNEFRPERFVT---GEAKEF  444

Query  353   ---NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
                 + ++ +PFG GRRSCPG+  A Q+  + +AR    F   TV + P+DM E  G+ +
Sbjct  445   DVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSESPGLTI  504

Query  182   PKLTPLEVLVTPRLSPTLF  126
             PK TPLEVL++PRL+  LF
Sbjct  505   PKATPLEVLMSPRLNEQLF  523



>ref|XP_003548649.2| PREDICTED: cytochrome P450 82C2-like [Glycine max]
Length=541

 Score =   443 bits (1140),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 225/525 (43%), Positives = 325/525 (62%), Gaps = 18/525 (3%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFSWR--------KQSK-RLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             + +I GI AL++ +  +R        KQ K    PE  GA P IGH+H      P  +T 
Sbjct  18    VQTIAGILALLIAYIVFRSIKSPNGSKQRKGNQVPEPRGALPFIGHVHLLNARKPYFRTF  77

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
             S  A+KYGP+F ++LG    LVV+S E  ++C  TNDK+ A+RP T AGK LGY+ AVF 
Sbjct  78    SAIAEKYGPIFILKLGCHPTLVVNSREIAKECLTTNDKVFASRPITSAGKILGYNNAVFG  137

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNN-NPSAPKV  1149
             FS    YWR +RK+   EILSS +LEKLKHV  +E  + +K+LY+ IS   N N S   V
Sbjct  138   FSPYGKYWREIRKMATLEILSSYKLEKLKHVRDTETLSLVKDLYSSISYPKNVNGSTTHV  197

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFP  969
              +S    H++ N+I++++AG+R+   +    + EA RL+       YL G FV+ DAI  
Sbjct  198   PISNLLEHMSFNIIVRMIAGKRFGGDTVNQEDNEAWRLRNAIRDATYLCGVFVAADAIPS  257

Query  968   LWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQK----FIDVMLSMIDD  801
             L    W+D++G+V  MKR  K++D IL+ W++   ++R   +D K    F+DVM+S   +
Sbjct  258   L---SWIDFQGYVSFMKRTNKEIDLILEKWLEEHLRKRGEEKDGKCESDFMDVMISAFQE  314

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             +  +   Y R+ VIKA  + ++  AS + A  LTW L++LL HP+ LK  Q E+DT++GK
Sbjct  315   E-EEICGYKREMVIKATSVLLILTASGSTAITLTWALSLLLNHPKVLKAAQKELDTHLGK  373

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             ERW ++SD+KNL YLQ ++KETLR+YP  P     E +EDC V GYH+PKGT+L +N+W 
Sbjct  374   ERWVQESDIKNLTYLQAIIKETLRLYPPAPLTGIREVMEDCCVAGYHVPKGTRLLINLWN  433

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             L RDPK+WP+P KF PERF+T        ++ ++ +PF +GRRSCPG  +  Q+  + +A
Sbjct  434   LQRDPKVWPNPNKFEPERFLTTHHDINFMSQNFELIPFSIGRRSCPGMTFGLQVLHLTLA  493

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             RL QGF+  T     +DM E +G+ LPK   L+V++ PRL   L+
Sbjct  494   RLLQGFDICTKDGAEVDMTEGLGVALPKEHGLQVMLQPRLPLGLY  538



>ref|XP_010445016.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   442 bits (1138),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 220/499 (44%), Positives = 320/499 (64%), Gaps = 21/499 (4%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCF  1407
             P+  GAWPIIGHLH       L+ +TL + AD YG   +++LG S   VVSS+E  ++CF
Sbjct  33    PKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNCF  92

Query  1406  ATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWV  1227
               NDK LA+RP T A K++GY++AVF F+  +++WR +RK+   E+LS+RRL+ LKHV V
Sbjct  93    TVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1226  SELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTIN--  1053
             SE+   +K+LY+ + + N       V++  W   +TLN+I+++VAG+RY +   G+ +  
Sbjct  153   SEISMGVKDLYS-LWVKNGGSEPVIVDLKSWLEDMTLNMIVRMVAGKRY-FGGAGSESSE  210

Query  1052  --EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW  879
               EEA + K+  S+  +L G F   DA FP    RW D +GH K MK+   ++D IL+ W
Sbjct  211   DTEEASQCKRAISKFFHLIGIFTVSDA-FP--SLRWFDLQGHEKEMKQTGSELDVILERW  267

Query  878   VDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
             ++  R+ER+       D  FIDVMLS+ +        Y   T IK+  L+++   S+T A
Sbjct  268   IENHRQERKVSGTKENDSDFIDVMLSLAEQGKLSHLQYDATTSIKSTCLALILGGSDTTA  327

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
             + LTW +A+LL + E LK  QDEID ++G++R  EDSD+ NL YLQ ++KETLR+YP GP
Sbjct  328   STLTWAIALLLNNKEMLKNAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRLYPAGP  387

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ-  354
              L P EA+EDC V GY++  GT+L VNVW++ RDPK++ +P +F PERF+T   GEA + 
Sbjct  388   LLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYEEPNEFRPERFIT---GEAKEF  444

Query  353   ---NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
                 + ++ +PFG GRRSCPG+  A Q+  + +AR    F   TV + P+DM E  G+ +
Sbjct  445   DVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSESPGLTI  504

Query  182   PKLTPLEVLVTPRLSPTLF  126
             PK TPLEVL++PRL+  LF
Sbjct  505   PKATPLEVLISPRLNEQLF  523



>ref|XP_010432796.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   442 bits (1138),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 222/520 (43%), Positives = 327/520 (63%), Gaps = 25/520 (5%)
 Frame = -1

Query  1640  IAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIR  1464
             +   + L+   +K      P+  GAWPIIGHLH       L+ +TL + AD YG   +++
Sbjct  14    LIVFIALFMKSKKPKHVKAPKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQ  73

Query  1463  LGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKL  1284
             LG S   VVSS+E  ++CF  NDK LA+RP T A K++GY++AVF F+  +++WR +RK+
Sbjct  74    LGSSEAFVVSSFEVAKNCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKI  133

Query  1283  VVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIM  1104
                E+LS+RRL+ LKHV VSE+   +K+LY+ + + N       V++ RW   +T N+I+
Sbjct  134   ATIELLSNRRLQMLKHVRVSEISMGVKDLYS-LWVKNGGSEPVIVDLKRWSEDMTQNVIV  192

Query  1103  QIVAGRRYEYRSDGTINE------EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY  942
             ++VAG+RY     G ++E      EA++ K+  S+  +L G F   DA FP    RW D+
Sbjct  193   RMVAGKRY---LGGAVSESSEDAAEARQCKRAISKFFHLIGIFTVSDA-FPA--LRWFDF  246

Query  941   EGHVKTMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYS  774
             +GH K MK+   ++D IL+ W +  R+ER+       D  FIDVMLS+ +        Y 
Sbjct  247   QGHEKEMKQTGSELDVILERWTENHRQERKVSGTKENDSDFIDVMLSLEEQGKLSHLQYD  306

Query  773   RDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDV  594
              +T IK+  LS++   S+T ++ LTW +A+LL + E LK+ QDEID ++G++R  EDSD+
Sbjct  307   ANTSIKSTCLSLILGGSDTTSSTLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDI  366

Query  593   KNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWP  414
              NL YLQ ++KETLR+YP GP L P EA+EDC V GY++  GT+L VNVW++ RDPK++ 
Sbjct  367   NNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYK  426

Query  413   DPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQG  246
             +P +F PERF+T   GEA +     + ++ +PFG GRRSCPG+  A Q+  + +AR    
Sbjct  427   EPNEFRPERFIT---GEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHS  483

Query  245   FNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             F   TV + P+DM E  G+ +PK TPLEVL++PRL   LF
Sbjct  484   FEVKTVLDMPVDMTESPGLTIPKATPLEVLISPRLKEHLF  523



>ref|XP_007049686.1| Cytochrome P450, family 82, subfamily C, polypeptide 2, putative 
[Theobroma cacao]
 gb|EOX93843.1| Cytochrome P450, family 82, subfamily C, polypeptide 2, putative 
[Theobroma cacao]
Length=590

 Score =   445 bits (1144),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 221/497 (44%), Positives = 330/497 (66%), Gaps = 13/497 (3%)
 Frame = -1

Query  1598  SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAV  1419
             S  LP    G    +G L  +  +V L +TL+  ADKYGPVFTIR+GI R L+VS+ EAV
Sbjct  103   SSYLPAVVAG---FLGLLILYNLTVTLARTLAAMADKYGPVFTIRIGIYRTLIVSNHEAV  159

Query  1418  RDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLK  1239
             ++CF TNDK+LA RP + AG YL YD+A F F+   +YWR++RKL V E+LS  RL  L 
Sbjct  160   KECFTTNDKILANRPRSNAGTYLAYDHAGFGFAPYGTYWRQMRKLAVLELLSVHRLATLT  219

Query  1238  HVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGT  1059
             HV VSE+   IK L  F      +P+  K+++S+    L LN++++ +AG RY   +DG 
Sbjct  220   HVRVSEVDAFIKNLCFFCKKSEQSPNQ-KISISQRLEVLNLNMMLRTIAGTRYFSDADGE  278

Query  1058  INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGH-VKTMKRAAKDVDAILQD  882
              ++EAQR  K+  +  YL G   +   + P  F +W+D+ GH VK+MKR +K++D++++ 
Sbjct  279   NDKEAQRAMKLIKEFSYLLG-VTALSEVVP--FLKWIDFWGHQVKSMKRISKEMDSLIES  335

Query  881   WVDA---RRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
             WVD    RR +  +  +Q FIDV+LS I+D     + ++R+T+IKA V  ++   S++ +
Sbjct  336   WVDEHKLRRFKIGAKNNQDFIDVLLSAIEDD--SMFGHTRETIIKATVTVLISAGSDSTS  393

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
               LTWIL+ L+ +  ++KR Q+E+D  IG++RW ED D++ L YLQ ++KET R+YP  P
Sbjct  394   RTLTWILSNLMNNRNAMKRAQEELDLKIGRDRWVEDCDIEKLVYLQAIIKETFRLYPAAP  453

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN  351
                PH+A+E C + GYHIPKGT+L+VNVW+L RDP+IW +PE+F PERF+T+ +      
Sbjct  454   LSVPHQAMEYCRISGYHIPKGTRLFVNVWKLQRDPRIWSNPEEFEPERFLTSYQNVDILG  513

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
             + ++ +PFG GRRSCPG  +A Q+ ++ +ARL QGF+ +T  N P+DM E+ G  + K T
Sbjct  514   QHFELIPFGSGRRSCPGMSWALQVIRLTIARLLQGFDLATPLNAPVDMTEEPGGTMSKAT  573

Query  170   PLEVLVTPRLSPTLFRL  120
             PL++++TPRL   L++L
Sbjct  574   PLQLVLTPRLPDHLYQL  590



>ref|XP_011030967.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   443 bits (1139),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 220/507 (43%), Positives = 320/507 (63%), Gaps = 15/507 (3%)
 Frame = -1

Query  1616  FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVV  1437
             F  R   K+  P+AGGAWP+IGHLH    + P  K L   A+KYGP+FTI++G+ R LVV
Sbjct  35    FLARTGKKKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVV  94

Query  1436  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR  1257
             S+WE  ++CF T+DK  + RP T A + L YD A+  FS    YWR+VRK+   E+LS+ 
Sbjct  95    SNWETAKECFTTHDKAFSGRPKTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNY  154

Query  1256  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPK-------VNMSRWFGHLTLNLIMQI  1098
             RLEKLK V  SE++  +KELY     D+N   A K       V M RWFG LTLN++++ 
Sbjct  155   RLEKLKDVRESEVRAFLKELYKL--WDDNRGGASKSKGSMVLVEMERWFGDLTLNIVLRT  212

Query  1097  VAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMK  918
             + G+   Y ++    E  +  KK      +  G F   DA   L F R+LD  GH + MK
Sbjct  213   IVGKTVGYITNVEDEESVKGWKKGLKDFFHWTGVFPVSDA---LPFLRFLDLGGHGEAMK  269

Query  917   RAAKDVDAILQDWVDARRKERRSN---EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV  747
             + AK++D +++DW++  +++R +      + F+D+ML + D+          DT+ KA  
Sbjct  270   KTAKELDLVVEDWLEEHKRKRAAGIVKGKEDFMDLMLDVFDNDAEAVQGGDSDTINKATS  329

Query  746   LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV  567
             L+++  AS+T A  L W L++L+ +P +LK+ Q E+DT++ KER  E+SDV+NL YL+ V
Sbjct  330   LTLILAASDTTAVTLIWALSLLVNNPNALKKAQLELDTHVSKERQVEESDVQNLVYLKAV  389

Query  566   VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER  387
             +KETLR+YP GP L PHEA+EDC +DGYH+P+GT+L VNV ++HRD ++W +P +F PER
Sbjct  390   LKETLRLYPPGPLLIPHEAIEDCTIDGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPER  449

Query  386   FMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDM  207
             F+T   G   + + ++F+PFG GRR CPG  +A     +A+A L  GF+F+T   EP+DM
Sbjct  450   FLTTHRGFDVRGKNFEFLPFGSGRRMCPGVSFALHAMDLALATLLHGFDFATPSGEPVDM  509

Query  206   MEDVGIILPKLTPLEVLVTPRLSPTLF  126
              E+ G+   + TPLEVL+ PRL   L+
Sbjct  510   HENSGLTNLRATPLEVLLCPRLPSRLY  536



>gb|KDO40894.1| hypothetical protein CISIN_1g009786mg [Citrus sinensis]
Length=525

 Score =   442 bits (1137),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 217/502 (43%), Positives = 323/502 (64%), Gaps = 21/502 (4%)
 Frame = -1

Query  1610  WRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSS  1431
             +  + KR  PEAGGAWP+IGHLH      P  + L   ADKYGP+FTI++GI+R LVVS+
Sbjct  37    YTSKKKRGAPEAGGAWPVIGHLHLLGGPEPPHRVLGCMADKYGPIFTIKMGINRALVVSN  96

Query  1430  WEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRL  1251
             WE  ++C  T+DK+ A+RP T A + LGY++++F FS   SYWR  RK+   E+LS+ RL
Sbjct  97    WEMAKECLTTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRL  156

Query  1250  EKLKHVWVSELQTNIKELYTFISMDNNNPSAPK---VNMSRWFGHLTLNLIMQIVAGRRY  1080
             EKLK V   EL+T +KELY      +NN S  K   V M RW      N++++++ G+  
Sbjct  157   EKLKQVREYELKTCLKELYQLW---DNNKSTNKMLLVEMKRWLADSIRNVVLRMIVGK--  211

Query  1079  EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDV  900
                  G  + +++  K++ ++   + G+FV  DA   L F RWLD  G  ++MK+ AK++
Sbjct  212   -----GCNSMDSEEWKELLTRFFEMSGKFVVSDA---LPFLRWLDIGGDERSMKKIAKEL  263

Query  899   DAILQDWVDARRKERRSNE----DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ  732
             D ++Q W++  + +R S E    ++ F+ VMLS++ D   Q Y    DT+ KAI L ++ 
Sbjct  264   DVVVQGWLEEHKMKRDSQEMNQEEEDFMYVMLSILGDT-DQYYGRDVDTINKAICLGLIL  322

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
              A++T A  LTWI+++LL H + L + ++E+D  +G +R   +SD+KNL YLQ ++KE +
Sbjct  323   AATDTTAVTLTWIISLLLNHHDILNKARNELDIQVGTKRQVNESDIKNLVYLQAILKEAM  382

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R+YP  P L PHE++E+C V GY++P GTQL++NVW+L RDP +W +P KF PERF+T  
Sbjct  383   RLYPAAPLLIPHESIEECTVSGYNVPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRH  442

Query  371   EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVG  192
             +    + + ++ +PF  GRR CPG  +A Q+ Q  +A L  GF+ +T  NEPLDM E +G
Sbjct  443   KDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLHGFDIATPSNEPLDMGEGLG  502

Query  191   IILPKLTPLEVLVTPRLSPTLF  126
             + + K TPLEVLV PRLS +L+
Sbjct  503   LTVEKSTPLEVLVAPRLSASLY  524



>ref|XP_002869304.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45563.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   442 bits (1137),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 225/525 (43%), Positives = 333/525 (63%), Gaps = 27/525 (5%)
 Frame = -1

Query  1646  LGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYG  1482
             L +  L+ ++ +  K+SK+      P   GAWPIIGHLH       L+ +TL + AD YG
Sbjct  8     LFVPILLFVFIALFKKSKKPNHVKAPAPSGAWPIIGHLHLLGGKEHLLYRTLGKMADHYG  67

Query  1481  PVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW  1302
             P  ++RLG S   VVSS+E  +DCF  NDK LA+RP T A K++GY++AVF F+  +++W
Sbjct  68    PAMSLRLGSSEAFVVSSFEVAKDCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFW  127

Query  1301  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTF-ISMDNNNPSAPKVNMSRWFGH  1125
             R +RK+   E+LS+RRL+ LKHV VSE+   +K+LY+  +      P    V++  W   
Sbjct  128   REMRKIATIELLSNRRLQMLKHVRVSEISMGVKDLYSLWVKKGGTEPVM--VDLKSWLED  185

Query  1124  LTLNLIMQIVAGRRYEYRSDGTIN----EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
             +TLN+I+++VAG+RY +   G+ +    EEA + KK  ++  +L G F   DA FP    
Sbjct  186   MTLNMIVRMVAGKRY-FGGGGSQSSEDTEEAMQCKKAIAKFFHLIGIFTVSDA-FPR--L  241

Query  956   RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQ  789
              W D +GH K MK+   ++D IL+ W++  R++R+       D  FIDVMLS+ +     
Sbjct  242   GWFDLQGHEKEMKQTGSELDVILERWIENHRQQRQVSGTKENDSDFIDVMLSLAEQGKLS  301

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
                Y  +T IK+  L+++   S+T A+ LTW +++LL + E LK+ QDEID ++G ++  
Sbjct  302   HLQYDANTSIKSTCLALILGGSDTSASTLTWAISLLLNNKEMLKKAQDEIDLHVGTDKNV  361

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
             EDSD++NL YLQ ++KETLR+YP GP L P EA+EDC V GY++P GT+L VNVW++ RD
Sbjct  362   EDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCRVAGYNVPCGTRLIVNVWKIQRD  421

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             PK++ +P +F PERF+T   GEA +     + ++ +PFG GRRSCPG+  A Q+  + +A
Sbjct  422   PKVYTEPNEFRPERFIT---GEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLA  478

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             R    F   TV + P+DM E  G+ +PK TPLEVL++PRL+  LF
Sbjct  479   RFLHSFEAKTVLDLPVDMSESPGLTIPKATPLEVLISPRLNEELF  523



>ref|XP_010091295.1| Cytochrome P450 82G1 [Morus notabilis]
 gb|EXC36851.1| Cytochrome P450 82G1 [Morus notabilis]
Length=546

 Score =   442 bits (1137),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 217/500 (43%), Positives = 309/500 (62%), Gaps = 22/500 (4%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             PE  GA PIIGHLH     VP+   L   ADKYGP++++RLG  R LV+SSWE V++CF 
Sbjct  52    PEPSGALPIIGHLHLLGGQVPVALILGAMADKYGPIYSLRLGQHRALVLSSWELVKECFT  111

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
             TND+L A RP+   GKY+ YD A F  S+  +YWR VRK+V   +LSS RLE L+H+  S
Sbjct  112   TNDRLFANRPSIAVGKYILYDSAAFAISSYGNYWRDVRKMVTLRLLSSHRLESLQHIRTS  171

Query  1223  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEA  1044
             E  + IK LY         P AP   +S     LT NL  +++ G+R+   + G  + +A
Sbjct  172   EFGSFIKGLY--FEYTKLGPLAP---LSELLEQLTFNLNARLIVGKRFIKSAVGDADTDA  226

Query  1043  QRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARR  864
             +R KK   + +YL G FV  DAI    +   LD  GHV +MKR  K++D +L  W++  R
Sbjct  227   RRFKKAIKEALYLSGVFVWSDAI---PWVECLDIHGHVSSMKRVFKEIDLVLGKWLEEHR  283

Query  863   KERRSNEDQK--------------FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA  726
             + R   +DQ+               +DVMLS I++       YSRDT+IKA  L ++   
Sbjct  284   QAREVLDDQRSNDKSSSNGDVERDLMDVMLSSIEEDDAMLSCYSRDTIIKATALILILTG  343

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             +E+ A  L W +++LL +P  +K  Q E+DT++G++RW ++SD+ NL +L+ +VKET+R+
Sbjct  344   TESTAVTLIWAISLLLNNPSVMKAAQRELDTHVGRDRWVQESDLSNLKFLEAIVKETIRL  403

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP GP   P EA E+C V G+H+PKGT+L VN+W+LHRDP++W DP +F PERFMT  E 
Sbjct  404   YPPGPITGPREATEECFVGGHHVPKGTRLIVNIWKLHRDPRMWADPCEFRPERFMTTHED  463

Query  365   EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII  186
                + + +Q++PF  GRRSCPG  +   + ++ +A L QGF F T  ++P+DM E +GI 
Sbjct  464   LNFRGQNFQYIPFSSGRRSCPGMTFGLLVVELMLASLVQGFEFKTKDDKPVDMREGLGIA  523

Query  185   LPKLTPLEVLVTPRLSPTLF  126
             LPKL  L+V + PRL   L+
Sbjct  524   LPKLNSLDVFLYPRLPTKLY  543



>ref|XP_006432710.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
 ref|XP_006471501.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45950.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
Length=524

 Score =   441 bits (1135),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 209/495 (42%), Positives = 317/495 (64%), Gaps = 14/495 (3%)
 Frame = -1

Query  1601  QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEA  1422
             + KR  PEAGGAWP+IGHLH  R   P  +   + ADKYGP+F IR+G +  L+VS+WE 
Sbjct  40    KKKRGAPEAGGAWPVIGHLHLLRGPKPPYRVFDKMADKYGPIFIIRMGKNPALIVSNWEI  99

Query  1421  VRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKL  1242
              ++C  T+DK+ A RP T A + LGY++++F FS   SYWR  RK+    +LS+ RLEKL
Sbjct  100   AKECLTTHDKVFANRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLGLLSNHRLEKL  159

Query  1241  KHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDG  1062
             KHV   E++T +KELY     + +      V M +WFG    N+++++V G+       G
Sbjct  160   KHVREYEVKTCLKELYELWHKNKSTNKILLVEMKKWFGDTLRNVVLRMVVGK-------G  212

Query  1061  TINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQD  882
               + +++  K++ ++   + G+FV  DA   L F RWLD  G  ++MK+ AK++D + Q 
Sbjct  213   CNSVDSEEWKELLTRFFEMSGKFVVSDA---LPFMRWLDIGGDERSMKKIAKELDVVAQG  269

Query  881   WVDARRKERRSNEDQK---FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
             W++  +++R S E +K   F+ VMLS++ D   Q      DT+ KAI L+++  A++T  
Sbjct  270   WLEEHKRKRDSQEIKKEEDFMYVMLSILGDT-EQYLGRDVDTINKAICLALILGAADTTT  328

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
               LTW++++LL H + L + Q+E+D  +G +R   +SD+KNL YLQ ++KE +R+YP GP
Sbjct  329   VTLTWVMSLLLNHRDILNKAQNELDIQVGTKRQVNESDIKNLVYLQAILKEAMRLYPAGP  388

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN  351
              L PHE++E+C V+GYH+P  TQL++N W++ RDP +W +P KF PERF+T  +    + 
Sbjct  389   LLVPHESIEECTVNGYHVPASTQLFINAWKIQRDPSVWEEPSKFQPERFLTRHKDIDVKG  448

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
             + ++ +PF  GRR CPG  +A Q+ Q  +A L QGFNF+T  NEP+DM E +G+ + K  
Sbjct  449   QNFELLPFSSGRRMCPGVSFALQVMQFTLASLLQGFNFATPSNEPVDMGEGLGLTMEKSQ  508

Query  170   PLEVLVTPRLSPTLF  126
             P EVLVTPRLS  ++
Sbjct  509   PFEVLVTPRLSAAVY  523



>ref|XP_002281431.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=516

 Score =   441 bits (1134),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 228/519 (44%), Positives = 322/519 (62%), Gaps = 22/519 (4%)
 Frame = -1

Query  1652  SILGIA-ALVLLWFSWRKQSK---RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1485
             ++ GI  A++ LW    K +K   R PPE  GAWP++GHLH      PL +T    AD+Y
Sbjct  11    TVFGILFAIICLWLVNAKGNKNKGRSPPEPSGAWPVMGHLHLLGADKPLHRTFGAMADEY  70

Query  1484  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY  1305
             GP+F+IRLG+   LVVSS E  ++C+ T DK LA RP + A K +GY++A+F F  +  Y
Sbjct  71    GPIFSIRLGLRTALVVSSSEVAKECYTTKDKALANRPRSLAVKLMGYEHAMFAFERHGPY  130

Query  1304  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH  1125
             WR VR+L + E+LS+R+ E LKHV  SE+   I+ELY      +N  S   V+M + F H
Sbjct  131   WRDVRRLAMVELLSNRQHEMLKHVRDSEVTFFIQELYG--QWVDNGGSPVLVDMKKKFEH  188

Query  1124  LTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD  945
             L  NL+M+ VAG+R              R  +     M L G+F+  DA+ P  F  WLD
Sbjct  189   LVANLVMRTVAGKR--------CGNGESRWCQALGDFMNLMGQFMVSDAV-P--FLGWLD  237

Query  944   -YEGHVKTMKRAAKDVDAILQDWVDARRKERRS---NE-DQKFIDVMLSMIDDQFTQGYS  780
                G+   MK  A+ +D ++  WV+  R++R S   NE +Q FI  MLS+IDD    G+ 
Sbjct  238   TVRGYTAKMKGTARQLDQVIGRWVEEHRQKRLSGSINEAEQDFIHAMLSVIDDAQFSGHD  297

Query  779   YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS  600
             +  DTVIKA  L+++  +++T A  LTW L++L+ +P +LK+ Q+E+D ++G+ +   +S
Sbjct  298   HDHDTVIKATCLTVMLASNDTIAITLTWALSLLMNNPHALKKAQEELDFHVGRNQQVYES  357

Query  599   DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI  420
             D+K L YLQ ++KETLR+YP GP   PHEA+EDC + G+HI  GT+L VN+W+LHRDP I
Sbjct  358   DIKKLVYLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQAGTRLLVNLWKLHRDPTI  417

Query  419   WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN  240
             W DP +F PERF+T   G   + + ++ +PFG GRR CPG  +A +I Q+ +ARL  GF 
Sbjct  418   WSDPLEFQPERFLTKHVGLDVRGQHFELLPFGSGRRMCPGISFALEILQLTLARLLHGFE  477

Query  239   FSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
                V + PLDM E VG+ LPK TPLEV + PRL   L+ 
Sbjct  478   LGVVADSPLDMTEGVGLALPKATPLEVTLVPRLPSELYH  516



>ref|XP_006432714.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
 ref|XP_006471503.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45954.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
Length=525

 Score =   441 bits (1134),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 217/502 (43%), Positives = 322/502 (64%), Gaps = 21/502 (4%)
 Frame = -1

Query  1610  WRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSS  1431
             +  + KR  PEAGGAWP+IGHLH      P  + L   ADKYGP+FTI++GI+R LVVS+
Sbjct  37    YTSKKKRGAPEAGGAWPVIGHLHLLGGPEPPHRVLGCMADKYGPIFTIKMGINRALVVSN  96

Query  1430  WEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRL  1251
             WE  ++C  T+DK+ A+RP T A + LGY++++F FS   SYWR  RK+   E+LS+ RL
Sbjct  97    WEMAKECLTTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRL  156

Query  1250  EKLKHVWVSELQTNIKELYTFISMDNNNPSAPK---VNMSRWFGHLTLNLIMQIVAGRRY  1080
             EKLK V   EL+T +KELY      +NN S  K   V M RW      N++++I+ G+  
Sbjct  157   EKLKQVREYELKTCLKELYQLW---DNNKSTNKMLLVEMKRWLADSIRNVVLRIIVGK--  211

Query  1079  EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDV  900
                  G  + +++  K++ ++   + G+FV  DA   L F RWLD  G  ++MK+ AK++
Sbjct  212   -----GCNSMDSEEWKELLTRFFEMSGKFVVSDA---LPFLRWLDIGGDERSMKKIAKEL  263

Query  899   DAILQDWVDARRKERRSNE----DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ  732
             D ++Q W++  + +R S E    ++ F+ VMLS++ D   Q Y    DT+ KAI L ++ 
Sbjct  264   DVVVQGWLEEHKMKRDSQEMNQEEEDFMYVMLSILGDT-EQYYGRDVDTINKAICLGLIL  322

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
              A++T A  LTWI+++LL H + L + ++E+D  +G +R   +SD+K L YLQ ++KE +
Sbjct  323   AATDTTAVTLTWIISLLLNHHDILNKARNELDIQVGTKRQVNESDIKKLVYLQAILKEAM  382

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R+YP  P L PHE++E+C V GY++P GTQL++NVW+L RDP +W +P KF PERF+T  
Sbjct  383   RLYPAAPLLIPHESIEECTVSGYNVPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRH  442

Query  371   EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVG  192
             +    + + ++ +PF  GRR CPG  +A Q+ Q  +A L  GF+ +T  NEPLDM E +G
Sbjct  443   KDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLHGFDIATPSNEPLDMGEGLG  502

Query  191   IILPKLTPLEVLVTPRLSPTLF  126
             + + K TPLEVLV PRLS +L+
Sbjct  503   LTVEKSTPLEVLVAPRLSASLY  524



>ref|XP_006375030.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
 gb|ERP52827.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
Length=538

 Score =   442 bits (1136),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 220/500 (44%), Positives = 315/500 (63%), Gaps = 15/500 (3%)
 Frame = -1

Query  1595  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             K+  P+AGGAWP+IGHLH    + P  K L   A+KYGP+FTI++G+ R LVVS+WE  +
Sbjct  42    KKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAK  101

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +CF T+DK  + RP T A + L YD A+  FS    YWR+VRK+   E+LS+ RLEKLK 
Sbjct  102   ECFTTHDKAFSGRPRTLASELLTYDGAMLGFSPYGPYWRQVRKITTVELLSNYRLEKLKD  161

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPK-------VNMSRWFGHLTLNLIMQIVAGRRYE  1077
             V  SE++  +KELY     D N  SA K       V M RWFG LTLN++++ + G+   
Sbjct  162   VRESEVRAFLKELYKL--WDENRGSASKSKSNLVLVEMKRWFGDLTLNIVLRTIVGKTVG  219

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
             Y ++    E  +  KK      +    F   DA   L F R+LD  GH + MK+ AK++D
Sbjct  220   YITNVEDEESVEGWKKGLKDFFHWTRVFSVSDA---LPFLRFLDLGGHGEAMKKTAKELD  276

Query  896   AILQDWVDARRKERRSN---EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA  726
              +++DW+   +++R +      + F+DVML + D+          DT IKA  L+++  A
Sbjct  277   LVVEDWLKEHKRKRAAGIVKGKEDFMDVMLDVFDNDAEAVQGGDSDTTIKATSLALILAA  336

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             S+T A  L W L++L+ +P  LK+ Q E+DT++GKER  E+SDV+NL YL+ V+KETLR+
Sbjct  337   SDTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETLRL  396

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP  P   PHEA+EDC +DGYH+P+GT+L VNV ++HRD ++W +P +F PERF+T   G
Sbjct  397   YPAAPLSLPHEAIEDCTIDGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPERFLTTHRG  456

Query  365   EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII  186
                + + ++F PFG GRR CPG  +A  +  +A+A L  GF+F+T   EP+DM E  G+ 
Sbjct  457   FDVRGKNFEFSPFGSGRRMCPGVSFALHVMDLALATLLHGFDFATPSGEPVDMHESSGLT  516

Query  185   LPKLTPLEVLVTPRLSPTLF  126
               + TPLEVL++PRLS  L+
Sbjct  517   NLRATPLEVLLSPRLSSRLY  536



>ref|XP_002282085.3| PREDICTED: cytochrome P450 82A1-like [Vitis vinifera]
Length=1053

 Score =   457 bits (1176),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 232/526 (44%), Positives = 332/526 (63%), Gaps = 17/526 (3%)
 Frame = -1

Query  1682  VMDAVPCCLS-------SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSV  1524
              MD +  CL+       +IL ++  +LLW S   +S R+ PEA GAWPIIGHLH    S 
Sbjct  528   TMDFLLQCLNPVMVGAFAILVLSYHLLLWRSGAGKS-RMAPEASGAWPIIGHLHLLGGSK  586

Query  1523  PLVKTL-SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLG  1347
              L   L    ADKYGPVF+IRLG+ R +VVSSWE  ++CF T+D  LA+RP   A KYLG
Sbjct  587   NLPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKECFTTHDLALASRPELVAAKYLG  646

Query  1346  YDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNN  1167
             Y+YA+F FS + +YWR VRK+   E+LS+RRLE LK+V +SE++T +KELY   +   + 
Sbjct  647   YNYAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMKELYKLWAEKKSE  706

Query  1166  PSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVS  987
                  V+M +WFGHL+LN+I+++V G+RY   +  +  +EAQ+ +K   +   L G FV 
Sbjct  707   AGVVLVDMKQWFGHLSLNVILKMVVGKRYFGYAAESKEKEAQQCQKAIREFFRLLGLFVV  766

Query  986   GDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVML  816
              DA   L F  WLD  GHVK MK+ AK++D I Q+W++  R+ + S E   DQ F+DVML
Sbjct  767   SDA---LPFLGWLDVGGHVKAMKKTAKELDGIAQEWLEEHRRRKDSGEADGDQDFMDVML  823

Query  815   SMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEID  636
             S++      GY    DT+ KA  L ++   ++T +  LTW +++LL +P  L++ Q+E+D
Sbjct  824   SILGATDPNGYD--ADTINKATSLILIAGGTDTTSVTLTWAISLLLNNPHVLRKAQEELD  881

Query  635   TNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLY  456
             T++GKER   + D+  L YLQ +VKETLR+YP  P     + ++D ++ GYHIPKGT+L 
Sbjct  882   THVGKERLVNEMDISKLVYLQAIVKETLRLYPAAPLSGQRQFIQDSVLGGYHIPKGTRLL  941

Query  455   VNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQIT  276
             +N+ ++ RDP++W +P KF P RF+T  +    + + +   PFG GRR CPG  +A Q+ 
Sbjct  942   LNLTKIQRDPRVWLNPTKFQPSRFLTTYKDVDVKGKHFVLTPFGGGRRICPGAAFALQVL  1001

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
              + +A     F  ST  N P+DM E  GI   K TPLEVL++PRL+
Sbjct  1002  PLTLANFLHKFQLSTPSNSPIDMSESFGITNIKSTPLEVLISPRLA  1047


 Score =   456 bits (1173),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 227/511 (44%), Positives = 332/511 (65%), Gaps = 13/511 (3%)
 Frame = -1

Query  1652  SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTS---VPLVKTLSEWADKYG  1482
             + L ++  +LLW S R  +K++ PEA  AWPIIGHLH        +P + TL   ADKYG
Sbjct  17    ATLFLSYCLLLWRS-RAGNKKIAPEAAAAWPIIGHLHLLAGGSHQLPHI-TLGNMADKYG  74

Query  1481  PVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYW  1302
             PVFTIR+G+ R +VVSSWE  ++C   ND++ ++RP   A K LGY+YA+F FS   SYW
Sbjct  75    PVFTIRIGLHRAVVVSSWEMAKECSTANDQVSSSRPELLASKLLGYNYAMFGFSPYGSYW  134

Query  1301  RRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHL  1122
             R +RK++  E+LS+ RLE LK V  SE+ T+IKELY   +   N      V M +WFG L
Sbjct  135   REMRKIISLELLSNSRLELLKDVRASEVVTSIKELYKLWAEKKNESGLVSVEMKQWFGDL  194

Query  1121  TLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY  942
             TLN+I+++VAG+RY   SD + N++AQR ++VF +  +L G FV  DAI P  F  WLD+
Sbjct  195   TLNVILRMVAGKRYFSASDASENKQAQRCRRVFREFFHLSGLFVVADAI-P--FLGWLDW  251

Query  941   EGHVKTMKRAAKDVDAILQDWVDARRKERRSNED---QKFIDVMLSMIDDQFTQGYSYSR  771
               H KT+K+ A ++D+I Q+W++  R+ + S +D   Q F+DVM S++D +   GY    
Sbjct  252   GRHEKTLKKTAIEMDSIAQEWLEEHRRRKDSGDDNSTQDFMDVMQSVLDGKNLGGYD--A  309

Query  770   DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVK  591
             DT+ KA  L+++   S+T    LTW L+++L + ++LK+ Q+E+D  +GKER   + D+ 
Sbjct  310   DTINKATCLTLISGGSDTTVVSLTWALSLVLNNRDTLKKAQEELDIQVGKERLVNEQDIS  369

Query  590   NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPD  411
              L YLQ +VKETLR+YP GP     +  EDC + GYH+ KGT+L +N+ ++ +DP+IW D
Sbjct  370   KLVYLQAIVKETLRLYPPGPLGGLRQFTEDCTLGGYHVSKGTRLIMNLSKIQKDPRIWSD  429

Query  410   PEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST  231
             P +F PERF+T  +    + + ++F+PFG GRR+CPG  +  Q+  + +A     F FST
Sbjct  430   PTEFQPERFLTTHKDVDPRGKHFEFIPFGAGRRACPGITFGLQVLHLTLASFLHAFEFST  489

Query  230   VPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
               NE ++M E +G+   K TPLEVL++PRLS
Sbjct  490   PSNEQVNMRESLGLTNMKSTPLEVLISPRLS  520



>ref|XP_007047111.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91268.1| Cytochrome P450 [Theobroma cacao]
Length=529

 Score =   441 bits (1135),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 223/517 (43%), Positives = 330/517 (64%), Gaps = 17/517 (3%)
 Frame = -1

Query  1640  IAALVLLWFSWRKQS----KRL--PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP  1479
             +A L  ++F   K++    KR   PP+AGGA P+IGH+H         KTL   ADKYGP
Sbjct  16    VALLSCIYFYQSKKASTHGKRCCTPPQAGGALPVIGHMHLLGGQQLTHKTLGAMADKYGP  75

Query  1478  VFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWR  1299
             VF+IRLG  R+LV++SWE  ++CF  +DK+ + RP+  A K+LGYD+A+F F+   SYWR
Sbjct  76    VFSIRLGSHRVLVLNSWEMAKECFTVHDKVFSTRPSIAASKHLGYDFAMFGFAPYGSYWR  135

Query  1298  RVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLT  1119
              +RK+   E+LSS R++ LKH+  SE++T I+ELY       +  +   V+M +WFG LT
Sbjct  136   EMRKIATIELLSSHRIDMLKHIRASEVKTAIRELYKSWLSKGSAETEVFVDMKQWFGDLT  195

Query  1118  LNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYE  939
              N+ +++V GRRY   +      +A+R +KV    +YL+G FV  DAI P  F  WLD++
Sbjct  196   HNIALRMVGGRRYFGPNADCEEADARRCQKVMRDFVYLFGVFVLSDAI-P--FLGWLDFQ  252

Query  938   GHVKTMKRAAKDVDAILQDWVDARRKERRSN----EDQKFIDVMLSMIDDQFTQGYSYSR  771
             G+ K+MKR AK +D++++ W++  +++R S     E+Q F+DVML++++D    G  +  
Sbjct  253   GYEKSMKRTAKQLDSLVERWLEEHKQKRLSGGGVIEEQDFMDVMLNILEDGKITG--FDA  310

Query  770   DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVK  591
             DT+ KA  L+++   S+T    LTW L++LL +P  LKR QDE+D ++GK+R  E+SD+ 
Sbjct  311   DTINKATCLNLILAGSDTTMVTLTWALSLLLNNPRVLKRAQDELDMHVGKDRPLEESDIS  370

Query  590   NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVD-GYHIPKGTQLYVNVWRLHRDPKIWP  414
             NL YLQ +VKETLR+YP  P +    A+EDC +  GYHIP GT+L VN W++ RD ++WP
Sbjct  371   NLVYLQSIVKETLRLYPPSPIIGLRAALEDCTLSTGYHIPSGTRLMVNAWKIQRDERVWP  430

Query  413   DPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS  234
             DP  F PERF+T+ +    + + ++ +PFG GRRSCPG   A ++    + R    F+ +
Sbjct  431   DPHDFQPERFLTSHKDMDFRGQTFELIPFGSGRRSCPGTSLALKMVHFILGRFLHSFDVA  490

Query  233   TVPN-EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
                  E +DM E  G+   K TPLEVLVTPRL+  L+
Sbjct  491   KPSKLEDVDMTESAGLTNLKATPLEVLVTPRLNSQLY  527



>ref|XP_010061805.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW68805.1| hypothetical protein EUGRSUZ_F02404 [Eucalyptus grandis]
Length=533

 Score =   441 bits (1134),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 216/498 (43%), Positives = 317/498 (64%), Gaps = 24/498 (5%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             PEAGGAWP+IGHLH     VP    L+  ADKYGP+F +++GI R L+VS+W+  + C  
Sbjct  49    PEAGGAWPLIGHLHLLGGPVPPHIVLANMADKYGPIFIVKMGIHRALIVSNWQIAKQCLT  108

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
              ND++ A RP + + + + Y+YA+F  +   SYWR  RKL + E+LS+ RLE LKH+  S
Sbjct  109   VNDRVFATRPKSISSEIMAYNYAMFGLAPYGSYWRHARKLTMLELLSNHRLELLKHIRES  168

Query  1223  ELQTNIKELYT-FISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEE  1047
             E+Q +I  +Y   I   N+ P    V+M R FG +TLN+I +++ G+RYE       +E+
Sbjct  169   EVQASINHIYRRCIENYNDAPKKVLVDMKRRFGDITLNVIFRMIVGKRYE-------DEQ  221

Query  1046  AQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR  867
              ++ +    +   L G F+  DA   L   RW D +G+ K MK+ A+++D ++Q W++  
Sbjct  222   DEKGRDALREFFDLAGRFIVSDA---LPILRWFDLDGYEKMMKKTARELDRVVQGWLNEH  278

Query  866   RKERRSNE--------DQKFIDVMLSMID--DQFTQGYSYSRDTVIKAIVLSMLQDASET  717
             +  R SN+        DQ F+DVMLS++D  ++F     Y  DT IKA  + ++   S+T
Sbjct  279   KIRRNSNKRRGNDKNNDQDFMDVMLSIVDATEEFP---GYDADTFIKATCMGLVLAGSDT  335

Query  716   FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ  537
              +  LTW L++LL H E+LK+ Q E+DT IG+E+  ++SD+KNL Y+Q ++KETLR+YP 
Sbjct  336   TSVSLTWALSLLLNHREALKKAQHELDTQIGREKRVKESDLKNLVYIQAIIKETLRLYPA  395

Query  536   GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA  357
             GP   PHE++EDC VDGYH+PKGT+L  N W++HRDP IW DP KF PERF+T  +    
Sbjct  396   GPLGVPHESMEDCTVDGYHVPKGTRLLFNFWKIHRDPHIWSDPLKFRPERFLTTYKDVDI  455

Query  356   QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPK  177
             + + ++ +PFG GRR CPG   A Q+  +++A L  GF  +T+ NEP+ M E +G+   K
Sbjct  456   RGQNFELIPFGSGRRMCPGINLAMQLMSLSLAALLHGFEVTTLANEPVGMTEAIGLTNLK  515

Query  176   LTPLEVLVTPRLSPTLFR  123
              TPLEVLVTPRL    ++
Sbjct  516   ATPLEVLVTPRLQERAYK  533



>ref|XP_002268915.2| PREDICTED: cytochrome P450 82C2 [Vitis vinifera]
Length=744

 Score =   448 bits (1152),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 222/492 (45%), Positives = 315/492 (64%), Gaps = 10/492 (2%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             P AGGAWPIIGHLH F       KTL   ADKYGPVFTIRLG++ ILV+SS E  R+CF 
Sbjct  257   PRAGGAWPIIGHLHLFGAQQLTHKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECFT  316

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
             T+D++ + RP+  A K LGYD+A+F F+   SYWR +RK+V  E+LS+ RL+ LKH+  S
Sbjct  317   THDRVFSTRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIRAS  376

Query  1223  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEA  1044
             E+ T+I+ELY     +        V+M RWFG LTLNL +++V G+RY      T   E 
Sbjct  377   EVGTSIRELYEMWVSERGTDGRVFVDMKRWFGDLTLNLAVRLVGGKRYFGAGADTKEGEG  436

Query  1043  QRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARR  864
             +  +KV     +L+G FV  DAI P  F  WLD +G+ K MKR AK++D++   W+   +
Sbjct  437   RTCQKVIRDFAHLFGVFVLSDAI-P--FLSWLDLKGYKKAMKRTAKELDSLFGGWLQEHK  493

Query  863   KER----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTW  696
             ++R       +DQ F+DVML++++D    G+    DTV KA  L+++   S+T    LTW
Sbjct  494   EKRLLGGEGKDDQDFMDVMLTVLEDVNFSGFDA--DTVNKATCLNLILAGSDTTKVTLTW  551

Query  695   ILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPH  516
              L++LL HP  LK+ Q E+D  +GK+R  ++SDVKNL YLQ ++KETLR+YP  P +  H
Sbjct  552   ALSLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPIITLH  611

Query  515   EAVEDC-IVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQ  339
              A+EDC +  GY+I  GTQ+ VN W++HRD ++W +P++F PERFMT+ +    + + ++
Sbjct  612   AAMEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHKDTDVRGQHFE  671

Query  338   FVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEV  159
              +PFG GRRSCPG   A Q+   A+A L   +  +   +  +DM E +G+   K TPLEV
Sbjct  672   LIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKATPLEV  731

Query  158   LVTPRLSPTLFR  123
             L++PRL   L+R
Sbjct  732   LLSPRLKAELYR  743



>ref|XP_006464328.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=521

 Score =   441 bits (1133),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 216/496 (44%), Positives = 317/496 (64%), Gaps = 15/496 (3%)
 Frame = -1

Query  1604  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWE  1425
             K +    PEAGGAWP+IGHLH F    P  + L   A+KYGP+FT+++G++R LVVS+ E
Sbjct  37    KNAHSQAPEAGGAWPMIGHLHLFGGPEPTHRILGNMANKYGPIFTMKMGVNRALVVSNSE  96

Query  1424  AVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEK  1245
               ++CF TNDK LA+RP   A + LGY++     S   SYWR  RK+   E+LS+ RLEK
Sbjct  97    ITKECFTTNDKALASRPRRMAMEILGYNFLATPSSPYGSYWRETRKIATVELLSNHRLEK  156

Query  1244  LKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSD  1065
             LKHV  SE+  +IK L  F    N+      V M  W    T ++I++I+ G+RY  +  
Sbjct  157   LKHVRESEVTASIKGL--FKDCQNSATGKVSVEMKHWLEGTTFDIIIRIIEGKRYTSQEG  214

Query  1064  GTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQ  885
               ++E A       +    L+G+FV  DA   L F RWLD  G+ K MK+ AK+ D ILQ
Sbjct  215   TDLHEHA-------ASFFTLFGKFVVSDA---LPFLRWLDIGGNEKLMKKTAKEFDIILQ  264

Query  884   DWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
              W+D  + +R S+E   D+ FI VMLS++ D   Q      DTVIKA+ L+++  A++T 
Sbjct  265   QWLDEHKIKRGSSEVEGDEDFIYVMLSLLYDNAKQLPDSDADTVIKALCLTVILGAADTT  324

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
             +  LTW +++LL + ++LK+ QDE++ ++G  R   +SD+KNL YLQ ++KET+R+YP  
Sbjct  325   SVTLTWAISLLLNNRDALKKAQDELNIHVGANRQVNESDIKNLVYLQAILKETMRLYPAA  384

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P L PH+++EDC + GYH+P GTQL+VN W++H DPK+W +P KFLPERF+T  +    +
Sbjct  385   PLLLPHQSMEDCTISGYHVPAGTQLFVNAWKVHHDPKVWKEPCKFLPERFLTTHKDIDLR  444

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
              + ++ +PFG GRR CPG  +A Q+  + +A L  GF+ +T  +EP+DM E   + + + 
Sbjct  445   GQNFELIPFGSGRRICPGISFAFQVMPLILASLLHGFDLATPLDEPVDMEEAKSLTITRA  504

Query  173   TPLEVLVTPRLSPTLF  126
             TPL+VL+TPRLS +L+
Sbjct  505   TPLKVLLTPRLSASLY  520



>ref|NP_001236179.1| cytochrome P450 CYP82C1 [Glycine max]
 gb|AAB94590.1| CYP82C1p [Glycine max]
Length=532

 Score =   441 bits (1133),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 225/522 (43%), Positives = 324/522 (62%), Gaps = 16/522 (3%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD  1491
             +S IL +   VL++   R  S        P+AGGAWPIIGHLH F       KTL   A+
Sbjct  14    ISIILAMLVGVLIYGLKRTHSGHGKICSAPQAGGAWPIIGHLHLFGGHQHTHKTLGIMAE  73

Query  1490  KYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNN  1311
             K+GP+FTI+LG  ++LV+SSWE  ++CF  +DK  + RP   A K +GY+YA+F F+   
Sbjct  74    KHGPIFTIKLGSYKVLVLSSWEMAKECFTVHDKAFSTRPCVAASKLMGYNYAMFGFTPYG  133

Query  1310  SYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWF  1131
              YWR +RKL   ++LS+ RLE LK+   SE +  I+ELY   S +        V+M +WF
Sbjct  134   PYWREIRKLTTIQLLSNHRLELLKNTRTSESEVAIRELYKLWSREGCPKGGVLVDMKQWF  193

Query  1130  GHLTLNLIMQIVAGR-RYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR  954
             G LT N+++++V G+  Y+  SD     EA+R KKV  + + L+G FV  DAI P  F  
Sbjct  194   GDLTHNIVLRMVRGKPYYDGASDDYAEGEARRYKKVMGECVSLFGVFVLSDAI-P--FLG  250

Query  953   WLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQK-----FIDVMLSMIDDQFTQ  789
             WLD  G+ K MKR A ++D +++ W++  +++R  N D K     F+DVML+++ D    
Sbjct  251   WLDINGYEKAMKRTASELDPLVEGWLEEHKRKRAFNMDAKEEQDNFMDVMLNVLKDAEIS  310

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
             G  Y  DT+IKA  L+++   S+T    LTW+L++LL H   LK+VQDE+DT IGK+R  
Sbjct  311   G--YDSDTIIKATCLNLILAGSDTTMISLTWVLSLLLNHQMELKKVQDELDTYIGKDRKV  368

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVD-GYHIPKGTQLYVNVWRLHR  432
             E+SD+  L YLQ +VKET+R+YP  P +    A+EDC    GYHIP GT+L VN W++HR
Sbjct  369   EESDITKLVYLQAIVKETMRLYPPSPLITLRAAMEDCTFSGGYHIPAGTRLMVNAWKIHR  428

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             D ++W DP  F P RF+T+ +    + + Y+ VPFG GRR+CPG   A ++  + +ARL 
Sbjct  429   DGRVWSDPHDFKPGRFLTSHKDVDVKGQNYELVPFGSGRRACPGASLALRVVHLTMARLL  488

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
               FN ++  N+ +DM E +G+   K TPLE+L+TPRL   L+
Sbjct  489   HSFNVASPSNQVVDMTESIGLTNLKATPLEILLTPRLDTKLY  530



>ref|XP_006340061.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=511

 Score =   439 bits (1130),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/490 (44%), Positives = 311/490 (63%), Gaps = 20/490 (4%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCF-  1407
             P+A GAWP IGHLH     +P+ +TL   ADKYGP+F ++LG    +VVS+WE V+DCF 
Sbjct  37    PKAPGAWPFIGHLHLLNGHLPVCRTLGLMADKYGPIFQLQLGDHPAIVVSNWEIVKDCFT  96

Query  1406  ATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWV  1227
             A NDK+ ++RP     KYLGY+ AVF  +    YWR +RK+V  E+L+  RLEKLKHV  
Sbjct  97    ANNDKIFSSRPNMAVSKYLGYNGAVFAMAPYGPYWRDIRKMVTVELLTHSRLEKLKHVRT  156

Query  1226  SELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEE  1047
             SE+   IKELY+      N PS  +VN+S WF ++T N+I++++AG+R+      T   E
Sbjct  157   SEVNCCIKELYS------NCPS--QVNLSSWFENITCNIIVRMLAGKRF------TGCAE  202

Query  1046  AQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR  867
                 K+   + +YL G FV  DAI P  +  W+D  GH+K MK   K+VD++   W+   
Sbjct  203   EMNFKESIKKALYLGGAFVFSDAI-P--WLEWMDIGGHIKAMKETYKEVDSVFDSWLKQH  259

Query  866   RKERRSNEDQKFIDVMLSMIDDQFT-QGYSYSRDTVIKAIVLSMLQDASETFATHLTWIL  690
                    E   FID+MLS + ++   +  +Y+R  +IKA  L ++  ASE+ A  L W L
Sbjct  260   INSIGDGEQSDFIDIMLSTLPEETNMESAAYNRHAIIKATTLILIMTASESTAETLIWAL  319

Query  689   AVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEA  510
             ++L+ +  SLK  Q+E+D  IG+ +W E+SD+KNLPYLQ +VKETLR+YP GP   P EA
Sbjct  320   SLLMNNTHSLKLAQNELDEQIGRNKWVEESDIKNLPYLQAIVKETLRLYPPGPLAGPREA  379

Query  509   VEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER-FMTNLEGEAAQNRQYQFV  333
             +EDC +  YHI KGT+L VN+W+L RD +IW DP +F PER F+        + + ++++
Sbjct  380   IEDCYIGKYHIKKGTRLIVNLWKLQRDSRIWEDPNEFKPERWFLNEHTNINFRGQHFEYI  439

Query  332   PFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLV  153
             PF  GRR CPG  +ATQ+  + +A+L  GFN S    EP+D+ E +GI LPK+ PL+ L+
Sbjct  440   PFSSGRRMCPGLTFATQVVHLTLAKLLHGFNISMPKEEPVDVSEGLGIALPKVKPLQPLL  499

Query  152   TPRLSPTLFR  123
             +PRL+  L++
Sbjct  500   SPRLAVELYQ  509



>ref|XP_011030916.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   440 bits (1131),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 215/498 (43%), Positives = 313/498 (63%), Gaps = 11/498 (2%)
 Frame = -1

Query  1595  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             K+  P+AGGAWP+IGHLH    + P  K L   A+KYGP+FTI++G+ R LVVS WE  +
Sbjct  42    KKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSRWETAK  101

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +CF T+DK  + RP T A + L YD A+  FS    YWR+VRK+   E+LS+ RLEKLK 
Sbjct  102   ECFTTHDKAFSGRPKTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKD  161

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPKVNM-----SRWFGHLTLNLIMQIVAGRRYEYR  1071
             +  SE++T +KELY     +    S  K NM      RWFG LTLN++++ + G+   Y 
Sbjct  162   IRESEVRTFLKELYKLWDKNRGGASKSKSNMVLVEMKRWFGDLTLNIVLRTIVGKTVGYI  221

Query  1070  SDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAI  891
             ++    E A+  KK      +    F   DA   L F R LD  GHV+ MK+ AK++D +
Sbjct  222   TNVEDEESAKGWKKGLKDFFHWTAVFSVSDA---LPFLRLLDLGGHVEAMKKTAKELDLV  278

Query  890   LQDWVDARRKERRSN---EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASE  720
             ++DW++  +++R +      + F+D+ML + D+          DT+ KA  L+++  AS+
Sbjct  279   VEDWLEEHKRKRAAGIVKGKEDFMDLMLDVFDNDAEAVQGGDSDTINKATSLALILAASD  338

Query  719   TFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYP  540
             T A  L W L++L+ +P  LK+ Q E+DT++GKER  E+SDV+NL +L+ V++ETLR+YP
Sbjct  339   TTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVFLKAVIRETLRLYP  398

Query  539   QGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA  360
               P L PHEA EDC +DGYH+P+GT+L V+V ++HRD ++W +P +F PERF+T   G  
Sbjct  399   AAPLLLPHEATEDCTIDGYHVPRGTRLLVDVSKIHRDERVWSNPNEFDPERFLTTHRGFD  458

Query  359   AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILP  180
             A+ + ++F PFG GRR CPG  +A     +A+A L  GF+F+T   EP+DM E  G+   
Sbjct  459   ARGKNFEFFPFGSGRRMCPGVSFALHAMDLALATLLHGFDFATPSGEPVDMHESSGLTNL  518

Query  179   KLTPLEVLVTPRLSPTLF  126
             + TPLEVL+ PRL   L+
Sbjct  519   RATPLEVLLCPRLPSGLY  536



>emb|CAN64371.1| hypothetical protein VITISV_016844 [Vitis vinifera]
Length=527

 Score =   439 bits (1129),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 225/500 (45%), Positives = 313/500 (63%), Gaps = 17/500 (3%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW  1428
             +K  KR PPE  G WP+IGHLH       L +TL + ADKYGP+F +RLG+ + LVVSSW
Sbjct  34    KKXGKR-PPEPSGRWPLIGHLHLLGADKLLHRTLGDMADKYGPIFCVRLGLKKTLVVSSW  92

Query  1427  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE  1248
             E  ++C+ T+DK+ A RP + A K +GYD+  F F+    YWR VRKL + E+LS+R+LE
Sbjct  93    EVAKECYTTSDKVFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELLSNRQLE  152

Query  1247  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
               KHV  SE++  IKELY   + + + P+   V M   FG+L LN++++ +AG+RY    
Sbjct  153   MHKHVQDSEVKILIKELYGQWASNKDGPAL--VEMKERFGNLALNVVVRAIAGKRY--FG  208

Query  1067  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGHVKTMKRAAKDVDAI  891
                  +E +R KK F   + L G F+  D I    F  WLD  +G    MKR AK+VD +
Sbjct  209   THACGDEPKRXKKAFEDFIILLGLFMVSDVI---PFLGWLDTMKGFTAEMKRVAKEVDYV  265

Query  890   LQDWVDARRKERRSNED----QKFIDVMLSMIDD-QFTQGYSYSRDTVIKAIVLSMLQDA  726
             L  WV+  R+ R S  D    Q FI  MLS+IDD QF+       DT+IK    +++   
Sbjct  266   LGSWVEEHRQNRLSANDNGAEQDFIHAMLSVIDDGQFS---GRDPDTIIKGTCSNLILAG  322

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             ++T +  LTW L++LL +  +LK+ Q E++ ++GK R  + SD+KNL YLQ +VKETLR+
Sbjct  323   NDTTSITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRL  382

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP GP   PHEA+EDC V G+HI  GT+L VN+W+LHRDP++W DP +F PERF+T   G
Sbjct  383   YPPGPLSLPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAG  442

Query  365   EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII  186
                + + Y+ +PFG GRR CPG  +A ++T + +ARL  GF    V + P+DM E  G+ 
Sbjct  443   LDVRGKNYELLPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLT  502

Query  185   LPKLTPLEVLVTPRLSPTLF  126
              PK TPLEV + PRL   L+
Sbjct  503   APKATPLEVTIVPRLPFELY  522



>ref|XP_004154826.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 82C4-like [Cucumis 
sativus]
Length=532

 Score =   439 bits (1129),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 224/498 (45%), Positives = 310/498 (62%), Gaps = 10/498 (2%)
 Frame = -1

Query  1595  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             KRLPPE GGA P+IGHLH    + P   T ++ AD YGP+FT+RLG+   L+VS+WE  R
Sbjct  39    KRLPPEVGGALPLIGHLHLLDKNEPAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEIAR  98

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +CF TNDK+ A+RP   A K LGYDYA+   S    +WR VRKL + E+L+S RL+KL+H
Sbjct  99    ECFTTNDKIFASRPKLVASKLLGYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKLQH  158

Query  1235  VWVSELQTNIKELYTF-ISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGT  1059
             + VSE+QT+IK LY   +    NN     V M  WFG +TLN I +IV G+++    D +
Sbjct  159   IRVSEVQTSIKNLYELCLKNKKNNEKNALVEMKTWFGDITLNTISRIVVGKQFSTAVDVS  218

Query  1058  INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW  879
                E +  +K        +G FV  D+ FP  F +WLD  GH K MK+ A+ +D +   W
Sbjct  219   NTNENEEYRKALRDFSNXFGVFVPSDS-FP--FLKWLDLGGHEKAMKKTAQVLDEVFDKW  275

Query  878   VDARRKERRS-----NEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
             +   ++++ +      E+  F+DVMLS + D   Q   Y    V KA  L+++   S+T 
Sbjct  276   IQEHQQKKNNLGAVKMEEHDFMDVMLSNVRDD-GQLSKYDAHIVTKATCLALILAGSDTT  334

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
                + W L++LL + E LKR Q E+D ++G++R  ++SDVKNL YLQ VVKETLR+YP  
Sbjct  335   TVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQAVVKETLRLYPAA  394

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P L PHE++EDC+V GYHIP GT+L VNV +L RDP+IW DP +F PERF+T+ +    +
Sbjct  395   PILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFRPERFLTSEKDFDVR  454

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
              +  Q +PFG GRR CPG  +A Q+  +A+A L  GF  S    E LDM E  G+   + 
Sbjct  455   GQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELLDMEESAGMTSIRK  514

Query  173   TPLEVLVTPRLSPTLFRL  120
              PLEV++TPRL P ++ L
Sbjct  515   NPLEVVLTPRLPPQVYEL  532



>ref|XP_006423130.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
 ref|XP_006479372.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Citrus sinensis]
 ref|XP_006479373.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
 ref|XP_006479374.1| PREDICTED: cytochrome P450 82C4-like isoform X3 [Citrus sinensis]
 gb|ESR36370.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
Length=524

 Score =   439 bits (1128),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 225/495 (45%), Positives = 316/495 (64%), Gaps = 16/495 (3%)
 Frame = -1

Query  1604  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSW  1428
             K+  R PPEA GAWP +GHLH    S  L+ +TL E ADKYG  F I LGI R LV+SSW
Sbjct  34    KKGGRKPPEAAGAWPCVGHLHLLAGSNQLIHQTLGEMADKYGKAFLIHLGIHRALVISSW  93

Query  1427  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE  1248
             E  ++CF TNDKL + RP + A K +GYD+A+  F+   SYWR VRKL   ++LS+ RLE
Sbjct  94    EVTKECFTTNDKLFSTRPKSLAVKLMGYDHAMIGFAPYGSYWREVRKLSTVQLLSNHRLE  153

Query  1247  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
              LKHV  +E++  IKEL+   +    N     V M   F  L +N+I++++AG+RY YRS
Sbjct  154   LLKHVRDTEVKVFIKELHEQCA---KNGGHVAVEMKERFKDLAMNIIVRMIAGKRY-YRS  209

Query  1067  DGTIN-EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGHVKTMKRAAKDVDA  894
             +   + +E++R +K     +YL G F++ D I    F  WLD  +G+   MKR AK++D 
Sbjct  210   ETNADDQESKRFQKALGDFLYLLGLFLASDNI---PFLGWLDIVKGYTGQMKRTAKELDD  266

Query  893   ILQDWVDARRKERRS---NEDQK-FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA  726
             +    V   R +R +   N+D++ FIDVMLS++DD  T       DTVIKA  LS++   
Sbjct  267   VFGRLVQEHRHKRLNGSINKDEEDFIDVMLSVMDDGKTS--PEDADTVIKATCLSLISGG  324

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             ++T  T +TW L++LL +   LK+ QDE+D ++GK R  E+SD+KNL YLQ +VKETLR+
Sbjct  325   NDTTVTTITWALSLLLNNRHVLKKAQDELDIHVGKNRQVEESDIKNLIYLQAIVKETLRL  384

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
              P  P  AP EA+EDC +DG+HIP GT+L VN+W++HRDP IW +P +F+P+RF+     
Sbjct  385   CPPLPLSAPREAMEDCTIDGFHIPAGTRLIVNLWKMHRDPSIWANPSEFIPDRFLNENAK  444

Query  365   EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII  186
                  + ++F+PFG GRR CPG  +A Q+  + +ARL   F+  TV +  +DM    GI 
Sbjct  445   LDVNGQDFEFLPFGSGRRKCPGISFALQVQHLTLARLLHAFSLGTVSDTLVDMSGSPGIT  504

Query  185   LPKLTPLEVLVTPRL  141
             +PK TPLEV +TPR+
Sbjct  505   VPKATPLEVTLTPRV  519



>emb|CBI40977.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   439 bits (1129),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 219/492 (45%), Positives = 310/492 (63%), Gaps = 24/492 (5%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             P AGGAWPIIGHLH F       KTL   ADKYGPVFTIRLG++ ILV+SS E  R+CF 
Sbjct  70    PRAGGAWPIIGHLHLFGAQQLTHKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECFT  129

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
             T+D++ + RP+  A K LGYD+A+F F+   SYWR +RK+V  E+LS+ RL+ LKH+  S
Sbjct  130   THDRVFSTRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIRAS  189

Query  1223  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEA  1044
             E+ T+I+ELY     +        V+M RWFG LTLNL +++V G+RY            
Sbjct  190   EVGTSIRELYEMWVSERGTDGRVFVDMKRWFGDLTLNLAVRLVGGKRY------------  237

Query  1043  QRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARR  864
                  V     +L+G FV  DAI P  F  WLD +G+ K MKR AK++D++   W+   +
Sbjct  238   --FGAVIRDFAHLFGVFVLSDAI-P--FLSWLDLKGYKKAMKRTAKELDSLFGGWLQEHK  292

Query  863   KER----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTW  696
             ++R       +DQ F+DVML++++D    G  +  DTV KA  L+++   S+T    LTW
Sbjct  293   EKRLLGGEGKDDQDFMDVMLTVLEDVNFSG--FDADTVNKATCLNLILAGSDTTKVTLTW  350

Query  695   ILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPH  516
              L++LL HP  LK+ Q E+D  +GK+R  ++SDVKNL YLQ ++KETLR+YP  P +  H
Sbjct  351   ALSLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPIITLH  410

Query  515   EAVEDC-IVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQ  339
              A+EDC +  GY+I  GTQ+ VN W++HRD ++W +P++F PERFMT+ +    + + ++
Sbjct  411   AAMEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHKDTDVRGQHFE  470

Query  338   FVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEV  159
              +PFG GRRSCPG   A Q+   A+A L   +  +   +  +DM E +G+   K TPLEV
Sbjct  471   LIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKATPLEV  530

Query  158   LVTPRLSPTLFR  123
             L++PRL   L+R
Sbjct  531   LLSPRLKAELYR  542



>ref|XP_010647827.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=516

 Score =   438 bits (1126),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 227/519 (44%), Positives = 319/519 (61%), Gaps = 22/519 (4%)
 Frame = -1

Query  1652  SILGIA-ALVLLWFSWRKQSK---RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1485
             ++ GI  A++ LW    K +K   R PPE  GAWP++GHLH      PL +T    AD+Y
Sbjct  11    TVFGILFAIICLWLVNAKGNKNKGRSPPEPSGAWPVMGHLHLLGADKPLHRTFGAMADEY  70

Query  1484  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY  1305
             GP+F+IR+G+   LVVSS E  ++C+ T DK LA RP + A K +GYD+A+F F  +  Y
Sbjct  71    GPIFSIRVGLRTALVVSSSEVAKECYTTKDKALATRPRSLAVKLMGYDHAMFAFERHGPY  130

Query  1304  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH  1125
             WR VR+L +  +LS+R+ E LKHV  SE++  I+ELY       N  S   V+M + F H
Sbjct  131   WRDVRRLAMVNLLSNRQHEMLKHVRDSEVKFFIQELYG--QWVENGGSPVLVDMKKKFEH  188

Query  1124  LTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD  945
             L  NL M+ VAG+R E       N E+ R  +     M L G+F+  DA   L F  WLD
Sbjct  189   LVANLTMRTVAGKRCE-------NGES-RWCQSLGDFMNLMGQFMVSDA---LPFLGWLD  237

Query  944   -YEGHVKTMKRAAKDVDAILQDWVDARRKERRS----NEDQKFIDVMLSMIDDQFTQGYS  780
                G+   MK  A+ +D ++  WV+  R++R S    + +Q FI  MLS+IDD    G+ 
Sbjct  238   TVRGYTAKMKGTARQLDRVIGRWVEEHRQKRLSGSINDAEQDFIHAMLSVIDDAQLSGHD  297

Query  779   YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS  600
             +  DTVIKA  L+++   ++T A  LTW L++L+ +P +LK+ Q+E+D ++G+ +   +S
Sbjct  298   HDHDTVIKATCLTVMLAGNDTIAVTLTWALSLLMNNPRALKKAQEELDFHVGRNQQVYES  357

Query  599   DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI  420
             D+K L YLQ ++KETLR+YP GP   PHEA+EDC + G+HI  GT+L VN+W+LHRDP I
Sbjct  358   DIKKLVYLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQAGTRLLVNLWKLHRDPTI  417

Query  419   WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN  240
             W DP +F PERF+T   G     + ++ +PFG GRR CPG   A +I Q+ +ARL  GF 
Sbjct  418   WSDPLEFQPERFLTKHVGLDVGGQHFELLPFGSGRRMCPGISLALEILQLTLARLLHGFE  477

Query  239   FSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
                V + PLDM E VG+ +PK TPLEV + PRL   L+ 
Sbjct  478   LGVVSDSPLDMTEGVGLAMPKATPLEVTLVPRLPSELYH  516



>ref|XP_006464300.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   438 bits (1127),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 219/498 (44%), Positives = 312/498 (63%), Gaps = 16/498 (3%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW  1428
             + Q+    P A GAWP+IGHLH F    P  + L + ADKYGP+FT+++G++R LVVS+W
Sbjct  36    KTQAPHQAPVAAGAWPLIGHLHLFGGQEPTHRLLGDVADKYGPIFTMKMGLNRALVVSNW  95

Query  1427  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE  1248
             E  ++CF  NDK  A RP + A   LGY++     S   +YWR  RK+   E+LS+ +L+
Sbjct  96    EIAKECFTINDKPFANRPRSMAMDLLGYNFLAIAASPYGNYWRESRKMATIELLSNNQLQ  155

Query  1247  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
             KLKHV  SE++ +IK L  F +   ++     V M  W   + L++IM+I+AG+RY  + 
Sbjct  156   KLKHVRESEVKASIKGL--FENCKRSSSHKVSVEMKHWIEGIVLDIIMRIIAGKRYTSQD  213

Query  1067  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL  888
                  E A       +    L G+FV  DA   L F RWLD  G+ K MK+ AK+ D + 
Sbjct  214   SSDFQEHA-------TNFFDLCGKFVVSDA---LPFLRWLDIGGYEKLMKKTAKEFDLVF  263

Query  887   QDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQ-GYSYSRDTVIKAIVLSMLQDASE  720
             Q W+D  + +R S+E   D+ F+ VMLS+ DD+  Q       DTVIKAI LS++  AS+
Sbjct  264   QGWLDEHKSKRGSSEVKGDEDFMYVMLSLFDDKAKQLPDGDDTDTVIKAICLSLILAASD  323

Query  719   TFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYP  540
             T A  LTW +A+LL + + LK+ Q+E+D  +G  R   +SD+KNL YLQ ++KETLR+YP
Sbjct  324   TTAVTLTWAIALLLNNRDVLKKAQNELDAQVGTNRQVNESDMKNLAYLQVILKETLRLYP  383

Query  539   QGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA  360
              GP L PHE++EDC + GYH+P GTQL VN W++ RDP +W +P KFLPERF+   +   
Sbjct  384   AGPLLVPHESIEDCTIRGYHVPAGTQLIVNAWKVQRDPGVWEEPCKFLPERFLKKYKDVD  443

Query  359   AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILP  180
              + + ++F+PFG GRR CPG  +A Q+  + +A L  GF+F+T  + P+DM E   +   
Sbjct  444   LKGQNFEFIPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYA  503

Query  179   KLTPLEVLVTPRLSPTLF  126
             K TPLEVL+TPRLS +L+
Sbjct  504   KATPLEVLLTPRLSASLY  521



>emb|CDP00859.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   438 bits (1127),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 229/524 (44%), Positives = 331/524 (63%), Gaps = 27/524 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFSWRKQS------KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEW  1497
             L +I  + AL L +  W+ +S      ++ PPE  GAWP+IGHL      + + +TL+  
Sbjct  7     LVAIPVVLALFLSYIQWKPRSQISDEKRKSPPEPEGAWPVIGHLLQMNPKIHVAETLAAM  66

Query  1496  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST  1317
             ADK GPVF+IRLG+  +LVV++WE+V++CF TNDK  A+RP +   KYL YDYA F  + 
Sbjct  67    ADKNGPVFSIRLGMLPVLVVNNWESVKECFTTNDKTFASRPPSSFAKYLCYDYAAFGIAP  126

Query  1316  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDN---NNPSAP-KV  1149
                YWR VRK+V+ E+LS++RLEKLK V +SE+QT+IKE++  IS  N   N   AP +V
Sbjct  127   YGPYWRDVRKMVLRELLSTQRLEKLKQVRISEVQTSIKEIFLNISEVNKHGNEIKAPARV  186

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFP  969
             ++   F  LTLN++++ +AG RY     G   E     ++V  +        V  D I P
Sbjct  187   DLGDVFEKLTLNIVLRKIAGGRYTDSDVG--KERDAEFRRVLKEFEAFARILVVSD-IIP  243

Query  968   LWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSN-----EDQKFIDVMLSMID  804
               F +WLD +G++K+MKR AK++D  +Q WVD  ++ R  N     ++  FIDV+LS I 
Sbjct  244   FRFLKWLDPQGNIKSMKRLAKELDKYMQIWVDEHKEGRMKNSGDGDDELDFIDVLLSTIK  303

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
             D+   G+S  ++ VIK+ +L ++   + T +  L+W++++LL H   L++ Q+EID+ +G
Sbjct  304   DESICGFS--KEVVIKSTILVLIVAGTSTTSRALSWVISLLLNHRHVLQKAQEEIDSFVG  361

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             KERW E+SD+KNL YLQ +VKET+R++P  P   P +A EDC V GY IPKGTQLYVNVW
Sbjct  362   KERWVEESDIKNLVYLQAIVKETMRLHPPAPVPMPRQADEDCNVAGYFIPKGTQLYVNVW  421

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAA---QNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             ++ RDP+IWP+PEKF PERF++     A     ++ ++  PFG GRR CPG  +A Q+  
Sbjct  422   KIQRDPRIWPEPEKFFPERFLSGDHAGAQLDFSSQNFELNPFGNGRRICPGMSFALQVMH  481

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
             + +ARL Q F+ S V + P+D     G    K  PLE L+ PRL
Sbjct  482   LTLARLLQAFDISRVSDLPVDTAGYEG----KAPPLEALMMPRL  521



>ref|XP_004147803.1| PREDICTED: cytochrome P450 82C4-like [Cucumis sativus]
Length=532

 Score =   438 bits (1127),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 224/498 (45%), Positives = 310/498 (62%), Gaps = 10/498 (2%)
 Frame = -1

Query  1595  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             KRLPPE GGA P+IGHLH    + P   T ++ AD YGP+FT+RLG+   L+VS+WE  R
Sbjct  39    KRLPPEVGGALPLIGHLHLLDKNEPAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEIAR  98

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +CF TNDK+ A+RP   A K LGYDYA+   S    +WR VRKL + E+L+S RL+KL+H
Sbjct  99    ECFTTNDKIFASRPKLVASKLLGYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKLQH  158

Query  1235  VWVSELQTNIKELYTF-ISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGT  1059
             + VSE+QT+IK LY   +    NN     V M  WFG +TLN I +IV G+++    D +
Sbjct  159   IRVSEVQTSIKNLYELCLKNKKNNEKNALVEMKTWFGDITLNTISRIVVGKQFSTAVDVS  218

Query  1058  INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW  879
                E +  +K        +G FV  D+ FP  F +WLD  GH K MK+ A+ +D +   W
Sbjct  219   NTNENEEYRKALRDFFEWFGVFVPSDS-FP--FLKWLDLGGHEKAMKKTAQVLDEVFDKW  275

Query  878   VDARRKERRS-----NEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
             +   ++++ +      E+  F+DVMLS + D   Q   Y    V KA  L+++   S+T 
Sbjct  276   IQEHQQKKNNLGAVKMEEHDFMDVMLSNVRDD-GQLSKYDAHIVTKATCLALILAGSDTT  334

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
                + W L++LL + E LKR Q E+D ++G++R  ++SDVKNL YLQ VVKETLR+YP  
Sbjct  335   TVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQAVVKETLRLYPAA  394

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P L PHE++EDC+V GYHIP GT+L VNV +L RDP+IW DP +F PERF+T+ +    +
Sbjct  395   PILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFHPERFLTSEKDFDVR  454

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
              +  Q +PFG GRR CPG  +A Q+  +A+A L  GF  S    E LDM E  G+   + 
Sbjct  455   GQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELLDMEESAGMTSIRK  514

Query  173   TPLEVLVTPRLSPTLFRL  120
              PLEV++TPRL P ++ L
Sbjct  515   NPLEVVLTPRLPPQVYEL  532



>ref|XP_009780811.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana sylvestris]
Length=708

 Score =   444 bits (1142),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 222/506 (44%), Positives = 313/506 (62%), Gaps = 16/506 (3%)
 Frame = -1

Query  1613  SWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVS  1434
             S  K S    P+A GAWP IGHLH     VP  +TL   ADKYGP+F ++LG    LVVS
Sbjct  208   STAKNSSIGAPKAPGAWPFIGHLHLLSDPVPACRTLGLMADKYGPIFQLQLGTHPALVVS  267

Query  1433  SWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRR  1254
             SWE V+DCF TNDK+ A+RP     KY  Y+ AVF  +    YWR +RK+V  E+ ++ R
Sbjct  268   SWEMVKDCFTTNDKIFASRPKMTLSKYF-YNDAVFALAPYGPYWREIRKMVTLELFTNSR  326

Query  1253  LEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEY  1074
             LEKLKHV  SE+   IKELY+F + +NN P+  +VN+S WF H+T N+I++++AG+R+  
Sbjct  327   LEKLKHVRASEVDCCIKELYSFCNNNNNFPT--QVNLSSWFEHITCNIIIRMLAGKRFSS  384

Query  1073  RSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDA  894
               +     +  + K+   + ++L G FV  D I  L    W+D  GH+K MK+   +VD+
Sbjct  385   SVNEQSGTKEMQFKESIKKALFLGGTFVVSDVIPSL---EWMDIGGHIKAMKQTFNEVDS  441

Query  893   ILQDWVDARRKERRSNEDQK--------FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSM  738
             +   W+    ++R+  E+          FIDVMLS + ++ T    Y RD +IKA  L +
Sbjct  442   VFDIWLKEHIQKRKDCENSNTGDDHQSDFIDVMLSTLPEE-TMVSGYDRDAIIKATTLIL  500

Query  737   LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE  558
             +  ASE+ A  L W L++L+     LK  QDE+D ++G+ RW E+SD+KNL YLQ +VKE
Sbjct  501   IMTASESTAETLIWTLSLLMNDRRILKIAQDELDEHVGRNRWVEESDMKNLKYLQAIVKE  560

Query  557   TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER-FM  381
             TLR+YP GP   P EA+EDC V  YHI KGT+L VN+W+L RD  IW +P +F PER F+
Sbjct  561   TLRLYPPGPLAGPREAIEDCYVGKYHIRKGTRLIVNLWKLQRDSSIWENPNEFQPERWFL  620

Query  380   TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMME  201
                     + + ++++PF  GRR CPG  + TQ+  + +ARL  GFN S    EP+D+ E
Sbjct  621   KEHMNINFRGQSFEYIPFSSGRRMCPGLTFGTQVVHLTLARLLHGFNISMPREEPVDLSE  680

Query  200   DVGIILPKLTPLEVLVTPRLSPTLFR  123
              +GI LPK+ PL+ L+TPRL   L++
Sbjct  681   GLGIALPKMKPLQPLLTPRLPMELYQ  706



>gb|KGN59914.1| hypothetical protein Csa_3G852630 [Cucumis sativus]
Length=538

 Score =   438 bits (1127),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 224/498 (45%), Positives = 310/498 (62%), Gaps = 10/498 (2%)
 Frame = -1

Query  1595  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             KRLPPE GGA P+IGHLH    + P   T ++ AD YGP+FT+RLG+   L+VS+WE  R
Sbjct  45    KRLPPEVGGALPLIGHLHLLDKNEPAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEIAR  104

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +CF TNDK+ A+RP   A K LGYDYA+   S    +WR VRKL + E+L+S RL+KL+H
Sbjct  105   ECFTTNDKIFASRPKLVASKLLGYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKLQH  164

Query  1235  VWVSELQTNIKELYTF-ISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGT  1059
             + VSE+QT+IK LY   +    NN     V M  WFG +TLN I +IV G+++    D +
Sbjct  165   IRVSEVQTSIKNLYELCLKNKKNNEKNALVEMKTWFGDITLNTISRIVVGKQFSTAVDVS  224

Query  1058  INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW  879
                E +  +K        +G FV  D+ FP  F +WLD  GH K MK+ A+ +D +   W
Sbjct  225   NTNENEEYRKALRDFFEWFGVFVPSDS-FP--FLKWLDLGGHEKAMKKTAQVLDEVFDKW  281

Query  878   VDARRKERRS-----NEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
             +   ++++ +      E+  F+DVMLS + D   Q   Y    V KA  L+++   S+T 
Sbjct  282   IQEHQQKKNNLGAVKMEEHDFMDVMLSNVRDD-GQLSKYDAHIVTKATCLALILAGSDTT  340

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
                + W L++LL + E LKR Q E+D ++G++R  ++SDVKNL YLQ VVKETLR+YP  
Sbjct  341   TVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQAVVKETLRLYPAA  400

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P L PHE++EDC+V GYHIP GT+L VNV +L RDP+IW DP +F PERF+T+ +    +
Sbjct  401   PILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFHPERFLTSEKDFDVR  460

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
              +  Q +PFG GRR CPG  +A Q+  +A+A L  GF  S    E LDM E  G+   + 
Sbjct  461   GQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELLDMEESAGMTSIRK  520

Query  173   TPLEVLVTPRLSPTLFRL  120
              PLEV++TPRL P ++ L
Sbjct  521   NPLEVVLTPRLPPQVYEL  538



>dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=511

 Score =   437 bits (1123),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 214/510 (42%), Positives = 316/510 (62%), Gaps = 11/510 (2%)
 Frame = -1

Query  1631  LVLLW---FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRL  1461
              ++LW    S +  + +  PEA GAWPIIGHLH    S    KTL   ADKYGP+F IR+
Sbjct  7     FLILWRTRSSSKTNTCKEAPEAPGAWPIIGHLHLLGGSELRHKTLGAMADKYGPIFKIRI  66

Query  1460  GISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLV  1281
             G++  LVVS+ +  ++CF TNDK  A+RPT+ A K LGYDY +F  +    YW  +RK+ 
Sbjct  67    GVNHALVVSNSDIAKECFTTNDKAFASRPTSTASKILGYDYVMFGMAPYGQYWVELRKIT  126

Query  1280  VEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQ  1101
             + E+LS+RRLE LKHV  SE+  +I++LY      +       V+M +WFG LTLN+I++
Sbjct  127   MSELLSNRRLELLKHVRDSEIDASIQDLYKVWKNHDKAKGPVLVDMKQWFGDLTLNVILR  186

Query  1100  IVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTM  921
             ++AG+RY          EA+  +K       L G F+  DA   L +  W D +G+ K M
Sbjct  187   MIAGKRYSGSMSSCDETEARTCQKGMRDFFRLLGLFIIEDA---LPYLSWFDLQGYKKEM  243

Query  920   KRAAKDVDAILQDWVDARRKERRS---NEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAI  750
             K  AK++D++ Q W++   + R++   N +Q F+DV++S+++D  T+   Y  DT+IK+ 
Sbjct  244   KNTAKELDSVFQRWLEEHNRMRQTGELNREQDFMDVLMSILED--TRISEYDNDTIIKST  301

Query  749   VLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQG  570
              LS++    +T    LTWIL++LL +  +LK+ QDE+D+++GK+R  E+SD+KNL YLQ 
Sbjct  302   CLSIVTGGGDTTMVTLTWILSLLLNNKHALKKAQDELDSHVGKDRQVEESDIKNLVYLQA  361

Query  569   VVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPE  390
             + KE LR+YP GP   P  A  DC V GYH+P GT+L VN +++ RDP +W +P +F PE
Sbjct  362   ITKEALRLYPAGPLSGPRVADADCTVAGYHVPAGTRLIVNTYKIQRDPLVWSEPSEFRPE  421

Query  389   RFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD  210
             RF+T+      +   Y+ +PFG GRRSCPG  +  Q+  + +AR    F+  T  + P+D
Sbjct  422   RFLTSHVNMDVKGLHYELIPFGAGRRSCPGMSFTLQVVPLVLARFLHEFDSKTEMDMPVD  481

Query  209   MMEDVGIILPKLTPLEVLVTPRLSPTLFRL  120
             M E  G+   K TPLEV++TPRL P ++ L
Sbjct  482   MTETAGLTNAKATPLEVVITPRLHPEIYGL  511



>gb|KDO42182.1| hypothetical protein CISIN_1g046041mg [Citrus sinensis]
Length=531

 Score =   437 bits (1125),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/500 (43%), Positives = 320/500 (64%), Gaps = 18/500 (4%)
 Frame = -1

Query  1610  WRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSS  1431
             +  + KR  PEAGGAWP+IGHLH      PL + L   ADKYGP+FTI++GI+R LVVSS
Sbjct  44    YTSKKKRGAPEAGGAWPVIGHLHILGGPEPLHRVLGSMADKYGPIFTIKIGINRALVVSS  103

Query  1430  WEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRL  1251
             WE  ++C  TNDK+ A+RP T A + LGY++++F FS   SYW   RK+   E+LS+ RL
Sbjct  104   WEMAKECLTTNDKIFASRPKTLAMEILGYNFSMFGFSPYGSYWCETRKIATLELLSNHRL  163

Query  1250  EKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR  1071
             EKL+HV   E++T +KELY      + + +   V M RWF     N+I++++ G+     
Sbjct  164   EKLRHVRDYEVKTCLKELYELWD-KSKSTNKMLVEMKRWFADTIRNVILRMIVGK-----  217

Query  1070  SDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAI  891
               G  + +++   ++ ++ + + G+FV  DA   L F RWLD  G  ++MK+ AK++D +
Sbjct  218   --GCNSVDSEEWMELLTRFLEMSGKFVVSDA---LPFLRWLDIGGDERSMKKTAKELDIV  272

Query  890   LQDWVDARRKERRS----NEDQKFIDVMLSMIDDQFTQGYS-YSRDTVIKAIVLSMLQDA  726
             +Q W +  +++R S     E+  F+ VM S++ D  T+ YS    DT+ KA+ L ++   
Sbjct  273   VQGWFEEHKRKRDSREVKGEELDFMSVMPSILGD--TEQYSGRDVDTINKAVCLGLIIAG  330

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
              +T    LTW++++LL H + L +VQ+E+D  +G +R   +SD+KNL YLQ  +KE +R+
Sbjct  331   LDTTTVTLTWVISLLLNHRDILDKVQNELDIQVGTKRQVNESDLKNLVYLQATLKEAMRL  390

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP  P L PHEA+E+C V+GYH+P  TQL +NVW+L RDP++W +P KF PERF+T  + 
Sbjct  391   YPAVPLLIPHEAIEECTVNGYHVPARTQLLINVWKLQRDPRVWEEPCKFQPERFLTKHKD  450

Query  365   EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII  186
                + +  + +PFG GRR CPG  +A Q+ Q  +A L QGF+F+T  NEPLDM E  G+ 
Sbjct  451   IDVRGQHLELLPFGSGRRMCPGVSFALQVMQFTIASLLQGFDFATPSNEPLDMGEGFGLT  510

Query  185   LPKLTPLEVLVTPRLSPTLF  126
             + K  PLEVL+ PRLS +L+
Sbjct  511   MEKSRPLEVLIAPRLSASLY  530



>gb|KDO65988.1| hypothetical protein CISIN_1g011292mg [Citrus sinensis]
Length=489

 Score =   436 bits (1121),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 208/457 (46%), Positives = 302/457 (66%), Gaps = 7/457 (2%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             PE  GAWP+IGHL       P+ K L   ADKYGP++++RLG    L+VSSWE V+DCF 
Sbjct  39    PEPFGAWPLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFT  98

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
             TND++LA RP+  AGKYLGYD AVF  +    YWR +RK+   ++LSS RLE LKHV  S
Sbjct  99    TNDRVLATRPSIAAGKYLGYDNAVFALAPYGRYWRDIRKIATTDLLSSHRLELLKHVRYS  158

Query  1223  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEA  1044
             E+ T IK+LY+  S +  NP+  KV +S+    LT N+ ++++AG+R+  R  G    E 
Sbjct  159   EVDTFIKDLYSRCSENAFNPA--KVVISKLIEQLTFNISLRLIAGKRFSAREFGEQGSEG  216

Query  1043  QRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARR  864
              R+ +   +  YL G FV GDAI P  +  W+D++GH+ +M+R AK +D ++ +W++   
Sbjct  217   WRINRAIKEATYLTGVFVLGDAI-P--WLEWIDFQGHIGSMRRTAKKIDDVIGNWLE-EH  272

Query  863   KERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAV  684
              +R+   +  F+DV+LS I+D  T    ++RDTVIKA  L ++   SE+    + W L++
Sbjct  273   AQRKLQGEGDFMDVLLSKIEDN-TVMSGHTRDTVIKATALILIFTGSESTYLGIIWTLSL  331

Query  683   LLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVE  504
             LL HP+ LK+ Q+E+D ++G++RW  +SD+KNL YL+ +VKETLR+YP GP     EA+E
Sbjct  332   LLNHPKELKKAQEELDVHVGRDRWVNESDMKNLKYLRAIVKETLRIYPPGPVTGIREAME  391

Query  503   DCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFG  324
             DC + GYH+PKGT+L VN+W+LHRDP++W +P +F PERF+T         + ++++PF 
Sbjct  392   DCEIGGYHVPKGTRLIVNIWKLHRDPRMWENPCEFRPERFLTTHADVDVNTQHFEYIPFS  451

Query  323   LGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPL  213
              GRRSCPG     QI Q+ +AR+ QGF+ +TV   PL
Sbjct  452   FGRRSCPGMTSGLQIVQLTLARILQGFDLATVGVYPL  488



>emb|CBI32510.3| unnamed protein product [Vitis vinifera]
Length=607

 Score =   440 bits (1131),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 225/501 (45%), Positives = 315/501 (63%), Gaps = 17/501 (3%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW  1428
             +K+ KR PPE  G WP+IGHLH       L +TL + ADKYGP+F +RLG+ + LVVSSW
Sbjct  102   KKRGKR-PPEPSGRWPLIGHLHLLGADKLLHRTLGDMADKYGPIFCVRLGLKKTLVVSSW  160

Query  1427  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE  1248
             E  ++C+ T+DK+ A RP + A K +GYD+  F F+    YWR VRKL + E+LS+R+LE
Sbjct  161   EVAKECYTTSDKVFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELLSNRQLE  220

Query  1247  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
               KHV  SE++  IKELY   + + + P+   V M   FG+L LN++++ +AG+RY    
Sbjct  221   MHKHVQDSEVKILIKELYGQWASNKDGPAL--VEMKERFGNLALNVVVRAIAGKRY--FG  276

Query  1067  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGHVKTMKRAAKDVDAI  891
                  +E +R KK F   + L G F+  D I    F  WLD  +G    MKR AK+VD +
Sbjct  277   THACGDEPKRAKKAFEDFIILLGLFMVSDVI---PFLGWLDTMKGFTAEMKRVAKEVDYV  333

Query  890   LQDWVDARRKERRSNED----QKFIDVMLSMIDD-QFTQGYSYSRDTVIKAIVLSMLQDA  726
             L  WV+  R+ R S  D    Q FI  MLS+IDD QF+       DT+IK    +++   
Sbjct  334   LGSWVEEHRQNRLSANDNGAEQDFIHAMLSVIDDGQFS---GRDPDTIIKGTCSNLILAG  390

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             ++T +  LTW L++LL +  +LK+ Q E++ ++GK R  + SD+KNL YLQ +VKETLR+
Sbjct  391   NDTTSITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRL  450

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP GP   PHEA+EDC V G+HI  GT+L VN+W+LHRDP++W DP +F PERF+T   G
Sbjct  451   YPPGPLSLPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAG  510

Query  365   EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII  186
                + + Y+ +PFG GRR CPG  +A ++T + +ARL  GF    V + P+DM E  G+ 
Sbjct  511   LDVRGKNYELLPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLT  570

Query  185   LPKLTPLEVLVTPRLSPTLFR  123
              PK TPLEV + PRL   L++
Sbjct  571   APKATPLEVTIVPRLPFELYK  591



>ref|XP_007226598.1| hypothetical protein PRUPE_ppa023495mg [Prunus persica]
 gb|EMJ27797.1| hypothetical protein PRUPE_ppa023495mg [Prunus persica]
Length=522

 Score =   437 bits (1123),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 229/523 (44%), Positives = 330/523 (63%), Gaps = 14/523 (3%)
 Frame = -1

Query  1670  VPCCLSSILGIAALVLLWFSWRKQSK--------RLPPEAGGAWPIIGHLHHFRTSVPLV  1515
             +PC  ++I GI A++L  +   K+S         +LP  AGG WP++GH   FR S    
Sbjct  5     LPCLNTAIAGILAILLFSYFIIKRSSSAAKAKGPKLPKVAGG-WPLLGHFGLFRGSQLPH  63

Query  1514  KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYA  1335
               L+   DKYGP FTI +GI   LV+S+WEA +DCF TND ++++RP T   K+LGY++A
Sbjct  64    IALASLVDKYGPAFTINIGIHSALVISTWEAAKDCFTTNDIVVSSRPATLGAKHLGYNFA  123

Query  1334  VFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP  1155
             +F FS   SYWR +RKL   E+LS+RRLE LK V VSE++ ++KELYT       +    
Sbjct  124   MFGFSPYGSYWREMRKLTSLELLSNRRLELLKKVRVSEVEMSLKELYTLWIKRKESSGER  183

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              V M +WFG LTLN+I ++VAG+R     + +  +EA+R +K   +  +L G FV GDA+
Sbjct  184   LVEMKQWFGDLTLNVIFRMVAGKRCFMNGNLSEEKEARRWQKAMREFFHLAGLFVLGDAV  243

Query  974   FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQF  795
              P  +  WLD  G  K MK+ AK++D+I+ +W++  +++R   +DQ F+DVMLS ID   
Sbjct  244   -P--WLSWLDLGGQQKAMKKTAKELDSIVAEWLEEHKQKRTKGKDQDFMDVMLSAIDGTD  300

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
               G+    DTVIKA  L ++  AS+T    LTW L++LL + + LK+V +E+D  +GK R
Sbjct  301   VAGFD--ADTVIKATCLILIAGASDTTMVTLTWTLSLLLNNRQVLKKVYEELDQYVGKGR  358

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
               ++SD+ NL YLQ  VKE +R+ P GP     E  EDC V GYH+PKGT L VN+W++ 
Sbjct  359   LLDESDINNLVYLQATVKEAMRLCPAGPLSGQREFTEDCTVGGYHVPKGTWLLVNLWKIQ  418

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
              DP++W DP +F PERF+T  +    + +Q++ +PFG GRR+CPG  +  Q+T + +A  
Sbjct  419   TDPRVWADPMEFKPERFLTTHKDVDVRGQQFELMPFGSGRRACPGISFGLQMTLLTLASF  478

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
                F+ +T  N P+DM   +G+   KLTPL+VLV PRLSP L+
Sbjct  479   LHSFDVTTQENAPVDMTGSIGLTNIKLTPLDVLVKPRLSPNLY  521



>gb|KHG26594.1| Cytochrome P450 [Gossypium arboreum]
Length=526

 Score =   437 bits (1123),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 227/524 (43%), Positives = 325/524 (62%), Gaps = 23/524 (4%)
 Frame = -1

Query  1649  ILGIAAL-VLLWFSW----------RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLS  1503
             ++G+A +  LL FS+              K+ PPE GGA P +GHLH      P   T+ 
Sbjct  9     VIGVAGIFALLLFSYLLFTTVITRKSSSKKKKPPEIGGARPFLGHLHLLGGPKPAHITMG  68

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
              +AD YGP+FT RLG+   LVVS+WE  ++CF TNDK  A+RP T A + LGY++A+F F
Sbjct  69    NFADAYGPIFTFRLGMHPTLVVSNWEMAKECFTTNDKAFASRPRTLAAELLGYNFAMFGF  128

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKV-N  1146
             S+   YWR VRK+   E+LS+ RLEKL+HV  SE++ +IK LY  ++   NN S P V  
Sbjct  129   SSYGPYWRHVRKIATLEVLSNYRLEKLRHVRESEIRASIKRLYELVT---NNCSEPVVVE  185

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             M RWF  L +N + +IV G+RY         EE ++ +K      +L G F   D+   L
Sbjct  186   MKRWFWTLNINTVFKIVIGKRYSEIETSHEEEENEQRRKALRDFFHLTGTFTVADS---L  242

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRS----NEDQKFIDVMLSMIDDQ  798
              F RWLD  GH K MK+ AK +D IL++ +D  +++R S    +E   F+ +MLS+++D 
Sbjct  243   PFLRWLDLGGHEKAMKKTAKKLDQILKECLDEHKRKRNSGKSYDELDNFMYMMLSLLEDA  302

Query  797   FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE  618
                  SY  DT+ KA  L+++   ++T    ++W L++LL H + LK+ Q+E+DT +GK+
Sbjct  303   GDHP-SYDADTINKATCLAIIVGGTDTTTVTISWALSLLLNHRDVLKKAQNELDTFVGKD  361

Query  617   RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL  438
             R  E+SD+KNL YLQ ++ ET R+YP  P   PHE+VEDCI  GY IP GT+L VN+ +L
Sbjct  362   RLVEESDIKNLVYLQAIINETTRLYPAAPLSVPHESVEDCITGGYFIPAGTRLLVNISKL  421

Query  437   HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR  258
              RDPK+W DP++F PERF+T  +    + + ++F+PFG GRR CPG  +A Q+ Q+ +A 
Sbjct  422   QRDPKVWSDPDEFRPERFLTTQKHMDVRGQNFEFIPFGSGRRVCPGISFALQVLQLNLAT  481

Query  257   LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             L Q F  +T+ +EP+DM E  G+   K TPL V+ TPRL P L+
Sbjct  482   LLQSFEITTLFDEPVDMREGAGLTNLKATPLNVVFTPRLPPHLY  525



>ref|XP_006464298.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   436 bits (1122),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 218/496 (44%), Positives = 313/496 (63%), Gaps = 16/496 (3%)
 Frame = -1

Query  1601  QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEA  1422
             Q+    P AGGAWP+IGHLH F    P  + L + ADKYGP+FT+++G++R LVVS+WE 
Sbjct  38    QAPHQAPVAGGAWPLIGHLHLFGGQEPTHRLLGDMADKYGPIFTMKMGLNRALVVSNWEI  97

Query  1421  VRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKL  1242
              ++CF  NDK  A RP + A   LGY++     S   +YWR  RK+   E+LS+ +L+KL
Sbjct  98    AKECFTINDKPFANRPRSMAMDLLGYNFLAIAASPYGNYWRESRKMATIELLSNNQLQKL  157

Query  1241  KHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDG  1062
             KHV  SE++ +IK L  F +   ++     V M  W   + L++IM+I+AG+RY  +   
Sbjct  158   KHVRESEVKASIKGL--FENCKRSSSHKVSVEMKHWIEGIVLDIIMRIIAGKRYTSQDSS  215

Query  1061  TINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQD  882
                E A       +    L+G+FV  DA   L F RWLD  G+ K MK+ AK+ D + Q 
Sbjct  216   DFQEHA-------TDFFDLFGKFVVSDA---LPFLRWLDIGGYEKLMKKTAKEFDLVFQG  265

Query  881   WVDARRKERRSNE---DQKFIDVMLSMIDDQFTQ-GYSYSRDTVIKAIVLSMLQDASETF  714
             W+D  + +R S+E   D+ F+ VMLS+ DD+  Q       DTVIKAI LS++  AS+T 
Sbjct  266   WLDEHKSKRGSSEVKGDEDFMYVMLSLFDDKTKQLPGGDDTDTVIKAICLSLILAASDTT  325

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
             A  LTW +A+LL + + L++ Q+E+D ++G  R   +SD+ NL YLQ V+KETLR+YP  
Sbjct  326   AVTLTWAIALLLNNRDVLEKAQNELDVHVGTNRQVNESDMINLAYLQVVLKETLRLYPAA  385

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P L PHE++EDC + GYH+P GTQL VN W++ RDP +W +P +FLPERF+T  +    +
Sbjct  386   PLLVPHESIEDCNISGYHVPAGTQLIVNAWKIQRDPGVWEEPCRFLPERFLTKYKDVDLK  445

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
              + ++F+PFG GRR CPG  +A Q+  + +A L  GF+F+T  + P+DM E   +   K 
Sbjct  446   GQNFEFIPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEAKSLTYAKA  505

Query  173   TPLEVLVTPRLSPTLF  126
             TPLEVL+TPRLS +L+
Sbjct  506   TPLEVLLTPRLSASLY  521



>ref|XP_009364189.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   436 bits (1121),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 219/531 (41%), Positives = 322/531 (61%), Gaps = 17/531 (3%)
 Frame = -1

Query  1679  MDAVPCCLSSILGIAALVLL-------WFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVP  1521
             MD++P   S   G+  ++++       W +   + K  PPEA GAWPI+GHL     S P
Sbjct  1     MDSLPYANSITAGLFTIIIVSYYLSRRWRAANHKGKLSPPEAKGAWPILGHLPLLGGSTP  60

Query  1520  LVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYD  1341
                TL   ADKYGP++TIRLG+   LV+SS E  ++CF TND  + +RP      ++GY+
Sbjct  61    PHITLGAMADKYGPLYTIRLGVYPSLVISSSEIAKECFTTNDLSVNSRPKMAVVDHIGYN  120

Query  1340  YAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPS  1161
             YA+F F+ +  YWR +RK+   E+LS+RR+E LKH+ VSE+ T +KEL+   S      S
Sbjct  121   YAMFGFAPSGPYWREIRKITTLELLSNRRVELLKHIRVSEVTTFLKELHKTWSTRQKEGS  180

Query  1160  APKV--NMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVS  987
                V   + +WFG +TLN+I+++VAG+RY   +D    +EA R++    +     G F+ 
Sbjct  181   NDGVVVELKQWFGDMTLNVIVRMVAGKRYSVAADEDEKKEALRVQNALREFFNFVGMFLV  240

Query  986   GDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDA---RRKERRSNEDQKFIDVML  816
             GDA+    + RWLD  GH K MK+ AKD+DA++ +WV+    RR +  +  +Q FID ML
Sbjct  241   GDAV---PYLRWLDLGGHEKAMKKTAKDLDAMVGEWVEEHKQRRAKGGAKGEQDFIDAML  297

Query  815   SMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEID  636
             S++D     G+    DT+ KA  L+M+   S+T    LTW +++L+ +P  LKR  +E+D
Sbjct  298   SVLDGADLGGFD--ADTINKATSLNMIAGGSDTTMVTLTWAISLLVNNPHVLKRALNELD  355

Query  635   TNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLY  456
             T IG++R   + D+ NL Y+Q +VKETLR+YP  P   P E  EDC + G HI KGT+L 
Sbjct  356   TKIGRQRVVSEEDISNLVYIQAIVKETLRLYPAAPLSGPREFTEDCTIAGCHIRKGTRLI  415

Query  455   VNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQIT  276
             +N+W+L  DPKIWPDP +F PERF+T  +    +   ++ +PFG GRR+CPG  +A Q+ 
Sbjct  416   MNLWKLQTDPKIWPDPLEFKPERFLTTHKDVDVKGHHFELIPFGSGRRACPGLAFALQMV  475

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             Q  +A     F  S   + P+DM E  G+   K+TPL+VL+ PRLS   ++
Sbjct  476   QFTLASFLHAFEISNPSSAPIDMTESFGLTNMKVTPLKVLIKPRLSFEFYK  526



>ref|XP_007017413.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14638.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   436 bits (1121),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 217/518 (42%), Positives = 330/518 (64%), Gaps = 18/518 (3%)
 Frame = -1

Query  1670  VPCCLSSILGIAALV--LLWFSW---RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             +P  ++++      +  LLW S     +  +R  PEAG +WP+IGHLH      P    L
Sbjct  10    IPFVIATVFAFPLFLFSLLWISKSVKNRDKRRAAPEAGSSWPVIGHLHLLGGPQPAHIVL  69

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
              + A+KYGP+FTI++G+ R LVV++WE  ++C  TNDK  A+RP T A + L YD+A+F 
Sbjct  70    GDMAEKYGPIFTIKMGVYRALVVNNWETAKECLTTNDKAFASRPKTLAMELLSYDHAMFG  129

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN  1146
             F+    YWR++RK+   E+LSS RL++LKHV  SE++T++KELY   S + ++     V 
Sbjct  130   FAPYGPYWRQMRKVATLELLSSYRLDRLKHVRQSEIKTSLKELYQHWSENKDSSDKVLVE  189

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             M  WF  +TLN+I++++ G+R    SD   + E +R K        L G+FV  DA   L
Sbjct  190   MKAWFRDVTLNVILRMIVGKRIP-SSDS--DAEGERWKDALRDFFDLSGKFVISDA---L  243

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWV-DARRKERRSNE--DQKFIDVMLSMIDDQF  795
              F +WLD  G  + MK+  K++D + + W+ D +R +   N+  DQ F+DVM S++ D  
Sbjct  244   PFLKWLDIGGDERFMKKVTKELDEVAEGWLQDHKRMKASGNQESDQDFMDVMFSILSDV-  302

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
                  +  DT+ KA  L+M+  AS+T    LTW L++LL +  +LK+ Q+E+D ++G+++
Sbjct  303   ---GKHDADTINKATCLAMILAASDTTMVTLTWALSLLLNNRGALKKAQEELDIHVGRDK  359

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
               E+SD+K L YL+ ++KETLR+YP GP   PHE++EDCIV GYHIP GT+L +NV+++H
Sbjct  360   LVEESDIKKLVYLRAILKETLRLYPAGPLSLPHESMEDCIVSGYHIPAGTRLLINVYKIH  419

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP++W DP +F PERF+T  +    + + ++ +PFG GRR CPG  +A Q+ ++ +A L
Sbjct  420   RDPRVWSDPCEFQPERFLTTYKDFDVRGQNFELIPFGSGRRMCPGVSFALQVLELTLANL  479

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
              QGF   T  +EP+DM E +G+   K +PLEVL+TPRL
Sbjct  480   LQGFELGTPLDEPVDMSEAMGLTNLKASPLEVLITPRL  517



>ref|XP_003634362.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   436 bits (1120),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 225/525 (43%), Positives = 333/525 (63%), Gaps = 17/525 (3%)
 Frame = -1

Query  1679  MDAVPCCLS-------SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVP  1521
             MD +  CL+       +IL ++  +LLW S   +S R+ PEA GAWPIIGHLH    S  
Sbjct  1     MDFLLHCLNPVMVGAFAILVLSYHLLLWRSGAGKS-RMAPEASGAWPIIGHLHLLGGSKN  59

Query  1520  LVKTL-SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGY  1344
             L   L    ADKYGPVF+IRLG+ R +VVSSWE  ++CF T+D  LA+RP   A KYLGY
Sbjct  60    LPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKECFTTHDLALASRPQLVAAKYLGY  119

Query  1343  DYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNP  1164
             +Y++F FS + +YWR VRK+   E+LS+RRLE LK+V +SE++T +KELY   +   +  
Sbjct  120   NYSMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMKELYKLWAETKSEA  179

Query  1163  SAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSG  984
                 V+M +WFGHL+LN+I+++V G+RY   +  +  + AQ+ +K   +   L G FV  
Sbjct  180   GVVLVDMKQWFGHLSLNVILKMVVGKRYFGYAAESKEKGAQQCQKAIREFFRLMGLFVVS  239

Query  983   DAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLS  813
             DA   L F  WLD  GHVK MK+ AK++D I Q+W++  R+ + S E   DQ F+DVMLS
Sbjct  240   DA---LPFLGWLDVGGHVKAMKKTAKELDGIAQEWLEEHRRRKDSGEADGDQDFMDVMLS  296

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
             ++  + T    Y  DT+ KA  L ++   ++T +  LTW +++LL +P  L++ Q+E+D 
Sbjct  297   ILGGRDTT--DYDADTINKATALILIGGGTDTTSGTLTWAISLLLNNPHILRKAQEELDA  354

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
             ++GKER   + D+  L YLQ +VKETLR+ P  P   P + ++D I+ GY+I KGT+L +
Sbjct  355   HVGKERIVNEMDISKLVYLQAIVKETLRLNPTAPLSGPRQFIQDSILGGYYISKGTRLIL  414

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             N+ ++ RDP++W +P +F P+RF+T  +    + + ++  PFG GRR CPG ++A Q+  
Sbjct  415   NLTKIQRDPRVWLNPMEFQPDRFLTTHKDVDVRGKHFELTPFGGGRRICPGAIFALQVLH  474

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
             + +A     F  ST  + P+DM E  G+   K TPLEVL++PRL+
Sbjct  475   LTLANFLHRFQLSTPSDAPVDMSESFGLTNIKSTPLEVLISPRLA  519



>gb|KCW68807.1| hypothetical protein EUGRSUZ_F02406 [Eucalyptus grandis]
Length=502

 Score =   435 bits (1118),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 213/496 (43%), Positives = 316/496 (64%), Gaps = 20/496 (4%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             PEAGGAWP+IGHLH     VP    L+  ADKYGP+FTI+ G+ R L+VS+W+  + C  
Sbjct  18    PEAGGAWPLIGHLHLLGGPVPPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLT  77

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
              ND+  A+RP + + + + Y+YA+F  +    YWR VRK+ + E+LS+ RLE LKHV  S
Sbjct  78    VNDRAFASRPKSVSSEVMAYNYAMFGLAPYGPYWRHVRKITMLELLSNHRLELLKHVRHS  137

Query  1223  ELQTNIKELYT-FISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEE  1047
             E+Q ++  LY   +   +  P    V+M RWFG +TLN++ +++ G+RYE       +E+
Sbjct  138   EVQASVTHLYKRCMESYSGAPMKVLVDMKRWFGDITLNVVFRMIVGKRYE-------DEQ  190

Query  1046  AQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDAR  867
              ++ ++       L G F+  DA FP+   RWLD +G+ K MK+ A ++D ++Q W++  
Sbjct  191   DEKGREALRSYFDLAGRFIVSDA-FPI--LRWLDLDGYEKMMKKTAHELDRVVQGWLNEH  247

Query  866   RKERRSNE--------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
             ++ R +N+        DQ F+DVMLS++D    +   Y  DT IKA  ++++   S+T +
Sbjct  248   KRRRSANKRRGDNKDSDQDFMDVMLSIVDAA-EELPGYDADTFIKATCMALVLAGSDTTS  306

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
               LTW L++LL H E LK+ Q E+DT IG+ER   +SD+ NL Y+Q ++KET+R+YP  P
Sbjct  307   VSLTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDLMNLVYIQAIIKETMRLYPAAP  366

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN  351
                PHE++EDC VDGYHIPKGT+L +N W++HRD  IW DP +F PERF+T       + 
Sbjct  367   LGVPHESMEDCTVDGYHIPKGTRLLLNFWKIHRDQHIWSDPLEFRPERFLTTHRNFDVRG  426

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
             + ++ +PFG GRR CPG   A Q+  +++A L  GF+ +T+ +EP+DM E +G+   K T
Sbjct  427   QNFELIPFGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEPVDMAEAIGMTNLKAT  486

Query  170   PLEVLVTPRLSPTLFR  123
             PLEVLVTPRL    +R
Sbjct  487   PLEVLVTPRLPEHAYR  502



>ref|XP_002284806.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=527

 Score =   436 bits (1120),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 224/493 (45%), Positives = 316/493 (64%), Gaps = 16/493 (3%)
 Frame = -1

Query  1586  PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCF  1407
             P E  G WPIIGHLH         +TL + ADKYGP+F I LG+ + LVVSSWE  ++C+
Sbjct  40    PQEPSGRWPIIGHLHLLGADKLPHRTLGDMADKYGPIFCIHLGLRKALVVSSWEVAKECY  99

Query  1406  ATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWV  1227
              TNDK+ A RP + A K +GYD+A+  F+    YWR VRKL + E+LS+R+LE LKHV  
Sbjct  100   TTNDKVFATRPRSLAVKLMGYDHAMLGFAPYGPYWRDVRKLAMVELLSNRQLEMLKHVQD  159

Query  1226  SELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEE  1047
             SE++  IKELY   + + ++P+   V M   FG+L +N++++ +AG+RY        ++E
Sbjct  160   SEVEFLIKELYGQWARNKDSPAL--VEMKERFGNLVMNVMVRAIAGKRY--FGTHACDDE  215

Query  1046  AQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGHVKTMKRAAKDVDAILQDWVDA  870
              +R KK     M L G F+  DAI    F  WLD  +G+   MK+ AK++D +L  WV+ 
Sbjct  216   PKRGKKALDDFMLLVGLFMVSDAI---PFLGWLDTVKGYTTDMKKIAKELDYLLGRWVEE  272

Query  869   RRKERRSNEDQK----FIDVMLSMIDD-QFTQGYSYSRDTVIKAIVLSMLQDASETFATH  705
              R++R S  + +    F+ VMLS+IDD QF+       DTVIKA  L+++    +T +  
Sbjct  273   HRQQRLSANNNRAEVDFLHVMLSVIDDGQFS---GRDPDTVIKATCLNLILAGYDTTSIT  329

Query  704   LTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYL  525
             LTW L++LL +  +LK+ Q E++ ++GK R  + SD+KNL YLQ +VKETLR+YP GP  
Sbjct  330   LTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPPGPLS  389

Query  524   APHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQ  345
              PHEA+EDC V G+HI  GT+L VN+W+LHRDP++W DP +F PERF+TN  G   + + 
Sbjct  390   VPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTNHAGLDVRGKN  449

Query  344   YQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPL  165
             Y+ +PFG GRR CPG  +A ++T +A+ARL  GF    V + P+DM E  G+  PK TPL
Sbjct  450   YELLPFGSGRRVCPGISFALELTHLALARLLHGFELGVVADSPVDMTEGPGLSAPKATPL  509

Query  164   EVLVTPRLSPTLF  126
             EV + PRL   L+
Sbjct  510   EVTIVPRLPFELY  522



>ref|XP_010064745.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   436 bits (1120),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 219/534 (41%), Positives = 328/534 (61%), Gaps = 34/534 (6%)
 Frame = -1

Query  1655  SSILGIAALVLLWFSWRK--------------QSKRLPPEAGGAWPIIGHLHHFRTSVPL  1518
             +++LGI A   + + +R                 K   PEAGGAWP+IGHLH     VP 
Sbjct  10    TALLGIFAFATVLYFFRSLLVRTKNDRRSVDGHKKASLPEAGGAWPLIGHLHLLGGPVPP  69

Query  1517  VKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDY  1338
                L+  ADKYGP+FTI+ G+ R L+VS+W+  + C   ND+  A+RP + + + + Y+Y
Sbjct  70    HIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLTVNDRAFASRPKSVSSEVMAYNY  129

Query  1337  AVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYT-FISMDNNNPS  1161
             A+F  +    YWR VRK+ + E+LS+ RLE LKHV  SE+Q ++  LY   +   +  P 
Sbjct  130   AMFGLAPYGPYWRHVRKITMLELLSNHRLELLKHVRHSEVQASVTHLYKRCMESYSGAPM  189

Query  1160  APKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGD  981
                V+M RWFG +TLN++ +++ G+RYE       +E+ ++ ++       L G F+  D
Sbjct  190   KVLVDMKRWFGDITLNVVFRMIVGKRYE-------DEQDEKGREALRSYFDLAGRFIVSD  242

Query  980   AIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE--------DQKFID  825
             A FP+   RWLD +G+ K MK+ A ++D ++Q W++  ++ R +N+        DQ F+D
Sbjct  243   A-FPI--LRWLDLDGYEKMMKKTAHELDRVVQGWLNEHKRRRSANKRRGDNKDSDQDFMD  299

Query  824   VMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQD  645
             VMLS++D    +   Y  DT IKA  ++++   S+T +  LTW L++LL H E LK+ Q 
Sbjct  300   VMLSIVDAA-EELPGYDADTFIKATCMALVLAGSDTTSVSLTWALSLLLNHREVLKKAQH  358

Query  644   EIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGT  465
             E+DT IG+ER   +SD+ NL Y+Q ++KET+R+YP  P   PHE++EDC VDGYHIPKGT
Sbjct  359   ELDTQIGRERLVNESDLMNLVYIQAIIKETMRLYPAAPLGVPHESMEDCTVDGYHIPKGT  418

Query  464   QLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYAT  285
             +L +N W++HRD  IW DP +F PERF+T       + + ++ +PFG GRR CPG   A 
Sbjct  419   RLLLNFWKIHRDQHIWSDPLEFRPERFLTTHRNFDVRGQNFELIPFGSGRRMCPGINLAM  478

Query  284   QITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             Q+  +++A L  GF+ +T+ +EP+DM E +G+   K TPLEVLVTPRL    +R
Sbjct  479   QLISLSLAALLHGFDITTLADEPVDMAEAIGMTNLKATPLEVLVTPRLPEHAYR  532



>ref|XP_007017415.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14640.1| Cytochrome P450, putative [Theobroma cacao]
Length=529

 Score =   436 bits (1120),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 221/495 (45%), Positives = 312/495 (63%), Gaps = 9/495 (2%)
 Frame = -1

Query  1595  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             KR  PE  GA P +GHLH    S P    L + AD  GP+FTIRLG+   LVVS+WE  +
Sbjct  38    KRKAPEVSGARPFLGHLHLLGGSKPAHVVLGDLADTNGPIFTIRLGMHPTLVVSNWEIAK  97

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +CF TNDK  A RP T A + LGY+YA+F FS    YWR++RK+   E+LS+ RLEKLKH
Sbjct  98    ECFTTNDKAFANRPRTIAAELLGYNYAMFGFSPYGPYWRQIRKIATLEVLSNHRLEKLKH  157

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPKV--NMSRWFGHLTLNLIMQIVAGRRYEYRSDG  1062
             +  SE++T+IKELY       +N S+ KV   M RWF  L +N++ ++V G+RY      
Sbjct  158   IRESEVRTSIKELYELGVEGVSNSSSGKVLVEMKRWFWTLNINMVFKMVVGKRYSEAETS  217

Query  1061  TINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQD  882
                +E    +K       L G F  GD+   L F RWLD  GH K MK+ AK++D IL++
Sbjct  218   HGKDENDGHRKALRDFFELTGTFTVGDS---LPFLRWLDLGGHEKAMKKTAKELDHILEE  274

Query  881   WVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
             W++  +++R S     +  F+ +MLS+++D   +  SY+ DT+IKA  L+++   ++T  
Sbjct  275   WLEEHKQKRNSGNAESEHDFMGMMLSLLNDA-AELPSYNADTIIKATCLAIILGGTDTTT  333

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
               +TW L++LL H + L++ Q E+DT +G+ER  ++SDVKNL YLQ ++KET R+YP  P
Sbjct  334   VTITWALSLLLNHHDVLEKAQHELDTYVGRERPVQESDVKNLVYLQAIIKETTRLYPAAP  393

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN  351
                 HE+VEDC   GY IP GT+L VN+ +L RDPK W +P++F PERF+T  +    + 
Sbjct  394   LSVMHESVEDCTTAGYFIPAGTRLLVNLSKLQRDPKAWSNPDEFRPERFLTTHKHFDVRG  453

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
             + Y+ VPFG GRR CPG  +A Q+ Q ++A L Q F  +T  +EP+DM E  G+   K T
Sbjct  454   QNYELVPFGSGRRVCPGISFALQVLQFSLASLLQAFEITTPSDEPVDMGEGAGLTNLKAT  513

Query  170   PLEVLVTPRLSPTLF  126
             PLEV++TPRL P L+
Sbjct  514   PLEVILTPRLPPHLY  528



>ref|XP_011039260.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=528

 Score =   435 bits (1119),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 210/491 (43%), Positives = 314/491 (64%), Gaps = 10/491 (2%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             P+AGGAWPIIGH+H F       K L   ADKYGPVFTI+LG  R+LVV+SWE  RDCF 
Sbjct  42    PQAGGAWPIIGHMHLFGGKQLTHKILGAMADKYGPVFTIKLGSHRVLVVNSWEMARDCFT  101

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
              +D+  ++RP+  A K LGYD A+F F+    YWR +RK+   E+LSS R++ L+H+  S
Sbjct  102   VHDRAFSSRPSIAASKLLGYDLAMFGFAPYGPYWREMRKITTIELLSSHRIDMLRHIRAS  161

Query  1223  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEA  1044
             E++T I++L+       +  S   V+M +WFG LTLN+++++V G+RY   S      EA
Sbjct  162   EVETAIRDLHKMWVSKGSAESGVTVDMKQWFGELTLNIVLRMVGGKRYFGPSADGEEAEA  221

Query  1043  QRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARR  864
             +R +KV    + L+G FV  DAI P  F  WLD+ G+ K MKR AK++D +   W++  +
Sbjct  222   RRNQKVMRDFVRLFGVFVLSDAI-P--FLGWLDFNGYEKAMKRTAKELDILAGGWLEEHK  278

Query  863   KER----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTW  696
             + R    +  ++Q F+DVML++++     G+    DT+ KA  L+++   S+T    LTW
Sbjct  279   QRRLLGGKEKQEQDFMDVMLNILEKANIGGFDA--DTINKATCLNVILAGSDTTMVTLTW  336

Query  695   ILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPH  516
              L++LL +P+ LK+ +DE+D ++GK+R  ++SD+ NL YLQ ++KETLR+YP  P +A  
Sbjct  337   ALSLLLNNPQVLKKAKDELDIHVGKDRLVDESDINNLVYLQAIIKETLRLYPPSPLIAHR  396

Query  515   EAVEDCIVD-GYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQ  339
              A EDC +  GYH+P GT+L  N W++ RD ++WP+P++F PERF+T+ +    + + ++
Sbjct  397   SAKEDCTLSVGYHVPSGTRLMANAWKIQRDERVWPNPDEFHPERFLTSQKEIDLKGQNFE  456

Query  338   FVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEV  159
              +PFG GRRSCPG   A +I    +ARL   F  +    E +DM E  G+   K TPLE+
Sbjct  457   LIPFGSGRRSCPGIALALRIVHFTLARLLHSFEVTKPSREDVDMTESHGLTNLKATPLEI  516

Query  158   LVTPRLSPTLF  126
             L+ PRL+P L+
Sbjct  517   LLIPRLNPRLY  527



>ref|XP_002281361.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=516

 Score =   435 bits (1118),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 228/519 (44%), Positives = 320/519 (62%), Gaps = 22/519 (4%)
 Frame = -1

Query  1652  SILGIA-ALVLLWFSWRKQSK---RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1485
             ++ GI  A++ LW    K +K   R PPE  GAWP++GHLH       + +T    AD+Y
Sbjct  11    TVFGILFAIICLWLVNAKGNKNKGRSPPEPSGAWPVMGHLHLLGADKQIHRTFGAMADEY  70

Query  1484  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY  1305
             GP+F+IRLG+   LVVSS E  ++C+ T DK LA RP + A K +GYD+A+F F  +  Y
Sbjct  71    GPIFSIRLGLRTALVVSSSEVAKECYTTKDKALATRPRSLAVKLMGYDHAMFAFERHGPY  130

Query  1304  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH  1125
             WR VR+L +  +LS+R+ E LKHV  SE++  I+ELY       N  S   V+M + F H
Sbjct  131   WRDVRRLAMVNLLSNRQHEMLKHVRDSEVKFFIQELYG--QWVENGGSPVLVDMKKKFEH  188

Query  1124  LTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD  945
             L  NL M+ VAG+R E       N E+ R  +     M L G+F+  DA+ P  F  WLD
Sbjct  189   LVANLTMRTVAGKRCE-------NGES-RWCQALGDFMNLMGQFMVSDAV-P--FLGWLD  237

Query  944   -YEGHVKTMKRAAKDVDAILQDWVDARRKERRS---NE-DQKFIDVMLSMIDDQFTQGYS  780
                G+   MK  A+ +D +L  WV+  R++R S   NE +Q FI  MLS+IDD     + 
Sbjct  238   TVRGYTAKMKGTARQLDQVLGRWVEEHRQKRLSGSINEAEQDFIHAMLSVIDDAQLSAHD  297

Query  779   YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS  600
             +  DTVIKA  L+++   ++T A  LTW L++L+ +P +LK+ Q+E+D ++G+ +   +S
Sbjct  298   HDHDTVIKATCLTVMLAGNDTIAITLTWALSLLMNNPRALKKAQEELDFHVGRNQQVYES  357

Query  599   DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI  420
             D+K L YLQ ++KETLR+YP GP   PHEA+EDC + G+HI  GT+L VN+W+LHRDP I
Sbjct  358   DIKKLVYLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQAGTRLLVNLWKLHRDPTI  417

Query  419   WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN  240
             W DP +F PERF+T   G   + + ++ +PFG GRR CPG   A +I Q+ +ARL  GF 
Sbjct  418   WSDPLEFQPERFLTKHVGLDVRGQHFELLPFGSGRRMCPGISLALEILQLTLARLLHGFE  477

Query  239   FSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
                V + PLDM E VG+ +PK TPLEV + PRL   L+ 
Sbjct  478   LGVVADSPLDMTEGVGLAMPKATPLEVTLVPRLPSELYH  516



>ref|XP_007134140.1| hypothetical protein PHAVU_010G022700g [Phaseolus vulgaris]
 gb|ESW06134.1| hypothetical protein PHAVU_010G022700g [Phaseolus vulgaris]
Length=530

 Score =   435 bits (1119),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 212/490 (43%), Positives = 303/490 (62%), Gaps = 8/490 (2%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             PE G A P IGHLH     +P  +T S  A+KYGP+F ++LG    +VV+S E  ++C  
Sbjct  42    PEPGVALPFIGHLHLLNARIPYFRTFSAMAEKYGPIFCVKLGCHPTIVVNSREIAKECLT  101

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
              ND++ A+RP T AG+ LGY++AVF  +   +YWR +RK+ V EI SS RLEKLKHV  S
Sbjct  102   KNDRVFASRPNTSAGRILGYNHAVFGLAPYGNYWREIRKMAVLEIFSSYRLEKLKHVRDS  161

Query  1223  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEA  1044
             E  + +KELY+ IS   N   + +V MS    H+T N+I++++AG+R+   +    + EA
Sbjct  162   ETLSLVKELYSSISSIKNVKGSTEVAMSNLLEHMTFNIIVRMIAGKRFGGDTVNEEDNEA  221

Query  1043  QRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARR  864
              +L+K      YL G FV  DAI  L    W D++GH+  MKR AK +D ILQ W++   
Sbjct  222   WKLRKAIKDATYLCGIFVVADAIPSL---SWFDFQGHLSFMKRTAKKLDFILQKWLEEHV  278

Query  863   KERRSNED----QKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTW  696
             K R  N +    + F+DVMLS  + Q      Y+R+ VIKA  + ++   S + A  LTW
Sbjct  279   KTRGDNMNGGCERDFMDVMLSSFEGQ-EDFCGYNREIVIKATSVLLVLTGSGSTAITLTW  337

Query  695   ILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPH  516
              L++LL HP  LK  Q E+D ++GKERW ++SD+KNL YL  ++KETLR+YP  P     
Sbjct  338   ALSLLLNHPRVLKAAQQELDNSVGKERWVQESDIKNLNYLHAIIKETLRLYPPAPLTGIR  397

Query  515   EAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQF  336
             EA+EDC V GYH+PKG +L +N+W L RDP++W +P +F PERF+T        ++ ++ 
Sbjct  398   EAMEDCCVAGYHVPKGARLLINLWELQRDPEVWSNPNEFNPERFLTTHRDIDFMSQNFEL  457

Query  335   VPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVL  156
             +PF  GRRSCPG  +  Q+  + +ARL QGF+ ST     +DM E +G+ LPK   L++ 
Sbjct  458   IPFSFGRRSCPGVTFGLQVLHLTLARLIQGFDMSTKDGAEVDMTEGLGVALPKENELQLT  517

Query  155   VTPRLSPTLF  126
             + PRL   L+
Sbjct  518   LAPRLPLMLY  527



>ref|XP_002284810.3| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=610

 Score =   438 bits (1126),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 225/500 (45%), Positives = 314/500 (63%), Gaps = 17/500 (3%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW  1428
             +K+ KR PPE  G WP+IGHLH       L +TL + ADKYGP+F +RLG+ + LVVSSW
Sbjct  117   KKRGKR-PPEPSGRWPLIGHLHLLGADKLLHRTLGDMADKYGPIFCVRLGLKKTLVVSSW  175

Query  1427  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE  1248
             E  ++C+ T+DK+ A RP + A K +GYD+  F F+    YWR VRKL + E+LS+R+LE
Sbjct  176   EVAKECYTTSDKVFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELLSNRQLE  235

Query  1247  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
               KHV  SE++  IKELY   + + + P+   V M   FG+L LN++++ +AG+RY    
Sbjct  236   MHKHVQDSEVKILIKELYGQWASNKDGPAL--VEMKERFGNLALNVVVRAIAGKRY--FG  291

Query  1067  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGHVKTMKRAAKDVDAI  891
                  +E +R KK F   + L G F+  D I    F  WLD  +G    MKR AK+VD +
Sbjct  292   THACGDEPKRAKKAFEDFIILLGLFMVSDVI---PFLGWLDTMKGFTAEMKRVAKEVDYV  348

Query  890   LQDWVDARRKERRSNED----QKFIDVMLSMIDD-QFTQGYSYSRDTVIKAIVLSMLQDA  726
             L  WV+  R+ R S  D    Q FI  MLS+IDD QF+       DT+IK    +++   
Sbjct  349   LGSWVEEHRQNRLSANDNGAEQDFIHAMLSVIDDGQFS---GRDPDTIIKGTCSNLILAG  405

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             ++T +  LTW L++LL +  +LK+ Q E++ ++GK R  + SD+KNL YLQ +VKETLR+
Sbjct  406   NDTTSITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRL  465

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP GP   PHEA+EDC V G+HI  GT+L VN+W+LHRDP++W DP +F PERF+T   G
Sbjct  466   YPPGPLSLPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTKHAG  525

Query  365   EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII  186
                + + Y+ +PFG GRR CPG  +A ++T + +ARL  GF    V + P+DM E  G+ 
Sbjct  526   LDVRGKNYELLPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTESPGLT  585

Query  185   LPKLTPLEVLVTPRLSPTLF  126
              PK TPLEV + PRL   L+
Sbjct  586   APKATPLEVTIVPRLPFELY  605



>gb|KDP38438.1| hypothetical protein JCGZ_04363 [Jatropha curcas]
Length=526

 Score =   435 bits (1118),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 214/497 (43%), Positives = 322/497 (65%), Gaps = 12/497 (2%)
 Frame = -1

Query  1601  QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEA  1422
             + +R  PEAGGAWP+IGHLH FR S PL   L + ADK GP+F I+LG+   LVVS+WE 
Sbjct  36    KRERKVPEAGGAWPLIGHLHLFRGSKPLHIILGKMADKMGPIFKIKLGMHPTLVVSNWEM  95

Query  1421  VRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKL  1242
              + C  TND++ A RP T A   +GY+ A+  FS    YWR++RK+ + E+LS++R++  
Sbjct  96    AKQCLTTNDQVFATRPKTLASVLVGYNRAMLPFSPYGPYWRQMRKIAILELLSNQRIQTQ  155

Query  1241  KHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEY-RSD  1065
               V  SE++T +KELY F   + N+ +   V M RWFG +TLNLI +I+ G+   Y  ++
Sbjct  156   SRVRESEVRTFLKELYKFWDKNKNSQNKVLVEMVRWFGDMTLNLICEIIVGKSVGYVTTE  215

Query  1064  GTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQ  885
             G    E++  K+    +  L G+FV+ DAI P  F RW D  G  K M + AK++D + +
Sbjct  216   G--GGESKIWKQGLRDLFDLIGKFVAADAI-P--FLRWFDIGGFEKAMIKTAKELDLVAE  270

Query  884   DWVDARRKERRSN---EDQKFIDVMLSMIDD-QFTQGYSYSRDTVIKAIVLSMLQDASET  717
              W+   +K+R S     ++ F+ +ML+++D  Q  QG     D + KA+ LS++  AS+T
Sbjct  271   GWLKEHKKKRASGFKQGEEHFMGLMLNILDHTQVAQGPH--SDPINKAVSLSLILVASDT  328

Query  716   FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ  537
              A  L W L++L+ +P +LK+ QDE+D ++G+ER  ++SD+KNL YLQ ++KETLR+YP 
Sbjct  329   TAVTLNWALSLLVNNPNALKKAQDELDMHVGRERQIQESDIKNLEYLQAILKETLRLYPA  388

Query  536   GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA  357
             GP   PHE+ EDC V GY IP GT+L +N+W++H DP++W +P +F PERF+T+ +    
Sbjct  389   GPLSLPHESTEDCTVGGYDIPAGTKLVINIWKIHHDPRVWENPFEFRPERFLTSHKDFDV  448

Query  356   QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPK  177
             + + ++F+PFG GRR CPG  +  Q+ Q+ +A L   F+  T  NEP+DM E++G+   +
Sbjct  449   RGQNFEFIPFGSGRRRCPGISFGLQVMQLTLANLLHSFDIETPSNEPVDMTENIGLTNLR  508

Query  176   LTPLEVLVTPRLSPTLF  126
              TPLE+L+ PRL P L+
Sbjct  509   ATPLEILMHPRLPPHLY  525



>ref|XP_006432711.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
 gb|ESR45951.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
Length=473

 Score =   432 bits (1112),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 217/497 (44%), Positives = 312/497 (63%), Gaps = 30/497 (6%)
 Frame = -1

Query  1601  QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEA  1422
             + KR  PEAGGAWP+IGHLH      PL + L   ADKYGP+FTI++GI+R LVVSSWE 
Sbjct  1     KKKRGAPEAGGAWPVIGHLHILGGPEPLHRVLGSMADKYGPIFTIKIGINRALVVSSWEM  60

Query  1421  VRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKL  1242
              ++C  TNDK+ A+RP T A + LGY++++F  S   SYWR  RK+   E+LS  RLEKL
Sbjct  61    AKECLTTNDKIFASRPKTLAMEILGYNFSMFGSSPYGSYWRETRKIATLELLSKHRLEKL  120

Query  1241  KHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDG  1062
             +HV   E++T +KELY      + + +   V M RWF     N+I++++ G         
Sbjct  121   RHVRDYEVKTCLKELYELWD-KSKSTNKMLVEMKRWFEDTICNVILRMIVG---------  170

Query  1061  TINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQD  882
                       K  + V  + G+FV  DA   L F RWLD  G  ++MK+ AK++D ++Q 
Sbjct  171   ----------KGCNSVDKMSGKFVVSDA---LPFLRWLDIGGDERSMKKTAKELDIVVQG  217

Query  881   WVDARRKERRS----NEDQKFIDVMLSMIDDQFTQGYS-YSRDTVIKAIVLSMLQDASET  717
              ++  +++R S     E+  F+ VMLS++ D  T+ YS    DT+ KA+ L ++    +T
Sbjct  218   CLEEHKRKRDSREMKGEELDFMSVMLSILGD--TEKYSGRDVDTINKAVCLGLIIAGLDT  275

Query  716   FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ  537
                 LTW++++LL H + L +VQ+E+D  +G +R   +SD+KNL YLQ  +KE +R+YP 
Sbjct  276   TTVTLTWVISLLLNHRDILDKVQNELDIQVGTKRQVNESDLKNLVYLQATLKEAMRLYPA  335

Query  536   GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA  357
              P L PHEA+E+C V+GYH+P GTQL +NVW+L RDP++W +P KF PERF+T  +    
Sbjct  336   VPLLIPHEAIEECTVNGYHVPAGTQLLINVWKLQRDPRVWEEPCKFQPERFLTKHKDIDV  395

Query  356   QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPK  177
             + +  + +PFG GRR CPG  +A Q+ Q  +A L QGF+F+T  NEPLDM E  G+ + K
Sbjct  396   RGQHLELLPFGSGRRMCPGVSFALQVMQFTIASLLQGFDFATPSNEPLDMGEGFGLTMEK  455

Query  176   LTPLEVLVTPRLSPTLF  126
               PLEVL+ PRLS +L+
Sbjct  456   SRPLEVLIAPRLSASLY  472



>ref|XP_010526010.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Tarenaya hassleriana]
Length=524

 Score =   433 bits (1114),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 226/527 (43%), Positives = 322/527 (61%), Gaps = 25/527 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFS-----WRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEW  1497
             L S+  I    L  FS     ++KQ  R  PE  G+WPI+GHLH       L+ +TL   
Sbjct  5     LGSLAPIFIASLFLFSVFATLFKKQKHRKAPEPTGSWPILGHLHLLGGKNNLLYRTLGAL  64

Query  1496  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST  1317
             AD+YGP F ++LG  + LVVSSW+  ++C   ND+  A+RP T   K++GY+YA+F F+ 
Sbjct  65    ADEYGPAFGLQLGSQKALVVSSWDVAKECLTVNDRTFASRPKTVGAKHMGYNYALFGFAP  124

Query  1316  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPK-VNMS  1140
              +SY+R +RK+V  E+LS++R++KL HV +SE++  IK++Y   S      S P  V++ 
Sbjct  125   YDSYFRDMRKIVTFELLSNQRIQKLSHVRISEIEMGIKDIYNLWS--KKGGSGPVLVDVK  182

Query  1139  RWFGHLTLNLIMQIVAGRRYEYRSDGTINE--EAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             +W   L LN+I+++VAG+RY +  D T +E  EA+R  K  ++   L G FV  DA   L
Sbjct  183   QWLEDLNLNMIVKLVAGKRYAF-GDATADEADEARRCPKATARFFQLMGLFVLSDA---L  238

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQF  795
              F    D +GH K MK+ A ++D IL+ W+    + R   E   D  FIDVMLS  +   
Sbjct  239   PFLGRFDLQGHEKEMKKNAAEIDGILEGWLQEHERRRALGETDGDSDFIDVMLSQKEQGK  298

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
                  +   T IKA  L+M+   S+T    L W  A+L  + E LK+ ++EID ++GK+R
Sbjct  299   LSNLKHDERTAIKATCLAMILGGSDTLVGTLVWAFALLANNREILKKAREEIDFHVGKDR  358

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
               EDSD++ L YLQ + KETLR+YP  P L P EA EDC V GYH+  GT+L VNVW++H
Sbjct  359   KVEDSDIEKLVYLQAITKETLRLYPAAPLLGPREATEDCTVAGYHVTAGTRLMVNVWKVH  418

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             RDPKIWP+P++F+PERF   LEG+A++     + Y+ +PFG GRRSCPG   A Q+  + 
Sbjct  419   RDPKIWPNPDEFIPERF---LEGKASEYSVRGQSYELLPFGSGRRSCPGISLAVQVLHLL  475

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +AR    F+ STV    +DM E  G+ +PK  PLEVL++PRL   L+
Sbjct  476   LARFLHSFDMSTVSGMDVDMGESPGLTIPKTKPLEVLLSPRLKKELY  522



>ref|XP_007222622.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
 gb|EMJ23821.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
Length=525

 Score =   433 bits (1114),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 220/521 (42%), Positives = 319/521 (61%), Gaps = 15/521 (3%)
 Frame = -1

Query  1661  CLSSILGIAALVLLWFSWR-KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1485
              +++ L    +V  +FS R + +K +P EA GAWPI GHL     S P    L+  ADKY
Sbjct  10    SITAFLFTIIIVSYYFSRRWRPAKLVPTEAKGAWPIFGHLPLLGGSTPPHIKLAAMADKY  69

Query  1484  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY  1305
             GP+FTIRLG+   LV+SS E  ++CF TND +L +RP      ++GY+ A+F F+ +  +
Sbjct  70    GPLFTIRLGVYPSLVISSSEIAKECFTTNDLVLNSRPKLAVVDHIGYNCAMFGFAPSGPF  129

Query  1304  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELY----TFISMDNNNPSAPKVNMSR  1137
             WR +RK+   E+LS+RRLE L+H+ VSE+ T ++EL+    T    ++NN     V + +
Sbjct  130   WREMRKITTLELLSNRRLELLRHIRVSEVTTFLQELFKTWSTAEKRESNNSDGVLVELKQ  189

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
             WFG +TLN+I+++VAG+RY   +D     EA+R++    +  Y  G FV GDA+    + 
Sbjct  190   WFGDMTLNVILRMVAGKRYSVAADEDEKTEARRVQSALKEFFYYVGLFVVGDAV---PYL  246

Query  956   RWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQK----FIDVMLSMIDDQFTQ  789
             RWLD  GH K MKR AK++DAI+  WV+   K RR+  D K    FID MLS++D     
Sbjct  247   RWLDLGGHEKAMKRIAKELDAIVGGWVE-EHKRRRARGDAKGEPDFIDAMLSVLDGADLG  305

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
             G+    DTV KA  L+M+   S+T    L W +++LL +P  LK  Q+E+DT IG++R  
Sbjct  306   GFD--ADTVNKATSLNMIAGGSDTTMVTLIWAISLLLNNPHVLKSAQNELDTEIGRQRVV  363

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
              +SD+  L Y+Q +VKETLR+YP  P   P E  +DC + GYH+ KGT+L  N+W++  D
Sbjct  364   SESDISKLVYIQAIVKETLRLYPAAPLSGPREFTKDCTIGGYHVSKGTRLITNLWKIQTD  423

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ  249
             P+IWPDP +F PERF+T+      +   ++ +PFG GRR+CPG  +A Q+ Q  +A    
Sbjct  424   PRIWPDPLEFKPERFLTSHRDVDVKGLHFELIPFGSGRRACPGLAFALQMVQFTLASFVH  483

Query  248   GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              F+ S   N P+DM E  G+   K TPL+VL+ PRL   L+
Sbjct  484   AFDISNPSNSPIDMTESFGLTNIKATPLQVLIKPRLPSQLY  524



>ref|XP_007226343.1| hypothetical protein PRUPE_ppa022174mg [Prunus persica]
 gb|EMJ27542.1| hypothetical protein PRUPE_ppa022174mg [Prunus persica]
Length=522

 Score =   433 bits (1113),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 226/523 (43%), Positives = 329/523 (63%), Gaps = 14/523 (3%)
 Frame = -1

Query  1670  VPCCLSSILGIAALVLLWFSWRKQSK--------RLPPEAGGAWPIIGHLHHFRTSVPLV  1515
             +PC  ++I GI A++L  +   K+S         +LP  AGG WP++GH   FR S    
Sbjct  5     LPCLNTAIAGILAILLFSYFIIKRSSSAAKAKGPKLPKVAGG-WPLLGHFGLFRGSQLPH  63

Query  1514  KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYA  1335
               L+   DKYGP FTI +GI   LV+S+WEA +DCF TND ++++RP T   K+LGY++A
Sbjct  64    IALASLVDKYGPAFTINIGIHSALVISTWEAAKDCFTTNDIVVSSRPATLGAKHLGYNFA  123

Query  1334  VFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP  1155
             +F F     YWR +RKL   E+LS+RRLE LK V VSE++ ++KELYT       +    
Sbjct  124   MFGFGPYGPYWREMRKLTSLELLSNRRLELLKKVRVSEVEMSLKELYTLWIKRKESSGER  183

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              V M +WFG LTLN+I ++VAG+R     + +  +EA+R +K   +  +L G FV GDA+
Sbjct  184   LVEMKQWFGDLTLNVIFRMVAGKRCFMNGNLSEEKEARRWQKAMREFFHLVGLFVLGDAV  243

Query  974   FPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQF  795
              P  +  WLD  G  K MK+ AK++D+I+ +W++  +++R   +DQ F+DVMLS ID + 
Sbjct  244   -P--WLSWLDLGGQQKAMKKTAKELDSIVAEWLEEHKQKRTKGKDQDFMDVMLSAIDGRD  300

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
               G+    DTVIKA  LS++   S+T    LTW L++LL + + LK+V +E+D  +GK R
Sbjct  301   VAGFD--ADTVIKATCLSLIAGGSDTTMVTLTWTLSLLLNNRQVLKKVYEELDQYVGKGR  358

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
               ++SD+ NL YLQ  VKE +R+ P GP     E  EDC V GYH+PKGT L VN+W++ 
Sbjct  359   LLDESDINNLVYLQATVKEVMRLCPAGPLSGQREFTEDCTVGGYHVPKGTWLLVNLWKIQ  418

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
              DP++W DP +F P+RF+T  +    + +Q++ +PFG GRR+CPG  +  Q+T + +A  
Sbjct  419   TDPRVWADPMEFKPDRFLTTHKDVDVRGQQFELMPFGSGRRACPGISFGLQMTLLTLASF  478

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
                F+ +T  N P+DM   +G+   KLTPL+VLV PRLSP L+
Sbjct  479   LHSFDVTTQENAPVDMTGSIGLTNIKLTPLDVLVKPRLSPNLY  521



>ref|XP_009364169.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=528

 Score =   433 bits (1113),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 220/528 (42%), Positives = 327/528 (62%), Gaps = 17/528 (3%)
 Frame = -1

Query  1673  AVPCCLSSILGIAALVLLWFSWRKQSKRL-------PPEAGGAWPIIGHLHHFRTSVPLV  1515
             ++P   +++ G+ A++L  F + ++ +         PP+  G  P++GHL  F  S    
Sbjct  4     SLPFLNTAVAGLFAILLFSFYFIQKFRAASNARGSKPPKLAGGLPVLGHLDLFGGSQLPH  63

Query  1514  KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYA  1335
              TL    DKYGP+FTI++GI   LV+++WEA ++CF TND ++++RP T   K+L YD+A
Sbjct  64    ITLGALVDKYGPIFTIKIGIHSALVINTWEAAKECFTTNDSIVSSRPATLGIKHLSYDFA  123

Query  1334  VFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAP  1155
             +F FS   SYWR +RKL+  E+LS+RRLE LK V VSE++ ++KELY   +   +  S+ 
Sbjct  124   MFGFSPYGSYWREIRKLISIEVLSNRRLELLKSVRVSEVEMSLKELYKRWTERKDGASSG  183

Query  1154  --KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEE--AQRLKKVFSQVMYLWGEFVS  987
                V M RWFG LTLN++++++AGRR     +G +N+E  A+  +    +   L G FV 
Sbjct  184   DISVEMKRWFGDLTLNVVLRMIAGRRDFNVVNGNLNDEKEARTWQNAMREFFRLVGMFVL  243

Query  986   GDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQK-FIDVMLSM  810
             GDAI  LW   WLD  GH K MK+ AK +D+I+  W++  ++ R    DQ+ F+ VMLS+
Sbjct  244   GDAIPWLW---WLDLGGHQKAMKQTAKALDSIVMGWLEEHKQRRAEGHDQQDFMGVMLSV  300

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
             +D     G+    DTVIKA  L+++   S+T    L W L++LL +  +LK+V +E+D +
Sbjct  301   LDGAHVSGFD--TDTVIKATCLALIAGGSDTTTVTLIWTLSLLLNNRHALKKVHEELDKH  358

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +GKER   +SD+ NL YLQ  VKE +R+ P GP     E  ED  V GYH+PKGT L VN
Sbjct  359   VGKERLVNESDISNLVYLQATVKEAMRLCPAGPLSGQREFTEDGTVGGYHVPKGTWLLVN  418

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             +W++  DP++W DP +F PERF+T  +    + + ++ +PFG GRR+CPG  +  Q T +
Sbjct  419   LWKIQTDPRVWADPMEFKPERFLTTHKDIDVRGQHFELMPFGSGRRACPGITFGLQATLL  478

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +A     F+ ST+ N P+DM   VG+   KLTPL+VLV PRLS  +F
Sbjct  479   TLAGFLHAFDVSTLKNAPVDMTGSVGLTNMKLTPLDVLVKPRLSSQIF  526



>gb|KDP38423.1| hypothetical protein JCGZ_04348 [Jatropha curcas]
Length=561

 Score =   434 bits (1116),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 217/497 (44%), Positives = 323/497 (65%), Gaps = 17/497 (3%)
 Frame = -1

Query  1592  RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             R  PE  GAWPIIGHLH    +  L+ +TL   ADKYGP F IR+G     VV+S E  +
Sbjct  72    REAPEPSGAWPIIGHLHLLGGADKLLHQTLGLMADKYGPAFNIRIGSHCAFVVASSELAK  131

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +CF  NDK +A+RPTT A K++ Y++AVF F+ ++S+WR +RK+V+ E+LS+RRLE +KH
Sbjct  132   ECFTINDKDVASRPTTAATKHMCYNHAVFGFAPHSSHWREMRKIVMLELLSNRRLEMVKH  191

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTI  1056
             V  SE+   IK+LY   + +N  P    V + +WF  LTLN+I+++VAG+RY   SD   
Sbjct  192   VQNSEVNLGIKKLYHLWAENNCLPVL--VELKQWFEDLTLNVIVRVVAGKRYTGSSD---  246

Query  1055  NEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWV  876
             ++ A+R +   S+  +L G FV  DA   L F +WLD EGH + MK+ AKD+DA+L+ W+
Sbjct  247   DDGARRCQNAISKFFHLMGIFVVSDA---LPFLQWLDLEGHQRAMKKTAKDLDAVLEGWL  303

Query  875   DARRKER-------RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET  717
                R++R       ++  +Q FIDVMLS+ +     G+ Y  DT IK+  L+++  AS+T
Sbjct  304   TEHRQKRVSVLGEAKTEGEQDFIDVMLSLEEKGHLSGFIYDADTSIKSTCLALIAGASDT  363

Query  716   FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ  537
               T LTW +++LL +  +LK+ ++E+D ++G ER  ++SD+K+L Y+Q ++KETLR+YP 
Sbjct  364   TTTTLTWAISLLLNNKSALKKAREELDLHVGPERQVDESDLKSLVYIQAIIKETLRLYPV  423

Query  536   GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA  357
              P L P E  +DC + GYH+P GT+L VN W++ RDP+ W +P  F PERF+T+      
Sbjct  424   AP-LIPREFTKDCTIAGYHVPAGTRLLVNAWKIQRDPRYWTNPSAFQPERFLTSHANVDV  482

Query  356   QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPK  177
             + + ++ +PFG GRRSCPG  +A     + +AR    F+ +T  ++P+DM E  G  LPK
Sbjct  483   RGQHHELIPFGSGRRSCPGAAFALHALHLTLARFLHAFDLATTMDKPVDMTETPGTTLPK  542

Query  176   LTPLEVLVTPRLSPTLF  126
              TPL+VL++PRL   L+
Sbjct  543   ATPLDVLLSPRLPAELY  559



>ref|XP_006432704.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
 ref|XP_006471494.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45944.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
Length=525

 Score =   432 bits (1112),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 208/496 (42%), Positives = 317/496 (64%), Gaps = 15/496 (3%)
 Frame = -1

Query  1601  QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEA  1422
             + KR  PEAGGAWP+ GHLH      P  + L   ADK GP+FTI++GI+R LVVS+WE 
Sbjct  40    KKKRRAPEAGGAWPVTGHLHLLGGPEPPHRVLGAMADKCGPIFTIKMGINRALVVSNWEM  99

Query  1421  VRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKL  1242
              ++C  T+DK+ A+RP T A +  GY++++F FS   SYWR  RK+   E+LS+ RLEKL
Sbjct  100   AKECLTTHDKVFASRPKTLAMEIFGYNFSMFGFSPYGSYWRETRKIATVELLSNHRLEKL  159

Query  1241  KHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDG  1062
             KHV   E++T +KELY     + +      V + RWF     N++++++ G+       G
Sbjct  160   KHVRDYEVKTCLKELYELWDKNKSTNEMLLVELKRWFADTIRNVVLRMIVGK-------G  212

Query  1061  TINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQD  882
               + + +   ++ ++   + G+FV  DA   L F RWLD  G  ++MK  A+++D +LQ 
Sbjct  213   CNSVDGEEWMELLTRSFEMSGKFVVSDA---LPFLRWLDIGGDERSMKNIAEELDNLLQG  269

Query  881   WVDARRKERRSNEDQK----FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
             W++  +++R S E ++    F+ VML ++ D+  Q      DTV KA  L ++  A++T 
Sbjct  270   WLEKHKRKRNSQEIKEEELDFMSVMLLILGDK-EQYSGRDVDTVNKATCLGLILAATDTT  328

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
             A  LTW++++LL H + L + Q+E+D  +G +R   +SD+KNL YLQ ++KET+R+YP  
Sbjct  329   AVTLTWVISLLLNHRDILNKAQNELDIQVGSKRQVNESDIKNLVYLQAILKETMRLYPAV  388

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P L PHE++E+CIV+GYHIP GTQL++N W+L RDP++W +P KF P+RF+T  +    +
Sbjct  389   PLLVPHESMEECIVNGYHIPAGTQLFINAWKLQRDPRVWEEPYKFHPKRFLTRHKDIDVK  448

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
              + ++ +PF  GRR CPG  +A Q+ Q  +A L  GF+F+T  NEP+DM E +G+ + K 
Sbjct  449   GQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLHGFDFATPSNEPVDMGEGLGLTMEKS  508

Query  173   TPLEVLVTPRLSPTLF  126
             TPL VLV PRLS +L+
Sbjct  509   TPLVVLVAPRLSASLY  524



>ref|XP_006464299.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   432 bits (1112),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 216/498 (43%), Positives = 312/498 (63%), Gaps = 16/498 (3%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW  1428
             + Q+    P AGGAWP+IGHLH      P  + L + ADKYGP+FT+++G++R LVVS+W
Sbjct  36    KTQAPHQAPVAGGAWPVIGHLHLLGGQEPTHRLLGDMADKYGPIFTMKMGLNRALVVSNW  95

Query  1427  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE  1248
             E  ++CF  NDK  A RP + A   LGY++     S   +YWR  RK+   E+LS+ +L+
Sbjct  96    EIAKECFTINDKPFANRPRSMAMDLLGYNFLAIAASPYGNYWRESRKMATIELLSNNQLQ  155

Query  1247  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
             KLKHV  SE++ +IK L  F +   ++     V M  W   + L++IM+I+AG+RY  + 
Sbjct  156   KLKHVRESEVKASIKGL--FENCKRSSSHKVSVEMKHWIEGIVLDIIMRIIAGKRYTSQD  213

Query  1067  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL  888
                  E A       +    L+G+FV  DA   L F RWLD  G+ K MK+ AK+ D + 
Sbjct  214   SSDFQEHA-------TDFFDLFGKFVVSDA---LPFLRWLDIGGYEKLMKKTAKEFDLVF  263

Query  887   QDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQ-GYSYSRDTVIKAIVLSMLQDASE  720
             Q W+D  + +R S+E   D+ F+ VMLS+ DD+  Q       DTVIKAI LS++  AS+
Sbjct  264   QGWLDEHKSKRGSSEVKGDEDFMYVMLSLFDDKTKQLPGGDDTDTVIKAICLSLILAASD  323

Query  719   TFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYP  540
             T A  LTW +A+LL + + L++ Q+E+D ++G  R   +SD+ NL +LQ V+KETLR+YP
Sbjct  324   TTAVTLTWAIALLLNNRDVLEKAQNELDVHVGTNRQVNESDMINLAHLQVVLKETLRLYP  383

Query  539   QGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA  360
               P L PHE++EDC + GYH+P GTQL VN W++ RDP +W +P KFLPERF+T  +   
Sbjct  384   AAPLLLPHESIEDCTISGYHVPAGTQLIVNAWKIQRDPGVWEEPCKFLPERFLTKYKDVD  443

Query  359   AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILP  180
              + + ++F+PFG GRR CPG  +A Q+  + +A L  GF+F+T  +  +DM E   +   
Sbjct  444   LKGQNFEFIPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAAVDMEEAKSLTYA  503

Query  179   KLTPLEVLVTPRLSPTLF  126
             K TPLEVL+TPRLS +L+
Sbjct  504   KATPLEVLLTPRLSASLY  521



>ref|XP_006283535.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
 gb|EOA16433.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
Length=524

 Score =   432 bits (1112),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 218/516 (42%), Positives = 327/516 (63%), Gaps = 23/516 (4%)
 Frame = -1

Query  1631  LVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGI  1455
             L+ L+   +K      P+  GAWPIIGHLH       L+ +TL + AD YG   +++LG 
Sbjct  17    LIALFKKSKKPKHVKAPKPSGAWPIIGHLHLISGKEQLLYRTLGKMADHYGAAMSLQLGS  76

Query  1454  SRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVE  1275
             S   VVSS+E  +DCF  NDK LA+RP T A K++GY++AVF F+  +++WR +RK+   
Sbjct  77    SEAFVVSSFEVAKDCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATI  136

Query  1274  EILSSRRLEKLKHVWVSELQTNIKELYTF-ISMDNNNPSAPKVNMSRWFGHLTLNLIMQI  1098
             E+LS+RRL+ LKHV VSE+   +  LY+  +    + P    V++  W   +TLN+++++
Sbjct  137   ELLSNRRLQMLKHVRVSEISMGVNYLYSLWVKKGGSEPVM--VDLKSWLDDMTLNMVVRM  194

Query  1097  VAGRRYEYRSDGTIN----EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV  930
             VAG+RY +   G+ +    EEA++ KK  ++  +L G F   DA FP     W D +GH 
Sbjct  195   VAGKRY-FGGAGSESSKDTEEARQCKKAIAKFFHLIGIFTVSDA-FPT--LGWFDLQGHE  250

Query  929   KTMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTV  762
             K MK+   ++D IL+ WV+  R++R+       D  FIDVMLS+ +        Y  +  
Sbjct  251   KEMKQTGIELDVILERWVENHRQQRKVSGPKENDSDFIDVMLSLAEQGKLSHLQYDANIS  310

Query  761   IKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLP  582
             IK+  L+++   SET ++ LTW +A+LL + E LK+ QDEID ++G ER  EDSD++NL 
Sbjct  311   IKSTCLALILGGSETTSSTLTWAIALLLNNKEMLKKAQDEIDLHVGTERNVEDSDIENLV  370

Query  581   YLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEK  402
             Y+Q ++KETLR+YP GP L P EA+EDC V G+++ +GT+L VNVW++ RDP+++ +P +
Sbjct  371   YVQAIIKETLRLYPAGPLLGPREAMEDCTVAGHNVSRGTRLIVNVWKIQRDPRVYMEPNE  430

Query  401   FLPERFMTNLEGEA----AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS  234
             F PERF+T   GEA     + + ++ +PFG GRRSCPG+  A Q+  + +AR+ Q F+  
Sbjct  431   FRPERFVT---GEAKKFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARILQSFDVK  487

Query  233   TVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             TV +  +DM E  G+ +PK TPLEVL++PRL   LF
Sbjct  488   TVSDMAVDMSESPGLTIPKATPLEVLISPRLKEHLF  523



>ref|XP_006471151.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=558

 Score =   433 bits (1114),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 222/514 (43%), Positives = 319/514 (62%), Gaps = 17/514 (3%)
 Frame = -1

Query  1625  LLWFSWRKQS---KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGI  1455
             LLW S R ++   K+  PE GGAWP+IGHLH      P   TL   A+K GP+F I+LG+
Sbjct  47    LLWLSRRHRNSIDKKPVPEPGGAWPLIGHLHLLGGQKPAYVTLGNIAEKCGPIFMIKLGM  106

Query  1454  SRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVE  1275
              R L+VS+WE  ++CF TNDK+ + R    A + LGY+YA+F FS    YWR++RK+   
Sbjct  107   HRALIVSNWEIAKECFTTNDKVFSNRIKALAPEILGYNYAMFGFSPYGPYWRQIRKIATL  166

Query  1274  EILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIV  1095
             E+LS+ RLE LKHV  SE++T++KELY      ++      V M   F  +TLN+  ++V
Sbjct  167   EVLSNHRLEMLKHVRESEVRTSMKELYDEWMKHSDGSGKALVEMKERFNAVTLNVATRMV  226

Query  1094  AGRRYEYRSDGT-----INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV  930
              G+R      G      I+EE  R +K   +   L G F   DA+    F RWLD +G  
Sbjct  227   VGKRLFVGGTGKTNHQEIDEENDRCRKAIRKFSELTGGFAIADAV---PFLRWLDLDGCE  283

Query  929   KTMKRAAKDVDAILQDWVDARRKERRSNEDQ------KFIDVMLSMIDDQFTQGYSYSRD  768
             K+M R AK++D IL+ W+   +++R S++DQ       F+DVM+S++ +   +  S+  D
Sbjct  284   KSMGRTAKELDQILEGWLKDHKQKRISSDDQVIKDENDFMDVMISVLTEADEEIPSFDAD  343

Query  767   TVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKN  588
             T+ KA  L+++   ++T    LTW L ++L H + LK+VQDE+DT+IG+ER   +SD K 
Sbjct  344   TITKATCLALILGGTDTTMVTLTWALTLVLNHGDVLKKVQDELDTHIGRERQVNESDTKK  403

Query  587   LPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDP  408
             L YLQ VVKETLR+YP  P   PHE++EDC + GYH+P GT+L+VN+ ++ RDP +W  P
Sbjct  404   LVYLQAVVKETLRLYPATPLSVPHESIEDCTIAGYHVPAGTRLFVNIPKIQRDPNVWEKP  463

Query  407   EKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTV  228
              +F PERF+T  +    + + ++ +PFG GRR CPG  +A Q+  + +A L  GF F+T 
Sbjct  464   NEFRPERFLTTHKDIDVRGQNFELIPFGSGRRGCPGISFALQVLLLTLASLLHGFEFATP  523

Query  227   PNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +EPLDM E VG+   K TPL+VL+TPRL   LF
Sbjct  524   GDEPLDMSEGVGLTNLKATPLQVLLTPRLHAPLF  557



>gb|AGO03797.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=518

 Score =   432 bits (1110),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 215/512 (42%), Positives = 320/512 (63%), Gaps = 15/512 (3%)
 Frame = -1

Query  1649  ILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT  1470
             +L IA ++L      +     PP A GAWPIIGHLH    S P    L +WADKYGP+FT
Sbjct  12    VLVIAFMILNKMRVNRSKHNAPPRAKGAWPIIGHLHLVAGSRPRQHVLGDWADKYGPIFT  71

Query  1469  IRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVR  1290
             I+LG  + LVVSS E  ++CF TNDK+ A+RP   A + +GY+YA+F  +    YWR+ R
Sbjct  72    IKLGFHQALVVSSTEIAKECFTTNDKVFASRPKAKAVEIMGYNYAMFGLAPYGDYWRQER  131

Query  1289  KLVVEEILSSRRLEKLKHVWVSELQTNIKELYTF--ISMDNNNPSAPKVNMSRWFGHLTL  1116
             K++  E+LS RR+E L HV  SE++ ++K+++     + +N   +  KV+M +WFG L L
Sbjct  132   KIITLEVLSPRRVEMLGHVRESEIRASLKDIHVAWENNKENEGSNMVKVDMKQWFGTLVL  191

Query  1115  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG  936
             N+++++++G+R+        +EE    + V  + + L G FV+ D I P  +    D  G
Sbjct  192   NIVVRVISGKRFPAN-----DEEGVHFQNVLRKNVVLMGAFVASDYI-P--YIDRFDLGG  243

Query  935   HVKTMKRAAKDVDAILQDWVDARRKERRSNE----DQKFIDVMLSMIDDQFTQGYS-YSR  771
             + K MK   K++D I++ W+  RR+E  S +    +Q F+DV++S +     + +S +  
Sbjct  244   YQKEMKLVWKELDDIMEGWLQERRREMESGQQLERNQAFMDVLISSLQGAPKEDFSDFDH  303

Query  770   DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVK  591
             DTVIKA  L ++    +T +  LTW+L +LL +P++L+ VQ+EID ++G++R  E+SD+K
Sbjct  304   DTVIKASCLELITAGLDTTSVTLTWVLCLLLNNPKALRTVQEEIDEHVGRDRPVEESDMK  363

Query  590   NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPD  411
             NL YL  V+KET+R+YP  P   PHE+ EDC+V GY++PKGT+L +N+W+LHRDP IW D
Sbjct  364   NLLYLGAVIKETMRLYPAAPLAVPHESTEDCVVSGYNVPKGTRLLINLWKLHRDPNIWSD  423

Query  410   PEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST  231
             PE+F PERFMT  +    + R Y  +PFG GRR CPG  +A Q   + +A L Q F    
Sbjct  424   PEEFKPERFMTTNKDIDVKGRHYDLLPFGSGRRMCPGIYFALQAMHLTLATLIQQFELVK  483

Query  230   VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSP  135
               +E +DM E  G+   K TPLEVL++PR  P
Sbjct  484   PTDEQIDMSERSGLTTSKATPLEVLLSPRSVP  515



>ref|XP_010106079.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07349.1| Cytochrome P450 82A3 [Morus notabilis]
Length=528

 Score =   432 bits (1110),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 230/519 (44%), Positives = 332/519 (64%), Gaps = 15/519 (3%)
 Frame = -1

Query  1670  VPCCLSSILGIAALVLLWFSWRKQ-SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWA  1494
             VP     ++G+  L L    W+++ S+R PPEAGGAWPIIGHLH      P   TL+  A
Sbjct  10    VPATAPILVGL--LFLFHLLWKQRFSRRTPPEAGGAWPIIGHLHLLAGPQPPHITLAHMA  67

Query  1493  DKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTN  1314
             DKYGP+FTI++G+ R LVVSSWE  ++C  TNDK+ A RP   A +++ Y+YA+F FS  
Sbjct  68    DKYGPIFTIKMGVHRALVVSSWEMAKECLTTNDKIFANRPKAAAPEHMTYNYAMFGFSPY  127

Query  1313  NSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTF---ISMDNNNPSAPKVNM  1143
               YWR+VRK+   E+LS+ RLE L HV VSE+ T IKE Y      +   NN +   V M
Sbjct  128   GPYWRQVRKIATLELLSNHRLEMLSHVRVSEVNTAIKEKYELWVKNNNSGNNNNGVGVEM  187

Query  1142  SRWFGHLTLNLIMQIVAGRRY-EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
              +WFG +TLN+I ++V G+RY E  S   I  +  R +K       L G FV  DA   L
Sbjct  188   KKWFGDITLNVIFRMVVGKRYLEATSLSEIGSD-DRCRKALRDFFELTGTFVVSDA---L  243

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDD-Q  798
              + +WLD+ G+ K+MK+ +K++D + Q W++  +++R S E   DQ F+DVMLS++D  +
Sbjct  244   PYLKWLDFGGYEKSMKKTSKELDQLAQRWLEEHKRKRVSGEVNGDQDFMDVMLSILDGAE  303

Query  797   FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE  618
                  +Y  DT+ KA  L+++   ++T    +TW LA+LL + E+LK+ + E+D  +GKE
Sbjct  304   LGISSTYDADTINKATSLALILAGTDTTTVTMTWALALLLNNREALKKAEQELDLYVGKE  363

Query  617   RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL  438
             R  ++SD+KNL YLQ ++KET+R+YP GP   PHE+ EDC V GYH+P GT+L +N+ +L
Sbjct  364   RQVKESDLKNLVYLQAILKETMRLYPAGPLSLPHESTEDCTVGGYHVPAGTRLLLNLSKL  423

Query  437   HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR  258
             H DPK+W  P +F PERF+T  +    + + ++ +PF  GRR CPG  +A Q+ Q+ +A 
Sbjct  424   HLDPKVWDQPSEFRPERFLTAHKNVDVRGQNFELIPFSSGRRMCPGVSFALQVMQLTLAA  483

Query  257   LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
             L  GF  +T  +EP+DM E VG+   K TPL+V++TPRL
Sbjct  484   LLHGFKIATRSDEPVDMRETVGLTNLKATPLDVIITPRL  522



>ref|XP_010069622.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Eucalyptus 
grandis]
Length=478

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 214/474 (45%), Positives = 309/474 (65%), Gaps = 20/474 (4%)
 Frame = -1

Query  1496  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST  1317
             ADK GP+F IRLG+    ++SS EAVR CF T+DK LA+RP +  G + GY YA F F+ 
Sbjct  2     ADKQGPMFRIRLGVHPATIISSQEAVRKCFTTHDKDLASRPKSKVGIHFGYGYAGFGFAE  61

Query  1316  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFI---SMDNNNPSAPKVN  1146
                 WR +RK+ + E+LS+RRL+ LKHV  SE+ T +K+L+      ++D  N S+  V 
Sbjct  62    YGDLWREMRKITMLELLSTRRLDNLKHVQASEIDTFVKDLHALCRTNAIDAQNGSSKVVV  121

Query  1145  MSRWFGHLTLNLIMQIVAGRRY------EYRSDGTINEEAQRLKKVFSQVMYLWGEFVSG  984
             +S+    LTLN+I++++A +RY         S    +EEA  L+KV  + MY+ G F + 
Sbjct  122   ISQLLELLTLNIIIRMIASKRYFGLLSASTGSSTDDDEEASHLRKVIKEFMYISG-FPTV  180

Query  983   DAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE--------DQKFI  828
               + P  F  W D  G VKTMKR A+++D I+  WV+  + +R  ++         + FI
Sbjct  181   SELVP--FTGWTDCVGTVKTMKRVAREMDEIVGKWVEEHKLKREGDQRGEVIGDVKEDFI  238

Query  827   DVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQ  648
             DVMLS+I +     + +S +T+IKA V++++   S+T + +LTW+L++LL H   LKR Q
Sbjct  239   DVMLSVIGEDGLAQFGHSPETLIKATVVNIIVAGSDTTSLNLTWVLSLLLNHKHVLKRAQ  298

Query  647   DEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKG  468
             +EID  +GK++W +DSD+ +L YLQ +VKETLR+YP GP   PHEA  DC V GY IPKG
Sbjct  299   EEIDLKVGKDKWVQDSDIGSLHYLQAIVKETLRLYPPGPLSIPHEARADCNVRGYLIPKG  358

Query  467   TQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYA  288
             T+++VNVW+LHRDP++W DPEKFLPERF+TN  G  A  + ++F+PFG GRR CPG  +A
Sbjct  359   TRIFVNVWKLHRDPQVWSDPEKFLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAFA  418

Query  287   TQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              + T + +ARL QGF+ +   +E +DM E +G+ LPK TPL V++ PRL   L+
Sbjct  419   LRATHLTLARLLQGFDLAISSDELVDMTEGIGLNLPKATPLRVVLNPRLPSMLY  472



>ref|XP_002869302.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45561.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   431 bits (1109),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 212/499 (42%), Positives = 320/499 (64%), Gaps = 21/499 (4%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCF  1407
             P   GAWPIIGHLH       L+ +TL + AD YGP  ++RLG S   VVSS+E  ++CF
Sbjct  33    PAPSGAWPIIGHLHLLSGKEQLLYRTLGKMADHYGPAMSLRLGSSETFVVSSFEVAKECF  92

Query  1406  ATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWV  1227
               NDK LA+RP + A K++GY++AVF F+   ++WR +RK+   E+LS+RRL+ LKHV V
Sbjct  93    TVNDKALASRPMSAAAKHMGYNFAVFGFAPYGAFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1226  SELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTIN--  1053
             SE+   +K+LY+ + +         V++  W   ++LN+++++VAG+RY +   G+++  
Sbjct  153   SEIAMGVKDLYS-LWVKKGGAEPVMVDLQSWLEDISLNMMVRMVAGKRY-FGGGGSLSSE  210

Query  1052  --EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW  879
               EEA++ +K  +   +L G F   DA FP     W D +GH K MK+  +++D IL+ W
Sbjct  211   DTEEARQCRKGVANFFHLVGIFTVSDA-FPK--LGWFDLQGHEKEMKQTGRELDVILERW  267

Query  878   VDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
             ++  R++R+     + D  FIDVMLS+ +        Y  +T IK+  L+M+   +ET  
Sbjct  268   IENHRQQRKVSGTKHNDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLAMILGGTETSP  327

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
               LTW +++LL + E LK+ Q+EID ++G++R  EDSD++NL YLQ ++KETLR+YP GP
Sbjct  328   ATLTWAISLLLNNKEMLKKAQEEIDIHVGRDRNVEDSDIENLVYLQAIIKETLRLYPAGP  387

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ-  354
              L   EA+EDC V GY++P GT++ VNVW++ RDPK++ +P++F PERF+T   GEA + 
Sbjct  388   LLGHREAMEDCTVAGYNVPCGTRMLVNVWKIQRDPKVYMEPDEFRPERFIT---GEAKEF  444

Query  353   ---NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
                 + ++ +PFG GRRSCPG   A Q+  + +AR    F   TV + P+DM E  G+ +
Sbjct  445   DVRGQNFELMPFGSGRRSCPGASLAMQVLHLGLARFLHSFEVKTVMDMPVDMSESPGLTI  504

Query  182   PKLTPLEVLVTPRLSPTLF  126
             PK TPLEVL++PRL   LF
Sbjct  505   PKGTPLEVLISPRLKEELF  523



>ref|XP_006465163.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=527

 Score =   431 bits (1109),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 215/499 (43%), Positives = 308/499 (62%), Gaps = 16/499 (3%)
 Frame = -1

Query  1595  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             KR  PEAGG WP+IGHLH      PL K L + ADKYGP+ TI++G+ R LVVS+WE  +
Sbjct  29    KRGAPEAGGGWPVIGHLHLLGRPEPLHKVLGKIADKYGPILTIKIGVHRTLVVSNWEIAK  88

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +C  T+DK+ A RP T AG  L YD ++  F     YWR++RK+   E+LSS RLE LK+
Sbjct  89    ECLTTSDKVFATRPKTVAGDILCYDSSLLGFVPYGHYWRQIRKIATLELLSSYRLESLKY  148

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPK-VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGT  1059
             V  SE++T +KELY     D      P  V+M +W  ++TLN+I+++V G+R        
Sbjct  149   VRESEVRTCLKELYNL--WDAGLDKVPVLVDMKKWCEYVTLNVILRMVVGKRCNISISQK  206

Query  1058  INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW  879
                  Q  K   S+     G+ V  DA   L F RWLD  G  + MK+ A+++D I+Q W
Sbjct  207   GASSDQGWKDELSRFFEFMGKLVVSDA---LPFLRWLDIGGDERLMKKTARELDLIMQRW  263

Query  878   VDARRKERRSNEDQ------KFIDVMLSMIDDQFTQGY-SYSRDTVIKAIVLSMLQDASE  720
             +D  R++  S +DQ       F+  MLS++DD   Q +     DT+ KA  L+++   S+
Sbjct  264   LDEHRRKGDSGDDQIKGREGNFMGAMLSILDDIGAQEFPGRDADTINKATCLALILGGSD  323

Query  719   TFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYP  540
             T +  LTW +++LL +  +LKR  +E+D  +GKER  ++SD +NL YLQ ++KETLR+YP
Sbjct  324   TTSGTLTWAISLLLNNRHALKRAHEELDQQVGKERAVDESDTQNLVYLQAIIKETLRLYP  383

Query  539   QGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA  360
              GP LAP EA+EDC V GYH+P GT+L +N W++ RDP++W +P  F PERF+      A
Sbjct  384   AGPLLAPREAMEDCTVSGYHVPAGTRLMINAWKIQRDPRVWENPSAFQPERFLPGHGAHA  443

Query  359   ---AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI  189
                 + +Q++ +PFG GRRSCPG   A Q+  + +ARL   F  +T  ++P+DM E  G+
Sbjct  444   DVDVRGQQFELIPFGSGRRSCPGASSALQVLHLTLARLLHAFELATPLDQPVDMSESPGL  503

Query  188   ILPKLTPLEVLVTPRLSPT  132
              +PK TPL+VL++PRL P 
Sbjct  504   TIPKATPLKVLLSPRLLPA  522



>ref|XP_004238201.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=520

 Score =   431 bits (1108),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 212/507 (42%), Positives = 319/507 (63%), Gaps = 20/507 (4%)
 Frame = -1

Query  1619  WFSWRKQSK--RLPPEAGGAWPIIGHLHHFRTS----VPLVKTLSEWADKYGPVFTIRLG  1458
             ++S +KQS   R  PEAGGAWPIIGHLH    S    +P  K L   ADKYGP+F ++LG
Sbjct  24    FYSVKKQSSSSRKVPEAGGAWPIIGHLHLLGGSESDHLPH-KMLGRLADKYGPIFGMKLG  82

Query  1457  ISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVV  1278
             + +++VVS  +  ++CF TND  LA RP + A + +GY +A+F   +   YWR  RK+  
Sbjct  83    VHQVVVVSDHKLAKECFTTNDLALAGRPKSMASEIIGYKHAMFGLCSYGPYWRETRKIAT  142

Query  1277  EEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQI  1098
              E+ S+RR+E LKH+   E+++ IKE+Y     +N N    K+ M  W G L +N + +I
Sbjct  143   IELFSARRIEMLKHIREFEVKSGIKEIYNNWEKNNLN-GVVKMEMKEWIGDLFMNTMGKI  201

Query  1097  VAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMK  918
             + G+      D  IN+  + +++ F     L G FV  D    L + RWLD  GH K MK
Sbjct  202   LFGKGRRSNEDEGINKAHKAIRRFFE----LLGVFVVADF---LPYLRWLDIGGHEKAMK  254

Query  917   RAAKDVDAILQDWVDARRKER---RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV  747
               +K++D+++++W+   + +R   +S E++ F+DVMLS+ +D+   G     DT IKA  
Sbjct  255   EVSKEMDSVVEEWLTEHKTKRGIIKSGEEEDFMDVMLSVCEDRDLPGVD--ADTAIKATC  312

Query  746   LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV  567
             +++L   ++T    LTWIL++LL + +SL++ QDE+D ++GK RW ++SD+KNL Y Q +
Sbjct  313   MALLSAGTDTTMVTLTWILSLLLNNYQSLQKAQDELDAHVGKNRWVQESDIKNLVYFQAI  372

Query  566   VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER  387
             VKE LR+YP GP   PHE++EDC + GY IPKGT+L VN+W++ RDP IWP+P +F PER
Sbjct  373   VKEALRLYPAGPLSLPHESMEDCTISGYDIPKGTRLLVNIWKIQRDPNIWPNPHEFKPER  432

Query  386   FMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDM  207
             F++  +    +   ++ +PFG GRR CPG   A Q+    +A L QGF+   + +EP+DM
Sbjct  433   FLSTHKDVDVKGNHFELMPFGSGRRMCPGISLALQVLPFVIAMLLQGFDMKRLLDEPIDM  492

Query  206   MEDVGIILPKLTPLEVLVTPRLSPTLF  126
              E  G+ + K +PLEVL+ PRL+P L+
Sbjct  493   SESFGLTVLKASPLEVLLAPRLAPDLY  519



>ref|XP_007151142.1| hypothetical protein PHAVU_004G021300g [Phaseolus vulgaris]
 gb|ESW23136.1| hypothetical protein PHAVU_004G021300g [Phaseolus vulgaris]
Length=519

 Score =   431 bits (1107),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 203/513 (40%), Positives = 325/513 (63%), Gaps = 14/513 (3%)
 Frame = -1

Query  1652  SILGIAALVLLWFSWRKQSK----RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1485
             S +G+ +L++  F +    K    +  P   GAWPI+GHL     S    +TL   ADKY
Sbjct  6     SAIGLVSLIVFCFFFYGHFKFSQGKEAPTVAGAWPILGHLPLMSASKSPHRTLGALADKY  65

Query  1484  GPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSY  1305
             GP+FTI+LG  + LV+++WE  ++CF TND ++++RP   A +++ Y+ A+F  +    Y
Sbjct  66    GPIFTIKLGAKKALVINNWETAKECFTTNDIVVSSRPKLVAAEHMSYNKAMFALAPCGPY  125

Query  1304  WRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGH  1125
             W+++RK+ V EILS +R+++L+HV+ SE++ +IKEL  F   + N      V + +WF H
Sbjct  126   WQKIRKITVSEILSPQRVKQLRHVFESEVEESIKELSNFWCSNKNESGYALVELKQWFSH  185

Query  1124  LTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD  945
             L  N+++Q++ G+RY + +    +E+AQR  +   + M L+G F  GDA+ P  + RW D
Sbjct  186   LIFNMVLQMITGKRY-FSAATVDDEKAQRFVRAVEEFMRLFGVFTVGDAV-P--WLRWFD  241

Query  944   YEGHVKTMKRAAKDVDAILQDWVDARRKER----RSNEDQKFIDVMLSMIDDQFTQGYSY  777
             + GH K MK  AK++D IL + ++  RK +    + +E Q F+DVM+S+ D     G+  
Sbjct  242   FGGHEKAMKETAKELDIILGEELEEHRKRKGLGEKDDEVQDFMDVMISLFDGITIDGFD-  300

Query  776   SRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSD  597
               DTVIK+ VL ++   ++T +T LTW+++++L++P  L++V+ E+D ++GKE+   +S 
Sbjct  301   -ADTVIKSTVLLVIAGGTDTSSTLLTWVISLILRNPLVLEKVKVELDIHVGKEKCVSESH  359

Query  596   VKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW  417
             +  L YLQ +VKETLR+YP GP LAPHE +EDCI+ GY+I KGT+L  N+W++H D  +W
Sbjct  360   ISKLTYLQAIVKETLRLYPPGPLLAPHEIIEDCILSGYNIKKGTRLITNLWKIHTDKNVW  419

Query  416   PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF  237
              DP +F PERF+T  +    +   ++ +PFG GRR CPG  +  ++ Q ++A +   F F
Sbjct  420   EDPLEFKPERFLTTYKDLDVKGHHFELIPFGGGRRMCPGISFGLEVVQFSLASILHSFEF  479

Query  236   STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
              +   +P+DM E  G+   K TPLE+L+ PRLS
Sbjct  480   LSSSPDPIDMTETFGLTNTKGTPLEILIKPRLS  512



>gb|KDO39483.1| hypothetical protein CISIN_1g009723mg [Citrus sinensis]
Length=527

 Score =   431 bits (1108),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 214/499 (43%), Positives = 310/499 (62%), Gaps = 16/499 (3%)
 Frame = -1

Query  1595  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             KR  PEAGG WP+IGHLH      PL K L + ADKYGP+ TI++G+ R LVVS+WE  +
Sbjct  29    KRGAPEAGGGWPVIGHLHLLGRPEPLHKVLGKIADKYGPILTIKIGVHRTLVVSNWEIAK  88

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +C  T+DK+ A RP T AG  L YD ++  F     YWR++RK+   E+LSS RLE LK+
Sbjct  89    ECLTTSDKVFATRPKTVAGHILCYDSSLLGFVPYGHYWRQIRKIATLELLSSYRLESLKY  148

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPK-VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGT  1059
             V  SE++T +KELY     D     AP  V+M +W  ++TLN+I+++V G+R        
Sbjct  149   VRESEVRTCLKELYNL--WDAGLDKAPVLVDMKKWCEYVTLNVILRMVVGKRCNISISQK  206

Query  1058  INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW  879
                  Q  K   S+     G+ V  DA   L F RWLD  G  + MK+ A+++D I+Q W
Sbjct  207   GTSSDQGWKDELSRFFEFMGKLVVSDA---LPFLRWLDIGGDERLMKKTARELDLIMQRW  263

Query  878   VDARRKERRSNE------DQKFIDVMLSMIDDQFTQGY-SYSRDTVIKAIVLSMLQDASE  720
             +D  R++  S +      ++ F+  MLS++DD   Q +     DT+ KA  L+++   S+
Sbjct  264   LDEHRRKGDSGDYQIKGREENFMGAMLSILDDIGAQEFPGRDADTINKATCLALILGGSD  323

Query  719   TFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYP  540
             T +  LTW +++LL +  +LK+ Q+E+D  +GKER  ++SD +NL YLQ ++KETLR+YP
Sbjct  324   TTSGTLTWAISLLLNNRHALKKAQEELDQQVGKERAVDESDTENLVYLQAIIKETLRLYP  383

Query  539   QGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA  360
              GP LAP EA+EDC V GYH+P GT+L +N W++ RDP++W +P  F PERF+      A
Sbjct  384   AGPLLAPREAMEDCTVSGYHVPAGTRLMINAWKIQRDPRVWENPSAFQPERFLPGHGAHA  443

Query  359   ---AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI  189
                 + +Q++ +PFG GRRSCPG   A Q+  + +ARL   F  +T  ++P+DM E  G+
Sbjct  444   DVDVRGQQFELIPFGSGRRSCPGASSALQVLHLTLARLLHAFELATPLDQPVDMSESPGL  503

Query  188   ILPKLTPLEVLVTPRLSPT  132
              +PK TPL+VL++PRL P 
Sbjct  504   TIPKATPLKVLLSPRLLPA  522



>gb|ABB20912.1| P450 mono-oxygenase [Stevia rebaudiana]
Length=528

 Score =   431 bits (1108),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 213/525 (41%), Positives = 333/525 (63%), Gaps = 21/525 (4%)
 Frame = -1

Query  1664  CCLSSILGIAALVLLWFSWRKQ-----SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1500
               +++IL + A   L  S RK+     +K LPP+A GAWP+IGHL     +    + L +
Sbjct  9     TTVTAILVVTAF-FLQISKRKKVDTTKNKLLPPKAKGAWPLIGHLPLLGKNRIAHRVLGD  67

Query  1499  WADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFS  1320
              ADKYGP+FTI+LG+ ++LVVSS +AV+DCF T+DK  A+RP + A + +GY+YA+F  +
Sbjct  68    LADKYGPIFTIKLGVYQVLVVSSADAVKDCFTTSDKAFASRPKSTAVEIMGYNYAMFGLA  127

Query  1319  TNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTF--ISMDNNNPSAPKVN  1146
                 YWR+VRK+ V EILS +R++ L+   VSE++T+  E+Y    ++ +N       V+
Sbjct  128   PYGEYWRQVRKIAVLEILSQKRVDMLEWARVSEVRTSTNEVYDAWRVNKENEGSDMVLVD  187

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             M +WF +L LN++++I++G+R+ ++S      E  R +K+  ++  L G FV  D I  +
Sbjct  188   MKQWFTNLILNVLVRIISGKRFPFKS-----VEGIRFQKMEKKLFELLGAFVVSDLIPSM  242

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNE----DQKFIDVMLSMIDDQ  798
               F   D  G+ K MK AA++++ I++ W++ R+ ++ S E    DQ F+DV++S++ D 
Sbjct  243   KRF---DIGGYQKQMKMAAEEINDIMEGWLNNRKTQKESGEQKEGDQYFMDVLISVLKDA  299

Query  797   FTQGY-SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
                 +  Y  DTVIKA  +++L   S+T +  + W LA+LL HPE +K  QDEID ++G+
Sbjct  300   SDADFPGYDHDTVIKATCMALLAAGSDTTSVTIIWALALLLNHPEKMKIAQDEIDKHVGR  359

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             +R  E+SD+KNL Y+  ++KET+R+YP  P   PHEA+EDC+V GYHIPKGT+L  N W+
Sbjct  360   DRLVEESDLKNLVYINAIIKETMRLYPAAPLSVPHEAMEDCVVGGYHIPKGTRLLPNFWK  419

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             +  DP IWP+P +F PERF++  +    + + ++ +PFG GRR CP   +  QI  + +A
Sbjct  420   IQHDPNIWPEPYEFKPERFLSTHKDVDVKGKHFELLPFGTGRRMCPAITFVLQILPLTLA  479

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              L Q F      N+P+DM E  G+   + TPL+VL+ PRLS  ++
Sbjct  480   NLIQQFEIRKPSNDPIDMTESAGLTTKRATPLDVLIAPRLSLKMY  524



>ref|XP_010547840.1| PREDICTED: cytochrome P450 82C4-like [Tarenaya hassleriana]
Length=527

 Score =   431 bits (1107),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 222/509 (44%), Positives = 315/509 (62%), Gaps = 14/509 (3%)
 Frame = -1

Query  1628  VLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGIS  1452
              +L+   +K   R  PE  G+WPIIGHLH       L+ +TL   AD YGP F +RLG  
Sbjct  23    AILFKKTKKPENRKAPEPAGSWPIIGHLHLLGGKNNLLYRTLGALADDYGPAFGLRLGSR  82

Query  1451  RILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEE  1272
             + LVVSSWE  ++C   NDK  A+RP T   K +GY+YA+F F+  +SY+R +RK+V  E
Sbjct  83    KALVVSSWEVAKECLTANDKTFASRPNTVGAKLMGYNYALFGFAPYDSYFREMRKIVTFE  142

Query  1271  ILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPK-VNMSRWFGHLTLNLIMQIV  1095
             +LS+RR++ L+HV +SE++  IK++Y+  S      S P  V++ +W   L LN+I+++V
Sbjct  143   LLSNRRIQMLRHVRISEIEMGIKDIYSLWS--KKGGSGPVLVDVKQWLEDLNLNMIVKLV  200

Query  1094  AGRRYEYRSDGTINE--EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTM  921
             AG+RY +  D T +E  EA+R  K  ++   L G FV  DA FP  F    D +G+ K M
Sbjct  201   AGKRYSF-GDATADEADEARRCPKATARFFQLMGLFVIADA-FP--FLGRFDLQGYEKEM  256

Query  920   KRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAI  750
             K+ A ++D IL+ W+    + R S E   D  FIDVMLS+ D        +   T IK+ 
Sbjct  257   KKTAAEIDGILEGWLQEHERRRASGESEGDSDFIDVMLSLADQGKLSDLKHDERTCIKST  316

Query  749   VLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQG  570
              L+M+   S+T    L W  A+L  + E LK+ Q+EID ++GK+R   DSD++NL YLQ 
Sbjct  317   CLAMILGGSDTLVGTLIWAFALLANNREILKKAQEEIDFHVGKDRKVVDSDIENLVYLQA  376

Query  569   VVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPE  390
             + KETLRMYP  P L P EA EDC V GYH+  GT+L VNVW++HRDP+ WP+PE+F PE
Sbjct  377   ITKETLRMYPAAPLLGPREATEDCTVAGYHVTAGTRLMVNVWKIHRDPRFWPNPEEFRPE  436

Query  389   RFMTNLEGE-AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPL  213
             RF+T    E + + + ++ +PFG GRRSCPG   A Q+  + +AR+   F+ +TV    +
Sbjct  437   RFLTGPASEYSVRGQSFELLPFGSGRRSCPGISLALQMLHLLLARVLHSFDLTTVSGLDV  496

Query  212   DMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             DM E  G+ +PK  PLEVL++PRL   L+
Sbjct  497   DMGESPGLTIPKTKPLEVLLSPRLKKELY  525



>gb|KDP38422.1| hypothetical protein JCGZ_04347 [Jatropha curcas]
Length=523

 Score =   431 bits (1107),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 225/524 (43%), Positives = 331/524 (63%), Gaps = 22/524 (4%)
 Frame = -1

Query  1658  LSSILGIAALVLL---WFSWRKQSK----RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLS  1503
             LS+I+   + + L   +F   K SK    R  PE  G  P+IGHLH    +  L+ +TL 
Sbjct  7     LSAIVIFFSFIFLCNVYFRGTKSSKGSKGREAPEPAGGLPVIGHLHLLGGADKLLHQTLG  66

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
                DKYGPVF IR+G  R LVV+S E+ ++CF  NDK+LA+RPTT A K++ Y++AVF F
Sbjct  67    TMVDKYGPVFNIRIGSRRALVVASVESAKECFTLNDKILASRPTTAATKHMCYNHAVFGF  126

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             +  + +WR +RK+V+ E+LS+R LE +K V  +EL   I++LY   + ++  P   ++N 
Sbjct  127   APFSPHWREMRKIVMLELLSNRSLEMIKQVQHTELDLGIRKLYGLWAKNSCLPLLFELN-  185

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
              RWF  LTLN+I+++VAG++Y   S+   ++E++R +K  S+  +L G FV+ DA+  LW
Sbjct  186   -RWFDDLTLNVIVRVVAGKQYAGSSN---DDESKRCRKAISEFYHLMGIFVASDALPFLW  241

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRS-----NEDQKFIDVMLSMIDDQ  798
                WLD +GHVK MK+ A+D+D IL  W++  R+ R S       ++ FID+MLS+ +  
Sbjct  242   ---WLDLKGHVKAMKKTAEDLDVILSGWLNKHRQRRISVPGEVKSEKDFIDMMLSLEEKG  298

Query  797   FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE  618
                G+ Y  DT IK+  L+++  A +T  T LTW +++LL +  SLK+ Q+E+D ++G E
Sbjct  299   RMSGFQYDADTSIKSTCLALIAGAGDTITTTLTWAMSLLLNNQPSLKKAQEELDLHVGIE  358

Query  617   RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL  438
             R   +SD+KNL YLQ +VKETLR+YP  P L P E +EDC + GY +P GT+L VNV ++
Sbjct  359   RQVVESDIKNLVYLQAIVKETLRLYPVAP-LIPREFMEDCSIAGYRVPAGTRLLVNVGKI  417

Query  437   HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR  258
              RDPK W +P  F PERF+ N      +   ++ +PFG GRRSCPG  +A     + +AR
Sbjct  418   QRDPKFWTNPLAFQPERFLENHTNIDVRGHHFELIPFGSGRRSCPGASFALHTLHLTLAR  477

Query  257   LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             L   F+  T  ++P+DM E  G   PK TPLEVL++PRL   L+
Sbjct  478   LLHMFDLRTSMDKPVDMTETPGTHTPKATPLEVLLSPRLPEKLY  521



>ref|XP_006427755.1| hypothetical protein CICLE_v10025349mg [Citrus clementina]
 gb|ESR40995.1| hypothetical protein CICLE_v10025349mg [Citrus clementina]
Length=527

 Score =   430 bits (1106),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 214/499 (43%), Positives = 309/499 (62%), Gaps = 16/499 (3%)
 Frame = -1

Query  1595  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVR  1416
             KR  PEAGG WP+IGHLH      PL K L + ADKYGP+ TI++G+ R LVVS+WE  +
Sbjct  29    KRGAPEAGGGWPVIGHLHLLGGPEPLHKVLGKIADKYGPILTIKIGVRRTLVVSNWEIAK  88

Query  1415  DCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKH  1236
             +C  T+DK+ A RP T AG  L YD ++  F     YWR++RK+   E+LSS RLE LK+
Sbjct  89    ECLTTSDKVFATRPKTVAGHILCYDSSLLGFVPYGHYWRQIRKIATLELLSSYRLESLKY  148

Query  1235  VWVSELQTNIKELYTFISMDNNNPSAPK-VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGT  1059
             V  SE++T +KELY     D     AP  V+M +W  ++TLN+I+++V G+R        
Sbjct  149   VRESEVRTCLKELYNL--WDAGLDKAPVLVDMKKWCEYVTLNVILRMVVGKRCNISISQK  206

Query  1058  INEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDW  879
                  Q  K   S+     G+ V  DA   L F RWLD  G  + MK+ A+++D I+Q W
Sbjct  207   GTSSDQGWKDELSRFFEFMGKLVVSDA---LPFLRWLDIGGDERLMKKTARELDLIMQRW  263

Query  878   VDARRKERRSNE------DQKFIDVMLSMIDDQFTQGY-SYSRDTVIKAIVLSMLQDASE  720
             +D  R++  S +      ++ F+  MLS++DD   Q +     DT+ KA  L+++   S+
Sbjct  264   LDEHRRKGDSGDYQIKGREENFMGAMLSILDDIGAQEFPGRDADTINKATCLALILGGSD  323

Query  719   TFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYP  540
             T +  LTW +++LL +  +LK+ Q+E+D  +GKER  ++SD +NL YLQ ++KETLR+YP
Sbjct  324   TTSGTLTWAISLLLNNRHALKKAQEELDQQVGKERAVDESDTENLVYLQAIIKETLRLYP  383

Query  539   QGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA  360
              GP LAP EA+EDC V GYH+P GT+L +N W++ RDP +W +P  F PERF+      A
Sbjct  384   AGPLLAPREAMEDCTVSGYHVPAGTRLMINAWKIQRDPSVWENPSAFQPERFLPGHGAHA  443

Query  359   ---AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI  189
                 + +Q++ +PFG GRRSCPG   A Q+  + +ARL   F  +T  ++P+DM E  G+
Sbjct  444   DVDVRGQQFELIPFGSGRRSCPGASSALQVLHLTLARLLHSFELATPLDQPVDMSESPGL  503

Query  188   ILPKLTPLEVLVTPRLSPT  132
              +PK TPL+VL++PRL P 
Sbjct  504   TIPKATPLKVLLSPRLLPA  522



>ref|XP_010664625.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=520

 Score =   429 bits (1104),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 214/499 (43%), Positives = 309/499 (62%), Gaps = 14/499 (3%)
 Frame = -1

Query  1607  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSW  1428
             R + KR  PEA GAWP+IGHLH    S    KTL   ADKYGP+F I+LG   +LVVS+W
Sbjct  30    RSERKRTAPEAAGAWPVIGHLHLLGGSELPHKTLGAMADKYGPIFFIKLGARPVLVVSNW  89

Query  1427  EAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLE  1248
             E  ++CF TNDK  A RP   A + +GY+ A+F FS   SYWR++RK+V   +LS+R LE
Sbjct  90    EIAKECFTTNDKAFANRPKLIAVEVMGYNNAMFGFSPYGSYWRQMRKIVTTHLLSNRSLE  149

Query  1247  KLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
              LK V +SE++  IKEL+       ++ +   V M RWFG L LNL +++ AG+R+    
Sbjct  150   MLKLVRISEVKATIKELHELWVSKKSDSNMVSVEMRRWFGDLALNLAVRMTAGKRFSSDK  209

Query  1067  DGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAIL  888
             +G    +A R          L G+F+  DA   L F RW D  G+ K MK+ AK +D +L
Sbjct  210   EGVEYHKAIRC------FFELTGKFMVSDA---LPFLRWFDLGGYEKAMKKTAKSLDHLL  260

Query  887   QDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQG--YSYSRDTVIKAIVLSMLQDAS  723
             +DW+   +++R S +   DQ F+DVMLS++DD+       S   D + KA  L++L   +
Sbjct  261   EDWLQEHKRKRVSGQPTGDQDFMDVMLSILDDETRAQDIKSSDADIINKATCLNVLIATT  320

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             +T    LTW L++LL +   L + ++E+D ++G+ER  E+ D+ NL YL  ++KETLR+Y
Sbjct  321   DTVTVSLTWALSLLLNNRHVLNKAKEELDLHVGRERRVEERDMSNLVYLDAIIKETLRLY  380

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
                  LA HE+ E+C+V G +IP GT+L +N+W++H DP +W DP++F+PERF+T  +  
Sbjct  381   SAVQVLAAHESTEECVVGGCYIPAGTRLIINLWKIHHDPSVWSDPDQFMPERFLTTHKDV  440

Query  362   AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
               +   ++ +PFG GRR CPG   A Q  Q  +A L QGF F+T  + P+DM E +G+  
Sbjct  441   DVRGMHFELIPFGSGRRICPGVSLALQFLQFTLASLIQGFEFATASDGPVDMTESIGLTN  500

Query  182   PKLTPLEVLVTPRLSPTLF  126
              K TPL+VL+TPRLS  L+
Sbjct  501   LKATPLDVLLTPRLSSNLY  519



>gb|KDO42181.1| hypothetical protein CISIN_1g009844mg [Citrus sinensis]
Length=524

 Score =   429 bits (1104),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/495 (42%), Positives = 315/495 (64%), Gaps = 14/495 (3%)
 Frame = -1

Query  1601  QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEA  1422
             + KR  PEAGGAWP+IGHLH  R   P  +   + ADKYGP+F IR+G +  L+VS+WE 
Sbjct  40    KKKRGAPEAGGAWPVIGHLHLLRGPKPPYRVFDKMADKYGPIFIIRMGKNPALIVSNWEI  99

Query  1421  VRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKL  1242
              ++C  T+DK+ A RP T A + LGY++++F FS   SYWR  RK+    +LS+ RLEKL
Sbjct  100   AKECLTTHDKVFANRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLGLLSNHRLEKL  159

Query  1241  KHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDG  1062
             KHV   E++T +KELY     + +      V M +WFG    N+++++V G+       G
Sbjct  160   KHVREYEVKTCLKELYELWHKNKSTNKILLVEMKKWFGDTLRNVVLRMVVGK-------G  212

Query  1061  TINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQD  882
               + +++  K++ ++   + G+FV  DA   L F RWLD  G  ++MK+ AK++D I Q 
Sbjct  213   CNSVDSEEWKELLTRFFEMSGKFVVSDA---LPFMRWLDIGGDERSMKKIAKELDVIAQG  269

Query  881   WVDARRKERRSNEDQK---FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
             W++  +++R S E +K   F+ VMLS++ D   Q      DT+ KAI L+++  A++T  
Sbjct  270   WLEEHKRKRDSQEIKKEEDFMYVMLSILGDT-EQYLGRDVDTINKAICLALILGAADTTT  328

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
               LT ++++LL H + L + Q+E+D  +G +R   +SD+KNL YLQ ++KE +R+YP GP
Sbjct  329   VTLTLVMSLLLNHRDILNKAQNELDIQVGAKRQVNESDIKNLVYLQAILKEAMRLYPAGP  388

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN  351
              L PHE++E+C V+GYH+P  TQL++N W++ RDP +W +P KF PERF+T  +    + 
Sbjct  389   LLVPHESIEECTVNGYHVPASTQLFINAWKIQRDPSVWEEPSKFQPERFLTRHKDIDVKG  448

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
             + ++ +PF  GRR CPG  +A Q+ Q  +A L QGFNF+T  NEP+DM E +G+ + K  
Sbjct  449   QNFELLPFSSGRRMCPGVSFALQVMQFTLASLLQGFNFATPSNEPVDMGEGLGLTMEKSQ  508

Query  170   PLEVLVTPRLSPTLF  126
             P EVLVTPRLS   +
Sbjct  509   PFEVLVTPRLSAAFY  523



>ref|XP_010919967.1| PREDICTED: cytochrome P450 CYP82D47-like [Elaeis guineensis]
Length=518

 Score =   429 bits (1103),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 213/493 (43%), Positives = 304/493 (62%), Gaps = 15/493 (3%)
 Frame = -1

Query  1583  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFA  1404
             P+  GAWP++GHLH   +   + + L   AD  GPVF +RLG    LVVS+WEA R+CF 
Sbjct  35    PQPAGAWPVLGHLHLLGSHNNIGRALKAVADAVGPVFALRLGARPALVVSTWEAARECFT  94

Query  1403  TNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVS  1224
             TNDK LA RPT+ A K + Y+ A+  FS    YWR+VRK+   E+LS  RL    HV  S
Sbjct  95    TNDKALAGRPTSTASKLMCYNNAMVGFSPYGPYWRQVRKIFTVELLSHARLCSHAHVRAS  154

Query  1223  ELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRR---YEYRSDGTIN  1053
             E+    K LY      +  P+  +V MS+WF  LT N++ ++VAG+R   Y    DG  N
Sbjct  155   EVDAFAKTLYGLCRKVDGGPA--RVEMSKWFQELTFNVVARMVAGKRCFVYGAVDDGG-N  211

Query  1052  EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVD  873
              EA+R      ++M L G F+  D +    F RWLD  G+ + MKR A ++D I+  W+ 
Sbjct  212   REARRFTGAMHRMMELLGAFMVSDVVP---FLRWLDLGGYQRAMKRTAAEMDGIIGGWLR  268

Query  872   A---RRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHL  702
                 RR E R+   + F+DVMLS ++ +      +  DTVIKA  L+++   ++T +  +
Sbjct  269   EHRDRRSEGRAEGKEDFMDVMLSTMEKEGELFSDHDPDTVIKANSLALIIAGTDTTSVTM  328

Query  701   TWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLA  522
              W LA+LL HP  L+  Q+E+D+++GK+R  ++SDV+ L YLQ +VKETLR+YP GP L 
Sbjct  329   IWALALLLNHPNVLRTAQEELDSHVGKDRNVKESDVEKLVYLQAIVKETLRLYPPGPTLI  388

Query  521   PHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQY  342
             PH+ +EDC V G+ +P GTQ+ VN W +  DP++WPDP  F PERF+T+ +    + R +
Sbjct  389   PHQTMEDCQVSGFDVPAGTQVLVNAWAIQHDPEVWPDPSAFRPERFLTSHKDVDIRGRHF  448

Query  341   QFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLE  162
             + +PFG GRR+CPG  +A Q+  +A+AR+  GF+ +     P+DM E  G  LPK TPL+
Sbjct  449   ELLPFGSGRRACPGASFALQVVHLALARIIHGFDMA---GGPVDMTEGKGATLPKATPLQ  505

Query  161   VLVTPRLSPTLFR  123
             VLVTPRL P L++
Sbjct  506   VLVTPRLPPGLYQ  518



>emb|CAN76287.1| hypothetical protein VITISV_027433 [Vitis vinifera]
Length=538

 Score =   430 bits (1105),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 224/533 (42%), Positives = 327/533 (61%), Gaps = 34/533 (6%)
 Frame = -1

Query  1652  SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL-SEWADKYGPV  1476
             +IL ++  +LLW S   +S R+ PEA GAWPIIGHLH    S  L   L    ADKYGPV
Sbjct  6     AILVLSYHLLLWRSGAGKS-RMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPV  64

Query  1475  FTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRR  1296
             F+IRLG+ R + VSSWE  ++CF T+D  LA+RP   A KYLGY+Y +F  S + +YWR 
Sbjct  65    FSIRLGLKRAVXVSSWEMAKECFTTHDLALASRPZLVAAKYLGYNYXMFXXSPHGAYWRE  124

Query  1295  VRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTL  1116
             VRK+   E+LS+RRLE LK+V +SE++T +KELY   +   +      V+M +WFGHL+L
Sbjct  125   VRKIATLELLSNRRLELLKNVRISEVETCMKELYKLWAEXKSEAGVVLVDMKQWFGHLSL  184

Query  1115  NLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG  936
             N+I+++V G+RY   +  +  + AQ+ +K   +   L G FV  DAI P  F  WLD  G
Sbjct  185   NVILKMVVGKRYFGYAAESKEKGAQQCQKAIREFFRLMGLFVVSDAI-P--FLGWLDVGG  241

Query  935   HVKTMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDT  765
             HVK MK+ AK++D I Q+W++  R+ + S E   DQ F+DVMLS++  + T    Y  DT
Sbjct  242   HVKAMKKTAKELDGIXQEWLEEHRRRKDSGEADGDQDFMDVMLSILGGRDTT--DYDADT  299

Query  764   VIKA------------------------IVLSMLQDASETFATHLTWILAVLLKHPESLK  657
             + KA                        IV  M+   ++T +  LTW +++LL +P  L+
Sbjct  300   INKATXLEEAAEFAPLGGWAHRKYXCQKIVKVMIGGGADTTSGTLTWAISLLLNNPHILR  359

Query  656   RVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHI  477
             + Q+E+D ++GKER   + D+  L YLQ +VKETLR+ P  P   P + ++D I+ GYHI
Sbjct  360   KAQEELDAHVGKERLVNEMDISKLVYLQAIVKETLRLNPIAPLSGPRQFIQDSILGGYHI  419

Query  476   PKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGN  297
              KGT+L +N+ ++ RDP++W +P +F P+RF+T  +    + + ++  PFG GRR CPG 
Sbjct  420   SKGTRLILNLTKIQRDPRVWLNPMEFQPDRFLTTHKDVDVRGKHFELTPFGGGRRICPGI  479

Query  296   LYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
             ++A Q+  + +A     F  ST  + P+DM ED G+   K TPLEVL++PRL+
Sbjct  480   VFALQVLHLTLANFLHRFQLSTPSDAPVDMSEDFGLTNIKSTPLEVLISPRLA  532



>ref|XP_007017410.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14635.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=628

 Score =   433 bits (1113),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/503 (42%), Positives = 320/503 (64%), Gaps = 15/503 (3%)
 Frame = -1

Query  1613  SWR-KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVV  1437
             +WR    K+  PEAG +WP++GHLH      P   TLS  ADKYGP+FTI+LG+ R LVV
Sbjct  135   TWRCTNKKKAAPEAGNSWPVLGHLHLLAGRQPAHLTLSAMADKYGPIFTIKLGVRRALVV  194

Query  1436  SSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFSTNNSYWRRVRKLVVEEILSSR  1257
             SSWE  ++C  TNDK  A RP   + + LGY++A+F F+    YWR +RK+   E+LS+ 
Sbjct  195   SSWETAKECLTTNDKAFATRPKNISMEVLGYNHAMFGFAPYGPYWRNMRKITTLELLSNH  254

Query  1256  RLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             RL+ LKHV  SE++ +++ELY     + N+     V M +WF   T N+I++++ G+R  
Sbjct  255   RLDMLKHVRESEMKVSLQELYQLWKENKNSSDKVLVEMDKWFRDATANVILKMIVGKRIS  314

Query  1076  YRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKTMKRAAKDVD  897
                +   + E+ R KK   +   L G+F+  DA FP  F RWLD  G  + MK+  K ++
Sbjct  315   SLGN---DAESGRWKKALKEFFELSGKFLVADA-FP--FLRWLDIGGDERLMKKVKKVLN  368

Query  896   AILQDWVDARRKERRS----NEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD  729
              + ++W+   +++R S    +E++ F+DVMLS++ D       Y  DT+ KA  L ++  
Sbjct  369   EVAEEWLQEHKQKRASGEFRDEEEDFMDVMLSILTD----AKEYDADTINKATCLILILA  424

Query  728   ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR  549
             A++  A  LTW LA+LL + ++LK+ Q EID +IGK++  E++D+KNL YLQ ++KETLR
Sbjct  425   ATDPTAVTLTWCLALLLNNRDALKKAQQEIDIHIGKDKPVEENDIKNLVYLQAIIKETLR  484

Query  548   MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE  369
             ++P GP   PHE++E+C V+GYHIP GT+L +N++++HRD ++W DP KF PERF+T  +
Sbjct  485   LHPAGPLAVPHESMENCTVNGYHIPAGTELLINLYKIHRDSRVWSDPYKFQPERFLTTHK  544

Query  368   GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI  189
                 + + ++ +PF  GRR CPG  +A Q+ Q+ +A L  GF+ +T  +EP+DM E  G+
Sbjct  545   NFDVRGQNFELIPFSSGRRMCPGVSFALQVVQLTLANLLHGFDLATPFDEPVDMREAAGL  604

Query  188   ILPKLTPLEVLVTPRLSPTLFRL  120
                K TPLEV ++PRL  + + L
Sbjct  605   SNFKATPLEVSISPRLPNSCYEL  627


 Score = 87.8 bits (216),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -1

Query  1517  VKTLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDY  1338
             ++ L + A  YGP+FTI+LG+S+ ++VS+ E  ++C +TNDK+ A RP + A + LGY+Y
Sbjct  20    LRLLFKRAGNYGPIFTIKLGLSQAVIVSNRELAKECLSTNDKVFATRPKSIAFEILGYNY  79

Query  1337  AVFTFSTNNSYWRRVRKLVV  1278
             AVF FS   SYW  +RKL  
Sbjct  80    AVFGFSPYGSYWHHIRKLAT  99


 Score = 22.7 bits (47),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 7/10 (70%), Positives = 9/10 (90%), Gaps = 0/10 (0%)
 Frame = -3

Query  1566  VAYYWPPPPL  1537
             +AYYWPP P+
Sbjct  1     MAYYWPPSPI  10



>ref|XP_007134139.1| hypothetical protein PHAVU_010G022600g [Phaseolus vulgaris]
 gb|ESW06133.1| hypothetical protein PHAVU_010G022600g [Phaseolus vulgaris]
Length=530

 Score =   429 bits (1102),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 213/523 (41%), Positives = 322/523 (62%), Gaps = 16/523 (3%)
 Frame = -1

Query  1655  SSILGIAALVLLWFSWR------KQSKRLP----PEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             S + GI AL++ +  +R      + +KR      PE  GA P IGHLH     +P  +T 
Sbjct  10    SVVAGILALLIAYKVFRFFTSPNESTKRKKGTKIPEPYGALPFIGHLHLLNARIPYFRTF  69

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFT  1326
             S  A+KYGP+F ++LG    +VV+S E  ++C  TND++ A+RP T  G+ +GY+ A+F 
Sbjct  70    SAMAEKYGPIFCVKLGCHPTIVVNSREIAKECLTTNDRVFASRPNTTGGRLMGYNNAIFG  129

Query  1325  FSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVN  1146
              +   +YWR +RK+ V EILSS RLEKLKHV  +E  + +K+LY+ +S   N   + +V 
Sbjct  130   LAPYGNYWREIRKMAVLEILSSYRLEKLKHVRDTETFSLVKDLYSSMSSPKNVKGSTEVA  189

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             +S    H T N+I++++AG+R+   +    + EA +L+K      YL+G FV  DAI  L
Sbjct  190   ISNLLEHTTFNIIVRMIAGKRFGGDTVNQEDNEAWKLRKSIRDSTYLFGVFVVADAIPSL  249

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWVDA--RRKERRSNEDQKFIDVMLSMIDDQFT  792
                 W D++G+V  MKR AK  D ILQ W++   R + R    ++ F+DVM+S  ++Q  
Sbjct  250   ---SWFDFQGYVSFMKRTAKQTDLILQKWMEEHLRDRVRDGKCERDFMDVMISTFEEQ-E  305

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
             +   Y ++TVIKA  + ++   S + A  LTW L++LL HP+ LK    E+DT++GKERW
Sbjct  306   EICGYKKETVIKATAMLLILTGSGSTAMTLTWALSLLLNHPKVLKVALQELDTHVGKERW  365

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E+SD+KNL YL  ++KETLR+YP  P     E +EDC + GYH+PKGT+L +N+W L R
Sbjct  366   VEESDIKNLNYLHAIIKETLRLYPPAPLTGIREVMEDCSLVGYHVPKGTRLLINLWNLQR  425

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP++W +P +F PERF+++       ++ ++ +PF  GRRSCPG  +  Q+T + +ARL 
Sbjct  426   DPEVWANPNEFQPERFLSSHRDIDFMSQDFELIPFSFGRRSCPGMAFGLQVTHLTLARLL  485

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             QGF+        +DM E +G+ LPK  PL V++ PRL   L++
Sbjct  486   QGFHICLKDGAEVDMTEGLGVALPKEQPLRVMLQPRLPLELYQ  528



>gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita]
Length=516

 Score =   428 bits (1101),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 216/521 (41%), Positives = 322/521 (62%), Gaps = 13/521 (2%)
 Frame = -1

Query  1676  DAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLH--HFRTSVPLVKTLS  1503
             +A  C   + + + +  L+W      + + PPEAGGAWP +GHL+     T +P V +L 
Sbjct  4     NAAVCAALAFISLLSYYLIWLR-SASTHQAPPEAGGAWPFLGHLNIISGHTGLPHV-SLG  61

Query  1502  EWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTF  1323
               ADK+GP+F IR+G+ R +VVSS E +++ F TND  +++RP+  AGK+L YDYA+  F
Sbjct  62    NLADKHGPIFGIRIGVHRAVVVSSSEVIKELFTTNDAAVSSRPSVKAGKHLAYDYAMLGF  121

Query  1322  STNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKVNM  1143
             S+  +YWR++RKLV  E+ S+RR+E  ++V VSE    I ELY+      +  S   V M
Sbjct  122   SSYGTYWRQMRKLVSLELFSARRVELQRNVRVSETAHFINELYSAWEERRDGSSRVSVEM  181

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
                FG L++N+I+++VAG+R+   S G   EEA+R ++V  +  +L G FV  DA FP  
Sbjct  182   KELFGELSMNVILKMVAGKRF---SGGDDAEEARRCRRVMREFFHLAGLFVLSDA-FP--  235

Query  962   FFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNED--QKFIDVMLSMIDDQFTQ  789
             +  WLD  GH + MKR A+++D ++ +W+   R++  S E   Q F+DVMLS +     +
Sbjct  236   YLGWLDLGGHERRMKRTAEEMDELVGEWLAEHRRKEYSGEGKAQDFMDVMLSEVKGANFE  295

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
                Y  DT+IKA   +++   ++T A    W LA+LL +P  L++ Q E+DT++GK+R  
Sbjct  296   -CEYDVDTIIKATCGTLIAGGTDTTAVVFIWALALLLNNPHVLQKAQHELDTHVGKQRRV  354

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
              +SD+ NL YLQ + KETLR+YP GP        +DC V GYHIPK T L VN+W+LHRD
Sbjct  355   NESDLNNLVYLQAITKETLRLYPPGPLGGTRRLTQDCHVGGYHIPKETWLIVNLWKLHRD  414

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ  249
             P++W DP +F PERF+   +    + + ++ +PF  GRR CPG  +  Q+  + +A L Q
Sbjct  415   PRVWSDPSEFRPERFLNGEKSMDVKGQDFELIPFSAGRRICPGTNFGLQMLHLVLASLLQ  474

Query  248   GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              F+ S V NE +DM E  G+   K TPL+VL+ PRL P+L+
Sbjct  475   AFDLSRVSNEEIDMSESAGLTNIKATPLDVLIAPRLPPSLY  515



>ref|XP_010526011.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Tarenaya hassleriana]
Length=524

 Score =   428 bits (1101),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 224/527 (43%), Positives = 323/527 (61%), Gaps = 25/527 (5%)
 Frame = -1

Query  1658  LSSILGIAALVLLWFS-----WRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEW  1497
             L S+  I    L  FS     ++KQ  R  PE  G+WPI+GHLH       L+ +TL   
Sbjct  5     LGSLAPIFIASLFLFSVFATLFKKQKHRKAPEPTGSWPILGHLHLLGGKNNLLYRTLGAL  64

Query  1496  ADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAVFTFST  1317
             AD+YGP F ++LG  + LVVSSW+  ++C   ND+  A+RP T   K++GY+YA+F F+ 
Sbjct  65    ADEYGPAFGLQLGSQKALVVSSWDVAKECLTVNDRTFASRPKTVGAKHMGYNYALFGFAP  124

Query  1316  NNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPK-VNMS  1140
              +SY+R +RK+V  E+LS++R++KL HV +SE++  IK++Y   S      S P  V++ 
Sbjct  125   YDSYFRDMRKIVTFELLSNQRIQKLSHVRISEIEMGIKDIYNLWS--KKGGSGPVLVDVK  182

Query  1139  RWFGHLTLNLIMQIVAGRRYEYRSDGTINE--EAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             +W   L LN+I+++VAG+RY +  D T +E  EA+R  K  ++   L G FV  DA   L
Sbjct  183   QWLEDLNLNMIVKLVAGKRYAF-GDATADEADEARRCPKATARFFQLMGLFVLSDA---L  238

Query  965   WFFRWLDYEGHVKTMKRAAKDVDAILQDWV---DARRKERRSNEDQKFIDVMLSMIDDQF  795
              F    D +GH K MK+ A ++D IL+ W+   + RR   +++ D  FIDVMLS  +   
Sbjct  239   PFLGRFDLQGHEKEMKKNAAEIDGILEGWLQEHERRRALGKTDGDSDFIDVMLSQKEQGK  298

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
                  +   T IKA  L+M+   S+T    L W  A+L  + E LK+ ++EID ++GK+R
Sbjct  299   LSNLKHDERTAIKATCLAMILGGSDTLVGTLVWAFALLANNREILKKAREEIDFHVGKDR  358

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
               EDSD++ L YLQ + KETLR+YP  P L P EA EDC V GY +  GT+L VNVW++H
Sbjct  359   KVEDSDIEKLVYLQAITKETLRLYPAAPLLGPREATEDCTVAGYQVTAGTRLMVNVWKVH  418

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             RDPKIW +P++F+PERF   LEG+A++     + Y+ +PFG GRRSCPG   A Q+  + 
Sbjct  419   RDPKIWSNPDEFIPERF---LEGKASEYSVRGQSYELLPFGSGRRSCPGISLAVQVLHLL  475

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +AR    F+ STV    +DM E  G+ +PK  PLEVL++PRL   L+
Sbjct  476   LARFLHSFDMSTVSGMDVDMGESPGLTIPKTKPLEVLLSPRLKKELY  522



>ref|XP_004306669.1| PREDICTED: cytochrome P450 82A3-like [Fragaria vesca subsp. vesca]
Length=539

 Score =   429 bits (1102),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 226/535 (42%), Positives = 321/535 (60%), Gaps = 21/535 (4%)
 Frame = -1

Query  1664  CCLSSILGIAALVLLWFSWRKQSK-------RLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1506
             C  ++IL  + L L+ F W  + K       R PPEA GAWPI+GHL       P    L
Sbjct  10    CAPTTILA-SVLFLVSFVWIYKYKEKSTAKNRGPPEAPGAWPILGHLPLLGGPQPPHVIL  68

Query  1505  SEWADKYGPVFTIRLGISRILVVSSWEAVRDCF-ATNDKLLAARPTTCAGKYLGYDYAVF  1329
             +  A+KYGP+FTI+LG+ R LVVSSW+  ++C  +TNDK  A RP   A + +GYDYA+F
Sbjct  69    ANMANKYGPLFTIKLGVHRALVVSSWDVAKECLTSTNDKAFANRPKALAAEIMGYDYAMF  128

Query  1328  TFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPKV  1149
              FS   +YWR+VRK+ +  ILS  +LE LKHV  SE++   K +      +    +   V
Sbjct  129   GFSPYGAYWRQVRKIAMLHILSGHKLEMLKHVRESEVKVCTKHIVDMWERNKGVSNKVMV  188

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIFP  969
              M +WFG LT N+++++V G+R+        NEE + L+K   +   L GEFV  DA+  
Sbjct  189   EMRKWFGDLTSNVMLRMVVGKRFLGLEQE--NEEIECLRKALREFFKLGGEFVISDAV--  244

Query  968   LWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRS-----NEDQKFIDVMLSMID  804
               + RWLD  G+ K MK+ AK++D  LQ  ++  + +  +     N +  F+D++LS++D
Sbjct  245   -PYLRWLDLGGYEKAMKKTAKELDGALQKCLEEHKHKSSNSVQHVNGENDFMDMVLSVLD  303

Query  803   DQFTQ--GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
             D   Q  G S + DT+ KA  LS+L   ++T A  LTW L++LL +PE LK+ Q E+D +
Sbjct  304   DDCIQDFGGSVTADTISKATCLSVLLGGTDTTAVTLTWALSLLLNNPEVLKKAQLELDNH  363

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +G++R   +SDVKNL YLQ ++KETLR+YP  P   PHE+ EDC V  YH+  GT+L +N
Sbjct  364   VGRDRQVNESDVKNLVYLQAIMKETLRLYPAAPLSVPHESREDCTVGDYHVSSGTRLLIN  423

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             + ++ RDP IW +P KF PERF+T  +    + +  +F PFG GRR CPG   A Q+TQ+
Sbjct  424   LSKIQRDPNIWIEPCKFQPERFLTTHKNVDVRGQSLEFTPFGTGRRICPGISLALQVTQL  483

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL*AYIC  105
              +A L  GF  +    EP+DM E  G+   K TPLEV +TPRL P L+    Y C
Sbjct  484   TLAHLLHGFEITAPSGEPVDMGESSGLTNMKATPLEVFLTPRLHPKLYENVDYKC  538



>ref|XP_008245476.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=522

 Score =   428 bits (1101),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 224/522 (43%), Positives = 324/522 (62%), Gaps = 14/522 (3%)
 Frame = -1

Query  1667  PCCLSSILGIAALVLLWFSWRKQSK--------RLPPEAGGAWPIIGHLHHFRTSVPLVK  1512
             PC  ++I GI A++L  +   K+S         +LP  AGG WP++GHL  F  S     
Sbjct  6     PCLNTAIAGILAILLFSYFIIKRSSSAAKAKGPKLPKVAGG-WPLLGHLGLFGGSQLPHI  64

Query  1511  TLSEWADKYGPVFTIRLGISRILVVSSWEAVRDCFATNDKLLAARPTTCAGKYLGYDYAV  1332
              L+   DKYGP FTI +GI   LV+S+WE  +DCF TND ++++RP T   K+LGY++A+
Sbjct  65    ALASLVDKYGPAFTINIGIHSALVISTWEVAKDCFTTNDIVVSSRPATLGAKHLGYNFAM  124

Query  1331  FTFSTNNSYWRRVRKLVVEEILSSRRLEKLKHVWVSELQTNIKELYTFISMDNNNPSAPK  1152
             F FS    YWR +RKL   E+LS+RRLE LK V VSE++ ++KELYT       +     
Sbjct  125   FGFSPYGPYWREMRKLTSLELLSNRRLELLKKVRVSEVEMSLKELYTLWIKRKESSGERL  184

Query  1151  VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGTINEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
             V M RWFG LTLN+I ++VAG+R     + +  +EA+R +K   +  +L G FV GDA+ 
Sbjct  185   VEMKRWFGDLTLNVIFRMVAGKRCFMNGNLSEEKEARRWQKAMREFFHLAGLFVLGDAV-  243

Query  971   PLWFFRWLDYEGHVKTMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFT  792
             P  +  WLD  G  K MK+ AK++D I+ +W++  +++    +DQ F+DVMLS I+    
Sbjct  244   P--WLSWLDLGGQQKAMKKTAKELDNIVAEWLEEHKQKITEEKDQDFMDVMLSAINGTDV  301

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
              G+    DTVIKA  L ++   S+T    LTW L++LL + + LK+V +E+D  +GK R 
Sbjct  302   AGFD--ADTVIKATCLILIAGGSDTTMVTLTWALSLLLNNRQVLKKVYEELDQYVGKGRL  359

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E+SD+ NL YLQ  VKE +R+ P GP     E  EDC + GYH+PKGT L VN+W++  
Sbjct  360   LEESDINNLVYLQATVKEAMRLCPAGPLSGQREFTEDCTIGGYHVPKGTWLLVNLWKIQT  419

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP++W DP +F PERF+T  +    + +Q++ +PFG GRR+CPG  +  Q+T + +A   
Sbjct  420   DPRVWADPMEFKPERFLTTHKDVDVRGQQFELMPFGSGRRACPGISFGLQMTLLTLASFL  479

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
               F+ +T  N P+DM   +G+   KLTPL+VL+ PRLSP L+
Sbjct  480   HSFDVATQENAPVDMTGSIGLTNIKLTPLDVLIKPRLSPNLY  521



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4850515030408