BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23946_g1_i1 len=1715 path=[3937:0-232 4170:233-272 4210:273-343
4281:344-376 4314:377-473 4411:474-605 4543:606-643 4581:644-712
4650:713-745 4683:746-845 4783:846-917 999:918-925 1007:926-955
7607:956-1018 8447:1019-1094 7746:1095-1150 3761:1151-1225
3836:1226-1254 6273:1255-1358 6377:1359-1387 6705:1388-1443
6761:1444-1714]

Length=1715
                                                                      Score     E

ref|XP_006349946.1|  PREDICTED: cytochrome P450 82C2-like               535   0.0      
ref|XP_006339196.1|  PREDICTED: cytochrome P450 82C4-like               526   3e-178   
ref|XP_009801176.1|  PREDICTED: cytochrome P450 CYP82D47-like           523   3e-177   
ref|XP_006352674.1|  PREDICTED: cytochrome P450 82C4-like               522   9e-177   
ref|XP_009761500.1|  PREDICTED: cytochrome P450 82C2-like               522   3e-176   
ref|XP_009606611.1|  PREDICTED: cytochrome P450 82C4-like               521   6e-176   
gb|ABC69375.1|  CYP82M1v4                                               517   9e-175   Nicotiana tabacum [American tobacco]
ref|XP_009616319.1|  PREDICTED: cytochrome P450 CYP82D47-like           516   2e-174   
gb|ABC69374.1|  CYP82M1v3                                               516   3e-174   Nicotiana tabacum [American tobacco]
ref|XP_004249377.1|  PREDICTED: cytochrome P450 82C4-like               515   5e-174   
gb|ABC69373.1|  CYP82M1v2                                               513   2e-173   Nicotiana tabacum [American tobacco]
gb|ABC69372.1|  CYP82M1v1                                               513   3e-173   Nicotiana tabacum [American tobacco]
gb|ABC69376.1|  CYP82M1v5                                               513   4e-173   Nicotiana tabacum [American tobacco]
ref|XP_011089652.1|  PREDICTED: cytochrome P450 82C2                    511   4e-172   
ref|XP_007200049.1|  hypothetical protein PRUPE_ppa023510mg             503   3e-169   
dbj|BAM36724.1|  nicotine N-demethylase                                 501   1e-168   
dbj|BAM36727.1|  nicotine N-demethylase                                 501   1e-168   
dbj|BAM36723.1|  nicotine N-demethylase                                 500   3e-168   
dbj|BAM36725.1|  nicotine N-demethylase                                 500   3e-168   
ref|XP_004248527.2|  PREDICTED: cytochrome P450 CYP82D47-like           499   2e-167   
dbj|BAM36726.1|  nicotine N-demethylase                                 498   2e-167   
ref|XP_008235431.1|  PREDICTED: cytochrome P450 82C4-like               498   4e-167   
ref|XP_009609539.1|  PREDICTED: cytochrome P450 82C4-like               496   1e-166   
gb|AJD25203.1|  cytochrome P450 CYP82V2                                 497   1e-166   
ref|XP_009609537.1|  PREDICTED: cytochrome P450 82C4-like               496   1e-166   
ref|XP_007201695.1|  hypothetical protein PRUPE_ppa004301mg             494   6e-166   
gb|ABD39479.1|  CYP82E4v8                                               494   1e-165   Nicotiana tabacum [American tobacco]
ref|XP_009757628.1|  PREDICTED: cytochrome P450 CYP82D47-like           494   1e-165   
gb|ADP65809.1|  nicotine N-demethylase                                  494   1e-165   
ref|XP_009619218.1|  PREDICTED: cytochrome P450 CYP82D47-like           493   2e-165   
gb|ABD39477.1|  CYP82E4v6                                               493   3e-165   Nicotiana tabacum [American tobacco]
gb|ABX56037.1|  CYP82E5v2                                               493   3e-165   Nicotiana tabacum [American tobacco]
ref|XP_002274740.1|  PREDICTED: cytochrome P450 CYP82D47                493   4e-165   Vitis vinifera
gb|ABA07807.1|  cytochrome P450 monooxygenase CYP82E3                   492   6e-165   Nicotiana tabacum [American tobacco]
ref|XP_009778755.1|  PREDICTED: cytochrome P450 82C4-like               492   7e-165   
gb|ABD39480.1|  CYP82E4v10                                              491   8e-165   Nicotiana tabacum [American tobacco]
gb|ABA07804.1|  cytochrome P450 monooxygenase CYP82E4v2                 491   2e-164   Nicotiana tabacum [American tobacco]
gb|ABA07805.1|  cytochrome P450 monooxygenase CYP82E4v1                 491   2e-164   Nicotiana tabacum [American tobacco]
gb|ABD39478.1|  CYP82E4v7                                               490   2e-164   Nicotiana tabacum [American tobacco]
gb|ABD39476.1|  CYP82E4v5                                               490   3e-164   Nicotiana tabacum [American tobacco]
ref|XP_004236938.1|  PREDICTED: cytochrome P450 82C4-like               490   6e-164   
gb|ABC69371.1|  CYP82E5                                                 489   6e-164   Nicotiana tabacum [American tobacco]
gb|ABD39475.1|  CYP82E4v4                                               489   1e-163   Nicotiana tabacum [American tobacco]
gb|ABD39474.1|  CYP82E4v3                                               488   1e-163   Nicotiana tabacum [American tobacco]
gb|ABD39481.1|  CYP82E4v11                                              488   1e-163   Nicotiana tabacum [American tobacco]
ref|XP_009627979.1|  PREDICTED: cytochrome P450 82C4-like               488   2e-163   
gb|AGD93125.1|  CYP450 nicotine N-demethylase                           486   1e-162   
ref|XP_002274509.1|  PREDICTED: cytochrome P450 CYP82D47-like           486   2e-162   Vitis vinifera
gb|ABD39482.1|  CYP82E4v12                                              485   2e-162   Nicotiana tabacum [American tobacco]
ref|XP_011101555.1|  PREDICTED: cytochrome P450 CYP82D47-like           485   2e-162   
ref|XP_003635525.2|  PREDICTED: cytochrome P450 CYP82D47-like           484   7e-162   
emb|CDP15065.1|  unnamed protein product                                482   7e-161   
ref|XP_002264790.1|  PREDICTED: cytochrome P450 CYP82D47                481   1e-160   Vitis vinifera
emb|CBI36491.3|  unnamed protein product                                482   1e-160   
ref|XP_011030904.1|  PREDICTED: cytochrome P450 82C4-like               481   2e-160   
ref|XP_006375022.1|  hypothetical protein POPTR_0014s03660g             480   3e-160   
gb|KDP26345.1|  hypothetical protein JCGZ_17503                         479   8e-160   
emb|CAN61061.1|  hypothetical protein VITISV_018742                     479   2e-159   Vitis vinifera
ref|XP_004517185.1|  PREDICTED: cytochrome P450 82C4-like               476   1e-158   
emb|CAN77159.1|  hypothetical protein VITISV_019026                     478   2e-158   Vitis vinifera
ref|XP_007136644.1|  hypothetical protein PHAVU_009G061600g             475   3e-158   
gb|ABD39485.1|  CYP82E2v4                                               475   3e-158   Nicotiana tabacum [American tobacco]
ref|XP_002300088.2|  hypothetical protein POPTR_0001s34230g             475   4e-158   Populus trichocarpa [western balsam poplar]
ref|XP_004241385.1|  PREDICTED: cytochrome P450 82C2-like               475   5e-158   
ref|XP_008235430.1|  PREDICTED: cytochrome P450 CYP82D47-like           474   6e-158   
ref|XP_002264464.1|  PREDICTED: cytochrome P450 CYP82D47                473   1e-157   Vitis vinifera
ref|XP_009758062.1|  PREDICTED: cytochrome P450 82C4-like               472   1e-157   
ref|XP_010106089.1|  Cytochrome P450 82C4                               473   2e-157   
gb|ABR57311.1|  cytochrome P450 monooxygenase                           473   2e-157   Nicotiana sylvestris
ref|XP_006473405.1|  PREDICTED: cytochrome P450 82C4-like               473   3e-157   
ref|XP_008372514.1|  PREDICTED: cytochrome P450 CYP82D47-like           472   4e-157   
ref|XP_010664626.1|  PREDICTED: cytochrome P450 CYP82D47                473   4e-157   
ref|XP_009348373.1|  PREDICTED: cytochrome P450 CYP82D47-like           473   4e-157   
ref|XP_010069627.1|  PREDICTED: cytochrome P450 CYP82D47-like           472   6e-157   
ref|XP_009348374.1|  PREDICTED: cytochrome P450 CYP82D47-like           471   2e-156   
gb|KDP26346.1|  hypothetical protein JCGZ_17504                         470   2e-156   
gb|ABD39483.1|  CYP82E2v2                                               469   7e-156   Nicotiana tabacum [American tobacco]
ref|XP_003523888.1|  PREDICTED: cytochrome P450 82C4-like               469   7e-156   
ref|XP_007227272.1|  hypothetical protein PRUPE_ppa017703mg             469   9e-156   
ref|XP_009599169.1|  PREDICTED: cytochrome P450 82C4-like               468   1e-155   
gb|KDO84376.1|  hypothetical protein CISIN_1g036812mg                   467   2e-155   
gb|ABA07806.2|  cytochrome P450 monooxygenase CYP82E2                   468   2e-155   Nicotiana tabacum [American tobacco]
ref|XP_008372515.1|  PREDICTED: cytochrome P450 82C4-like               468   2e-155   
ref|XP_010104162.1|  Cytochrome P450 82C4                               466   3e-155   
ref|XP_006434890.1|  hypothetical protein CICLE_v10003803mg             467   3e-155   
ref|XP_011045174.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    467   4e-155   
ref|XP_002531094.1|  cytochrome P450, putative                          466   8e-155   Ricinus communis
ref|XP_010264712.1|  PREDICTED: cytochrome P450 CYP82D47-like           466   2e-154   
ref|XP_002284031.1|  PREDICTED: cytochrome P450 82C4                    465   2e-154   Vitis vinifera
ref|XP_007017403.1|  Cytochrome P450, family 82, subfamily C, pol...    465   2e-154   
ref|XP_004292356.1|  PREDICTED: cytochrome P450 82C4-like               464   2e-154   
ref|XP_010069626.1|  PREDICTED: cytochrome P450 CYP82D47-like           465   4e-154   
ref|XP_008378409.1|  PREDICTED: cytochrome P450 82C4-like               464   8e-154   
ref|XP_009364162.1|  PREDICTED: cytochrome P450 82C4-like               463   1e-153   
ref|XP_006443550.1|  hypothetical protein CICLE_v10019727mg             463   2e-153   
gb|ABD39484.1|  CYP82E2v3                                               462   2e-153   Nicotiana tabacum [American tobacco]
ref|XP_011040244.1|  PREDICTED: cytochrome P450 82C4-like               461   1e-152   
emb|CAN75482.1|  hypothetical protein VITISV_020998                     460   1e-152   Vitis vinifera
ref|XP_009768110.1|  PREDICTED: cytochrome P450 82A4-like               460   2e-152   
ref|XP_004510285.1|  PREDICTED: uncharacterized protein LOC101505071    476   5e-152   
gb|KCW58034.1|  hypothetical protein EUGRSUZ_H00762                     459   5e-152   
ref|XP_007049681.1|  Cytochrome P450                                    459   6e-152   
ref|XP_006355071.1|  PREDICTED: cytochrome P450 82C4-like               459   7e-152   
ref|XP_011045172.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    459   7e-152   
ref|XP_006376421.1|  cytochrome P450 family protein                     458   9e-152   
ref|XP_010069621.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    459   1e-151   
ref|XP_007134137.1|  hypothetical protein PHAVU_010G022400g             458   1e-151   
ref|XP_006435895.1|  hypothetical protein CICLE_v10031217mg             457   2e-151   
ref|XP_002531093.1|  cytochrome P450, putative                          457   3e-151   Ricinus communis
ref|XP_002323130.1|  hypothetical protein POPTR_0016s00980g             456   5e-151   Populus trichocarpa [western balsam poplar]
ref|XP_009792748.1|  PREDICTED: cytochrome P450 CYP82D47-like           456   6e-151   
ref|XP_009770601.1|  PREDICTED: cytochrome P450 CYP82D47-like           456   8e-151   
ref|XP_009595933.1|  PREDICTED: cytochrome P450 82A4-like               455   1e-150   
gb|ABC69420.1|  CYP82E8                                                 455   2e-150   Nicotiana tabacum [American tobacco]
ref|XP_006443549.1|  hypothetical protein CICLE_v10019706mg             454   3e-150   
emb|CAN66023.1|  hypothetical protein VITISV_042713                     453   5e-150   Vitis vinifera
ref|XP_010437977.1|  PREDICTED: cytochrome P450 82C4-like               454   5e-150   
ref|XP_007049687.1|  Cytochrome P450 82A3, putative                     454   8e-150   
ref|XP_010253830.1|  PREDICTED: cytochrome P450 CYP82D47-like           453   1e-149   
ref|XP_006486179.1|  PREDICTED: cytochrome P450 82C4-like               453   1e-149   
ref|XP_004247061.1|  PREDICTED: cytochrome P450 82C4-like               452   2e-149   
ref|XP_007017417.1|  Cytochrome P450 82A3, putative isoform 2           452   2e-149   
ref|XP_010918630.1|  PREDICTED: cytochrome P450 82C4-like               451   3e-149   
ref|XP_010447469.1|  PREDICTED: cytochrome P450 82C4-like               452   4e-149   
ref|XP_002510298.1|  cytochrome P450, putative                          451   1e-148   Ricinus communis
ref|XP_006435903.1|  hypothetical protein CICLE_v10031215mg             450   1e-148   
ref|XP_006435899.1|  hypothetical protein CICLE_v10031216mg             450   2e-148   
emb|CDP15728.1|  unnamed protein product                                450   2e-148   
dbj|BAA35080.1|  putative cytochrome P450                               449   4e-148   Nicotiana tabacum [American tobacco]
gb|KEH25406.1|  cytochrome P450 family protein                          449   5e-148   
ref|XP_006486181.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    449   7e-148   
emb|CBI29738.3|  unnamed protein product                                455   1e-147   
gb|KFK29809.1|  hypothetical protein AALP_AA7G181800                    447   3e-147   
ref|XP_006375032.1|  hypothetical protein POPTR_0014s03770g             447   4e-147   
ref|XP_006375031.1|  hypothetical protein POPTR_0014s03760g             447   4e-147   
ref|XP_002283952.2|  PREDICTED: cytochrome P450 CYP82D47-like           446   5e-147   Vitis vinifera
emb|CAN81014.1|  hypothetical protein VITISV_025152                     446   9e-147   Vitis vinifera
gb|AJD25202.1|  cytochrome P450 CYP82U4                                 445   1e-146   
ref|XP_010061805.1|  PREDICTED: cytochrome P450 CYP82D47-like           445   2e-146   
emb|CDP15727.1|  unnamed protein product                                447   2e-146   
ref|XP_010547839.1|  PREDICTED: cytochrome P450 82C4-like               444   2e-146   
emb|CDY53704.1|  BnaC03g67210D                                          444   2e-146   
ref|XP_002282035.1|  PREDICTED: cytochrome P450 CYP82D47-like           445   2e-146   Vitis vinifera
ref|XP_006464328.1|  PREDICTED: cytochrome P450 82C4-like               444   3e-146   
gb|KDO40892.1|  hypothetical protein CISIN_1g009347mg                   445   3e-146   
ref|XP_006432712.1|  hypothetical protein CICLE_v10000809mg             445   3e-146   
ref|XP_011037409.1|  PREDICTED: cytochrome P450 82G1-like               444   3e-146   
ref|XP_011030967.1|  PREDICTED: cytochrome P450 CYP82D47-like           445   3e-146   
ref|XP_002510313.1|  cytochrome P450, putative                          444   3e-146   Ricinus communis
ref|XP_011008137.1|  PREDICTED: cytochrome P450 82G1-like               444   3e-146   
emb|CDY23316.1|  BnaA08g12300D                                          444   4e-146   
emb|CAN74205.1|  hypothetical protein VITISV_031127                     444   4e-146   Vitis vinifera
ref|XP_006342717.1|  PREDICTED: cytochrome P450 82C4-like               444   5e-146   
ref|XP_002264473.1|  PREDICTED: cytochrome P450 82C4-like               444   5e-146   Vitis vinifera
emb|CDP00859.1|  unnamed protein product                                444   6e-146   
gb|KEH18125.1|  cytochrome P450 family protein                          443   6e-146   
ref|XP_002264520.2|  PREDICTED: cytochrome P450 82C4                    445   6e-146   Vitis vinifera
ref|XP_006375030.1|  hypothetical protein POPTR_0014s03750g             444   7e-146   
ref|XP_007017416.1|  Cytochrome P450 82A3, putative isoform 1           452   8e-146   
gb|KDO40894.1|  hypothetical protein CISIN_1g009786mg                   443   8e-146   
ref|XP_006366435.1|  PREDICTED: cytochrome P450 82A3-like               443   9e-146   
ref|XP_008464765.1|  PREDICTED: cytochrome P450 CYP82D47-like           443   1e-145   
gb|KHG07864.1|  Cytochrome P450 protein                                 442   1e-145   
emb|CDP03915.1|  unnamed protein product                                441   1e-145   
ref|XP_002305292.2|  hypothetical protein POPTR_0004s10630g             442   2e-145   Populus trichocarpa [western balsam poplar]
ref|XP_006432714.1|  hypothetical protein CICLE_v10000845mg             442   2e-145   
ref|XP_002281431.2|  PREDICTED: cytochrome P450 82C4                    442   2e-145   Vitis vinifera
ref|XP_003548652.1|  PREDICTED: cytochrome P450 82C4-like               441   5e-145   
ref|XP_006464300.1|  PREDICTED: cytochrome P450 82C4-like               441   6e-145   
dbj|BAF98469.1|  cytochrome P450                                        440   7e-145   Coptis japonica var. dissecta
ref|XP_002282111.2|  PREDICTED: cytochrome P450 82A3-like               441   7e-145   Vitis vinifera
emb|CAN66846.1|  hypothetical protein VITISV_002367                     441   8e-145   Vitis vinifera
ref|XP_010064745.1|  PREDICTED: cytochrome P450 CYP82D47-like           440   1e-144   
gb|KCW68807.1|  hypothetical protein EUGRSUZ_F02406                     439   2e-144   
ref|XP_004252778.1|  PREDICTED: cytochrome P450 82C4-like               440   2e-144   
ref|NP_194922.1|  cytochrome P450, family 82, subfamily C, polype...    440   2e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109920.1|  PREDICTED: cytochrome P450 82C4                    439   2e-144   
ref|XP_010432796.1|  PREDICTED: cytochrome P450 82C4-like               439   3e-144   
ref|XP_010436299.1|  PREDICTED: cytochrome P450 82C4-like               439   3e-144   
ref|XP_006432710.1|  hypothetical protein CICLE_v10000851mg             439   3e-144   
ref|XP_010451089.1|  PREDICTED: cytochrome P450 82C4                    439   4e-144   
ref|XP_010445016.1|  PREDICTED: cytochrome P450 82C4-like               439   4e-144   
ref|XP_006464298.1|  PREDICTED: cytochrome P450 82C4-like               438   5e-144   
ref|XP_002869304.1|  CYP82C4                                            438   6e-144   
gb|KDP26347.1|  hypothetical protein JCGZ_17505                         438   6e-144   
ref|XP_010647827.1|  PREDICTED: cytochrome P450 CYP82D47                438   8e-144   
ref|XP_007049686.1|  Cytochrome P450, family 82, subfamily C, pol...    440   9e-144   
ref|XP_007047111.1|  Cytochrome P450                                    438   1e-143   
ref|XP_009364189.1|  PREDICTED: cytochrome P450 82A3-like               437   1e-143   
ref|XP_010091295.1|  Cytochrome P450 82G1                               438   1e-143   
ref|XP_006340061.1|  PREDICTED: cytochrome P450 82C4-like               437   2e-143   
ref|XP_011030916.1|  PREDICTED: cytochrome P450 CYP82D47-like           437   2e-143   
gb|AGO03797.1|  cytochrome P450-like protein                            437   2e-143   
emb|CAN64371.1|  hypothetical protein VITISV_016844                     436   4e-143   Vitis vinifera
ref|XP_003547786.2|  PREDICTED: cytochrome P450 82C2-like               437   4e-143   
gb|KHG26594.1|  Cytochrome P450                                         436   5e-143   
gb|KDO42182.1|  hypothetical protein CISIN_1g046041mg                   436   9e-143   
ref|XP_006464299.1|  PREDICTED: cytochrome P450 82C4-like               435   9e-143   
ref|XP_003548649.2|  PREDICTED: cytochrome P450 82C2-like               436   1e-142   
ref|NP_001236179.1|  cytochrome P450 CYP82C1                            435   1e-142   
ref|XP_006432704.1|  hypothetical protein CICLE_v10000846mg             435   2e-142   
ref|XP_007222622.1|  hypothetical protein PRUPE_ppa004175mg             435   2e-142   
ref|XP_002281361.1|  PREDICTED: cytochrome P450 82C4                    434   2e-142   Vitis vinifera
ref|XP_006423130.1|  hypothetical protein CICLE_v10030016mg             434   2e-142   
emb|CBI32510.3|  unnamed protein product                                437   2e-142   
ref|XP_004154826.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    434   3e-142   
ref|XP_006283535.1|  hypothetical protein CARUB_v10004585mg             433   5e-142   
gb|KGN59914.1|  hypothetical protein Csa_3G852630                       434   6e-142   
ref|XP_002284810.3|  PREDICTED: cytochrome P450 CYP82D47                436   7e-142   Vitis vinifera
ref|XP_002284806.1|  PREDICTED: cytochrome P450 CYP82D47                433   7e-142   Vitis vinifera
ref|XP_002282085.3|  PREDICTED: cytochrome P450 82A1-like               449   9e-142   Vitis vinifera
ref|XP_004147803.1|  PREDICTED: cytochrome P450 82C4-like               433   1e-141   
emb|CBI40977.3|  unnamed protein product                                432   4e-141   
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                    438   4e-141   Vitis vinifera
ref|XP_006432711.1|  hypothetical protein CICLE_v10003589mg             429   4e-141   
gb|KDP38438.1|  hypothetical protein JCGZ_04363                         431   4e-141   
ref|XP_007017413.1|  Cytochrome P450                                    431   6e-141   
ref|XP_004238201.1|  PREDICTED: cytochrome P450 CYP82D47-like           431   7e-141   
gb|ABB20912.1|  P450 mono-oxygenase                                     430   1e-140   Stevia rebaudiana
ref|XP_010664625.1|  PREDICTED: cytochrome P450 CYP82D47-like           430   1e-140   
ref|XP_007226598.1|  hypothetical protein PRUPE_ppa023495mg             429   2e-140   
ref|XP_010526010.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    429   2e-140   
gb|KDP38423.1|  hypothetical protein JCGZ_04348                         431   2e-140   
ref|XP_011039260.1|  PREDICTED: cytochrome P450 CYP82D47-like           429   2e-140   
ref|XP_009780811.1|  PREDICTED: cytochrome P450 82C4-like               435   2e-140   
gb|KDO65988.1|  hypothetical protein CISIN_1g011292mg                   428   3e-140   
ref|XP_007017415.1|  Cytochrome P450, putative                          429   4e-140   
gb|AGF30366.1|  CYP450 monooxygenase CYP82D62                           428   6e-140   
gb|KCW85809.1|  hypothetical protein EUGRSUZ_B02554                     427   6e-140   
ref|XP_006465163.1|  PREDICTED: cytochrome P450 82C4-like               428   6e-140   
gb|KDO42181.1|  hypothetical protein CISIN_1g009844mg                   427   1e-139   
ref|XP_003634362.2|  PREDICTED: cytochrome P450 CYP82D47-like           427   1e-139   
gb|KDO39483.1|  hypothetical protein CISIN_1g009723mg                   427   1e-139   
ref|XP_002869302.1|  CYP82C4                                            427   2e-139   
ref|XP_010046449.1|  PREDICTED: cytochrome P450 CYP82D47-like           427   2e-139   
ref|XP_007017410.1|  Cytochrome P450 82A3, putative                     430   2e-139   
ref|XP_004147802.1|  PREDICTED: cytochrome P450 82A4-like               426   3e-139   
gb|KCW68808.1|  hypothetical protein EUGRSUZ_F02407                     428   3e-139   
ref|XP_010061806.1|  PREDICTED: cytochrome P450 CYP82D47-like           427   3e-139   
ref|XP_006427755.1|  hypothetical protein CICLE_v10025349mg             426   3e-139   
ref|XP_006471151.1|  PREDICTED: cytochrome P450 82C4-like               427   3e-139   
ref|XP_007226343.1|  hypothetical protein PRUPE_ppa022174mg             426   4e-139   
ref|XP_010106079.1|  Cytochrome P450 82A3                               426   4e-139   
gb|KDP38422.1|  hypothetical protein JCGZ_04347                         426   4e-139   
ref|XP_006471495.1|  PREDICTED: cytochrome P450 82C4-like               426   4e-139   
ref|XP_010547840.1|  PREDICTED: cytochrome P450 82C4-like               426   5e-139   
ref|XP_009365841.1|  PREDICTED: cytochrome P450 CYP82D47-like           426   5e-139   
ref|XP_009801068.1|  PREDICTED: cytochrome P450 82C4-like               424   5e-139   
ref|XP_008382594.1|  PREDICTED: cytochrome P450 82G1-like               426   9e-139   
emb|CBI32505.3|  unnamed protein product                                440   1e-138   
gb|KHG29587.1|  Cytochrome P450 protein                                 424   1e-138   
ref|XP_011030958.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    424   2e-138   
ref|XP_010526011.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    424   2e-138   
ref|XP_010092357.1|  Cytochrome P450 82A3                               424   2e-138   
ref|XP_006366471.1|  PREDICTED: cytochrome P450 82A3-like               424   2e-138   
ref|XP_006423133.1|  hypothetical protein CICLE_v10028201mg             424   2e-138   
ref|XP_008796321.1|  PREDICTED: cytochrome P450 CYP82D47-like           424   2e-138   
ref|XP_009364169.1|  PREDICTED: cytochrome P450 CYP82D47-like           424   3e-138   
gb|KHN36186.1|  Cytochrome P450 82A3                                    424   3e-138   
ref|XP_007222623.1|  hypothetical protein PRUPE_ppa004179mg             424   3e-138   
ref|XP_010069622.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    422   5e-138   
ref|XP_007134140.1|  hypothetical protein PHAVU_010G022700g             423   5e-138   
ref|XP_006573615.1|  PREDICTED: cytochrome P450 82A3-like isoform X2    423   6e-138   
ref|NP_194925.1|  cytochrome P450, family 82, subfamily C, polype...    423   7e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006471496.1|  PREDICTED: cytochrome P450 82C4-like               422   8e-138   
ref|XP_010028533.1|  PREDICTED: cytochrome P450 CYP82D47-like           422   9e-138   
gb|ABK28662.1|  unknown                                                 422   9e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008245476.1|  PREDICTED: cytochrome P450 CYP82D47-like           422   1e-137   
ref|XP_008464764.1|  PREDICTED: cytochrome P450 CYP82D47-like           422   1e-137   
ref|XP_004147804.1|  PREDICTED: cytochrome P450 82C4-like               422   1e-137   
ref|XP_007151142.1|  hypothetical protein PHAVU_004G021300g             422   1e-137   
ref|XP_003528211.2|  PREDICTED: cytochrome P450 82A1-like               422   1e-137   
ref|XP_010919967.1|  PREDICTED: cytochrome P450 CYP82D47-like           422   1e-137   
ref|XP_009364178.1|  PREDICTED: cytochrome P450 CYP82D47-like           422   1e-137   
ref|XP_006375025.1|  hypothetical protein POPTR_0014s03700g             424   1e-137   
ref|XP_010106082.1|  Cytochrome P450 82A3                               422   2e-137   
ref|XP_006346673.1|  PREDICTED: cytochrome P450 82C4-like               421   2e-137   
ref|XP_011030954.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    422   2e-137   
ref|XP_010064744.1|  PREDICTED: cytochrome P450 CYP82D47-like           422   2e-137   
ref|XP_011030947.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    421   3e-137   
ref|XP_002510297.1|  cytochrome P450, putative                          421   4e-137   
ref|XP_009795251.1|  PREDICTED: cytochrome P450 CYP82D47-like           421   4e-137   
gb|AGF30364.1|  CYP450 monooxygenase CYP82D33                           421   5e-137   
gb|KCW58033.1|  hypothetical protein EUGRSUZ_H00761                     421   5e-137   
emb|CAN76287.1|  hypothetical protein VITISV_027433                     421   5e-137   
ref|XP_004238199.1|  PREDICTED: cytochrome P450 CYP82D47-like           421   6e-137   
emb|CAN65652.1|  hypothetical protein VITISV_016780                     418   9e-137   
gb|KDP38432.1|  hypothetical protein JCGZ_04357                         420   1e-136   
ref|XP_009364774.1|  PREDICTED: cytochrome P450 82A3-like               420   1e-136   
ref|XP_004291926.1|  PREDICTED: cytochrome P450 82A3-like               420   1e-136   
gb|KDP38424.1|  hypothetical protein JCGZ_04349                         419   1e-136   
emb|CBI37514.3|  unnamed protein product                                436   2e-136   
ref|XP_008220885.1|  PREDICTED: cytochrome P450 82A3-like               434   2e-136   
ref|XP_004306669.1|  PREDICTED: cytochrome P450 82A3-like               420   2e-136   
gb|AFK79026.1|  cytochrome P450 CYP82T1                                 419   2e-136   
ref|XP_009336967.1|  PREDICTED: cytochrome P450 82A4-like               419   2e-136   
ref|XP_002282133.1|  PREDICTED: cytochrome P450 CYP82D47                419   2e-136   
ref|XP_002282118.1|  PREDICTED: cytochrome P450 CYP82D47-like           419   3e-136   
ref|XP_010028535.1|  PREDICTED: cytochrome P450 CYP82D47-like           419   3e-136   
ref|XP_009336429.1|  PREDICTED: cytochrome P450 82A3-like               419   3e-136   
ref|XP_006486180.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    418   5e-136   
emb|CDP15067.1|  unnamed protein product                                416   7e-136   
ref|XP_008343753.1|  PREDICTED: cytochrome P450 CYP82D47-like           417   9e-136   
ref|XP_008236910.1|  PREDICTED: cytochrome P450 CYP82D47-like           418   1e-135   
ref|XP_010934114.1|  PREDICTED: cytochrome P450 82C4-like               417   1e-135   
ref|XP_007134139.1|  hypothetical protein PHAVU_010G022600g             417   1e-135   
ref|XP_009372222.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    417   2e-135   
ref|XP_007224171.1|  hypothetical protein PRUPE_ppa016912mg             416   2e-135   
ref|XP_010106083.1|  Cytochrome P450 82A3                               417   2e-135   
gb|KCW68806.1|  hypothetical protein EUGRSUZ_F02405                     416   3e-135   
emb|CBI19611.3|  unnamed protein product                                429   3e-135   
gb|KGN59915.1|  Cytochrome P450                                         416   4e-135   
ref|XP_009364766.1|  PREDICTED: cytochrome P450 82A3-like               416   4e-135   
ref|XP_010106080.1|  Cytochrome P450 82A3                               419   5e-135   
gb|KDP26344.1|  hypothetical protein JCGZ_17502                         416   5e-135   
gb|ABK55756.1|  P450 monooxygenase-like protein                         416   5e-135   
ref|XP_008464768.1|  PREDICTED: cytochrome P450 CYP82D47-like           416   5e-135   
ref|XP_008235427.1|  PREDICTED: cytochrome P450 82G1-like               416   6e-135   
ref|XP_007017404.1|  Cytochrome P450 82A3, putative                     415   6e-135   
ref|XP_011005663.1|  PREDICTED: cytochrome P450 CYP82D47-like           415   9e-135   
ref|XP_006379218.1|  hypothetical protein POPTR_0009s11180g             413   1e-134   
ref|XP_007017414.1|  Cytochrome P450 82A3, putative                     422   1e-134   
gb|KHG24650.1|  Cytochrome P450 protein                                 414   1e-134   
gb|KCW68803.1|  hypothetical protein EUGRSUZ_F02402                     414   2e-134   
ref|XP_010064743.1|  PREDICTED: cytochrome P450 CYP82D47-like           414   2e-134   
ref|XP_007156852.1|  hypothetical protein PHAVU_002G022900g             414   2e-134   
ref|XP_003516592.1|  PREDICTED: cytochrome P450 82A3-like isoform X1    414   2e-134   
gb|AAC39454.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   415   2e-134   
gb|KDP38434.1|  hypothetical protein JCGZ_04359                         415   2e-134   
gb|KHN36187.1|  Cytochrome P450 82A3                                    414   3e-134   
ref|XP_006366470.1|  PREDICTED: cytochrome P450 82A3-like               413   3e-134   
ref|XP_007207908.1|  hypothetical protein PRUPE_ppa019731mg             412   3e-134   
ref|XP_007201144.1|  hypothetical protein PRUPE_ppa016050mg             412   4e-134   
ref|XP_003523886.1|  PREDICTED: cytochrome P450 82A1-like               413   4e-134   
ref|XP_004488195.1|  PREDICTED: cytochrome P450 82A3-like               412   4e-134   
ref|XP_008464769.1|  PREDICTED: cytochrome P450 CYP82D47-like           413   5e-134   
gb|KDP45301.1|  hypothetical protein JCGZ_15166                         413   5e-134   
ref|XP_004489343.1|  PREDICTED: cytochrome P450 82A3-like               413   5e-134   
gb|KDP38426.1|  hypothetical protein JCGZ_04351                         412   6e-134   
ref|XP_011030924.1|  PREDICTED: cytochrome P450 CYP82D47-like           412   6e-134   
ref|XP_008378401.1|  PREDICTED: cytochrome P450 CYP82D47-like           413   6e-134   
ref|XP_010106088.1|  Cytochrome P450 82A4                               412   7e-134   
gb|KHN13272.1|  Cytochrome P450 82A4                                    412   7e-134   
ref|XP_006573616.1|  PREDICTED: cytochrome P450 82A3-like isoform X3    412   9e-134   
ref|XP_009336448.1|  PREDICTED: cytochrome P450 82A3-like               412   9e-134   
ref|XP_009336438.1|  PREDICTED: cytochrome P450 82A3-like               412   1e-133   
ref|XP_003543523.2|  PREDICTED: cytochrome P450 82A4-like               412   1e-133   
ref|XP_004291927.1|  PREDICTED: cytochrome P450 82A3-like               412   1e-133   
ref|XP_008391540.1|  PREDICTED: cytochrome P450 82A4-like               412   2e-133   
ref|XP_007201702.1|  hypothetical protein PRUPE_ppa004095mg             412   2e-133   
ref|XP_007047112.1|  Cytochrome P450                                    416   3e-133   
ref|XP_006432669.1|  hypothetical protein CICLE_v10000844mg             411   3e-133   
ref|XP_008372516.1|  PREDICTED: cytochrome P450 82G1-like               411   4e-133   
ref|XP_008343493.1|  PREDICTED: cytochrome P450 82A3-like               411   4e-133   
ref|XP_006471473.1|  PREDICTED: cytochrome P450 82A3-like               410   4e-133   
ref|XP_009341185.1|  PREDICTED: cytochrome P450 CYP82D47-like           411   4e-133   
ref|XP_003527704.1|  PREDICTED: cytochrome P450 82A1-like               411   4e-133   
ref|XP_008382597.1|  PREDICTED: cytochrome P450 82G1-like               410   6e-133   
gb|AJD25201.1|  cytochrome P450 CYP82D71                                410   6e-133   
ref|XP_007017411.1|  Cytochrome P450, putative                          410   7e-133   
ref|XP_007224041.1|  hypothetical protein PRUPE_ppa015200mg             409   8e-133   
ref|XP_003537400.1|  PREDICTED: cytochrome P450 82A3-like               410   1e-132   
ref|XP_008388170.1|  PREDICTED: cytochrome P450 82A3-like               410   1e-132   
emb|CDP07595.1|  unnamed protein product                                421   1e-132   
ref|XP_003604789.1|  Cytochrome P450                                    410   1e-132   
ref|XP_008235428.1|  PREDICTED: cytochrome P450 82G1-like               409   1e-132   
ref|XP_003554125.1|  PREDICTED: cytochrome P450 82A4-like               409   2e-132   
ref|XP_008355533.1|  PREDICTED: cytochrome P450 CYP82D47-like           409   2e-132   
ref|XP_004154898.1|  PREDICTED: cytochrome P450 82A3-like               408   2e-132   
ref|XP_006473406.1|  PREDICTED: cytochrome P450 82A3-like               409   2e-132   
ref|XP_008466638.1|  PREDICTED: cytochrome P450 CYP82D47-like           408   4e-132   
ref|XP_004291928.1|  PREDICTED: cytochrome P450 82A4-like               408   6e-132   
ref|XP_008355522.1|  PREDICTED: cytochrome P450 CYP82D47-like           408   7e-132   
ref|XP_006434891.1|  hypothetical protein CICLE_v10000852mg             407   8e-132   
ref|XP_004238200.1|  PREDICTED: cytochrome P450 CYP82D47-like           407   9e-132   
gb|KDO84377.1|  hypothetical protein CISIN_1g009899mg                   407   1e-131   
gb|KHG01223.1|  Cytochrome P450 protein                                 407   1e-131   
ref|XP_008388075.1|  PREDICTED: cytochrome P450 82A3-like               407   1e-131   
ref|XP_007222593.1|  hypothetical protein PRUPE_ppa004169mg             406   2e-131   
ref|XP_006375029.1|  putative cytochrome P450 family protein            406   2e-131   
ref|XP_004505090.1|  PREDICTED: cytochrome P450 82A3-like               407   2e-131   
ref|XP_008345296.1|  PREDICTED: cytochrome P450 CYP82D47-like           406   3e-131   
ref|XP_008464766.1|  PREDICTED: cytochrome P450 CYP82D47-like           405   3e-131   
ref|XP_010527267.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    406   3e-131   
ref|XP_007151148.1|  hypothetical protein PHAVU_004G021900g             406   4e-131   
ref|XP_010060880.1|  PREDICTED: cytochrome P450 CYP82D47-like           406   4e-131   
ref|XP_006366469.1|  PREDICTED: cytochrome P450 82A3-like               403   4e-131   
gb|KHN42044.1|  Cytochrome P450 82A3                                    405   5e-131   
gb|KHN04536.1|  Cytochrome P450 82A1                                    404   6e-131   
ref|XP_006364811.1|  PREDICTED: cytochrome P450 82A3-like               404   8e-131   
ref|XP_003554859.1|  PREDICTED: cytochrome P450 82A4-like               405   9e-131   
gb|KHN34164.1|  Cytochrome P450 82A4                                    404   1e-130   
gb|KDP29948.1|  hypothetical protein JCGZ_18517                         404   1e-130   
ref|XP_007223263.1|  hypothetical protein PRUPE_ppa004464mg             404   1e-130   
ref|XP_004147820.1|  PREDICTED: cytochrome P450 82C4-like               404   1e-130   
ref|XP_002510311.1|  cytochrome P450, putative                          404   1e-130   
gb|AGN54072.1|  cytochrome P450 monooxygenase                           404   2e-130   
ref|XP_010696237.1|  PREDICTED: cytochrome P450 82G1                    404   2e-130   
ref|XP_009348372.1|  PREDICTED: cytochrome P450 82G1-like               404   2e-130   
ref|XP_009336944.1|  PREDICTED: cytochrome P450 82A3-like               404   2e-130   
ref|XP_003554118.2|  PREDICTED: cytochrome P450 82A4-like               404   2e-130   
gb|KEH37856.1|  cytochrome P450 family protein                          403   3e-130   
gb|KHN16363.1|  Cytochrome P450 82A4                                    403   3e-130   
ref|XP_010249368.1|  PREDICTED: cytochrome P450 CYP82D47-like           404   3e-130   
ref|XP_003619137.1|  Cytochrome P450                                    402   4e-130   
ref|XP_010527268.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    402   6e-130   
ref|XP_007136643.1|  hypothetical protein PHAVU_009G061500g             402   6e-130   
gb|KHN42045.1|  Cytochrome P450 82C4                                    400   6e-130   
ref|XP_002510308.1|  cytochrome P450, putative                          402   8e-130   
gb|KEH30993.1|  cytochrome P450 family protein                          402   1e-129   
ref|XP_003517019.1|  PREDICTED: cytochrome P450 82A4-like               402   1e-129   
ref|XP_002522370.1|  cytochrome P450, putative                          401   1e-129   
gb|KDP38427.1|  hypothetical protein JCGZ_04352                         401   1e-129   
ref|XP_007151143.1|  hypothetical protein PHAVU_004G021400g             401   2e-129   
ref|XP_006366437.1|  PREDICTED: cytochrome P450 82A3-like               401   2e-129   
ref|XP_011099742.1|  PREDICTED: cytochrome P450 CYP82D47-like           400   3e-129   
ref|XP_007151141.1|  hypothetical protein PHAVU_004G021200g             400   4e-129   
ref|XP_009372224.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    401   4e-129   
ref|XP_009372223.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    401   4e-129   
gb|AAS90126.1|  cytochrome P450                                         400   4e-129   
ref|XP_004308852.1|  PREDICTED: cytochrome P450 82A3-like               398   6e-129   
ref|XP_008351399.1|  PREDICTED: cytochrome P450 82A4-like               400   7e-129   
ref|XP_007151147.1|  hypothetical protein PHAVU_004G021800g             399   8e-129   
ref|XP_010527266.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    399   8e-129   
ref|XP_007151146.1|  hypothetical protein PHAVU_004G021700g             399   8e-129   
ref|XP_009372225.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    400   1e-128   
ref|XP_007151145.1|  hypothetical protein PHAVU_004G021600g             399   1e-128   
gb|KEH18124.1|  cytochrome P450 family 82 protein                       397   1e-128   
ref|XP_009758036.1|  PREDICTED: cytochrome P450 82C4-like               396   1e-128   
ref|XP_004147822.1|  PREDICTED: uncharacterized protein LOC101212976    414   1e-128   
ref|XP_010036785.1|  PREDICTED: cytochrome P450 82G1                    399   1e-128   
ref|XP_003618363.1|  Cytochrome P450                                    399   2e-128   
ref|XP_007217488.1|  hypothetical protein PRUPE_ppa027160mg             398   2e-128   
ref|XP_006856215.1|  hypothetical protein AMTR_s00059p00202900          403   2e-128   
ref|XP_009624056.1|  PREDICTED: cytochrome P450 82A3-like               398   2e-128   
ref|XP_010040235.1|  PREDICTED: cytochrome P450 CYP82D47-like           399   2e-128   
ref|XP_003618345.1|  Cytochrome P450                                    398   3e-128   
ref|XP_008228483.1|  PREDICTED: cytochrome P450 CYP82D47-like           397   4e-128   
ref|XP_007133366.1|  hypothetical protein PHAVU_011G173200g             397   5e-128   
gb|KCW52083.1|  hypothetical protein EUGRSUZ_J01518                     397   6e-128   
ref|XP_011073191.1|  PREDICTED: cytochrome P450 82C4-like               397   7e-128   
ref|XP_006581227.1|  PREDICTED: cytochrome P450 82A1-like               397   7e-128   
gb|AII31759.1|  cytochrome P450 monooxygenase                           397   9e-128   
gb|AES74584.2|  cytochrome P450 family protein                          397   1e-127   
ref|XP_006471191.1|  PREDICTED: cytochrome P450 82C4-like               397   1e-127   
ref|XP_002510312.1|  cytochrome P450, putative                          395   3e-127   
ref|XP_011099743.1|  PREDICTED: cytochrome P450 CYP82D47-like           395   3e-127   
ref|XP_006432705.1|  hypothetical protein CICLE_v10001118mg             393   4e-127   
ref|XP_009804510.1|  PREDICTED: cytochrome P450 CYP82D47-like           395   4e-127   
ref|XP_010527265.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    395   5e-127   
gb|KHG29695.1|  Cytochrome P450                                         395   5e-127   
gb|AII31758.1|  cytochrome P450 monooxygenase                           395   5e-127   
ref|XP_010040234.1|  PREDICTED: cytochrome P450 CYP82D47-like           395   5e-127   
ref|XP_004489342.1|  PREDICTED: cytochrome P450 82A1-like               395   6e-127   
ref|XP_009374201.1|  PREDICTED: cytochrome P450 CYP82D47-like           395   6e-127   
gb|KHN19614.1|  Cytochrome P450 82A4                                    394   6e-127   
emb|CDP16080.1|  unnamed protein product                                394   9e-127   
gb|KHN22285.1|  Cytochrome P450 82A4                                    394   9e-127   
ref|XP_003618361.1|  Cytochrome P450                                    394   9e-127   
ref|XP_003618365.1|  Cytochrome P450                                    394   1e-126   
gb|AAG09208.1|AF175278_1  wound-inducible P450 hydroxylase              394   1e-126   
ref|XP_010527272.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    392   1e-126   
ref|XP_003618354.1|  Cytochrome P450                                    394   2e-126   
ref|XP_003619141.1|  Cytochrome P450                                    394   2e-126   
gb|KHG01290.1|  Cytochrome P450                                         394   2e-126   
ref|XP_010527271.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    392   2e-126   
gb|AES74583.2|  cytochrome P450 family 82 protein                       394   2e-126   
gb|KHN44000.1|  Cytochrome P450 82A4                                    393   2e-126   
ref|XP_008378426.1|  PREDICTED: cytochrome P450 CYP82D47-like           393   2e-126   
ref|XP_010527270.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    393   3e-126   
gb|KHG29694.1|  Cytochrome P450                                         392   3e-126   
ref|XP_010527269.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    393   5e-126   
sp|Q43068.2|C82A1_PEA  RecName: Full=Cytochrome P450 82A1; AltNam...    393   6e-126   
gb|EYU23762.1|  hypothetical protein MIMGU_mgv1a004588mg                392   6e-126   
gb|KCW60845.1|  hypothetical protein EUGRSUZ_H03582                     392   7e-126   
gb|KCW45363.1|  hypothetical protein EUGRSUZ_L00956                     392   7e-126   
sp|O49859.1|C82A4_SOYBN  RecName: Full=Cytochrome P450 82A4; AltN...    392   7e-126   
gb|KCW67753.1|  hypothetical protein EUGRSUZ_F01486                     392   7e-126   
gb|KHG07801.1|  Cytochrome P450                                         392   7e-126   
gb|KHN22284.1|  Cytochrome P450 82A3                                    389   8e-126   
ref|XP_004147801.1|  PREDICTED: cytochrome P450 82A4-like               392   1e-125   
gb|KEH30997.1|  cytochrome P450 family protein                          391   1e-125   
ref|XP_008464770.1|  PREDICTED: cytochrome P450 CYP82D47-like           391   1e-125   
ref|XP_002885694.1|  CYP82G1                                            391   1e-125   
ref|XP_003554857.2|  PREDICTED: cytochrome P450 82A4-like               401   2e-125   
ref|XP_010060877.1|  PREDICTED: cytochrome P450 CYP82D47-like           391   2e-125   
ref|XP_007151144.1|  hypothetical protein PHAVU_004G021500g             390   2e-125   
gb|KDO37275.1|  hypothetical protein CISIN_1g012878mg                   388   2e-125   
ref|XP_007225086.1|  hypothetical protein PRUPE_ppa017464mg             390   3e-125   
ref|XP_009606708.1|  PREDICTED: cytochrome P450 CYP82D47-like           390   3e-125   
ref|NP_001240972.1|  cytochrome P450 82A3                               390   5e-125   
gb|KHN00733.1|  Cytochrome P450 82A4                                    390   5e-125   
ref|XP_010686308.1|  PREDICTED: cytochrome P450 CYP82D47-like           389   5e-125   
ref|XP_010064547.1|  PREDICTED: cytochrome P450 CYP82D47-like           389   6e-125   
ref|XP_007041355.1|  Cytochrome P450 82C4, putative isoform 1           392   8e-125   
ref|XP_008219217.1|  PREDICTED: cytochrome P450 82A3-like               389   1e-124   
emb|CAN82329.1|  hypothetical protein VITISV_016031                     385   1e-124   
ref|XP_010696627.1|  PREDICTED: cytochrome P450 CYP82D47-like           388   1e-124   
ref|XP_003519977.1|  PREDICTED: cytochrome P450 82A4-like               388   2e-124   
ref|XP_007216265.1|  hypothetical protein PRUPE_ppa017300mg             388   2e-124   



>ref|XP_006349946.1| PREDICTED: cytochrome P450 82C2-like [Solanum tuberosum]
Length=531

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/524 (51%), Positives = 362/524 (69%), Gaps = 16/524 (3%)
 Frame = -1

Query  1661  ILGIAALVLLWFSWR--KQSKRLPPEAGGAWPIIGHLHHFRTS--VPLVKTLSEWADKYG  1494
             +L IA +    F W+  K    LPPE  G WP+IGHL  F  +  +PL + L+  ADKYG
Sbjct  14    LLLIAFIFSSIFIWKLLKPQNPLPPEISGGWPVIGHLLQFSGADDIPLSRKLATLADKYG  73

Query  1493  PVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYW  1314
             PVFT RLG+  ILVVS+++ V+DC  TNDK  AARP + AG+Y+GY+ A+   +    YW
Sbjct  74    PVFTFRLGLPCILVVSSYDAVKDCLCTNDKAFAARPASLAGEYIGYNNAMLFLANYGPYW  133

Query  1313  RNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRW  1134
             R +RK+V+ E+LSS R+EKLK V VSE+Q +INE Y+ I++  + N + P   KVN++ W
Sbjct  134   RKIRKIVLQEVLSSSRLEKLKFVRVSEIQTSINELYSLISVAGE-NVDFPV--KVNVTNW  190

Query  1133  FGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR  954
                LTL+LI++++AG+ Y     G   EEA+R KK     MY+  EFV  DA FP+  F+
Sbjct  191   IEKLTLSLIVKMIAGKSYGRVEKGGNEEEAERFKKALKDFMYISMEFVLWDA-FPIALFK  249

Query  953   WLDYEGHVKSMKRAAKDVDAILQDWVDA--RRKERRS---NEDQKFIDVMLSMIDDQ-FT  792
             W+D++GHVK MKR  KD+D +LQ+W+D   ++KER       +Q FIDVMLSM+ ++ F 
Sbjct  250   WIDFQGHVKFMKRTFKDIDCVLQNWLDEHLKKKERVDVVDGNEQDFIDVMLSMMSNEDFA  309

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
              G+S  R+T IKA  LSM+ DAS+T A HL W++A LL H + +K+VQ+E+DT +G+ RW
Sbjct  310   DGHS--RETTIKATALSMVLDASDTTAIHLNWVMATLLNHRDVMKKVQEELDTKVGRNRW  367

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E+SD+KNL Y Q VVKETLR+YP  P L PHE++EDCIV GYHIPKGT+L+VN  +L R
Sbjct  368   VEESDIKNLVYFQAVVKETLRLYPPAPLLVPHESIEDCIVQGYHIPKGTRLWVNTMKLQR  427

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DPKIW +P  F PERF+T+  G   + +QY+F+PFG  RRSCPG  YA Q+T +A+A L 
Sbjct  428   DPKIWSNPNTFDPERFLTSQAGCDVRGQQYEFIPFGSRRRSCPGITYAIQVTHLAIAHLL  487

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL  120
             QGF+FST  NEPLDM E +G+ + K+ P+EV++TPR    L++ 
Sbjct  488   QGFDFSTPSNEPLDMKEGLGMTMRKVNPIEVMITPRFPSVLYKF  531



>ref|XP_006339196.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=524

 Score =   526 bits (1356),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 247/524 (47%), Positives = 362/524 (69%), Gaps = 20/524 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLLWF-SWRKQSKRLPPEAGGAWPIIGHLHHFR--TSVPLVKTLSEWADK  1500
             L+++L  +  ++LW  +W+  S +LPPE  G+WPIIGHL  F    +VPL +T  + +D+
Sbjct  14    LATLLVFSLSIILWTRNWK--STKLPPEIPGSWPIIGHLRGFGDGKNVPLARTFGKLSDQ  71

Query  1499  YGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNS  1320
             YGP+FTI+LG+ R  V++NWE  +DCFT NDK +AARP + A ++ GY+YA F+F+    
Sbjct  72    YGPIFTIKLGMYRYCVINNWEAAKDCFTINDKELAARPISLAAEHYGYNYARFSFANYGP  131

Query  1319  YWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMS  1140
             Y+  VRKLV+  +LSS R+EK+KHV  SE++ +I E Y      ++ N        +N+S
Sbjct  132   YYCQVRKLVLQNVLSSTRLEKVKHVRTSEVEISIKELYNLCGKGDNSNT-------INIS  184

Query  1139  RWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWF  960
             +WF  LTLN+I++++AG+RY         EEAQ  +K F+++MYL GEF+  DAI P   
Sbjct  185   KWFEKLTLNIIVKMIAGKRYISLEK---DEEAQCFRKAFAKIMYLAGEFILYDAI-PFKI  240

Query  959   FRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFT  792
             F+++D++GH+K+MK+  KD+D ILQ WV+   ++++    +N +Q  ID MLS+   +  
Sbjct  241   FKYVDFQGHIKTMKQIYKDLDDILQSWVNEHMEKKKIEGDNNNEQDCIDSMLSVTKLEDF  300

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
             + Y Y+RDTVIKA VLSM+ D S+T A HLTW++++LL +P  +  VQ EID  +GK+RW
Sbjct  301   KAYGYTRDTVIKATVLSMILDGSDTTAVHLTWLMSLLLNNPHVMSHVQKEIDNKVGKDRW  360

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E+SD+K+L YLQ +VKE LR+YP  P L PHEAVEDC V GY+IPKGT+L+ N W++ R
Sbjct  361   VEESDIKDLVYLQAIVKEALRLYPPAPLLVPHEAVEDCTVAGYNIPKGTRLFPNAWKIQR  420

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP+++ +P+KF+PERF+       A+ + ++F+PFG GRRSCPG  +ATQ+  + + RL 
Sbjct  421   DPRVYSEPDKFMPERFLNEHSNVDARGQHFEFIPFGSGRRSCPGINFATQVAHLTIGRLI  480

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL  120
             QGFNF T  N P+DM E  GI +PK  P+EV++TPRL+  L+ L
Sbjct  481   QGFNFGTPSNLPVDMTEGQGITMPKAKPVEVVITPRLNSMLYEL  524



>ref|XP_009801176.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=517

 Score =   523 bits (1348),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 250/523 (48%), Positives = 361/523 (69%), Gaps = 20/523 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTS---VPLVKTLSEW  1509
               +++G+ A V L    WR+   S++L PE  GAWPIIGHL     +   +P  + L   
Sbjct  5     FQALIGLLAFVFLSIILWRRTLASRKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGAL  64

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             ADKYGPVFT+R+G+   L+V+NWE  +DC TT+DK +AARPT+ AG+ +GY YA FT++ 
Sbjct  65    ADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDLAARPTSMAGESIGYKYARFTYAN  124

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
                Y+  VRKL + ++LSS ++EK+KH+ VSE++ +I E Y+   + N+         KV
Sbjct  125   FGPYYNQVRKLALQQVLSSTKLEKMKHIRVSEMETSIKELYSLALVKNN-------IQKV  177

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI-F  972
             N+S+WF  LTLN+I++ + G+RY   S+    EEAQR +K F  +MY+ G+ V  DAI F
Sbjct  178   NISKWFEQLTLNIIVKTICGKRY---SNIEEDEEAQRFRKAFKGIMYVVGQIVLYDAIPF  234

Query  971   PLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARR-KERRSNEDQKFIDVMLSMIDDQF  795
             PL  F++ D++GH+K MK+  KD+D ILQ W+D    K+  +NEDQ  +D ML +     
Sbjct  235   PL--FKYFDFQGHIKLMKKIYKDLDYILQGWLDDHMMKKDVNNEDQDAMDAMLKVTQLNE  292

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
              + Y +S+ TVIK+ VLS++ D ++T A HL W++++LL +P  +K+ Q+EID  +GKER
Sbjct  293   FKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQAQEEIDMKVGKER  352

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W ED+D+KNL YLQ +VKETLR+YP  P+L PHEAV+DC V GYHIPKGT+L++N W++H
Sbjct  353   WVEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVAGYHIPKGTRLHINAWKVH  412

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP+IW +PE+F+PERF+T+     A+ + ++F+PFG GRRSCPG  +AT +T +   RL
Sbjct  413   RDPEIWSEPERFMPERFLTSKANVDARGQNFEFIPFGSGRRSCPGINFATLVTHLTFGRL  472

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGF+FST  N P+DM E VG+ LPK+  +EVL++PRL   L+
Sbjct  473   LQGFDFSTPSNTPIDMTEGVGVTLPKVNQVEVLISPRLPSKLY  515



>ref|XP_006352674.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=520

 Score =   522 bits (1345),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 254/528 (48%), Positives = 358/528 (68%), Gaps = 28/528 (5%)
 Frame = -1

Query  1661  ILGIAALVL---LWFSWR-----KQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTL  1518
             +L IA  V+   L+  W+     K S +    LPPE  GA+  IGHL+ F +  PL   L
Sbjct  5     LLAIAIFVIFVSLYMLWKTKIQAKNSSKVMINLPPEIPGAYFPIGHLYLFISKTPLALIL  64

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
             +  ADKYG +F+IRLGI R ++VSNWE V++CFTTNDK +A RP + AG YLGY+ A F 
Sbjct  65    ANLADKYGHIFSIRLGIHRAIIVSNWEIVKECFTTNDKVLAGRPASSAGIYLGYNNAAFG  124

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
             F+    YWRN+RKLV++E+LSS+R+++ KH+ V+E++ NI E Y++I       + NPS 
Sbjct  125   FADYGPYWRNIRKLVLLEVLSSKRLDQFKHIRVTEVETNIKELYSSIL---KSGSTNPS-  180

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
              KVNMS+WF  LTLN+IM+++ G+RY+        E+ +   +   + MY   +FV  D 
Sbjct  181   -KVNMSKWFEQLTLNVIMKMITGKRYKTED-----EKGRHFTRTTKEYMYESVQFVLSDV  234

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR---SNEDQKFIDVMLSMI  807
             I PL F +W D++G +KSMK+ ++++D I+  W+D    +R     ++DQ FIDVMLS I
Sbjct  235   I-PLPFLKWFDFQGRIKSMKKLSQEMDKIVTSWIDEHLMKRELAIKDDDQDFIDVMLSKI  293

Query  806   DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
             D+QF   Y Y+R+T+IKA +L+++   S+T + HLTW+L++L+ +   + + Q+EID  I
Sbjct  294   DEQFM--YGYTRETIIKATILNIILAGSDTTSIHLTWLLSLLVNNKHVMDQAQEEIDMKI  351

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             GKERW E+ D+KNL YLQ +VKETLR+YP GP   PH A+EDC V GY +PKGT+L VNV
Sbjct  352   GKERWVEECDIKNLVYLQAIVKETLRLYPPGPLAIPHAAMEDCTVGGYKVPKGTRLMVNV  411

Query  446   WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             W+LHRDP+IW DPEKF+PERFM +        + ++F+PFG GRRSCPG  +A Q+T + 
Sbjct  412   WKLHRDPQIWSDPEKFMPERFMKSHSEIDISGQNFEFIPFGSGRRSCPGITFAMQVTHLT  471

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             +ARL QGFNFST+ + P+D+     I LPK  PLEV V PRL+P L++
Sbjct  472   LARLLQGFNFSTLGDLPVDLTVGNSITLPKANPLEVFVMPRLAPMLYQ  519



>ref|XP_009761500.1| PREDICTED: cytochrome P450 82C2-like [Nicotiana sylvestris]
Length=555

 Score =   522 bits (1345),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 259/530 (49%), Positives = 357/530 (67%), Gaps = 26/530 (5%)
 Frame = -1

Query  1637  LLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTS--VPLVKTLSEWADKYGPVFTIRLGIS  1464
             L +F   K    LPPE  G WP+IGHL  F  +  +PL + L+  A+KYGPVFT RLG+ 
Sbjct  28    LKYFKLSKPLNPLPPEISGGWPVIGHLLQFSGADDIPLSRKLATLAEKYGPVFTFRLGLP  87

Query  1463  RILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVE  1284
             R+LVVS+++ VRDC   NDK  AARP + AG+Y+GY+ A+   S+   YWR +RK+V+ E
Sbjct  88    RVLVVSSYDAVRDCLNANDKAFAARPASLAGEYIGYNNAMLFLSSYGPYWRKIRKIVLQE  147

Query  1283  LLSSRRMEKLKHVWVSELQANINEFYT----------------TIAMDNDKNNNNPSAPK  1152
             +LSS R+EKLK+V VSELQ +I E ++                +I  DN     +    K
Sbjct  148   VLSSSRLEKLKNVRVSELQTSIKELFSLFPVTGDHSSVTGDHSSITGDNLPVTGDYVPVK  207

Query  1151  VNMSRWFGHLTLNLIMQIVAGRRY-EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
             +N++ W   LTL+LI++++AG+ Y          EEA+R KK     MY+  EFV  DA 
Sbjct  208   LNLTNWIEKLTLSLIVKMIAGKSYGRLNEKAEDEEEAERFKKALKDFMYISMEFVLWDA-  266

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR-----SNEDQKFIDVMLSM  810
             FP+  F+W+D++GHVK MKR  KD+D +LQ+W+D   K+R      +  +Q FIDVMLSM
Sbjct  267   FPIPLFKWIDFQGHVKFMKRTFKDIDCVLQNWLDEHVKKREGVDVVAGNEQDFIDVMLSM  326

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
             + ++     SY+R+T IKA  LSM+ DAS+T A HL W++A+LL H + +K+VQ+E+DT 
Sbjct  327   MSNE-DFADSYTRETTIKATALSMVLDASDTTAIHLNWVMAILLNHRDVMKKVQEELDTK  385

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             I + RW E+SD+KNL Y Q V+KETLR+YP  P L PHE+VEDCIV GYHIPKGT+L+VN
Sbjct  386   ISRNRWVEESDIKNLVYFQAVIKETLRLYPPAPLLVPHESVEDCIVHGYHIPKGTRLWVN  445

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
               +L RDP+IW +P+ F PERF+T+  G   + +QY+F+PFG GRRSCPG  YATQ+T +
Sbjct  446   TMKLQRDPEIWSNPDTFDPERFLTSQAGFDVRGQQYEFIPFGSGRRSCPGITYATQVTHL  505

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL  120
             A+A L QGF+FST+ NEPLDM E +G+ + K+ P+EVL+ PRL   L++ 
Sbjct  506   AIAHLLQGFDFSTLLNEPLDMKEGLGMTMRKVNPIEVLIMPRLPSVLYKF  555



>ref|XP_009606611.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=548

 Score =   521 bits (1342),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 260/523 (50%), Positives = 359/523 (69%), Gaps = 19/523 (4%)
 Frame = -1

Query  1637  LLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTS--VPLVKTLSEWADKYGPVFTIRLGIS  1464
             L +F+  K    LPPE  G WP+IGHL  F  +  +PL + L+  A+KYGPVFT RLG+ 
Sbjct  28    LKYFNRSKPLNPLPPEISGGWPVIGHLLQFFGADDIPLSRKLATLAEKYGPVFTFRLGLP  87

Query  1463  RILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVE  1284
             RILVVS++E VRDC  TNDK  AARP + AG+Y+GY+ A+   ++   YWR +RK+V+ E
Sbjct  88    RILVVSSYEAVRDCLNTNDKAFAARPASLAGEYIGYNNAMLFLASYGPYWRKIRKIVLQE  147

Query  1283  LLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKN----NNNPSAP-----KVNMSRWF  1131
             +LSS R+EKLK V VSE+Q +I E ++   +  D +    +N P        K+N++ W 
Sbjct  148   VLSSSRLEKLKIVRVSEVQTSIKELFSLFPVTGDHSSITGDNFPVTGDYVPVKLNLTNWI  207

Query  1130  GHLTLNLIMQIVAGRRY-EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR  954
               LTL+LI++++AG+ Y      G   EEA+R KK     MY+  EFV  DA FP+  F+
Sbjct  208   EKLTLSLIVKMIAGKSYGRLNEKGEDEEEAERFKKALKDFMYISMEFVLWDA-FPIPLFK  266

Query  953   WLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR-----SNEDQKFIDVMLSMIDDQFTQ  789
             W+D++GHVK MKR  KD+D +LQ+W+D   K+R      +  +Q FIDVMLSM+ ++   
Sbjct  267   WIDFQGHVKFMKRTFKDIDCVLQNWLDEHMKKREEVDVVAGNEQDFIDVMLSMMSNE-DF  325

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
               SY+R+T IKA  LSM+ DAS+T A HL W++A LL H + +K+VQ+E+DT +G+ RW 
Sbjct  326   ADSYTRETTIKATALSMVLDASDTTAIHLNWVMATLLNHRDVMKKVQEELDTKVGRNRWV  385

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
             E+SD+KNL Y Q V+KETLR+YP  P L PHE+VEDCIV GYHIPKGT+L+VN  +L RD
Sbjct  386   EESDIKNLVYFQAVIKETLRLYPPAPLLVPHESVEDCIVHGYHIPKGTRLWVNTMKLQRD  445

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ  249
             P+IW DP+ F PERF+T   G   + +QY+F+PFG GRRSCPG  YA+Q+T +A+A L Q
Sbjct  446   PEIWSDPDTFDPERFLTCQAGFDVRGQQYEFIPFGSGRRSCPGITYASQVTHLAIAHLLQ  505

Query  248   GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL  120
             GF+F+T  NEPL+M E +G+ + K+ P+EVL+TPRL   L++ 
Sbjct  506   GFDFTTPFNEPLEMKEGLGMTMRKVNPIEVLITPRLPSVLYKF  548



>gb|ABC69375.1| CYP82M1v4 [Nicotiana tabacum]
Length=521

 Score =   517 bits (1332),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 251/523 (48%), Positives = 358/523 (68%), Gaps = 20/523 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTS---VPLVKTLSEW  1509
               ++LG+ A V L    WR+   S++L PE  GAWPIIGHL     +   +P  + L   
Sbjct  9     FQALLGLLAFVFLSIILWRRTLTSRKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGAL  68

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             ADKYGPVFT+R+G+   L+V+NWE  +DC TT+DK +AARPT+ AG+ +GY YA FT++ 
Sbjct  69    ADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDLAARPTSMAGESIGYKYARFTYAN  128

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
                Y+  VRKL +  +LSS ++EK+KH+ VSEL+ +I E Y+   +   KNN      KV
Sbjct  129   FGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETSIKELYS---LTLGKNN----MQKV  181

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI-F  972
             N+S+WF  LTLN+I++ + G+RY   S+    EEAQR +K F  +M++ G+ V  DAI F
Sbjct  182   NISKWFEQLTLNIIVKTICGKRY---SNIEEDEEAQRFRKAFKGIMFVVGQIVLYDAIPF  238

Query  971   PLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR-SNEDQKFIDVMLSMIDDQF  795
             PL  F++ D++GH++ M +  KD+D+ILQ W+D     +  +N+DQ  ID ML +     
Sbjct  239   PL--FKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKDVNNKDQDAIDAMLKVTQLNE  296

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
              + Y +S+ TVIK+ VLS++ D ++T A HL W++++LL +P  +K+ Q+EID  +GKER
Sbjct  297   FKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKVGKER  356

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W ED+D+KNL YLQ +VKETLR+YP  P+L PHEAV+DC V GYHIPKGT+LY+N W++H
Sbjct  357   WIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVH  416

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP+IW +PEKF+P RF+T+     A+ + ++F+PFG GRRSCPG  +AT +T +   RL
Sbjct  417   RDPEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRL  476

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGF+FS   N P+DM E VG+ LPK+  +EVL+TPRL   L+
Sbjct  477   LQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>ref|XP_009616319.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=521

 Score =   516 bits (1330),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 251/527 (48%), Positives = 359/527 (68%), Gaps = 20/527 (4%)
 Frame = -1

Query  1682  VPCCLSSILGIAALVLL-WFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTS---VPLVKT  1521
             +     ++LG+ A V L    WR+   S++L PE  GAWPIIGHL     +   +P  + 
Sbjct  5     ISSHFQALLGLLAFVFLSIILWRRTLTSRKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRI  64

Query  1520  LSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVF  1341
             L   ADKYGPVFT+R+G+   L+V+NWE  +DC TT+DK  AARPT+ AG+ +GY YA F
Sbjct  65    LGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGYKYARF  124

Query  1340  TFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPS  1161
             T++    Y+  VRKL +  +LSS ++EK+KH+ VSEL+ +I E Y+   +   KNN    
Sbjct  125   TYANFGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETSIKELYS---LTLGKNNMQ--  179

Query  1160  APKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGD  981
               KVN+S+WF  LTLN+I++ + G+RY   S+    EEAQR +K F  +M++ G+ V  D
Sbjct  180   --KVNISKWFEQLTLNIIVKTICGKRY---SNIEEDEEAQRFRKAFKGIMFVVGQIVLYD  234

Query  980   AI-FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR-SNEDQKFIDVMLSMI  807
             AI FPL  F++ D++GH++ M +  KD+D+ILQ W+D     +  +N+DQ  ID ML + 
Sbjct  235   AIPFPL--FKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKDVNNKDQDAIDAMLKVT  292

Query  806   DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
                  + Y +S+ TVIK+ VLS++ D ++T A HL W++++LL +P  +K+ Q+EID  +
Sbjct  293   QLNEFKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKV  352

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             GKERW ED+D+KNL YLQ +VKETLR+YP  P+L PHEAV+DC V GYHIPKGT+LY+N 
Sbjct  353   GKERWIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINA  412

Query  446   WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             W++HRDP+IW +PEKF+P+RF+T+     A+ + ++F+PFG GRRSCPG  +AT +T + 
Sbjct  413   WKVHRDPEIWSEPEKFMPDRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLT  472

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
               RL QGF+FS   N P+DM E VG+ LPK+  +EVL+TPRL   L+
Sbjct  473   FGRLLQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>gb|ABC69374.1| CYP82M1v3 [Nicotiana tabacum]
Length=521

 Score =   516 bits (1328),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 251/523 (48%), Positives = 357/523 (68%), Gaps = 20/523 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTS---VPLVKTLSEW  1509
               ++LG+ A V L    WR+   S++L PE  GAWPIIGHL     +   +P  + L   
Sbjct  9     FQALLGLLAFVFLSIILWRRTLTSRKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGAL  68

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             ADKYGPVFT+R+G+   L+V+NWE  +DC TT+DK  AARPT+ AG+ +GY YA FT++ 
Sbjct  69    ADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGYKYARFTYAN  128

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
                Y+  VRKL +  +LSS ++EK+KH+ VSEL+ +I E Y+   +   KNN      KV
Sbjct  129   FGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETSIKELYS---LTLGKNN----MQKV  181

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI-F  972
             N+S+WF  LTLN+I++ + G+RY   S+    EEAQR +K F  +M++ G+ V  DAI F
Sbjct  182   NISKWFEQLTLNIIVKTICGKRY---SNIEEDEEAQRFRKAFKGIMFVVGQIVLYDAIPF  238

Query  971   PLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR-SNEDQKFIDVMLSMIDDQF  795
             PL  F++ D++GH++ M +  KD+D+ILQ W+D     +  +N+DQ  ID ML +     
Sbjct  239   PL--FKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKDVNNKDQDAIDAMLKVTQLNE  296

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
              + Y +S+ TVIK+ VLS++ D ++T A HL W++++LL +P  +K+ Q+EID  +GKER
Sbjct  297   FKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKMGKER  356

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W ED+D+KNL YLQ +VKETLR+YP  P+L PHEAV+DC V GYHIPKGT+LY+N W++H
Sbjct  357   WIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVH  416

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP+IW +PEKF+P RF+T+     A+ + ++F+PFG GRRSCPG  +AT +T +   RL
Sbjct  417   RDPEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRL  476

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGF+FS   N P+DM E VG+ LPK+  +EVL+TPRL   L+
Sbjct  477   LQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>ref|XP_004249377.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=524

 Score =   515 bits (1327),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 241/524 (46%), Positives = 363/524 (69%), Gaps = 20/524 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLLWF-SWRKQSKRLPPEAGGAWPIIGHLHHFR--TSVPLVKTLSEWADK  1500
             L+++L  +  ++LW  +W+  S +LPP+  G+WPIIGHL  F    +VPL +T  + +++
Sbjct  14    LATLLVFSLSIILWTRNWK--STKLPPKIPGSWPIIGHLRGFGDGENVPLARTFGKLSNQ  71

Query  1499  YGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNS  1320
             YGP+FTI+LG+ R  V++NWE  +DCFT NDK +AARP + A ++ GY+YA F+F+    
Sbjct  72    YGPIFTIKLGMYRYCVINNWEAAKDCFTINDKELAARPISLAAEHYGYNYARFSFANYGP  131

Query  1319  YWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMS  1140
             Y+  VRKLV+  +LSS R+EK+K+V +SE++ +I E Y       + N        +N+S
Sbjct  132   YYCQVRKLVLQNVLSSTRLEKVKNVRISEVEISIKELYNIWGKGENSNT-------INIS  184

Query  1139  RWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWF  960
             +WF  LTLN+I++++AG+RY         +EAQ  ++ F+++MYL GEF+  DAI P   
Sbjct  185   KWFEKLTLNIIVKMIAGKRYISLEK---DQEAQCFRRAFAKIMYLAGEFILYDAI-PFKI  240

Query  959   FRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFT  792
             F+++D++GH+K+MK+  KD+D ILQ WV+   ++++    +N +Q  ID MLS+   +  
Sbjct  241   FKYVDFQGHIKTMKQIYKDLDDILQSWVNEHMEKKKIEGDNNNEQDCIDSMLSVTKLEDF  300

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
             + Y Y+RDTVIKAIVLSM+ D S+T A HLTW++++LL +P  +   Q EID+ +GK+RW
Sbjct  301   KAYGYTRDTVIKAIVLSMILDGSDTTAVHLTWLMSLLLNNPRVMNNAQKEIDSKVGKDRW  360

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              E+SD+K+L YLQ +VKE LR+YP  P L PHEAVEDC V GY+IPKGT+L+ N W++ R
Sbjct  361   IEESDIKDLVYLQAIVKEALRLYPPAPLLVPHEAVEDCTVAGYNIPKGTRLFANAWKIQR  420

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP+++ +P+KF+PERF+       A+ + ++F+PFG GRRSCPG  +ATQ+  + + RL 
Sbjct  421   DPRVYSEPDKFIPERFLNEHSNVDARGQHFEFIPFGSGRRSCPGINFATQVAHLTIGRLI  480

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL  120
             QGF+F T  N P+DM E  GI +PK  P+EV++TPRL+  L+ L
Sbjct  481   QGFSFGTPSNLPVDMTEGQGITMPKAKPVEVVITPRLNSMLYEL  524



>gb|ABC69373.1| CYP82M1v2 [Nicotiana tabacum]
Length=521

 Score =   513 bits (1322),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 250/523 (48%), Positives = 356/523 (68%), Gaps = 20/523 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTS---VPLVKTLSEW  1509
               ++LG+ A V L    WR+   S++L PE  GAWPIIGHL     +   +P  + L   
Sbjct  9     FQALLGLLAFVFLSIILWRRTLTSRKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGAL  68

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             ADKYGPVFT+R+G+   L+V+NWE  +DC TT+DK  AARPT+ AG+ +GY YA FT++ 
Sbjct  69    ADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGYKYARFTYAN  128

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
                Y+  VRKL +  +LSS ++EK+KH+ VSEL+ +I E Y+   +   KNN      KV
Sbjct  129   FGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETSIKELYS---LTLGKNN----MQKV  181

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI-F  972
             N+S+WF  LTLN+I++ + G+RY   S+    EEAQR +K F  +M++ G+ V  DAI F
Sbjct  182   NISKWFEQLTLNIIVKTICGKRY---SNIEEDEEAQRFRKAFKGIMFVVGQIVLYDAIPF  238

Query  971   PLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR-SNEDQKFIDVMLSMIDDQF  795
             PL  F++ D++GH++ M +  KD+D+ILQ W+D     +  +N+DQ  ID ML +     
Sbjct  239   PL--FKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKDVNNKDQDAIDAMLKVTQLNE  296

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
              + Y +S+ TVIK+ VLS++ D ++T A HL W++++LL +P  +K+ Q+EID  +GKER
Sbjct  297   FKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKVGKER  356

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W ED+D+KNL YLQ +VKETLR++P  P+L PHEAV+DC V GYHIPKGT+LY+N W++H
Sbjct  357   WIEDTDIKNLVYLQAIVKETLRLFPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVH  416

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP+IW +PEKF+P RF+T+     A+ + ++F+PFG GRRSCPG  +AT +T +   RL
Sbjct  417   RDPEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRL  476

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGF+FS   N P DM E VG+ LPK+  +EVL+TPRL   L+
Sbjct  477   LQGFDFSKPSNTPTDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>gb|ABC69372.1| CYP82M1v1 [Nicotiana tabacum]
Length=521

 Score =   513 bits (1322),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 250/523 (48%), Positives = 356/523 (68%), Gaps = 20/523 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTS---VPLVKTLSEW  1509
               ++LG+ A V L    WR+   S++L PE  GAWPIIGHL     +   +P  + L   
Sbjct  9     FQALLGLLAFVFLSIILWRRTLTSRKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGAL  68

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             ADKYGPVFT+R+G+   L+V+NWE  +DC TT+DK  AARPT+ AG+ +GY YA FT++ 
Sbjct  69    ADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGYKYARFTYAN  128

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
                Y+  VRKL +  +LSS ++EK+KH+ VSEL+ +I E Y+   +   KNN      KV
Sbjct  129   FGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETSIKELYS---LTLGKNN----MQKV  181

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI-F  972
             N+S+WF  LTLN+I++ + G+RY   S+    EEAQR +K F  +M++ G+ V  DAI F
Sbjct  182   NISKWFEQLTLNIIVKTICGKRY---SNIEEDEEAQRFRKAFKGIMFVVGQIVLYDAIPF  238

Query  971   PLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR-SNEDQKFIDVMLSMIDDQF  795
             PL  F++ D++GH++ M +  KD+D+ILQ W+D     +  +N+DQ  ID ML +     
Sbjct  239   PL--FKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKDVNNKDQDAIDAMLKVTQLNE  296

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
              + Y +S+ TVIK+ VLS++ D ++T A HL W++++LL +P  +K+ Q+EID  +GKER
Sbjct  297   FKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKVGKER  356

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W ED+D+KNL YLQ +VKETLR+YP  P+L PHEAV+DC V GYHIPKGT+LY+N W++H
Sbjct  357   WIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVH  416

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RD +IW +PEKF+P RF+T+     A+ + ++F+PFG GRRSCPG  +AT +T +   RL
Sbjct  417   RDSEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGLGFATLVTHLTFGRL  476

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGF+FS   N P+DM E VG+ LPK+  +EVL+TPRL   L+
Sbjct  477   LQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>gb|ABC69376.1| CYP82M1v5 [Nicotiana tabacum]
Length=521

 Score =   513 bits (1321),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 250/523 (48%), Positives = 356/523 (68%), Gaps = 20/523 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQ--SKRLPPEAGGAWPIIGHLHHFRTS---VPLVKTLSEW  1509
               ++LG+ A V L    WR+   S++L PE  GAWPIIGHL     +   +P  + L   
Sbjct  9     FQALLGLLAFVFLSIILWRRTLTSRKLAPEIPGAWPIIGHLRQLSGTDKNIPFPRILGAL  68

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             ADKYGPVFT+R+G+   L+V+NWE  +DC TT+DK  AARPT+ AG+ +GY YA FT++ 
Sbjct  69    ADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKDFAARPTSMAGESIGYKYARFTYAN  128

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
                Y+  VRKL +  + SS ++EK+KH+ VSEL+ +I E Y+   +   KNN      KV
Sbjct  129   FGPYYNQVRKLALQHVPSSTKLEKMKHIRVSELETSIKELYS---LTLGKNNMQ----KV  181

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI-F  972
             N+S+WF  LTLN+I++ + G+RY   S+    EEAQR +K F  +M++ G+ V  DAI F
Sbjct  182   NISKWFEQLTLNIIVKTICGKRY---SNIEEDEEAQRFRKAFKGIMFVVGQIVLYDAIPF  238

Query  971   PLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR-SNEDQKFIDVMLSMIDDQF  795
             PL  F++ D++GH++ M +  KD+D+ILQ W+D     +  +N+DQ  ID ML +     
Sbjct  239   PL--FKYFDFQGHIQLMNKIYKDLDSILQGWLDDHMMNKDVNNKDQDAIDAMLKVTQLNE  296

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
              + Y +S+ TVIK+ VLS++ D ++T A HL W++++LL +P  +K+ Q+EID  +GKER
Sbjct  297   FKAYGFSQATVIKSTVLSLILDGNDTTAVHLIWVMSLLLNNPHVMKQGQEEIDMKVGKER  356

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W ED+D+KNL YLQ +VKETLR+YP  P+L PHEAV+DC V GYHIPKGT+LY+N W++H
Sbjct  357   WIEDTDIKNLVYLQAIVKETLRLYPPVPFLLPHEAVQDCKVTGYHIPKGTRLYINAWKVH  416

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP+IW +PEKF+P RF+T+     A+ + ++F+PFG GRRSCPG  +AT +T +   RL
Sbjct  417   RDPEIWSEPEKFMPNRFLTSKANIDARGQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRL  476

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGF+FS   N P+DM E VG+ LPK+  +EVL+TPRL   L+
Sbjct  477   LQGFDFSKPSNTPIDMTEGVGVTLPKVNQVEVLITPRLPSKLY  519



>ref|XP_011089652.1| PREDICTED: cytochrome P450 82C2 [Sesamum indicum]
Length=528

 Score =   511 bits (1315),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 250/507 (49%), Positives = 352/507 (69%), Gaps = 21/507 (4%)
 Frame = -1

Query  1622  WRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRIL  1455
             WRK  +       PE  GAWP+IGHLH     VP+ +TL   AD+YGPVFT+RLG+   L
Sbjct  33    WRKSPQNPKVNSAPEPSGAWPVIGHLHLLGGRVPVYRTLGGLADRYGPVFTVRLGVHTAL  92

Query  1454  VVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLS  1275
             VVS+WE V+DCFTTNDK +  RP + AGKYLGYDYA F FS + +YWR +RKLV++E+LS
Sbjct  93    VVSSWEAVKDCFTTNDKILNKRPASSAGKYLGYDYAAFGFS-HGTYWRQMRKLVLLEVLS  151

Query  1274  SRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIV  1095
             +RR+E LK+VW SE+  +INE Y              S   V +S W   LTLN I+ ++
Sbjct  152   ARRLESLKNVWESEIHTSINELY-----------KKHSGKVVVISEWIERLTLNTIVMMI  200

Query  1094  AGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKR  915
             AG+RY   + G  + EA+  +++  + MY+ G+FV+ DAI P    RW+D++GH+KSMKR
Sbjct  201   AGKRYTDSTQGDETVEARSFRELIKEFMYISGQFVASDAI-PFPPLRWMDFQGHIKSMKR  259

Query  914   AAKDVDAILQDWVDARRK---ERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVL  744
              +K++  + + W+    +   + R   +Q FIDVMLS ID++FT  + ++R+T+IKA  L
Sbjct  260   ISKELSTVFERWITEHVRSDCKSRLGNEQDFIDVMLSTIDEKFTS-FGHTRETIIKATAL  318

Query  743   SMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVV  564
             +++   S+T + HLTW+L++LL + + +++ Q+EID  +GKERW ++SD+KNL YLQ VV
Sbjct  319   NLILAGSDTTSIHLTWLLSLLLNNRQVMQQAQEEIDMKVGKERWVQESDIKNLVYLQAVV  378

Query  563   KETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERF  384
             KETLR++P GP   PHEA+EDC V GYH+PKGT+L VNVW+LHRDP+IW +P+ F+PERF
Sbjct  379   KETLRLFPPGPLSVPHEAMEDCCVAGYHVPKGTRLLVNVWKLHRDPRIWAEPDNFVPERF  438

Query  383   MTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMM  204
             +T+        + ++FVPFG GRRSCPG  +A Q+T + +ARL QGF+ +T  N P+DM 
Sbjct  439   LTSHVAVDFTGQNHEFVPFGSGRRSCPGITFAMQVTHLTLARLLQGFDLATPSNGPVDMT  498

Query  203   EDVGIILPKLTPLEVLVTPRLSPTLFR  123
             E + I LPK TPLEV++TPRLS  L++
Sbjct  499   EGLSITLPKATPLEVVITPRLSDGLYQ  525



>ref|XP_007200049.1| hypothetical protein PRUPE_ppa023510mg [Prunus persica]
 gb|EMJ01248.1| hypothetical protein PRUPE_ppa023510mg [Prunus persica]
Length=517

 Score =   503 bits (1295),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 253/520 (49%), Positives = 351/520 (68%), Gaps = 22/520 (4%)
 Frame = -1

Query  1670  LSSILGIAAL-VLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1512
             LS  L IA L VL+ + WR      K    L P+  GA PIIGHLH  R  VP+ KTL+ 
Sbjct  4     LSHPLAIAGLLVLVLYLWRVRIQSHKIKGMLAPQPSGALPIIGHLHKLR--VPVFKTLAA  61

Query  1511  WADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFS  1332
              ADKYGP+FTI LG   +LV+SN++ V+ CFT ND   A RP +  GKYLGY+YA F FS
Sbjct  62    MADKYGPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFATRPRSSHGKYLGYNYAGFGFS  121

Query  1331  TNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPK  1152
                 YWR++RK+V+VELLS RR++ LKHV +SE+ A I   +     +   N  NP+  K
Sbjct  122   PYGPYWRDMRKMVMVELLSIRRLQNLKHVQISEVDAFIKGLFLLCKTEG-LNGLNPT--K  178

Query  1151  VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
             V +S W  HLTLN+I +++AG+RY   SD     + QR  K+  + MY+ G  V+ D I 
Sbjct  179   VVISDWIEHLTLNVITRMIAGKRYFDSSD---EGDEQRFGKIVKEFMYVSGNPVAADVI-  234

Query  971   PLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQ  798
                F  W+D++G VK+MKR  K++D+++  WV+    +KE  S ++  FIDVM+S+I+D 
Sbjct  235   --GFPSWIDFKGQVKAMKRIMKELDSVMGSWVEEHYAKKETNSRDEHDFIDVMMSVIEDN  292

Query  797   FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE  618
              T GY+  R+T+IKA  ++++   SET A +L WIL++LL +  +LK  Q+E+D  +G++
Sbjct  293   STLGYT--RETIIKATSMNLILAGSETTAINLIWILSLLLNNRHALKLAQEELDLKVGRD  350

Query  617   RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL  438
             RW ED+D++NLPYLQ +VKETLR+YP GP   PHEA++DC V G+HIPKGT+L+VN+W+L
Sbjct  351   RWIEDTDIENLPYLQAIVKETLRLYPPGPLSVPHEAMQDCQVCGFHIPKGTRLFVNLWKL  410

Query  437   HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR  258
             HRDP +WPDPE F PERF+T   G  A  + ++F+PFG GRRSCPG  +A Q+T + + R
Sbjct  411   HRDPCLWPDPEVFCPERFLTTHVGIDASGKHFEFIPFGSGRRSCPGATFALQVTHLTLGR  470

Query  257   LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
             L QGF  +T  + P+D+ E +GI +PK T LEV++TPRLS
Sbjct  471   LLQGFELATPMDMPVDLTEGLGITMPKATSLEVILTPRLS  510



>dbj|BAM36724.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   501 bits (1291),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 243/527 (46%), Positives = 356/527 (68%), Gaps = 29/527 (6%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1515
             + +I+G+  L  L +F W K+S++    LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     IEAIVGLVTLTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYGPV+T RLG+  +LVVS++E ++DCF+TND   + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +    YWR  RKL++ E+LS+ R+EK KHV ++++Q  I + Y+ I    D N++     
Sbjct  125   ANYGPYWRKNRKLIIQEVLSASRLEKFKHVRLAKIQTGIKDLYSRI----DGNSST----  176

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R KK F   M L  EFV  DA 
Sbjct  177   -INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSN---EDQKFIDVMLSMID  804
             FP+  F+W+D++GHVK+MKR  KD+D++ Q+W++   K+R  N    +Q FIDV+LS + 
Sbjct  232   FPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREVNAEGNEQDFIDVVLSKMS  291

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
             +++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EIDT +G
Sbjct  292   NEYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVG  350

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             K+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV 
Sbjct  351   KDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVM  410

Query  443   RLHRDPKIWPDPEKFLPERFM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             +L RDPK+WP+P+ F PERF+  N++    + + Y+++PFG GRRSCPG  YA Q+  + 
Sbjct  411   KLQRDPKLWPNPDNFDPERFVAANID---FRGQHYEYIPFGSGRRSCPGMTYALQVEHLT  467

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +ARL QGFN+ T   EPLDM E  GI + K+ P+EV++TPRL+P L+
Sbjct  468   MARLIQGFNYRTPTKEPLDMKEGAGITIRKVNPVEVIITPRLAPELY  514



>dbj|BAM36727.1| nicotine N-demethylase [Nicotiana langsdorffii]
Length=516

 Score =   501 bits (1291),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 243/527 (46%), Positives = 353/527 (67%), Gaps = 28/527 (5%)
 Frame = -1

Query  1670  LSSILGIAALV--LLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVKTL  1518
             + +I G+  LV  L +F W K+S++    LPP+  G WP+IGHL +F       PL + L
Sbjct  5     IEAIAGVVTLVTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKL  64

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
              + ADKYGPV+T RLG+  +LVVS++E ++DCF+TND   + RP    G+YLGY+ A+  
Sbjct  65    GDLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLF  124

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
              +    YWR  RKL++ E+LS+ R+EK KHV ++++Q  I + Y+ I    D N++    
Sbjct  125   LANYGPYWRKNRKLIIQEVLSASRLEKFKHVRLAKIQTGIKDLYSRI----DGNSST---  177

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
               +N++ W   L   LI++++AG+ YE    G   E+ +R K  F   M L  EFV  DA
Sbjct  178   --INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMILSMEFVLWDA  232

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSN---EDQKFIDVMLSMI  807
              FP+  F+W+D++GHVK+MKR  KD+D++ Q+W++   K+R  N    +Q FIDV+LS +
Sbjct  233   -FPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREVNAEGNEQDFIDVVLSKM  291

Query  806   DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
              +++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EIDT +
Sbjct  292   SNEYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKV  350

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             GK+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV
Sbjct  351   GKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANV  410

Query  446   WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
              +L RDPK+WP+P+ F PERF+        + + Y+++PFG GRRSCPG  YA Q+  + 
Sbjct  411   MKLQRDPKLWPNPDNFDPERFVA--ADIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHLT  468

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +ARL QGFN+ T  NEPLDM E  GI + K+ P+EV++TPRL+P L+
Sbjct  469   MARLIQGFNYRTPTNEPLDMKEGAGITIRKVNPVEVIITPRLAPELY  515



>dbj|BAM36723.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   500 bits (1288),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 242/527 (46%), Positives = 356/527 (68%), Gaps = 29/527 (6%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1515
             + +I+G+  L  L +F W K+S++    LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     IEAIVGLVTLTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYGPV+T RLG+  +LVVS++E ++DCF+TND   + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +    +WR  RKL++ E+LS+ R+EK KHV ++++Q  I + Y+ I    D N++     
Sbjct  125   ANYGPFWRKNRKLIIQEVLSASRLEKFKHVRLAKIQTGIKDLYSRI----DGNSST----  176

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R KK F   M L  EFV  DA 
Sbjct  177   -INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSN---EDQKFIDVMLSMID  804
             FP+  F+W+D++GHVK+MKR  KD+D++ Q+W++   K+R  N    +Q FIDV+LS + 
Sbjct  232   FPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREVNAEGNEQDFIDVVLSKMS  291

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
             +++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EIDT +G
Sbjct  292   NEYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVG  350

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             K+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV 
Sbjct  351   KDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVM  410

Query  443   RLHRDPKIWPDPEKFLPERFM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             +L RDPK+WP+P+ F PERF+  N++    + + Y+++PFG GRRSCPG  YA Q+  + 
Sbjct  411   KLQRDPKLWPNPDNFDPERFVAANID---FRGQHYEYIPFGSGRRSCPGMTYALQVEHLT  467

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +ARL QGFN+ T   EPLDM E  GI + K+ P+EV++TPRL+P L+
Sbjct  468   MARLIQGFNYRTPTKEPLDMKEGAGITICKVNPVEVIITPRLAPELY  514



>dbj|BAM36725.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   500 bits (1288),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 243/527 (46%), Positives = 355/527 (67%), Gaps = 29/527 (6%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1515
             + +I+G+  L LL +F W K+S++    LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     IEAIVGLVTLTLLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYGPV+T RLG+  +LVVS++E ++DCF+TND   + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +    YWR  RKL++ E+LS+ R+EK KHV ++++Q  I + Y+ I    D N++     
Sbjct  125   ANYGPYWRKNRKLIIQEVLSASRLEKFKHVRLAKIQTGIKDLYSRI----DGNSST----  176

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R K  F   M L  EFV  DA 
Sbjct  177   -INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMILSMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSN---EDQKFIDVMLSMID  804
             FP+  F+W+D++GHVK+MKR  KD+D++ Q+W++   K+R  N    +Q FIDV+LS + 
Sbjct  232   FPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREVNAEGNEQDFIDVVLSKMS  291

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
             +++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EIDT +G
Sbjct  292   NEYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKVG  350

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             K+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV 
Sbjct  351   KDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVM  410

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             +L RDPK+W +P+KF PERF+    G+   + + Y+++PFG GRRSCPG  YA Q+  + 
Sbjct  411   KLQRDPKLWSNPDKFDPERFIA---GDIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHLT  467

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +A L QGFN+ T  NEPLDM E  GI + K+ P+EV++TPRL+P L+
Sbjct  468   MAHLIQGFNYRTPTNEPLDMKEGAGITIRKVNPVEVIITPRLAPELY  514



>ref|XP_004248527.2| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=521

 Score =   499 bits (1284),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 249/527 (47%), Positives = 360/527 (68%), Gaps = 24/527 (5%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFS-WRKQ----SKRLPPEAGGAWPIIGHLHHFR---TSVPLVKTLS  1515
             L +ILGI A V      WR+     +++L P+  GAWPIIGHLH       +VP   TL+
Sbjct  5     LEAILGILAFVFFAIIIWRRSNTLTTEKLAPQVPGAWPIIGHLHQLSGIDKNVPFAHTLA  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
               ADKYGP+FT+R+G+   L+++NWEG +DC TT+DK  AARPT+ AG+ +GY YA FT+
Sbjct  65    ALADKYGPIFTLRMGMYPYLIINNWEGAKDCLTTHDKDFAARPTSMAGQSIGYKYARFTY  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             S    Y+ +VRKL + ++LSS ++EK++H+ V EL+ +I + Y+   + N KNN      
Sbjct  125   SNFGLYYNHVRKLALTQVLSSTKLEKMRHIRVVELENSIKDLYSLTQVAN-KNNE-----  178

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N+++WF  LTLN I++ + G+RY         EEA+R +K F  +MY+ G+ V  D +
Sbjct  179   VINITQWFHQLTLNTIVKTICGKRYNNIEK---DEEAKRFRKAFKGIMYVVGQIVLYDVV  235

Query  974   -FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVD--ARRKERRSNEDQKFIDVML-SMI  807
              FPL  F+++D++GH+K M    KD+D+ILQ W++   ++K+  +++D+  ID ML +  
Sbjct  236   PFPL--FKYVDFQGHIKLMNNIYKDLDSILQGWLEDHMKKKDLNNDDDEDAIDAMLKATY  293

Query  806   DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
              D+F + Y YS+ TVIK+ +LS++ D S+T A H+ WI+++LL +P ++K+ Q+EIDT +
Sbjct  294   VDEF-KAYGYSQATVIKSTILSLILDGSDTTAVHMIWIMSLLLNNPHAMKQAQEEIDTKV  352

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             GK RW  +SDVKNL YLQ +VKET R+YP  P L PHEAV+DC V GY IPKGT+ Y+N 
Sbjct  353   GKSRWVGESDVKNLVYLQAIVKETSRLYPPVPLLLPHEAVQDCKVAGYDIPKGTRTYINA  412

Query  446   WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             W++HRDPKIW + EKF+PERF+T+     A+ + ++F+PFG GRRSCPG  +AT +T + 
Sbjct  413   WKIHRDPKIWSESEKFMPERFLTSKSSVDARGQHFEFIPFGSGRRSCPGINFATLVTHLT  472

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              ARL QGF FST  N P+DM E VGI LPK+  +E+LVTPRLS   +
Sbjct  473   FARLLQGFAFSTSSNTPIDMTEGVGITLPKVNQVEILVTPRLSSNFY  519



>dbj|BAM36726.1| nicotine N-demethylase [Nicotiana alata]
Length=515

 Score =   498 bits (1282),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 243/528 (46%), Positives = 354/528 (67%), Gaps = 30/528 (6%)
 Frame = -1

Query  1670  LSSILGIAALV--LLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVKTL  1518
             + +I+G   L+  L +F W K+S++    LPP+  G WP+IGHL +F       PL + L
Sbjct  5     IEAIVGAVTLITFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDNDGDDRPLARKL  64

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
              + ADKYGPV+T RLG+  +LVVS++E ++DCF+TND   + RP    G+YLGY+  +  
Sbjct  65    GDLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLF  124

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
              +    YWR  RKLV+ E+LS+ R+EK KHV ++++Q  I + Y+ I    D N++    
Sbjct  125   LANYGPYWRKNRKLVIQEVLSASRLEKFKHVRLAKIQTGIKDLYSRI----DGNSST---  177

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
               +N++ W   L   LI++++AG+ YE    G   E+ +R K  F   M L  EFV  DA
Sbjct  178   --INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMILSMEFVLWDA  232

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSN---EDQKFIDVMLSMI  807
              FP+  F+W+D++GHVK+MKR  KD+D++ Q+W++   K+R  N    +Q FIDV+LS +
Sbjct  233   -FPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREVNAEGNEQDFIDVVLSKM  291

Query  806   DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
              +++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EIDT +
Sbjct  292   SNEYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDTKV  350

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             GK+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV
Sbjct  351   GKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANV  410

Query  446   WRLHRDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSCPGNLYATQITQV  270
              +L RDPK+WP+P+KF PERF+    G+   + + Y+++PFG GRRSCPG  YA Q+  +
Sbjct  411   MKLQRDPKLWPNPDKFDPERFIA---GDIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHL  467

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +ARL QGFN+ T  NEPLDM E  GI + K+ P+EV++TPRL+  L+
Sbjct  468   TMARLIQGFNYRTPTNEPLDMKEGAGITIRKVNPVEVIITPRLAHELY  515



>ref|XP_008235431.1| PREDICTED: cytochrome P450 82C4-like [Prunus mume]
Length=517

 Score =   498 bits (1281),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 247/514 (48%), Positives = 347/514 (68%), Gaps = 19/514 (4%)
 Frame = -1

Query  1664  SILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1497
             +I G+  LVL  +  R QS +    L P+  GA PIIGHLH  R   P+ KTL+  ADKY
Sbjct  9     AIAGLLVLVLYLWRLRIQSHKIKGMLAPQPSGALPIIGHLHKLRG--PIFKTLAAMADKY  66

Query  1496  GPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSY  1317
             GP+FTI LG   +LV+SN++ V+ CFT ND   A RP +  GKYLGY+YA F FS    Y
Sbjct  67    GPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFATRPRSSHGKYLGYNYAGFGFSPYGPY  126

Query  1316  WRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSR  1137
             WR++RK+V+VELLSSRR++ LKHV +SE+ A I   +  +    + N  NP+  KV +S 
Sbjct  127   WRDMRKMVMVELLSSRRLQNLKHVQISEVDAFIKGLFL-LCKTEEHNGLNPT--KVVISD  183

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
             W  HLTLN+I +++AG+RY    D     + QR  K+  + MY+ G  V+ D I    F 
Sbjct  184   WIEHLTLNVITRMIAGKRY---FDSSYEGDEQRFGKIVKEFMYVSGNPVASDVI---GFP  237

Query  956   RWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQFTQGY  783
              W+D++G +K+MKR  K++D+++  WV+    +K+  S +D  FIDVM+S+I+D  T GY
Sbjct  238   SWIDFKGQIKAMKRIMKELDSVMGSWVEEHYAKKQTDSRDDHDFIDVMISVIEDNSTLGY  297

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
             +  R+T+IKA  L+++   SET A +L WIL++LL +   LK  Q+E+D  +G++RW ED
Sbjct  298   T--RETIIKATSLNLILAGSETTAINLIWILSLLLNNRHVLKLAQEELDLKVGRDRWIED  355

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             +D++NLPYLQ +VKETLR+YP GP   PHEA++DC V G+ IPKGT+L+VN+W+LHRDP 
Sbjct  356   TDIENLPYLQAMVKETLRLYPPGPLSVPHEAMQDCQVCGFDIPKGTRLFVNLWKLHRDPS  415

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             +WPDPE F PERF+T   G  A  + ++F+PFG GRRSCPG  +A Q+T + + RL QGF
Sbjct  416   LWPDPEVFCPERFLTTHVGIDASGKHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGF  475

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
               +T  + P+D+ E +GI +PK T LEV++TPRL
Sbjct  476   ELATPLDMPVDLTEGLGITMPKATSLEVILTPRL  509



>ref|XP_009609539.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
 gb|ABM46920.1| cytochrome P450 monooxygenase CYP82E4 [Nicotiana tomentosiformis]
Length=517

 Score =   496 bits (1278),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 248/533 (47%), Positives = 352/533 (66%), Gaps = 35/533 (7%)
 Frame = -1

Query  1670  LSSILGIAALV----LLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVK  1524
             LS I  I  LV    L +F W K+S++    LPP+  G WP+IGHL HF       PL +
Sbjct  2     LSPIEAIVGLVTFTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLAR  61

Query  1523  TLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAV  1344
              L + ADKYGPVFT RLG+  +LVVS++E V+DCF+TND   + RP    G YLGY+ A+
Sbjct  62    KLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAM  121

Query  1343  FTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNP  1164
                +    YWR  RKLV+ E+LS+ R+EK KHV  + +QA+I   YT I    D N++  
Sbjct  122   LFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQASIKNLYTRI----DGNSST-  176

Query  1163  SAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSG  984
                 +N++ W   L   LI++++AG+ YE    G   E+ +R KK F   M L  EFV  
Sbjct  177   ----INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKKAFKDFMILSMEFVLW  229

Query  983   DAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDV  822
             DA FP+  F+W+D++GHVK+MKR  KD+D++ Q+W++    +R   E      +Q FIDV
Sbjct  230   DA-FPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDV  288

Query  821   MLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDE  642
             +LS + +++  G  YSRDTVIKA V S++ DA++T A H+ W +A+L+ + ++L + Q+E
Sbjct  289   VLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQKALTKAQEE  347

Query  641   IDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQ  462
             IDT +GK+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+
Sbjct  348   IDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTR  407

Query  461   LYVNVWRLHRDPKIWPDPEKFLPERFM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYAT  285
             L+ NV +L RDPK+W DP+ F PERF+ T+++    + + Y+++PFG GRRSCPG  YA 
Sbjct  408   LFANVMKLQRDPKLWSDPDTFDPERFIATDID---FRGQYYKYIPFGSGRRSCPGMTYAL  464

Query  284   QITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             Q+  + +A L QGFN+ T  +EPLDM E  GI + K+ P+E+++ PRL+P L+
Sbjct  465   QVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELIIAPRLAPELY  517



>gb|AJD25203.1| cytochrome P450 CYP82V2 [Salvia miltiorrhiza]
Length=534

 Score =   497 bits (1279),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 236/498 (47%), Positives = 341/498 (68%), Gaps = 15/498 (3%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             PE  GAWPIIGHLH     +P+ + L   ADK GPVFT+RLG+ R +VVS+ E V+DCFT
Sbjct  44    PEPSGAWPIIGHLHLLGGKIPISRILGAMADKLGPVFTLRLGVHRTVVVSSREAVKDCFT  103

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
             TND+ +A RP++ AG YLGY++A F FS +  YWR VRKLV+ E+L+ RR++ L+ V  +
Sbjct  104   TNDRVLAKRPSSTAGIYLGYNHAGFGFS-HGPYWREVRKLVLAEVLTPRRLDSLRPVREA  162

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR--SDG  1062
             EL A++ E +  +   +D         +V +S W   LTL+ IM ++AG+R   R   D 
Sbjct  163   ELAASLGELHELVRGSDDDQER-----EVAISEWLERLTLDTIMMMLAGKRCAERDGGDA  217

Query  1061  VVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQD  882
                EEA+ L+ +  Q MY+ G+FV  D+I P    RWLD +GH+KSMKR A ++  I + 
Sbjct  218   AAEEEAKSLRHIIKQFMYISGQFVVSDSI-PFPPLRWLDLQGHIKSMKRIADELSEICEG  276

Query  881   WVDARRKERRSNE-----DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET  717
             W+    + RR ++     ++ FIDVMLS IDD+F + + ++R+T+IKA +L+++   S+T
Sbjct  277   WIGEHVERRRIDDGGLGIERDFIDVMLSAIDDKFMR-FGHTRETIIKATLLNLILAGSDT  335

Query  716   FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ  537
              +TH+TWIL++LL +  ++++ Q EID  +GK+RW ++SD+KNL YLQ VVKE LR++P 
Sbjct  336   TSTHMTWILSLLLNNTRAMQQTQAEIDDKVGKDRWVQESDIKNLVYLQAVVKEALRLFPP  395

Query  536   GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA  357
             GP   PHEA+EDC V GYH+ +GT++ VNVW+LHRDP++W +P++F+PERF+T       
Sbjct  396   GPLAVPHEAMEDCRVAGYHVARGTRILVNVWKLHRDPRVWEEPDEFVPERFLTRHADVDF  455

Query  356   QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPK  177
                 ++F+PFG GRRSCPG  +ATQ+T + +ARL QGF F T  +EP+DM E +GI LPK
Sbjct  456   TGHHHEFIPFGSGRRSCPGITFATQVTHLTMARLIQGFEFRTPLDEPVDMTEGLGITLPK  515

Query  176   LTPLEVLVTPRLSPTLFR  123
              T L VLV PRL+P +++
Sbjct  516   ATLLRVLVAPRLAPFMYQ  533



>ref|XP_009609537.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
 gb|ABM46919.1| cytochrome P450 monooxygenase CYP82E3 [Nicotiana tomentosiformis]
Length=518

 Score =   496 bits (1277),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 242/530 (46%), Positives = 350/530 (66%), Gaps = 31/530 (6%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1515
             + +I+G+     L +F W K+S++    LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     VEAIVGLVTFTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYGPVFT RLG+  +LVVS++E ++DCF+TND   + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +   SYWR  RKL++ E+LS+ R+EK KHV  + +Q +I   YT I    D N++     
Sbjct  125   ANYGSYWRKNRKLIIQEVLSASRLEKFKHVRFARIQTSIKNLYTRI----DGNSST----  176

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R KK F   M L  EFV  DA 
Sbjct  177   -INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR-------SNEDQKFIDVML  816
             FP+  F+W+D++GHVK+MKR  KD+D++ Q+W++   K+R           +Q FIDV+L
Sbjct  232   FPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREKIMEVGTEGNEQDFIDVVL  291

Query  815   SMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEID  636
             S + +++  G  YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EID
Sbjct  292   SKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEID  350

Query  635   TNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLY  456
             T +GK+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+
Sbjct  351   TKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLF  410

Query  455   VNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQIT  276
              NV +L RDPK+W +P+KF PERF+          + Y+++PFG GRRSCPG  YA Q+ 
Sbjct  411   ANVMKLQRDPKLWSNPDKFNPERFIA--RDIDFHGQHYEYIPFGSGRRSCPGMTYALQVE  468

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              + +A L QGFN+ T  +EPLDM E  GI + K+ P++V++TPRL+P L+
Sbjct  469   HLTMAHLIQGFNYRTPTDEPLDMKEGAGITIRKVNPVKVIITPRLAPELY  518



>ref|XP_007201695.1| hypothetical protein PRUPE_ppa004301mg [Prunus persica]
 gb|EMJ02894.1| hypothetical protein PRUPE_ppa004301mg [Prunus persica]
Length=517

 Score =   494 bits (1273),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 251/520 (48%), Positives = 348/520 (67%), Gaps = 22/520 (4%)
 Frame = -1

Query  1664  SILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1497
             +I G+  LVL  +  R QS +    L P+  GA PIIGHLH  R   P+ KTL+  ADKY
Sbjct  9     AIAGLLVLVLYLWRLRIQSHKIKGMLAPQPSGALPIIGHLHKLRG--PIFKTLAAMADKY  66

Query  1496  GPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSY  1317
             GP+FTI LG   +LV+SN++ V+ CFT ND   A R  +  GKYLGY+YA F FS   +Y
Sbjct  67    GPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFATRSRSTVGKYLGYNYAGFGFSPYGTY  126

Query  1316  WRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSR  1137
             WR++RK+V+VELLSSRR+E LK V +SE+ A I   +  +      N  NP+  KV +S 
Sbjct  127   WRDMRKMVMVELLSSRRLETLKRVQISEVDAFIKGLFL-LCKTEGHNGLNPT--KVVISD  183

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI-FPLWF  960
             W  HLTLN+I +++AG+RY   SD     + QR  K+  + MY+ G  V+ D I FP   
Sbjct  184   WIEHLTLNVITRMIAGKRYFDSSD---EGDEQRFGKILKEFMYVSGNPVAADVIGFP---  237

Query  959   FRWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQFTQG  786
               W+D++G VK+MKR  K++D+++  WV+    +KE  S ++  FIDVM+S+I+D  T G
Sbjct  238   -SWIDFKGQVKAMKRIMKELDSVMGSWVEEHYAKKETNSRDEHDFIDVMISVIEDNSTLG  296

Query  785   YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAE  606
             Y+  R+T+IKA  L+++   SET A +L WIL++LL +   LK  Q+E+D  +G++RW E
Sbjct  297   YT--RETIIKATSLNLILAGSETTAINLIWILSLLLNNRHVLKLAQEELDLKVGRDRWIE  354

Query  605   DSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDP  426
             D+D++NLPYLQ +VKETLR+YP  P   PHEA++DC V G+HI KGT L+VN+W+LHRDP
Sbjct  355   DTDIENLPYLQAIVKETLRLYPPAPLSVPHEAMQDCQVCGFHIQKGTLLFVNLWKLHRDP  414

Query  425   KIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQG  246
              +WPDPE F PERF+T   G  A  + ++F+PFG GRRSCPG  +A Q+T + + RL QG
Sbjct  415   SLWPDPEVFCPERFLTTHVGIDASGQHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQG  474

Query  245   FNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             F  +T  + P+D+ E VGI +PK T LEV++TPRL P +F
Sbjct  475   FELATPMDMPVDLTEGVGITMPKSTSLEVILTPRL-PLVF  513



>gb|ABD39479.1| CYP82E4v8 [Nicotiana tabacum]
Length=517

 Score =   494 bits (1271),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 242/508 (48%), Positives = 343/508 (68%), Gaps = 27/508 (5%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1449
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1448  SNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSR  1269
             S++E V+DCF+TND   + RP    G YLGY+ A+   +    YWR  RKLV+ E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1268  RMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAG  1089
             R+EK KHV  + +QA+I   YT I    D N++      +N++ W   L   LI++++AG
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI----DGNSST-----INLTDWLEELNFGLIVKMIAG  197

Query  1088  RRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAA  909
             + YE    G   E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK+MKRA 
Sbjct  198   KNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRAF  253

Query  908   KDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV  747
             KD+D++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V
Sbjct  254   KDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATV  312

Query  746   LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV  567
              S++ DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +
Sbjct  313   FSLVLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAI  372

Query  566   VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER  387
             VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+VNV +L RDPK+W DP+ F PER
Sbjct  373   VKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFVNVMKLQRDPKLWSDPDTFDPER  432

Query  386   FM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD  210
             F+ T+++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLD
Sbjct  433   FIATDID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLD  489

Query  209   MMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             M E  GI + K+ P+E+++ PRL+P L+
Sbjct  490   MKEGAGITIRKVNPVELIIAPRLAPELY  517



>ref|XP_009757628.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
 gb|ADP65810.1| nicotine N-demethylase [Nicotiana sylvestris]
Length=517

 Score =   494 bits (1271),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 242/529 (46%), Positives = 348/529 (66%), Gaps = 30/529 (6%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFSWR-----KQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1515
             + +I+G+  L LL++  R     K SK LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     VEAIVGLVTLALLFYFIRTKKSQKPSKPLPPKIPGGWPVIGHLFYFDDDSDDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYGPVFT RLG+  +LVVS++E ++DCF+TND   + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +    YWR  RKLV+ E+L + R+EKLKHV   E+Q +I   YT I    D N++     
Sbjct  125   TKYGPYWRKNRKLVIQEVLCASRLEKLKHVRFGEIQTSIKNLYTRI----DGNSST----  176

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R +K F   + L  EFV  DA 
Sbjct  177   -INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFRKAFKDFIILSMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLS  813
             FP+  F+W+D++GHVK+MKR  KD+D++ Q+W++   K++   E      +Q FIDV+LS
Sbjct  232   FPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHVKKKEKMEVNAEGNEQDFIDVVLS  291

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
              + +++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EID 
Sbjct  292   KMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVALHMNWGMALLINNQHALKKAQEEIDK  350

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +GK+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ 
Sbjct  351   KVGKDRWVEESDIKDLVYLQTIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFA  410

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             NV +L RDPK+W +P+KF PERF         + + Y+F+PFG GRRSCPG  YA Q+  
Sbjct  411   NVMKLQRDPKLWSNPDKFDPERFFA--ADIDFRGQHYEFIPFGSGRRSCPGMTYAMQVEH  468

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + +A L QGFN+ T  +EPLDM E  G+ + K+ P+EV++TPRL+P L+
Sbjct  469   LTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPIEVVITPRLTPELY  517



>gb|ADP65809.1| nicotine N-demethylase [Nicotiana tabacum]
Length=517

 Score =   494 bits (1271),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 242/529 (46%), Positives = 348/529 (66%), Gaps = 30/529 (6%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFSWR-----KQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1515
             + +I+G+  L LL++  R     K SK LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     VEAIVGLVTLTLLFYFIRTKKSQKPSKPLPPKIPGGWPVIGHLFYFDDDSDDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYGPVFT RLG+  +LVVS++E ++DCF+TND   + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +    YWR  RKLV+ E+L + R+EKLKHV   E+Q +I   YT I    D N++     
Sbjct  125   TKYGPYWRKNRKLVIQEVLCASRLEKLKHVRFGEIQTSIKNLYTRI----DGNSST----  176

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R +K F   + L  EFV  DA 
Sbjct  177   -INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFRKAFKDFIILSMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLS  813
             FP+  F+W+D++GHVK+MKR  KD+D++ Q+W++   K++   E      +Q FIDV+LS
Sbjct  232   FPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHVKKKEKMEVNAEGNEQDFIDVVLS  291

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
              + +++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EID 
Sbjct  292   KMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVALHMNWGMALLINNQHALKKAQEEIDK  350

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +GK+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ 
Sbjct  351   KVGKDRWVEESDIKDLVYLQTIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFA  410

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             NV +L RDPK+W +P+KF PERF         + + Y+F+PFG GRRSCPG  YA Q+  
Sbjct  411   NVMKLQRDPKLWSNPDKFDPERFFA--ADIDFRGQHYEFIPFGSGRRSCPGMTYAMQVEH  468

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + +A L QGFN+ T  +EPLDM E  G+ + K+ P+EV++TPRL+P L+
Sbjct  469   LTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPIEVVITPRLTPELY  517



>ref|XP_009619218.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=517

 Score =   493 bits (1269),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 246/529 (47%), Positives = 349/529 (66%), Gaps = 30/529 (6%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQ----SKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1515
             + +I+G+  L LL +F W K+    SK LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     VEAIVGLVTLTLLFYFLWPKKFQIPSKPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYGPVFT RLG+  +LVVS++E V+DCF+TND   + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +    YWR  RKLV+ E+LS+ R+EKLKHV   ++Q +I   YT I    D N++     
Sbjct  125   TKYGPYWRKNRKLVIQEVLSASRLEKLKHVRFGKIQTSIKNLYTRI----DGNSST----  176

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R +K F   + L  EFV  DA 
Sbjct  177   -INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFRKAFKDFIILSMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLS  813
             FP+  F+W+D++GHVK+MKR  KD+D++ Q+W++   K+R   E      +Q FIDV+LS
Sbjct  232   FPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHVKKREKMEVNAQGNEQDFIDVVLS  291

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
              + +++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EID 
Sbjct  292   KMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVALHMNWGMALLINNQHALKKAQEEIDK  350

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +GKERW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ 
Sbjct  351   KVGKERWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFA  410

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             NV +L RDPK+W +P+KF PERF  +      Q+  Y+F+PFG GRRSCPG  YA Q+  
Sbjct  411   NVMKLQRDPKLWSNPDKFDPERFFADDIDYRGQH--YEFIPFGSGRRSCPGMTYALQVEH  468

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + +A L QGFN+ T  +EPLDM E  G+ + K+ P+EV +T RL+P L+
Sbjct  469   LTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPVEVTITARLAPELY  517



>gb|ABD39477.1| CYP82E4v6 [Nicotiana tabacum]
Length=517

 Score =   493 bits (1268),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 241/508 (47%), Positives = 342/508 (67%), Gaps = 27/508 (5%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1449
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1448  SNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSR  1269
             S++E V+DCF+TND   + RP    G YLGY+ A+   +    YWR  RKLV+ E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1268  RMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAG  1089
             R+EK KHV  + +QA+I   YT I    D N++      +N++ W   L   LI++++AG
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI----DGNSST-----INLTDWLEELNFGLIVKMIAG  197

Query  1088  RRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAA  909
             + YE    G   E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK+MKR  
Sbjct  198   KNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTF  253

Query  908   KDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV  747
             KD+D++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V
Sbjct  254   KDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATV  312

Query  746   LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV  567
              S++ DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +
Sbjct  313   FSLVLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAI  372

Query  566   VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER  387
             VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+WPDP+ F PER
Sbjct  373   VKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLLRDPKLWPDPDTFDPER  432

Query  386   FM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD  210
             F+ T+++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLD
Sbjct  433   FIATDID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLD  489

Query  209   MMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             M E  GI + K+ P+E+++ PRL+P L+
Sbjct  490   MKEGAGITIRKVNPVELIIAPRLAPELY  517



>gb|ABX56037.1| CYP82E5v2 [Nicotiana tabacum]
Length=517

 Score =   493 bits (1268),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 246/529 (47%), Positives = 348/529 (66%), Gaps = 30/529 (6%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQ----SKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1515
             + +I+G+  L LL +F W K+    SK LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     VEAIVGLVTLTLLFYFLWPKKFQIPSKPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYGPVFT RLG+  +LVVS++E V+DCF+TND   + RP    G+YLGY  A+   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAIFSNRPAFLYGEYLGYSNAMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +    YWR  RKLV+ E+LS+ R+EKLKHV   ++Q +I   YT I    D N++     
Sbjct  125   TKYGPYWRKNRKLVIQEVLSASRLEKLKHVRFGKIQTSIKSLYTRI----DGNSST----  176

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R +K F   + L  EFV  DA 
Sbjct  177   -INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFRKAFKDFIILSMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLS  813
             FP+  F+W+D++GHVK+MKR  KD+D++ Q+W++   K+R   E      +Q FIDV+LS
Sbjct  232   FPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHVKKREKMEVNAQGNEQDFIDVVLS  291

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
              + +++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EID 
Sbjct  292   KMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVALHMNWGMALLINNQHALKKAQEEIDK  350

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +GKERW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ 
Sbjct  351   KVGKERWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFA  410

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             NV +L RDPK+W +P+KF PERF  +      Q+  Y+F+PFG GRRSCPG  YA Q+  
Sbjct  411   NVMKLQRDPKLWSNPDKFDPERFFADDIDYRGQH--YEFIPFGSGRRSCPGMTYALQVEH  468

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + +A L QGFN+ T  +EPLDM E  G+ + K+ P+EV +T RL+P L+
Sbjct  469   LTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPVEVTITARLAPELY  517



>ref|XP_002274740.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=518

 Score =   493 bits (1268),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 247/526 (47%), Positives = 344/526 (65%), Gaps = 20/526 (4%)
 Frame = -1

Query  1679  PCCLSSILGIAALVLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1518
             P  L +I GI  LVLL+  WR      K   R  PE  GAWP +GHL   R   P+ +TL
Sbjct  4     PSQLVAISGILGLVLLYGVWRVMTLAGKSKGRSAPEPSGAWPFLGHLPLLRGQTPIFRTL  63

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
                ADK+GPVF IRLG+ R LVVS+ E V++CFTTNDK  A+RP++ AGK LGY+YA F 
Sbjct  64    GAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFASRPSSSAGKLLGYNYAGFG  123

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
             F+   + WR +RKL ++E+LS+RR++ LKHV +SEL  +I + Y+       K ++    
Sbjct  124   FAPYGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKDLYSL-----GKGSDWVHP  178

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
              KV MS WF HL+ N++++++AG+RY + + G   EEA+R      + + L G FV  DA
Sbjct  179   VKVVMSEWFQHLSFNIVLKMIAGKRY-FNTSGHGIEEARRAIATIQEFLSLSGAFVLSDA  237

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMID  804
             I  +    W+D +G++ SMKR AK+VD+++  WV+    R     +  Q FIDVMLS+++
Sbjct  238   IPGV---EWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEIRLNSEGSRMQDFIDVMLSVLE  294

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
             D  T  + +SR+TVIKA ++ ++   +ET AT  TW+L+ LL +  +LKR Q+E+D  +G
Sbjct  295   D--TSMFGHSRETVIKATIVILIVGGTETVATTSTWLLSALLNNKHALKRAQEELDLKVG  352

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             + RW E+SD+ NL YLQ V+KETLR+Y   P   PHEA+EDC V GYHIPKGT+L+VN W
Sbjct  353   RGRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPKGTRLFVNAW  412

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             +LHRDP +W DPE F PERF+T+        + ++ +PFG GRRSCPG   A ++  + +
Sbjct  413   KLHRDPSVWSDPEDFQPERFLTSHADLDVLGQHFELIPFGSGRRSCPGITMALKLLPLVI  472

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              RL QGF+ ST  N P+DM E + I L KLTPLEV++TPRL P+ F
Sbjct  473   GRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVILTPRL-PSQF  517



>gb|ABA07807.1| cytochrome P450 monooxygenase CYP82E3 [Nicotiana tabacum]
Length=518

 Score =   492 bits (1266),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 241/530 (45%), Positives = 348/530 (66%), Gaps = 31/530 (6%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1515
             + +I+G+     L +F W K+S++    LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     VEAIVGLVTFTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYGPVFT RLG+  +LVVS++E ++DCF+TND   + RP    G+YLGY  A+   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYKNAMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +   SYWR  RKL++ E+LS+ R+EK KHV  + +Q +I   YT I    D N++     
Sbjct  125   ANYGSYWRKNRKLIIQEVLSASRLEKFKHVRFARIQTSIKNLYTRI----DGNSST----  176

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R KK F   M L  EFV  DA 
Sbjct  177   -INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR-------SNEDQKFIDVML  816
             FP+  F+W+D++GHVK+MKR  KD+D++ Q+W++   K+R           +Q FIDV+L
Sbjct  232   FPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHIKKREKIMEVGTEGNEQDFIDVVL  291

Query  815   SMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEID  636
             S + +++  G  YSRDTVIKA V S++ DA++T A H+   +A+L+ +  +LK+ Q+EID
Sbjct  292   SKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINCGMALLINNQNALKKAQEEID  350

Query  635   TNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLY  456
             T +GK+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+
Sbjct  351   TKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLF  410

Query  455   VNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQIT  276
              NV +L RDPK+W +P+KF PERF+          + Y+++PFG GRRSCPG  YA Q+ 
Sbjct  411   ANVMKLQRDPKLWSNPDKFNPERFIA--RDIDFHGQHYEYIPFGSGRRSCPGMTYALQVE  468

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              + +A L QGFN+ T  +EPLDM E  GI + K+ P++V++TPRL+P L+
Sbjct  469   HLTMAHLIQGFNYRTPTDEPLDMKEGAGITIRKVNPVKVIITPRLAPELY  518



>ref|XP_009778755.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana sylvestris]
Length=515

 Score =   492 bits (1266),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 241/530 (45%), Positives = 342/530 (65%), Gaps = 34/530 (6%)
 Frame = -1

Query  1670  LSSILGIAALV--LLWF----SWRKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTL  1518
             + +I+G   L+  LL+F      +K SK LP +  G WP+IGHL HF       PL + L
Sbjct  5     IEAIVGAVTLITFLLYFLCTKKSQKHSKPLPTKIPGGWPVIGHLFHFNNDGDDRPLARKL  64

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
              + ADKYGPVFT RLG+  +LVVS++E ++DCF+TND   + RP    G+YLGY+  +  
Sbjct  65    GDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLF  124

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
              +    YWR  RKLV+ E+LS+ R+EK K V  + +Q +I   YT I         N ++
Sbjct  125   LANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTSIKNLYTRI---------NGNS  175

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
               +N+S W   L   LI++++AG+ YE    G   E+ +R K  F   M L  EFV  DA
Sbjct  176   STINLSDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMVLSMEFVLWDA  232

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVML  816
              FP+  F+W+D++GH+K+MKR  KD+D++ Q+W++    +R   E      +Q FIDV+L
Sbjct  233   -FPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREKMEVGAEGNEQDFIDVVL  291

Query  815   SMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEID  636
             S +  ++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EID
Sbjct  292   SKLSKEYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEID  350

Query  635   TNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLY  456
             T +GK+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+
Sbjct  351   TKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLF  410

Query  455   VNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQIT  276
              NV +L RDPK+WP+P+ F PERF+ +  G+      Y+++PFG GRRSCPG  YA Q+ 
Sbjct  411   ANVMKLQRDPKLWPNPDNFDPERFVIDFRGQ-----HYEYIPFGSGRRSCPGMTYALQVE  465

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              + +A L QGFN+ T  NEPLDM E  GI + K+  +EVL+ PRL+P L+
Sbjct  466   HLTMAHLIQGFNYRTPTNEPLDMKEGAGITIRKVNSVEVLIKPRLAPELY  515



>gb|ABD39480.1| CYP82E4v10 [Nicotiana tabacum]
Length=517

 Score =   491 bits (1265),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 240/507 (47%), Positives = 337/507 (66%), Gaps = 25/507 (5%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1449
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1448  SNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSR  1269
             S++E V+DCF+TND   + RP    G YLGY+ A+   +    YWR  RKLV+ E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1268  RMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAG  1089
             R+EK KHV  + +QA+I   YT I    D N++      +N++ W   L   LI++++AG
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI----DGNSST-----INLTDWLEELNFGLIVKMIAG  197

Query  1088  RRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAA  909
             + YE    G   E+ +R KK F   M L  EFV  D+ FP+  F+W+D++GHVK+MKR  
Sbjct  198   KNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDS-FPIPLFKWVDFQGHVKAMKRTF  253

Query  908   KDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV  747
             KD+D++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V
Sbjct  254   KDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATV  312

Query  746   LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV  567
              S++ DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +
Sbjct  313   FSLVLDAADTVALHINWGMALLMNNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAI  372

Query  566   VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER  387
             VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PER
Sbjct  373   VKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPER  432

Query  386   FMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDM  207
             F+    G   Q   Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLDM
Sbjct  433   FIATDIGFRGQ--YYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDM  490

Query  206   MEDVGIILPKLTPLEVLVTPRLSPTLF  126
              E  GI + K+ P+E+++ PRL+P L+
Sbjct  491   KEGAGITIRKVNPVELIIAPRLAPELY  517



>gb|ABA07804.1| cytochrome P450 monooxygenase CYP82E4v2 [Nicotiana tabacum]
 gb|ABB36475.1| nicotine demethylase [Nicotiana tabacum]
 gb|ABN42695.1| cytochrome P450 CYP82E4v2 nicotine demethylase [Nicotiana tabacum]
Length=517

 Score =   491 bits (1263),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 240/508 (47%), Positives = 341/508 (67%), Gaps = 27/508 (5%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1449
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1448  SNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSR  1269
             S++E V+DCF+TND   + RP    G YLGY+ A+   +    YWR  RKLV+ E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1268  RMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAG  1089
             R+EK KHV  + +QA+I   YT I    D N++      +N++ W   L   LI++++AG
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI----DGNSST-----INLTDWLEELNFGLIVKMIAG  197

Query  1088  RRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAA  909
             + YE    G   E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK+MKR  
Sbjct  198   KNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTF  253

Query  908   KDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV  747
             KD+D++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V
Sbjct  254   KDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATV  312

Query  746   LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV  567
              S++ DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +
Sbjct  313   FSLVLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAI  372

Query  566   VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER  387
             VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PER
Sbjct  373   VKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPER  432

Query  386   FM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD  210
             F+ T+++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLD
Sbjct  433   FIATDID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLD  489

Query  209   MMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             M E  GI + K+ P+E+++ PRL+P L+
Sbjct  490   MKEGAGITIRKVNPVELIIAPRLAPELY  517



>gb|ABA07805.1| cytochrome P450 monooxygenase CYP82E4v1 [Nicotiana tabacum]
Length=517

 Score =   491 bits (1263),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 240/508 (47%), Positives = 341/508 (67%), Gaps = 27/508 (5%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1449
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1448  SNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSR  1269
             S++E V+DCF+TND   + RP    G YLGY+ A+   +    YWR  RKLV+ E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1268  RMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAG  1089
             R+EK KHV  + +QA+I   YT I    D N++      +N++ W   L   LI++++AG
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI----DGNSST-----INLTDWLEELNFGLIVKMIAG  197

Query  1088  RRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAA  909
             + YE    G   E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK+MKR  
Sbjct  198   KNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTF  253

Query  908   KDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV  747
             KD+D++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V
Sbjct  254   KDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATV  312

Query  746   LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV  567
              S++ DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +
Sbjct  313   FSLVLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAI  372

Query  566   VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER  387
             VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PER
Sbjct  373   VKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPER  432

Query  386   FM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD  210
             F+ T+++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLD
Sbjct  433   FIATDID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLD  489

Query  209   MMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             M E  GI + K+ P+E+++ PRL+P L+
Sbjct  490   MKEGAGITIRKVNPVELIIAPRLAPELY  517



>gb|ABD39478.1| CYP82E4v7 [Nicotiana tabacum]
Length=517

 Score =   490 bits (1262),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 239/508 (47%), Positives = 341/508 (67%), Gaps = 27/508 (5%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1449
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1448  SNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSR  1269
             S++E V+DCF+TND   + RP    G YLGY+ A+   +    YWR  RKLV+ E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1268  RMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAG  1089
             R+EK KHV  + +QA+I   YT I    D N++      +N++ W   L   L+++++AG
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI----DGNSST-----INLTDWLEELNFGLVVKMIAG  197

Query  1088  RRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAA  909
             + YE    G   E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK+MKR  
Sbjct  198   KNYE---SGKGDEQVERFKKAFEDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTF  253

Query  908   KDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV  747
             KD+D++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V
Sbjct  254   KDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATV  312

Query  746   LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV  567
              S++ DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +
Sbjct  313   FSLVLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAI  372

Query  566   VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER  387
             VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PER
Sbjct  373   VKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPER  432

Query  386   FM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD  210
             F+ T+++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLD
Sbjct  433   FIATDID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLD  489

Query  209   MMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             M E  GI + K+ P+E+++ PRL+P L+
Sbjct  490   MKEGAGITIRKVNPVELIIAPRLAPELY  517



>gb|ABD39476.1| CYP82E4v5 [Nicotiana tabacum]
Length=517

 Score =   490 bits (1262),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 240/508 (47%), Positives = 341/508 (67%), Gaps = 27/508 (5%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1449
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1448  SNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSR  1269
             S++E V+DCF+TND   + RP    G YLGY+ A+   +    YWR  RKLV+ E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1268  RMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAG  1089
             R+EK KHV  + +QA+I   YT I    D N++      +N++ W   L   LI++++AG
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI----DGNSST-----INLTDWLEELNFGLIVKMIAG  197

Query  1088  RRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAA  909
             + YE    G   E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK+MKR  
Sbjct  198   KNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTF  253

Query  908   KDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV  747
             KD+D++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V
Sbjct  254   KDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATV  312

Query  746   LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV  567
              S++ DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +
Sbjct  313   FSLVLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAI  372

Query  566   VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER  387
             VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PER
Sbjct  373   VKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVVKLQRDPKLWSDPDTFDPER  432

Query  386   FM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD  210
             F+ T+++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLD
Sbjct  433   FIATDID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLD  489

Query  209   MMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             M E  GI + K+ P+E+++ PRL+P L+
Sbjct  490   MKEGAGITIRKVNPVELIIAPRLAPELY  517



>ref|XP_004236938.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=530

 Score =   490 bits (1261),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 238/529 (45%), Positives = 346/529 (65%), Gaps = 29/529 (5%)
 Frame = -1

Query  1676  CCLSSILGIAALVLLWFSWRKQSKR-LPPEAGGAWPIIGHLHHFRT--SVPLVKTLSEWA  1506
               + ++L +A L     S +K SK  LPPE  G WP+IGHL +F    + PL + LS+ A
Sbjct  15    AAIVALLTLAFLFYFILSTKKSSKLPLPPEIAGGWPVIGHLFYFNDGDNRPLARKLSDLA  74

Query  1505  DKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTN  1326
             DKYGPVFT RLG+ R+LV+S+++ V++C+T ND   A RP    G+Y+GY+ A+   +  
Sbjct  75    DKYGPVFTFRLGLHRMLVISSYDAVKECYTKNDAVFANRPACLYGEYIGYNNAILFLANY  134

Query  1325  NSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVN  1146
              SYWRN+RKL++ E+LS+ R+EKLKHV + +++  I          N +  N+     +N
Sbjct  135   GSYWRNIRKLIIQEVLSNSRLEKLKHVKIEKIRNEIKNL-------NSRIQNSEVKSVIN  187

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             ++ W   +   LI++++AG+ YE   DG   EE +R ++ F + + L  EFV  DA FP+
Sbjct  188   LTDWLEKMNFGLIVKMIAGKNYESGGDG--DEEVERFRETFKKFLVLSMEFVLWDA-FPI  244

Query  965   WFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR-RKERRSNEDQK----FIDVMLS-MID  804
               F+W+D++GHVK MK   KD+D+I Q W+D   ++    NED+K    FIDVMLS M D
Sbjct  245   RLFKWIDFQGHVKLMKETFKDIDSISQRWLDEHVKRNTEVNEDEKYERDFIDVMLSKMSD  304

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
             ++  QG+S  RD  IKA + SM+ DA++T   H+ W + +L+ +   LK+ Q+EIDT +G
Sbjct  305   ERLHQGHS--RDNAIKATIFSMVMDAADTVPHHINWGMTLLINNQHVLKKAQEEIDTKVG  362

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             K RW +D+D+KNL YLQ +VKETLR+YP  P L PHE  E+C+V GY IPKGT+LY NV 
Sbjct  363   KARWIDDNDIKNLVYLQAIVKETLRLYPPSPLLVPHENTEECVVSGYRIPKGTRLYANVM  422

Query  443   RLHRDPKIWPDPEKFLPERFMT---NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             +L  DPK+WP+PE+F P+RF++   N  G+      Y+F+PFG GRRSCPG  YA Q+  
Sbjct  423   KLQLDPKVWPNPEQFNPDRFLSTDINFRGQ-----DYEFIPFGSGRRSCPGISYALQMEH  477

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + +  L QGFN+ T  NEPLD+ E +G+ +PK+ P+EV++TPRL+  L+
Sbjct  478   LTIGHLIQGFNYQTPSNEPLDLQEGIGMTMPKVNPVEVIITPRLATELY  526



>gb|ABC69371.1| CYP82E5 [Nicotiana tabacum]
Length=517

 Score =   489 bits (1260),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 243/529 (46%), Positives = 349/529 (66%), Gaps = 30/529 (6%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQ----SKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLS  1515
             + +I+G+  L LL +F W K+    SK LPP+  G WP+IGHL +F       PL + L 
Sbjct  5     VEAIVGLVTLTLLFYFLWPKKFQIPSKPLPPKIPGGWPVIGHLFYFDDDGDDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYGPVFT RLG+  +L+VS++E V+DCF+TND   + RP    G+YLGY+ A+   
Sbjct  65    DLADKYGPVFTFRLGLPLVLIVSSYEAVKDCFSTNDAIFSNRPAFLYGEYLGYNNAMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +    YWR  RKLV+ E+LS+ R+EKLKHV   ++Q +I   YT I    D N++     
Sbjct  125   TKYGPYWRKNRKLVIQEVLSASRLEKLKHVRFGKIQTSIKSLYTRI----DGNSST----  176

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R +K +   + L  EFV  DA 
Sbjct  177   -INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFRKAYKDFIILSMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLS  813
             FP+  F+W+D++G+VK+MKR  KD+D++ Q+W++   K+R   E      +Q FIDV+LS
Sbjct  232   FPIPLFKWVDFQGYVKAMKRTFKDIDSVFQNWLEEHVKKREKMEVNAQGNEQDFIDVVLS  291

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
              + +++     YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EID 
Sbjct  292   KMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVALHMNWGMALLINNQHALKKAQEEIDK  350

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +GKERW E+SD+K+L YLQ +VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ 
Sbjct  351   KVGKERWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFA  410

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             NV +L RDPK+W +P+KF PERF  +      Q+  Y+F+PFG GRRSCPG  YA Q+  
Sbjct  411   NVMKLQRDPKLWSNPDKFDPERFFADDIDYRGQH--YEFIPFGSGRRSCPGMTYALQVEH  468

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + +A L QGFN+ T  +EPLDM E  G+ + K+ P+EV +T RL+P L+
Sbjct  469   LTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKVNPVEVTITARLAPELY  517



>gb|ABD39475.1| CYP82E4v4 [Nicotiana tabacum]
Length=517

 Score =   489 bits (1258),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 239/508 (47%), Positives = 340/508 (67%), Gaps = 27/508 (5%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1449
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPV T RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVLTFRLGLPLVLVV  86

Query  1448  SNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSR  1269
             S++E V+DCF+TND   + RP    G YLGY+ A+   +    YWR  RKLV+ E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1268  RMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAG  1089
             R+EK KHV  + +QA+I   YT I    D N++      +N++ W   L   LI++++AG
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI----DGNSST-----INLTDWLEELNFGLIVKMIAG  197

Query  1088  RRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAA  909
             + YE    G   E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK+MKR  
Sbjct  198   KNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTF  253

Query  908   KDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV  747
             KD+D++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V
Sbjct  254   KDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATV  312

Query  746   LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV  567
              S++ DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +
Sbjct  313   FSLVLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAI  372

Query  566   VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER  387
             VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PER
Sbjct  373   VKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPER  432

Query  386   FM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD  210
             F+ T+++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLD
Sbjct  433   FIATDID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLD  489

Query  209   MMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             M E  GI + K+ P+E+++ PRL+P L+
Sbjct  490   MKEGAGITIRKVNPVELIIAPRLAPELY  517



>gb|ABD39474.1| CYP82E4v3 [Nicotiana tabacum]
Length=517

 Score =   488 bits (1257),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 239/508 (47%), Positives = 340/508 (67%), Gaps = 27/508 (5%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1449
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1448  SNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSR  1269
             S++E V+DCF+TND   + RP    G YLGY+ A+   +    YWR  RKLV+ E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1268  RMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAG  1089
             R+EK KHV  + +QA+I   YT I    D N++      +N++ W   L   LI++++AG
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI----DGNSST-----INLTDWLEELNFGLIVKMIAG  197

Query  1088  RRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAA  909
             + YE    G   E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK+MKR  
Sbjct  198   KNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTF  253

Query  908   KDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV  747
             KD+D++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V
Sbjct  254   KDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATV  312

Query  746   LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV  567
              S++ DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +
Sbjct  313   FSLVLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAI  372

Query  566   VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER  387
             VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PER
Sbjct  373   VKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPER  432

Query  386   FM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD  210
             F+ T+++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EP D
Sbjct  433   FIATDID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPSD  489

Query  209   MMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             M E  GI + K+ P+E+++ PRL+P L+
Sbjct  490   MKEGAGITIRKVNPVELIIAPRLAPELY  517



>gb|ABD39481.1| CYP82E4v11 [Nicotiana tabacum]
Length=517

 Score =   488 bits (1257),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 238/508 (47%), Positives = 340/508 (67%), Gaps = 27/508 (5%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1449
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLAQKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1448  SNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSR  1269
             S++E V+DCF+T+D   + RP    G YLGY+ A+   +    YWR  RKLV+ E+LS+ 
Sbjct  87    SSYEAVKDCFSTDDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1268  RMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAG  1089
             R+EK KHV  + +QA+I   YT I    D N++      +N++ W   L   LI++++AG
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI----DGNSST-----INLTDWLEELNFGLIVKMIAG  197

Query  1088  RRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAA  909
             + YE    G   E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK+MKR  
Sbjct  198   KNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTF  253

Query  908   KDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV  747
             KD+D++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V
Sbjct  254   KDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATV  312

Query  746   LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV  567
               ++ DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +
Sbjct  313   FGLVLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAI  372

Query  566   VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER  387
             VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PER
Sbjct  373   VKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPER  432

Query  386   FM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD  210
             F+ T+++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLD
Sbjct  433   FIATDID---FRGQYYKYIPFGSGRRSCPGMTYALQVEHLTIAHLIQGFNYRTPNDEPLD  489

Query  209   MMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             M E  GI + K+ P+E+++ PRL+P L+
Sbjct  490   MKEGAGITIRKVNPVELIIAPRLAPELY  517



>ref|XP_009627979.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=517

 Score =   488 bits (1257),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 237/529 (45%), Positives = 349/529 (66%), Gaps = 30/529 (6%)
 Frame = -1

Query  1670  LSSILGIAALVLL-WFSWRKQSKR----LPPEAGGAWPIIGHLHHFR---TSVPLVKTLS  1515
             + +I+G+     L +F W K+S++    LPP+  G WP+IGHL HF       PL + L 
Sbjct  5     IEAIVGLVTFTFLFYFLWTKKSQKPSKPLPPKIPGGWPVIGHLFHFNDDGNDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYG VFT RLG+  +LVVS++E ++DCF+TND   + RP    G+Y+GY+ A+   
Sbjct  65    DLADKYGLVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYIGYNNAMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +    YWR  RKLV+ E+LS+ R++K KHV  + +Q +I   YT I    D+N++     
Sbjct  125   ANYGPYWRKNRKLVIQEVLSASRLKKFKHVRFARIQTSIKNLYTRI----DRNSST----  176

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R KK F   M +  EFV  DA 
Sbjct  177   -INLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKKAFKDFMIISMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLS  813
             FP+  F+W+D++GHVK+MKR  KD+D++ Q+W++    +R   E      +Q FIDV+LS
Sbjct  232   FPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLS  291

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
              + +++  G  YSRDTVIKA V S++ DA++T A H+ W +A+L+ +  +LK+ Q+EIDT
Sbjct  292   KMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQNALKKAQEEIDT  350

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +GK+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE +EDC+V GY+I KGT+L+ 
Sbjct  351   KVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENIEDCVVSGYYISKGTRLFA  410

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             NV +L RDPK+WP+P+ F PERF+    G   + + Y+++PFG GRRSCPG  YA Q+  
Sbjct  411   NVMKLQRDPKLWPNPDNFDPERFVA--AGIDFRGQHYEYIPFGSGRRSCPGMTYALQVEH  468

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + +A L QGFN+ST  +EPLDM E  GI + K+ P+EV++  RL+P L+
Sbjct  469   LTMAHLIQGFNYSTPNDEPLDMKEGAGITIRKVNPVEVIIMSRLAPELY  517



>gb|AGD93125.1| CYP450 nicotine N-demethylase [Nicotiana tabacum]
Length=517

 Score =   486 bits (1250),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 239/510 (47%), Positives = 337/510 (66%), Gaps = 31/510 (6%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1449
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1448  SNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSR  1269
             S++E V+DCF+TND   + RP    G YLGY+ A+   +    YWR  RKLV+ E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1268  RMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAG  1089
             R+EK KHV  + +QA+I   YT I    D N++      +N++ W   L   LI++++AG
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI----DGNSST-----INLTDWLEELNFGLIVKMIAG  197

Query  1088  RRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAA  909
             + YE    G   E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK+MKR  
Sbjct  198   KNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTF  253

Query  908   KDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV  747
             KD+D++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVIKA V
Sbjct  254   KDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATV  312

Query  746   LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV  567
              S++ DA++T A H+ W +A+L+ + ++L + Q+EIDT +GK+RW E+SD+K+L YLQ +
Sbjct  313   FSLVLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAI  372

Query  566   VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER  387
             VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L  DPK+W DP+ F PER
Sbjct  373   VKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQCDPKLWSDPDTFDPER  432

Query  386   FMT---NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEP  216
             F+    +  G+      Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EP
Sbjct  433   FIAIDIDFRGQ-----YYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEP  487

Query  215   LDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             LDM E  GI + K+ P+E+++ PRL+P L+
Sbjct  488   LDMKEGAGITIRKVNPVELIIAPRLAPELY  517



>ref|XP_002274509.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=543

 Score =   486 bits (1252),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 243/523 (46%), Positives = 346/523 (66%), Gaps = 20/523 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEW  1509
             L +I GI  LVLL+  WR      K   R  PE  GAWP +GHL   R   P+ +TL   
Sbjct  32    LVAISGILGLVLLYGVWRVMILAGKSKGRSAPEPFGAWPFLGHLPILRGQTPIFRTLGAM  91

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             ADK+GPVF IRLG+ R LVVS+ E V++CFTTNDK  A+RP++ AGK LGY++A F F+ 
Sbjct  92    ADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFASRPSSSAGKILGYNHAGFGFAP  151

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
               + WR +RKL ++E+LS+RR++ LKHV +SEL  +I + Y+       K ++     KV
Sbjct  152   YGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKDLYSL-----GKGSDWFHPVKV  206

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFP  969
              MS WF HL+ N++++++AG+RY + + G  +EEA+R      ++++L G FV  DAI  
Sbjct  207   VMSEWFQHLSFNIVLKMIAGKRY-FNTSGHGNEEARRAIATIQKLLFLTGAFVLSDAIPG  265

Query  968   LWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQF  795
             +    W+D +G++ SMK+ AK+VD+++  WV+    R     N+ Q FIDVMLS+++D  
Sbjct  266   V---EWMDSQGYLGSMKQVAKEVDSLVGGWVEEHEMRLNSEGNKRQDFIDVMLSVLED--  320

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
             T  + +SR+TVIKA ++ ++   ++T +T  TW+L+ LL +  +LK  Q+E+D  +G+ R
Sbjct  321   TSMFGHSRETVIKATIMILIVGGTDTVSTTSTWLLSALLNNKHALKCAQEELDLKVGRGR  380

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W E+SD+ NL YLQ V+KETLR+Y   P  APHEA+EDC V GYHIPKGT+L+VN W+LH
Sbjct  381   WVEESDIPNLLYLQAVIKETLRLYTATPLSAPHEAMEDCHVAGYHIPKGTRLFVNAWKLH  440

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP +W DPE F PERF+T         + ++ +PFG GRRSCPG   A ++  + + RL
Sbjct  441   RDPSVWSDPEDFQPERFLTTHADLDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIGRL  500

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              QGF+ ST  N P+DM E + I L KLTPLEV++TPRL P+ F
Sbjct  501   LQGFDLSTPLNAPVDMREGLSITLAKLTPLEVMLTPRL-PSQF  542



>gb|ABD39482.1| CYP82E4v12 [Nicotiana tabacum]
Length=517

 Score =   485 bits (1249),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 238/508 (47%), Positives = 340/508 (67%), Gaps = 27/508 (5%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVV  1449
             +K SK LPP+  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVV
Sbjct  27    QKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVV  86

Query  1448  SNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSR  1269
             S++E V+DCF+TND   + RP    G YLGY+ A+   +    YWR  RKLV+ E+LS+ 
Sbjct  87    SSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSAS  146

Query  1268  RMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAG  1089
             R+EK KHV  + +QA+I   YT I    D N++      +N++ W   L   LI++++AG
Sbjct  147   RLEKFKHVRFARIQASIKNLYTRI----DGNSST-----INLTDWLEELNFGLIVKMIAG  197

Query  1088  RRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAA  909
             + YE    G   E+ +R KK F   M L  EFV  DA FP+  F+W+D++GHVK+MKR  
Sbjct  198   KNYE---SGKGDEQVERFKKAFKDFMILSMEFVLWDA-FPIPLFKWVDFQGHVKAMKRTF  253

Query  908   KDVDAILQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIV  747
             KD+D++ Q+W++    +R   E      +Q FIDV+LS + +++  G  YSRDTVI+A V
Sbjct  254   KDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIEATV  312

Query  746   LSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGV  567
              S++ DA++T A H+ W +A+L+ + ++L + Q+EIDT + K+RW E+SD+K+L YLQ +
Sbjct  313   FSLVLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVCKDRWVEESDIKDLVYLQAI  372

Query  566   VKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER  387
             VKE LR+YP GP L PHE VEDC+V GYHIPKGT+L+ NV +L RDPK+W DP+ F PER
Sbjct  373   VKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPER  432

Query  386   FM-TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD  210
             F+ T+++    + + Y+++PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +EPLD
Sbjct  433   FIATDID---FRGQYYKYIPFGPGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLD  489

Query  209   MMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             M E  GI + K+ P+E+++ PRL+P L+
Sbjct  490   MKEGAGITIRKVNPVELIIAPRLAPELY  517



>ref|XP_011101555.1| PREDICTED: cytochrome P450 CYP82D47-like [Sesamum indicum]
Length=519

 Score =   485 bits (1249),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 237/522 (45%), Positives = 339/522 (65%), Gaps = 18/522 (3%)
 Frame = -1

Query  1676  CCLSSILGIAALVL-LWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADK  1500
               LS++L I  L+  LW  + ++  + PP+  GAWPIIGHLH     + +  TL+E ADK
Sbjct  10    ATLSALLFIIVLLYNLWRRYPRKGAQSPPQPSGAWPIIGHLHLLDPELNIAHTLAELADK  69

Query  1499  YGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNS  1320
             YGPVFT+  G  R +VVS+ E V +CFT NDK  A RP T AG++L YD+A F FS N  
Sbjct  70    YGPVFTLWFGAQRAVVVSSREAVFECFTRNDKSFANRPITSAGEHLVYDHASFGFS-NGP  128

Query  1319  YWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMS  1140
             YWR +RKLV  E+LS+RR+E ++++ V+E+  +I E Y  +          P   KV MS
Sbjct  129   YWREMRKLVSSEVLSARRLEAMRNLRVTEIATSIGELY--LETTTKTRGQQPLPSKVVMS  186

Query  1139  RWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWF  960
              W   +TLN+I++ +AG+RY     G  + E +  +K+  +   L GEFV  D I P+ F
Sbjct  187   SWVEKMTLNIIVKTIAGKRY-----GKGAAEVESFRKLIREFTVLSGEFVPSDVI-PIPF  240

Query  959   FRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE----DQKFIDVMLSMIDDQFT  792
              RW+D +GH+KSMKR +K++D I++ WV+   K R   E    +Q FID MLS IDD+F 
Sbjct  241   LRWIDPKGHIKSMKRVSKELDVIIEKWVEEHMKRRGKGEGCTEEQDFIDAMLSTIDDKF-  299

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
                +  + T+IKA VL+++    +T + HLTW+L++L+ +  ++   + EID  +G +RW
Sbjct  300   ---AIPKLTIIKATVLNVILGGFDTTSVHLTWVLSLLVNNKHAMNLARQEIDDKVGNQRW  356

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
              ++SD+ NLPYLQ ++KE+LR+YP  P   PH+AVEDC +  Y IPKGT L+VN+W+LH 
Sbjct  357   VQESDINNLPYLQAIIKESLRLYPPLPLSIPHQAVEDCHLSNYLIPKGTLLFVNIWKLHH  416

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             D + WP+P +F+PERF+T         +QY+++PFG GRRSCPG  +A Q+T + VARL 
Sbjct  417   DARFWPEPNRFMPERFLTGHTQVDVMGQQYEYIPFGTGRRSCPGTTFAMQVTSLTVARLI  476

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             QGF+F+T  NE +DM E +GI +P+  PLEVLVTPRL   L+
Sbjct  477   QGFDFATEGNEAVDMAEGIGITMPRKNPLEVLVTPRLPSQLY  518



>ref|XP_003635525.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=518

 Score =   484 bits (1246),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 248/524 (47%), Positives = 339/524 (65%), Gaps = 21/524 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFSWRKQS------KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEW  1509
             L +I G   L+LL+  WR +S       R  PE  GAWP +GHLH      P+ +TL+  
Sbjct  7     LLAIAGFMGLLLLYNVWRVRSFAHGGKGRSAPEPSGAWPFVGHLHLLSGPTPIFRTLAAM  66

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             ADK+GPVF IRLG+ R LVVS+ E V++C TTNDK  A+RP++ AGK LGY+YA F F+ 
Sbjct  67    ADKHGPVFMIRLGMHRALVVSSHEAVKECLTTNDKAFASRPSSSAGKLLGYNYAGFGFAP  126

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
                 WR +RKL V ELLS+R + +LKHV VSEL   I + Y+   +  + N  NP   KV
Sbjct  127   YGPLWREMRKLSVTELLSNRPLNELKHVLVSELDVCIRDLYS---LGKETNWVNPI--KV  181

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGV-VSEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
              MS W   LT N+++++VAG+RY    +GV  +EEA+    V  + ++L G FV+ DAI 
Sbjct  182   AMSEWLEQLTFNVVLRMVAGKRY--FGNGVHGNEEARHAIAVIKKFIFLTGVFVASDAIP  239

Query  971   PLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNED--QKFIDVMLSMIDDQ  798
                F  W+D +GH+ SMKR A+ +D  ++ WV+    + +S+    Q FIDVMLS++ D 
Sbjct  240   ---FVEWMDLQGHLGSMKRVAEQLDPFVEGWVEEHVTKLKSDPSSRQDFIDVMLSVLKDN  296

Query  797   FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE  618
                 + + R+TVIKA V++++   SET +    WIL+ LL +  +LKR Q+E+D  +G+ 
Sbjct  297   --SMFGHRRETVIKATVMTLIVGGSETTSIASIWILSALLNNRHTLKRAQEELDLKVGRG  354

Query  617   RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL  438
             RW E+SD++NL YLQ  VKETLR+YP GP L PHEA++DC V GYHIPKGT+L VNVW+L
Sbjct  355   RWVEESDIQNLIYLQAAVKETLRLYPPGPLLVPHEAIQDCSVCGYHIPKGTRLLVNVWKL  414

Query  437   HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR  258
             HRDP  W DPE+F PERF+T         +  + +PF  GRRSCPG   A QI  + VAR
Sbjct  415   HRDPDAWSDPEEFQPERFLTTHANLNVFGQHSELIPFSSGRRSCPGIALALQILHLTVAR  474

Query  257   LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             L QG++ +T  N P+DM E +G+ +PK TPLEV++TPRL   L+
Sbjct  475   LLQGYDMTTPLNAPVDMTEGIGLAMPKETPLEVMLTPRLPSLLY  518



>emb|CDP15065.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   482 bits (1240),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 228/491 (46%), Positives = 337/491 (69%), Gaps = 17/491 (3%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             PEA G WP IGHL     +VP+ + L   ADKYGPVF++RLG+ + LVVS+WE V++CFT
Sbjct  39    PEAAGGWPFIGHLLQLSPNVPIARNLGAMADKYGPVFSLRLGMRQTLVVSSWEAVKECFT  98

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
             TNDK  + RP +   +Y+GY+YA   F+    YWR +RK+V++ELLS+RR+E+LKHV +S
Sbjct  99    TNDKAFSYRPPSSFNEYVGYNYAAIGFAPYGPYWREIRKIVMLELLSNRRLERLKHVRIS  158

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E++ NI      +  D  K+++N    KVNM +WF  L LN++++ ++G RY     G  
Sbjct  159   EIENNIK-----VLFDGWKSSSNDPPAKVNMGKWFEDLFLNIMVRKISGTRYTDSEVG--  211

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAI-FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDW  879
             S+   + ++V  + ++  G+FV  D I FPL   +W+D +GH+KS+KR +K++D+I+Q W
Sbjct  212   SKRNAQFRRVVKEFVHFLGQFVVSDVIPFPL--LKWIDMQGHLKSIKRVSKELDSIIQIW  269

Query  878   VDARRKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
             +D   + R     + +E Q FID +LS+  D++   + +SR+TVIKA ++S++  A ET 
Sbjct  270   IDEHNERRMKISEQGDEQQDFIDALLSVTKDEYL--FGHSRETVIKATLMSLVIAAFETT  327

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
             + HLTW L++LL +   +++ Q+EID+N+GKERWAE+SD+ NL YLQ +VKE++R+YP  
Sbjct  328   SIHLTWTLSLLLNNKHVMRQAQEEIDSNVGKERWAEESDINNLVYLQAIVKESIRLYPPA  387

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P   P +A+EDC V GY I  GTQL+VNVW+L RDP+IW +P++FLPERF+      + +
Sbjct  388   PLSLPRQAMEDCNVSGYRISMGTQLFVNVWKLQRDPRIWSEPDQFLPERFLNGEVDFSGK  447

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
             N ++ F PFG GRRSCPG   ATQ+T + +ARL QGF+ +T  + P+DM ED  I + K 
Sbjct  448   NFEFSFTPFGSGRRSCPGIPLATQVTHLTLARLLQGFDLTTPSDLPVDMTEDTSISMGKA  507

Query  173   TPLEVLVTPRL  141
             TPLEV++ PRL
Sbjct  508   TPLEVVILPRL  518



>ref|XP_002264790.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   481 bits (1239),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 240/526 (46%), Positives = 337/526 (64%), Gaps = 23/526 (4%)
 Frame = -1

Query  1667  SSILGIAALVL---LWFS-WR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1518
             S  L IA L+L   LW++ WR      K     PPE  GAWP +GHLH  +  VP+ +TL
Sbjct  5     SHFLAIAGLILGLVLWYNHWRGKTLTHKSKGMSPPEPSGAWPFVGHLHLLQGKVPVFRTL  64

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
                ADK GPVF IRLG+ R LVVSN E  ++CFTTNDK  A+RP++ A K LGY+Y  F 
Sbjct  65    GAMADKVGPVFVIRLGMYRALVVSNHEAAKECFTTNDKVFASRPSSSASKILGYNYVAFG  124

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
              +     WR +RKL ++E+LS+RR+  L HV VSEL A I + Y    +  D N  NP  
Sbjct  125   LAPYGPLWREIRKLCMLEILSTRRLSDLMHVHVSELHAGIKDLYI---LGKDYNWVNPK-  180

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
              KV +S WF HL  N+++++VAG+RY + +     EEA     V  +++ L G FV+ D 
Sbjct  181   -KVVISEWFEHLNFNVVLRMVAGKRY-FNNVVHGGEEAGSATAVIKKLVPLAGAFVASDV  238

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMID  804
             I    F  W+D +GH+ SMK+ AK++D++L+ WV+    R    ++  Q FID+ML+ + 
Sbjct  239   IP---FLEWVDLQGHLSSMKQVAKEMDSVLESWVEEHTGRLNSEASSRQDFIDIMLTKLK  295

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
             D     + YSR+T+IKA V+ ++   S+T +   TW+L+ LL +   +K  Q+E+D  +G
Sbjct  296   D--ASLFGYSRETIIKATVMMLIVAGSDTTSITSTWLLSALLNNRHVMKHAQEELDLKVG  353

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             ++RW E SD++NL YL+ +VKETLR+YP  P L PHEA+EDC V GYHIPKGT+L VN W
Sbjct  354   RDRWVEQSDIQNLVYLKAIVKETLRLYPAVPLLVPHEAMEDCHVGGYHIPKGTRLLVNAW  413

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             +LHRDP +W +PE+F PERF+T+        + ++ +PFG GRRSCPG   A Q+  + +
Sbjct  414   KLHRDPAVWSNPEEFQPERFLTSHATVDVLGQNFELIPFGSGRRSCPGINMALQMLHLTI  473

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             A+L QGF+ +T  N P+DM E + I +PKLTPLEV++TPRL   L+
Sbjct  474   AQLLQGFDMATPSNSPVDMAEAISITMPKLTPLEVMLTPRLPAELY  519



>emb|CBI36491.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   482 bits (1241),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 241/515 (47%), Positives = 335/515 (65%), Gaps = 19/515 (4%)
 Frame = -1

Query  1679  PCCLSSILGIAALVLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1518
             P  L +I GI  LVLL+  WR      K   R  PE  GAWP +GHL   R   P+ +TL
Sbjct  30    PSQLVAISGILGLVLLYGVWRVMTLAGKSKGRSAPEPSGAWPFLGHLPLLRGQTPIFRTL  89

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
                ADK+GPVF IRLG+ R LVVS+ E V++CFTTNDK  A+RP++ AGK LGY+YA F 
Sbjct  90    GAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFASRPSSSAGKLLGYNYAGFG  149

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
             F+   + WR +RKL ++E+LS+RR++ LKHV +SEL  +I + Y+       K ++    
Sbjct  150   FAPYGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKDLYSL-----GKGSDWVHP  204

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
              KV MS WF HL+ N++++++AG+RY + + G   EEA+R      + + L G FV  DA
Sbjct  205   VKVVMSEWFQHLSFNIVLKMIAGKRY-FNTSGHGIEEARRAIATIQEFLSLSGAFVLSDA  263

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMID  804
             I  +    W+D +G++ SMKR AK+VD+++  WV+    R     +  Q FIDVMLS+++
Sbjct  264   IPGV---EWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEIRLNSEGSRMQDFIDVMLSVLE  320

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
             D  T  + +SR+TVIKA ++ ++   +ET AT  TW+L+ LL +  +LKR Q+E+D  +G
Sbjct  321   D--TSMFGHSRETVIKATIVILIVGGTETVATTSTWLLSALLNNKHALKRAQEELDLKVG  378

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             + RW E+SD+ NL YLQ V+KETLR+Y   P   PHEA+EDC V GYHIPKGT+L+VN W
Sbjct  379   RGRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPKGTRLFVNAW  438

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             +LHRDP +W DPE F PERF+T+        + ++ +PFG GRRSCPG   A ++  + +
Sbjct  439   KLHRDPSVWSDPEDFQPERFLTSHADLDVLGQHFELIPFGSGRRSCPGITMALKLLPLVI  498

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEV  159
              RL QGF+ ST  N P+DM E + I L KLTPLEV
Sbjct  499   GRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEV  533



>ref|XP_011030904.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=526

 Score =   481 bits (1238),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 232/496 (47%), Positives = 329/496 (66%), Gaps = 15/496 (3%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCF  1419
             PE  GAWPIIGHLH       L+ +TL   ADK+G  FTIRLG  R  VVS+WE V++CF
Sbjct  38    PEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKHGSAFTIRLGSRRAFVVSSWEVVKECF  97

Query  1418  TTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWV  1239
             T NDK +A+RPTT A K++GY+YAVF F+  +++WR +RK+  +ELLS+RR+E LKHV  
Sbjct  98    TINDKALASRPTTVAAKHMGYNYAVFGFAPYSAFWREMRKIATIELLSNRRLEMLKHVRA  157

Query  1238  SELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGV  1059
             SE+   I E Y + A      NN+ S   V + +W   LTLN+++++VAG+RY   +   
Sbjct  158   SEVDIGIRELYNSWA------NNSSSPVVVELKQWLEDLTLNVVVRMVAGKRYFGSAAAS  211

Query  1058  VSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDW  879
                EA+R +K  +Q   L G F+  DA   L F  WLD +GH ++MK  AK++DAIL+ W
Sbjct  212   DDGEARRCQKAINQFFRLIGIFLVSDA---LPFLGWLDLQGHERAMKNTAKELDAILEGW  268

Query  878   VDARRKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
             +D  R+ R     +  ++Q FIDVMLS+ ++     + Y  +T IK+  L+++   S+T 
Sbjct  269   LDEHRQRRVSAGIKDEDEQDFIDVMLSLKEEGQLSNFQYDANTSIKSTCLALILGGSDTT  328

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
             A  LTW +++LL +   LK+ Q+E+D  +GKER  EDSDVKNL YLQ ++KETLR+YP G
Sbjct  329   AGTLTWAISLLLNNRHMLKKAQEELDLLVGKERQVEDSDVKNLVYLQAIIKETLRLYPAG  388

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P L P EA+EDC V GYH+P GT+L VNVW++ RDP++W +P  FLPERF+T+      +
Sbjct  389   PLLGPREAMEDCKVAGYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSHGDVDVR  448

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
              +Q++ +PFG GRRSCPG  +A Q+  + +ARL   F  +T  ++P+D+ E  G+ +PK 
Sbjct  449   GQQFELIPFGSGRRSCPGVSFALQVLHLTLARLLHSFQLATPMDQPVDLTESSGLTIPKA  508

Query  173   TPLEVLVTPRLSPTLF  126
             TPLEV++TPRL P L+
Sbjct  509   TPLEVILTPRLPPKLY  524



>ref|XP_006375022.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
 gb|ERP52819.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
Length=519

 Score =   480 bits (1235),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 233/496 (47%), Positives = 328/496 (66%), Gaps = 15/496 (3%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCF  1419
             PE  GAWPIIGHLH       L+ +TL   ADK+G  FTIRLG  R  VVS+WE V++CF
Sbjct  31    PEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKHGSAFTIRLGSRRAFVVSSWEVVKECF  90

Query  1418  TTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWV  1239
             T N K +A+RPTT A K++GY+YAVF F+  +S+WR +RK+  +ELLS+RR+E LKHV  
Sbjct  91    TINAKALASRPTTVAAKHMGYNYAVFGFAPYSSFWREMRKIATLELLSNRRLEMLKHVRA  150

Query  1238  SELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGV  1059
             SE+   I E Y + A      NN+ S   V + +W   LTLN+++++VAG+RY   +   
Sbjct  151   SEVDIGIRELYNSWA------NNSSSPVVVELKQWLEDLTLNVVVRMVAGKRYFGSAAAS  204

Query  1058  VSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDW  879
                EA+R +K  +Q   L G FV  DA   L F  WLD +GH ++MK  AK++DAIL+ W
Sbjct  205   DDGEARRCQKAINQFFRLIGIFVVSDA---LPFLGWLDLQGHERAMKNTAKELDAILEGW  261

Query  878   VDARRKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
             +D  R+ R     +   +Q FIDVMLS+ ++     + Y  +T IK+  L+++   S+T 
Sbjct  262   LDEHRQRRVSAGIKDEGEQDFIDVMLSLKEEGQLSNFQYDANTSIKSTCLALILGGSDTT  321

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
             A  LTW +++LL +   LK+ Q+E+D ++GKER  EDSDVKNL YLQ ++KETLR+YP G
Sbjct  322   AGTLTWAISLLLNNRHMLKKAQEELDLHVGKERQVEDSDVKNLVYLQAIIKETLRLYPAG  381

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P L P EA+EDC V GYH+P GT+L VNVW++ RDP++W +P  FLPERF+T+      +
Sbjct  382   PLLGPREAMEDCKVAGYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSHGDVDVR  441

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
              +Q++ +PFG GRRSCPG  +A Q+  + +ARL   F  +T  ++P+D+ E  G+ +PK 
Sbjct  442   GQQFELIPFGSGRRSCPGVSFALQVLHLTLARLLHSFELATPMDQPVDLTESSGLTIPKA  501

Query  173   TPLEVLVTPRLSPTLF  126
             TPLEV++TPRL P L+
Sbjct  502   TPLEVILTPRLPPKLY  517



>gb|KDP26345.1| hypothetical protein JCGZ_17503 [Jatropha curcas]
Length=532

 Score =   479 bits (1234),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 241/544 (44%), Positives = 353/544 (65%), Gaps = 36/544 (7%)
 Frame = -1

Query  1691  MDAVPCCLSSILGIAALVLLW--FSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSV  1536
             MD     L+  + ++ +++L+    WR      K    L PE  GA PI+GHLH      
Sbjct  1     MDISSHLLAISVAVSVILVLYKYNQWRLRDHSHKNKGLLAPEPFGALPILGHLHLLGAEK  60

Query  1535  PLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGY  1356
              L +TL+  ADKYGP+FTI LG+ R + VS+ E +++CFT NDK +A+RP +  GKYL Y
Sbjct  61    TLARTLALLADKYGPIFTIWLGVHRTVEVSSHEAIKECFTANDKVLASRPKSSHGKYLSY  120

Query  1355  DYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKN  1176
             +YA F F++   YWR++RKLVV++LLSS R++ LKHV VSE+   I + Y         +
Sbjct  121   NYAAFGFASYGPYWRDMRKLVVIQLLSSHRLKSLKHVQVSEVNTLIKDLYLL-------S  173

Query  1175  NNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGE  996
              N PS+ K+ +S +F HLTLN+I +++AG+RY    +G   EE  R+ K+  + MY+ G 
Sbjct  174   LNQPSSNKIVISEFFEHLTLNMITRMIAGKRY-CNCNGGNDEEGIRIGKLMKEFMYVSGV  232

Query  995   FVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARR----KERR--------  852
             FV  D I  LW   W+++ G VK+MKR +K++D++LQ W+D  +     +RR        
Sbjct  233   FVPSDVIPFLW---WMNFLGPVKAMKRLSKELDSLLQTWIDEHKLKGINKRRDGGGGGGD  289

Query  851   -SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLK  675
               N ++ FIDVMLS+++D F   + +SRD +IK  V++++   ++T +  LTWIL+ LL 
Sbjct  290   FKNIEEDFIDVMLSILEDNF---FGHSRDDIIKGTVMTLIIAGADTTSITLTWILSNLLN  346

Query  674   HPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCI  495
             +  +L+  Q E+D  +GKER  +DSD++NL YLQ VVKETLR+YP GP   PHEA+ DC 
Sbjct  347   NRHALELAQQELDLKVGKERCVQDSDIENLVYLQAVVKETLRLYPPGPLAVPHEAINDCY  406

Query  494   VDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLG  318
             + GY+IPKGT++  N+W+LHRDP IW +P+KFLPERF+ N +       + ++++PFG G
Sbjct  407   ISGYYIPKGTRVLANLWKLHRDPNIWSNPDKFLPERFLANRDNNVDFSGQNFEYLPFGSG  466

Query  317   RRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
             RRSCPG  +A Q   + +ARL Q F+ +T+ N+P+DM E +GI LPK TPLE+ +TPRLS
Sbjct  467   RRSCPGLNFAIQAIHLTLARLLQAFSLTTLFNQPVDMTEGLGITLPKATPLEIQITPRLS  526

Query  137   PTLF  126
               L+
Sbjct  527   SELY  530



>emb|CAN61061.1| hypothetical protein VITISV_018742 [Vitis vinifera]
Length=542

 Score =   479 bits (1233),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 247/550 (45%), Positives = 344/550 (63%), Gaps = 44/550 (8%)
 Frame = -1

Query  1679  PCCLSSILGIAALVLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1518
             P  L +I GI  LVLL+  WR      K   R  PE  GAWP +GHL   R   P+ +TL
Sbjct  4     PSQLVAISGILGLVLLYGVWRVMTLAGKSKGRSAPEPSGAWPFLGHLPLLRGQTPIFRTL  63

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
                ADK+GPVF IRLG+ R LVVS+ E V++CFTTNDK  A+RP++ AGK LGY+YA F 
Sbjct  64    GAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFASRPSSSAGKLLGYNYAGFG  123

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
             F+   + WR +RKL ++E+LS+RR++ LKHV +SEL  +I + Y+       K ++    
Sbjct  124   FAPYGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKDLYSL-----GKGSDWVHP  178

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
              KV MS WF HL+ N++++++AG+RY + + G   EEA+R      + + L G FV  DA
Sbjct  179   VKVVMSEWFQHLSFNIVLKMIAGKRY-FNTSGHGIEEARRAIATIQEFLSLSGAFVLSDA  237

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMID  804
             I  +    W+D +G++ SMKR AK+VD+++  WV+    R     +  Q FIDVMLS+++
Sbjct  238   IPGV---EWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEIRLNSEGSRMQDFIDVMLSVLE  294

Query  803   DQFTQGYSYSRDTVIKAIVLS------------------------MLQDASETFATHLTW  696
             D  T  + +SR+TVIKA ++                         ++   +ET AT  TW
Sbjct  295   D--TSMFGHSRETVIKATIVVRSSPIHELLLLSWKSVFLQPTLKILIVGGTETVATTSTW  352

Query  695   ILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPH  516
             +L+ LL +  +LKR Q+E+D  +G+ RW E+SD+ NL YLQ V+KETLR+Y   P   PH
Sbjct  353   LLSALLNNKHALKRAQEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPH  412

Query  515   EAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQF  336
             EA+EDC V GYHIPKGT+L+VN W+LHRDP +W DPE F PERF+T+        + ++ 
Sbjct  413   EAMEDCHVAGYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPERFLTSHADFDVLGQHFEL  472

Query  335   VPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVL  156
             +PFG GRRSCPG   A ++  + + RL QGF+ ST  N P+DM E + I L KLTPLEV+
Sbjct  473   IPFGSGRRSCPGITMALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVI  532

Query  155   VTPRLSPTLF  126
             +TPRL P+ F
Sbjct  533   LTPRL-PSQF  541



>ref|XP_004517185.1| PREDICTED: cytochrome P450 82C4-like [Cicer arietinum]
Length=522

 Score =   476 bits (1225),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 238/533 (45%), Positives = 349/533 (65%), Gaps = 23/533 (4%)
 Frame = -1

Query  1691  MDAVPCCLSSILGIAALVLLWFSWR-------KQSKRLPPEAGGAWPIIGHLHHFRTSVP  1533
             M+  P   ++I+   ALV+L+  WR       K   + PP+   A P IGHLH      P
Sbjct  1     MEYFPSQQTTIVLAIALVVLYNIWRIKKHSNNKLKGKQPPQPSYALPFIGHLHLLGNQTP  60

Query  1532  LVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYD  1353
             L +  + +ADKYGP+F I LG    LV+SN E +++CFTTNDK +A+RP +  G YLGY+
Sbjct  61    LARIFASFADKYGPIFQIYLGSYPALVISNQESIKECFTTNDKILASRPKSSHGIYLGYN  120

Query  1352  YAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNN  1173
             YA F F+   +Y+  +RKL ++ELLSSRR+E L+H++ SE+   +N+ +  +       +
Sbjct  121   YAGFGFAPYGTYFTKLRKLTMLELLSSRRIESLRHLYESEIDTLVNDLWLYV------KD  174

Query  1172  NNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY-EYRSDGVVSEEAQRLKKVFSQVMYLWGE  996
             NN     V +S+W   LT N+I ++++G+RY EY  D V   EA  + K+  + M++ GE
Sbjct  175   NNKVTKAVVISKWLEKLTFNIITKMISGKRYFEYLQD-VDDVEAHGIVKLIKEFMHISGE  233

Query  995   FVSGDAIFPLWFFRWLDYEGHV-KSMKRAAKDVDAILQDWVD--ARRKERRSNEDQKFID  825
             FV  D I P+    W  +EG V KSMKR  +D+D ++  WVD   ++ +   NE   FID
Sbjct  234   FVPSDLI-PI--IGWFGFEGQVLKSMKRVGRDLDKVVGRWVDEHVQKIDDGVNEKHDFID  290

Query  824   VMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQD  645
             VMLS+I+D  + G+   RDT+IKA +++++   S+T +T +TWILA+LL +  +LKR Q+
Sbjct  291   VMLSVIEDDPSSGHD--RDTIIKANIMNLMLAGSDTTSTTMTWILAILLNNTNALKRAQE  348

Query  644   EIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGT  465
             EI+ +IGK+R  E SD+KNL YLQ ++KETLR+YP GP L PHEA +DC + GY++PKGT
Sbjct  349   EINHHIGKKRRVESSDIKNLVYLQAIMKETLRLYPPGPLLVPHEATKDCYIQGYNVPKGT  408

Query  464   QLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYAT  285
             +++ NVW+LHRDP IW + EKF PERF+    GE  +   ++++PFGLGRR+CPG+++AT
Sbjct  409   RVFANVWKLHRDPSIWLEAEKFSPERFINEKNGELYEGHNFEYLPFGLGRRACPGSMFAT  468

Query  284   QITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             Q+  + +ARL  GF+      E +DM E +GI LPKLTPL V++TPRL+  L+
Sbjct  469   QVCLITLARLIHGFDLEVPMGEDVDMREGLGITLPKLTPLNVILTPRLTYELY  521



>emb|CAN77159.1| hypothetical protein VITISV_019026 [Vitis vinifera]
Length=604

 Score =   478 bits (1231),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 250/527 (47%), Positives = 340/527 (65%), Gaps = 24/527 (5%)
 Frame = -1

Query  1670  LSSILGIAA---LVLLWFSWRKQS------KRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1518
             LS +L +A    LVLL   WR +S       R  PE  GAWP IGHLH   + +P+ +TL
Sbjct  90    LSHLLAVAGFMWLVLLCNVWRVKSFAHRGKGRSAPEPSGAWPFIGHLHLLNSPMPIFRTL  149

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
             +  AD +GPVF IRLG+ R LVVS+ + V++C TTNDK  A+RP + AGK LGY+YA F 
Sbjct  150   TAMADXHGPVFMIRLGMXRALVVSSHKAVKECLTTNDKAFASRPISSAGKLLGYNYAGFG  209

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
             F+     WR +RKL V ELLS+RR+++LKHV VSEL   I + Y+   +  + N  NP  
Sbjct  210   FAPYGPLWREMRKLSVTELLSNRRLDELKHVLVSELDVCIRDLYS---LGKETNWVNPI-  265

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGV-VSEEAQRLKKVFSQVMYLWGEFVSGD  981
              KV MS W    T N+++++VAG+RY    +GV  +EEA+    V  + + L G FV+ D
Sbjct  266   -KVAMSEWLEQXTFNVVLRMVAGKRY--FGNGVHGNEEARHAIAVIKKFLSLTGAFVASD  322

Query  980   AIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNED--QKFIDVMLSMI  807
              I    F  W+D +GH+ SMKR A  +D  ++ WV+    +  S+    Q FIDVMLS++
Sbjct  323   VIP---FVEWMDLQGHLGSMKRVAGQLDPFVEGWVEEHVTKLNSDPSSRQDFIDVMLSVL  379

Query  806   DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
              D     + ++R+TVIKA V++++   SET +   TWIL+ LL +  +LKR Q+EID  +
Sbjct  380   KDNSI--FGHTRETVIKATVMTLIVGGSETTSIVSTWILSALLNNRHALKRAQEEIDLKV  437

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             G+ RW E+SD++NL YLQ VVKETLR+YP  P   PHEAVEDC V  YHIPKGT+L+VNV
Sbjct  438   GRGRWVEESDIZNLIYLQAVVKETLRLYPPAPLSIPHEAVEDCNVCEYHIPKGTRLFVNV  497

Query  446   WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             W+LHRDP +W DPE+F PERF+T         + ++ +PF  GRRSCPG   A QI  + 
Sbjct  498   WKLHRDPGVWSDPEEFQPERFLTTNANLNVFGQHFELIPFSSGRRSCPGIALALQILHLT  557

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             VARL QG++ +T  N P+DM E +GI +P+ TPLEV++TPRL   L+
Sbjct  558   VARLLQGYDMTTPLNAPVDMTEGIGITMPRATPLEVMLTPRLPSLLY  604



>ref|XP_007136644.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
 gb|ESW08638.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
Length=528

 Score =   475 bits (1223),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 236/526 (45%), Positives = 338/526 (64%), Gaps = 26/526 (5%)
 Frame = -1

Query  1658  LGIAALVLLWFSW---------RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEW  1509
             + ++ LV LW ++         R  SK  P   G AWP+IGHLH       L+ +TL   
Sbjct  12    ISVSLLVFLWHAFLGKKRNKGGRNNSKEAPVPVG-AWPLIGHLHLLGGDDQLLYRTLGTM  70

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             AD+YGP F I LG  R  VVS+WE  ++CFTTNDK +A+RPTT A K++GY+YAVF F+ 
Sbjct  71    ADQYGPAFNIWLGTRRAFVVSSWEVAKECFTTNDKALASRPTTVAAKHMGYNYAVFGFAP  130

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
              + +WR +RK+  +ELLS+RR+E LKHV VSEL   I E Y +      +N + P    V
Sbjct  131   YSPFWREMRKIATLELLSNRRLEMLKHVRVSELNTGIKELYNSWV----QNRSQPVV--V  184

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFP  969
              ++RW   LTLN+++++VAG+RY   S     +EA+R +K  +Q  +L G FV  DA   
Sbjct  185   ELNRWLEDLTLNMVVRMVAGKRYFGASATCDDDEARRCQKAINQFFHLIGIFVVSDA---  241

Query  968   LWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDVMLSMID  804
             L F RW D +GH ++MK+ AK++D+IL+ W+   R +R   E     +Q FIDVML +  
Sbjct  242   LPFLRWFDLQGHERAMKKTAKELDSILEGWLQEHRMQRVDGEVKVEGEQDFIDVMLDLQK  301

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
                   + Y  DT IK+  L+++   S+T A  LTW +++LL + ++LK+ Q+E+D N+G
Sbjct  302   TGHLSNFQYDSDTSIKSTCLAIILGGSDTSAGTLTWAISLLLNNRQALKKAQEELDLNVG  361

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
              ER  E+SD++NL YLQ ++KETLR+YP GP L P EA EDC V GY +P GT+L VN+W
Sbjct  362   MERQVEESDIRNLAYLQAIIKETLRLYPAGPLLGPREAQEDCNVGGYDVPAGTRLVVNLW  421

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             ++HRDP++W +P  F PERF+T+ +    + + ++ +PFG GRRSCPG  +A Q+  + +
Sbjct  422   KIHRDPRVWEEPSAFRPERFLTS-DAVDVRGQNFELIPFGSGRRSCPGMSFALQVLHLTL  480

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             ARL   F F+T  +EP+DM E  G+ +PK TPLEVL+TPRL P L+
Sbjct  481   ARLLHAFEFATPSDEPVDMTESPGLTIPKATPLEVLLTPRLPPQLY  526



>gb|ABD39485.1| CYP82E2v4 [Nicotiana tabacum]
Length=517

 Score =   475 bits (1222),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 233/530 (44%), Positives = 340/530 (64%), Gaps = 32/530 (6%)
 Frame = -1

Query  1670  LSSILGIAALV-LLWFSWRKQSKRLP----PEAGGAWPIIGHLHHFRTSV---PLVKTLS  1515
             + + +G+     LL+F W K+S++LP    P+  G WP+IGHL HF       PL + L 
Sbjct  5     IEAFVGLVTFTFLLYFLWTKKSQKLPKPLLPKIPGGWPVIGHLFHFNNDGDDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYGPVFT RLG+  +LVVS++E ++DCF+TND   + RP    G+YLGY+  +   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +    YWR  RKLV+ E+LS+ R+EK K V  + +Q +I   YT I         N ++ 
Sbjct  125   ANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTSIKNLYTRI---------NGNSS  175

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R K  F   M L  EFV  DA 
Sbjct  176   TINLTDWLEELDFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMVLSMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLS  813
             FP+  F+W+D++GH+K+MKR  KD+D++ Q+W++    +R   E      +Q FIDV+LS
Sbjct  232   FPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREKMEVGAEGNEQDFIDVVLS  291

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
              +  ++     YSRDTVIKA V S++ DA++T A H+ W + +L+ +  +L + Q+EIDT
Sbjct  292   KLSKEYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMTLLINNQNALMKAQEEIDT  350

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +GK RW E+SD+K+L YLQ +VK+ LR+YP GP L PHE V+DC+V GYHIPKGT+L+ 
Sbjct  351   KVGKYRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHEYVKDCVVSGYHIPKGTRLFA  410

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSCPGNLYATQIT  276
             NV +L RDPK+  +P+KF PERF+    G+   +   Y+F+PFG GRRSCPG  YA Q+ 
Sbjct  411   NVMKLQRDPKLLSNPDKFDPERFIA---GDIDFRGHHYEFIPFGSGRRSCPGMTYALQVE  467

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              + +A L QGFN+ T  +E LDM E  GI + K+ P+E+++TPRL+P L+
Sbjct  468   HLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPRLAPELY  517



>ref|XP_002300088.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa]
 gb|EEE84893.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa]
Length=527

 Score =   475 bits (1222),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 226/531 (43%), Positives = 347/531 (65%), Gaps = 29/531 (5%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFSWRK--QSKR------LPPEAGGAWPIIGHLHHFRTSVPLVKTLS  1515
             L ++  + ALVL W++ R+  +S+R       PPE  GA P+IGHLH       L +TL+
Sbjct  7     LLAVSTVLALVL-WYTLRRVRESRRKTEKGLQPPEPSGALPLIGHLHLLGAQKTLARTLA  65

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
               ADKYGP+FTIRLG    +VVSN E +++CFTT+D+ +++RP +  G++L Y+YA F F
Sbjct  66    AMADKYGPIFTIRLGKHPTVVVSNLEAIKECFTTHDRILSSRPRSSHGEHLSYNYAAFGF  125

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             + +  +WR +RK+V ++LLSS R++ L+HV VSE+   IN+ Y          +N   + 
Sbjct  126   NNSGPFWREMRKIVTIQLLSSHRLKSLRHVQVSEVNTLINDLYLL------SKSNKQGST  179

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
             K+++S  F  +T+N+I +++AG+RY   ++    +E +R+ K+  + MY+ G FV  D I
Sbjct  180   KIDISECFERMTINMITRMIAGKRYFSSTEAEKEDEGKRIGKLMKEFMYISGVFVPSDVI  239

Query  974   FPLWFFRWLD-YEGHVKSMKRAAKDVDAILQDWVDARRKERRSN-------EDQKFIDVM  819
                 F  W++ + G VK+MKR ++++D++++ W+   + +R  +       ED  FIDVM
Sbjct  240   ---PFLGWMNNFLGSVKTMKRLSRELDSLMESWIQEHKLKRLESTENTNKMEDDDFIDVM  296

Query  818   LSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEI  639
             LS++DD     + YSR+T+IKA  ++++   ++T +  LTWIL+ LL +  SL+  Q+E+
Sbjct  297   LSLLDDSM---FGYSRETIIKATAMTLIIAGADTTSITLTWILSNLLNNRRSLQLAQEEL  353

Query  638   DTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQL  459
             D  +G+ERWAEDSD+ NL Y+Q ++KETLR+YP GP   PHEA +D  V GYHIPKGT+L
Sbjct  354   DLKVGRERWAEDSDIGNLVYIQAIIKETLRLYPPGPLSVPHEATKDFCVAGYHIPKGTRL  413

Query  458   YVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQI  279
             + N+W+LHRDP +W +P++++PERF+T+          ++ +PFG GRRSCPG  +A Q+
Sbjct  414   FANLWKLHRDPNLWSNPDEYMPERFLTDHANVDVLGHHFELIPFGSGRRSCPGITFALQV  473

Query  278   TQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
               +  ARL QGF+  T   E +DM E V I LPK TPLE+ +TPRLSP L+
Sbjct  474   LHLTFARLLQGFDMKTPTGESVDMTEGVAITLPKATPLEIQITPRLSPELY  524



>ref|XP_004241385.1| PREDICTED: cytochrome P450 82C2-like [Solanum lycopersicum]
Length=543

 Score =   475 bits (1223),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 242/517 (47%), Positives = 333/517 (64%), Gaps = 27/517 (5%)
 Frame = -1

Query  1616  KQSKRL---PPEAGGAWPIIGHLHHFRTS-------------VPLVKTLSEWADKYGPVF  1485
             K SK+    PP+  GAWPIIGHL    ++             +PL  TL   ADKYGPVF
Sbjct  32    KNSKKFGPAPPQLPGAWPIIGHLPQILSNTLDGRNRINKDGEIPLAHTLGALADKYGPVF  91

Query  1484  TIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNV  1305
             T+R G+  I VVS++E +++CFTT DK++A R  TC+ KYLGYD+A  TF+    YWR V
Sbjct  92    TVRQGMFPIAVVSSYEAIKECFTTQDKNLANRVATCSCKYLGYDHANLTFANYGPYWRMV  151

Query  1304  RKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGH  1125
             RKLVV  LLSS+ +E+LKHV +SE++++I E YT    +  KN       KV++  WF  
Sbjct  152   RKLVVNNLLSSKSLERLKHVRISEVESSIKELYTLFVANEAKN----VPTKVDIGHWFDD  207

Query  1124  LTLNLIMQIVAGRRY-EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL  948
             + LN+ ++++ G+RY +  +     EEA+R +K F++ MY +   V  +  FP    +WL
Sbjct  208   MMLNITVKMIGGKRYSQVNNKEEEKEEAERFRKAFNETMY-YIAIVGIEDAFPFPLLQWL  266

Query  947   DYEGHVKSMKRAAKDVDAILQDWVD---ARRKERRSNEDQKFIDVMLSMIDDQFTQGYSY  777
             D +G++K MKR A ++D ILQ W+D    +RK   SN+DQ  ID+ML+ +D    Q Y Y
Sbjct  267   DLQGNIKVMKRIADEMDVILQRWLDDHTNKRKNNESNDDQDLIDIMLTELDKDDFQ-YGY  325

Query  776   SRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSD  597
             SR+T+IKA +L+++ DA+ T A HL WI+A LL +   L++V +EIDT +GK+RW EDSD
Sbjct  326   SRETIIKATMLTIVSDATHTTAVHLIWIIACLLNNKHVLEKVHEEIDTKVGKDRWVEDSD  385

Query  596   VKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW  417
             +KNL Y Q  +KE LR+YP  P L  HEA+ DC V GYHI KGT+L+VNVW+L +D K W
Sbjct  386   IKNLMYFQATIKEVLRLYPPSPMLV-HEALADCQVLGYHISKGTRLFVNVWKLQKDSKFW  444

Query  416   PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF  237
             P+PEKFLPERF+T         +  +F+PFG GRRSCPG   A Q+T +++ARL Q F+F
Sbjct  445   PEPEKFLPERFLTTKAKVDVYGKDLEFIPFGSGRRSCPGITMAMQVTYLSIARLLQAFDF  504

Query  236   STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
                 N+PLDM E  G    K  PLEV+V PR+ P  +
Sbjct  505   DLPNNDPLDMTEGPGFTAVKKVPLEVVVKPRMLPMYY  541



>ref|XP_008235430.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=517

 Score =   474 bits (1220),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 249/519 (48%), Positives = 344/519 (66%), Gaps = 22/519 (4%)
 Frame = -1

Query  1670  LSSILGIAAL-VLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1512
             LS  L IA L VL  + WR      K    L P+  GA PIIGHLH  R   P+ KTL+ 
Sbjct  4     LSHPLAIAGLLVLALYLWRLRIQSHKIKGMLAPQPSGALPIIGHLHKLRG--PIFKTLAA  61

Query  1511  WADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFS  1332
              ADKYGP+FTI LG   +LV+SN++ V+ CFT ND   A RP +  GKYLGY+YA F FS
Sbjct  62    MADKYGPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFATRPRSTTGKYLGYNYAGFGFS  121

Query  1331  TNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPK  1152
                +YWR++RK+V+VELLSSRR+E LKHV +SE+ A I   +  +      N  NP+  K
Sbjct  122   PYGTYWRDMRKMVMVELLSSRRLETLKHVQISEVDAFIKGLFL-LCKTEGHNGLNPT--K  178

Query  1151  VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
             V +S W   LTLN+I +++AG+RY   SD     + QR  K+  + MY+ G+ V+ D I 
Sbjct  179   VVISDWIERLTLNVITRMIAGKRYFDSSD---EGDEQRFGKILKEFMYVSGKPVASDVI-  234

Query  971   PLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMIDDQ  798
                F  W+D++G +K+MKR  K++D+ + + V+    +KE  S ++  FIDVM+S+I+D 
Sbjct  235   --GFPSWIDFKGQIKAMKRIMKELDSFMGNLVEEHYAKKETNSRDEHDFIDVMISVIEDN  292

Query  797   FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE  618
              T GY+  R+T+IKA  L+++   SET A  L WIL++LL +   LK  Q+E+D  +G++
Sbjct  293   STLGYT--RETIIKATSLNLILAGSETTAISLIWILSLLLNNRHVLKLAQEELDLKVGRD  350

Query  617   RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL  438
             RW ED+D++NLPYLQ +VKETLR+YP  P   PHEA++DC V G+HI KGT L+VN+W+L
Sbjct  351   RWIEDTDIENLPYLQAIVKETLRLYPPAPLSVPHEAMQDCQVCGFHIQKGTLLFVNLWKL  410

Query  437   HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR  258
             HRDP +WPDPE F PERF+T   G  A  + ++F+PFG GRRSCPG  +A Q+T + + R
Sbjct  411   HRDPSLWPDPEVFCPERFLTTHVGIDASGQHFEFIPFGSGRRSCPGATFALQVTHLTLGR  470

Query  257   LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
             L QGF  +T  + P+D+ E +GI +PK T LEV++TPRL
Sbjct  471   LLQGFELATPMDMPVDLTEGLGITMPKSTSLEVILTPRL  509



>ref|XP_002264464.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   473 bits (1218),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 241/528 (46%), Positives = 334/528 (63%), Gaps = 27/528 (5%)
 Frame = -1

Query  1667  SSILGIAALVL---LWFS-WR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1518
             S  L IA L+L   LW++ WR      K     PPE  GAWP +GHLH     VP+ +TL
Sbjct  5     SHFLAIAGLILGLVLWYNHWRGKTLTHKSKGMSPPEPSGAWPFVGHLHLLHGKVPVFRTL  64

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
                ADK GPVF IRLG+ R LVVSN E  ++CFTTNDK  A+RP + A K LGY+YA F 
Sbjct  65    GAMADKVGPVFVIRLGMYRTLVVSNREAAKECFTTNDKIFASRPNSSAAKILGYNYAAFA  124

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
             F+ +  YWR +RKL ++E+LS+RR+  L HV VSEL A I + Y    +  D N  NP  
Sbjct  125   FAPHGPYWREMRKLSMLEILSTRRLGDLMHVQVSELHAGIKDLYI---LGKDNNWVNPK-  180

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV--SEEAQRLKKVFSQVMYLWGEFVSG  984
              KV +S WF HLT N+++++VAG+RY    + VV   EEA+       +V+ L G  V+ 
Sbjct  181   -KVVISEWFEHLTFNVVLRMVAGKRY---FNNVVHGGEEARSAIAAIKKVLLLVGASVAS  236

Query  983   DAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSM  810
             D I P  F  W+D +GH+ SMK  AK++D++++ WV     R    ++    FID+ML+ 
Sbjct  237   DVI-P--FLEWVDLQGHLSSMKLVAKEMDSLIESWVKEHTGRLNSEASSSLDFIDIMLTK  293

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
             + D     + YSR+T+IKA VL+M+   S+T +   TW+L+ LL +   +K  Q+E+D  
Sbjct  294   LKD--ASLFGYSRETIIKATVLTMIVAGSDTTSLTSTWLLSALLNNKHVMKHAQEELDLK  351

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +G++RW E SD++NL Y++ +VKETLR+Y   P L PHEA+EDC V GYHI KGT+L VN
Sbjct  352   VGRDRWVEQSDIQNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCHVGGYHISKGTRLLVN  411

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
              W+LHRDP +W +PE+F PERF+T+        + ++ +PFG GRRSCPG     Q+  +
Sbjct  412   AWKLHRDPAVWSNPEEFQPERFLTSHANVDVFGQHFELIPFGSGRRSCPGLNMGLQMLHL  471

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +ARL QGF+ +   N P+DM E + + L KLTPLEV++TPRL   L+
Sbjct  472   TIARLLQGFDMTKPSNSPVDMTEGISVALSKLTPLEVMLTPRLPAELY  519



>ref|XP_009758062.1| PREDICTED: cytochrome P450 82C4-like, partial [Nicotiana sylvestris]
Length=485

 Score =   472 bits (1215),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 228/502 (45%), Positives = 326/502 (65%), Gaps = 27/502 (5%)
 Frame = -1

Query  1601  LPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGV  1431
             LP +  G WP+IGHL HF       PL + L + ADKYGPVFT RLG+  +LVVS++E +
Sbjct  1     LPTKIPGGWPVIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAI  60

Query  1430  RDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLK  1251
             +DCF+TND   + RP    G+YLGY+  +   +    YWR  RKLV+ E+LS+ R+EK K
Sbjct  61    KDCFSTNDAIFSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFK  120

Query  1250  HVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR  1071
              V  + +Q +I   YT I         N ++  +N+S W   L   LI++++AG+ YE  
Sbjct  121   QVRFTRIQTSIKNLYTRI---------NGNSSTINLSDWLEELNFGLIVKMIAGKNYE--  169

Query  1070  SDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAI  891
               G   E+ +R K  F   M L  EFV  DA FP+  F+W+D++GH+K+MKR  KD+D++
Sbjct  170   -SGKGDEQVERFKNAFKDFMVLSMEFVLWDA-FPIPLFKWVDFQGHIKAMKRTFKDIDSV  227

Query  890   LQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD  729
              Q+W++    +R   E      +Q FIDV+LS +  ++     YSRDTVIKA V S++ D
Sbjct  228   FQNWLEEHINKREKMEVGAEGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSLVLD  286

Query  728   ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR  549
             A++T A H+ W + +L+ +  +L + Q+EIDT +GK+RW E+SD+K+L YLQ +VKE LR
Sbjct  287   AADTVALHINWGMTLLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLR  346

Query  548   MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE  369
             +YP GP L PHE V+DC+V GYHIPKGT+L+ NV +L RDPK+W +P+KF PERF+    
Sbjct  347   LYPPGPLLVPHENVKDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFIA---  403

Query  368   GEAA-QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVG  192
             G+   +   Y+F+PFG GRRSCPG  YA Q+  + +A L QGFN+ T  +E LDM E  G
Sbjct  404   GDIDFRGHHYEFIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAG  463

Query  191   IILPKLTPLEVLVTPRLSPTLF  126
             I + K+ P+E+++TPRL+P L+
Sbjct  464   ITIRKVNPVELIITPRLAPELY  485



>ref|XP_010106089.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXC07359.1| Cytochrome P450 82C4 [Morus notabilis]
Length=528

 Score =   473 bits (1218),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 236/521 (45%), Positives = 331/521 (64%), Gaps = 23/521 (4%)
 Frame = -1

Query  1649  AALVLLWFSW-RKQSKRL-------PPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKY  1497
             A+ V+L+++  RK+SK          PE  GAWPIIGHLH       L+ +TL   AD Y
Sbjct  16    ASSVILYYALLRKKSKPTRITPGVQAPEPEGAWPIIGHLHLLGGGDQLLYRTLGAMADNY  75

Query  1496  GPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSY  1317
             GP F IRLG  R  VV++W+  +DCFT NDK +A+RPTT A K++GY+YAVF F+  + +
Sbjct  76    GPAFNIRLGSRRAFVVNSWDVAKDCFTANDKALASRPTTVAAKHMGYNYAVFGFAPYSPF  135

Query  1316  WRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSR  1137
             WR +RK+  +ELLS+RR+E LKHV +SE+   I + Y       D+  N      V +SR
Sbjct  136   WREMRKIATLELLSNRRLEMLKHVRISEIDTGIQDLY-------DRVQNGAHPVVVELSR  188

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
             W   LTLN+++++VAG+RY         +EAQR +K   +  +L G FV  DA+  LW  
Sbjct  189   WLDELTLNMVVRMVAGKRYFGALAECNGDEAQRCQKAICEFFHLIGIFVVSDALPFLW--  246

Query  956   RWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRS---NEDQKFIDVMLSMIDDQFTQG  786
              WLD  GH ++MKR AK++DAIL  W++  R+ R S   + DQ FIDVMLS+ +      
Sbjct  247   -WLDLHGHERAMKRTAKELDAILGGWLEEHRRRRASKMADSDQDFIDVMLSLQEGGELSN  305

Query  785   YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAE  606
             + Y  D  IK+  L+++   S+T A  LTW +++LL +  +LK+ Q E+D  +G  R  +
Sbjct  306   FQYDADISIKSTCLALILGGSDTTAGTLTWAISLLLNNSHALKKAQQELDIEVGTNRLVD  365

Query  605   DSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDP  426
             DSD+KNL YLQ ++KETLR+YP GP L P EA+EDC V GYH+P GT+L VNVW++ RDP
Sbjct  366   DSDIKNLVYLQAIIKETLRLYPAGPLLGPREALEDCTVSGYHVPAGTRLVVNVWKIQRDP  425

Query  425   KIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQG  246
              +W +PE F PERF+T       + +Q++ +PFG GRRSCPG  +A Q+  + +ARL Q 
Sbjct  426   TVWSNPEAFEPERFLTTHAHVDVRGQQFELIPFGSGRRSCPGASFALQVLHLTLARLLQA  485

Query  245   FNFST-VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             F FS  +   P+DM E+ G+ +PK  PLEVL++PRL   L+
Sbjct  486   FEFSNPLDGRPVDMTENPGLTIPKAHPLEVLLSPRLPRELY  526



>gb|ABR57311.1| cytochrome P450 monooxygenase [Nicotiana sylvestris]
Length=517

 Score =   473 bits (1216),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 234/530 (44%), Positives = 340/530 (64%), Gaps = 32/530 (6%)
 Frame = -1

Query  1670  LSSILGIAALV-LLWFSWRKQSKRLPPEAG----GAWPIIGHLHHFRTSV---PLVKTLS  1515
             + + +G+     LL+F W K+S++LP        G WP+IGHL HF       PL + L 
Sbjct  5     IEAFVGLVTFTFLLYFLWTKKSQKLPKPLPPKIPGGWPVIGHLFHFNNDGDDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYGPVFT RLG+  +LVVS++E ++DCF+TND   + RP    G+YLGY+  +   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +    YWR  RKLV+ E+LS+ R+EK K V  + +Q +I   YT I         N ++ 
Sbjct  125   ANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTSIKNLYTRI---------NGNSS  175

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R K  F   M L  EFV  DA 
Sbjct  176   TINLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMVLSMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLS  813
             FP+  F+W+D++GH+K+MKR  KD+D++ Q+W++    +R   E      +Q FIDV+LS
Sbjct  232   FPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREKMEVGAEGNEQDFIDVVLS  291

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
              +  ++     YSRDTVIKA V S++ DA++T A H+ W + +L+ +  +L + Q+EIDT
Sbjct  292   KLSKEYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMTLLINNQNALMKAQEEIDT  350

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +GK+RW E+SD+K+L YLQ +VKE LR+YP GP L PHE V+DC+V GYHIPKGT+L+ 
Sbjct  351   KVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVKDCVVSGYHIPKGTRLFA  410

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSCPGNLYATQIT  276
             NV +L RDPK+W +P+KF PERF+    G+   +   Y+F+PFG GRRSCPG  YA Q+ 
Sbjct  411   NVMKLQRDPKLWSNPDKFDPERFIA---GDIDFRGHHYEFIPFGSGRRSCPGMTYALQVE  467

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              + +A L QGFN+ T  +E LDM E  GI + K+ P+E+++TPRL+P L+
Sbjct  468   HLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPRLAPELY  517



>ref|XP_006473405.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   473 bits (1216),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 235/526 (45%), Positives = 341/526 (65%), Gaps = 23/526 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFS----WRKQSK----RLPPEAGGAWPIIGHLHHFRTSVPLV-KTL  1518
             LSSI+ + +L+L  ++     RK S     +  PE  GAWPIIGHLH       L+ +TL
Sbjct  7     LSSIVVVFSLLLFLYNASLRGRKSSNVRKTKKAPEPAGAWPIIGHLHLLGGGDQLLYRTL  66

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
                ADK+GP F IRLG     VVS+WE V++CFT NDK +A+RP T A K++GYDYAVF 
Sbjct  67    GAMADKWGPAFNIRLGSRSAFVVSSWEVVKECFTINDKALASRPKTAAAKHMGYDYAVFG  126

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
             F+    +WR +RK+  +ELLS+RR+E LKHV +SE++  + E +   A    KNN+ P  
Sbjct  127   FAPYTPFWREMRKIATLELLSNRRLEALKHVRISEVEMGLRELHGLWA----KNNSRPVL  182

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
               V + +W   +TLN+++++VAG+RY   S      EA++ +K  +Q  +L G F   DA
Sbjct  183   --VELKKWLEDMTLNMVVRMVAGKRYFGASATCDDSEARQCQKAINQFFHLIGIFTVSDA  240

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKER-----RSNEDQKFIDVMLS  813
                L FF WLD++GH  +MK+ AK++DAIL+ W++  R+ R      S  +Q FIDVMLS
Sbjct  241   ---LPFFWWLDWQGHEMAMKKTAKELDAILEGWLEEHRQRRVSGGIESESEQDFIDVMLS  297

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
             + ++     + +S D  IK+  L+++   S+T +  LTW +++LL +P  LK+ Q+E+D 
Sbjct  298   LQEEGHLSQFQHSADISIKSTCLALILGGSDTTSGTLTWAISLLLNNPNMLKKAQEELDQ  357

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              IG +R  +DSD+KNL YLQ ++KETLR+YP GP L P EA+EDC V GYHIP GT+L V
Sbjct  358   QIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHIPAGTRLIV  417

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             NVW++ RDP++W +P  F PERF+T+      + +Q++ +PFG GRRSCPG  +A Q+  
Sbjct  418   NVWKIQRDPRVWKNPSAFQPERFLTSHTDVDFRGQQFELIPFGSGRRSCPGASFALQVLH  477

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSP  135
             + +ARL   F  +T  ++P+DM E  G+ +PK TPLEV+++PRL P
Sbjct  478   LTLARLLHAFELATPSDQPVDMTESPGLTIPKATPLEVVLSPRLPP  523



>ref|XP_008372514.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=524

 Score =   472 bits (1215),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 241/529 (46%), Positives = 336/529 (64%), Gaps = 22/529 (4%)
 Frame = -1

Query  1679  PCCLSSILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1512
             P  L +I+GI   VL  +  + QS +    L P+  GA PIIGHLH      PL +TL+ 
Sbjct  4     PSHLLAIVGILLFVLYLWRVKIQSHKTKGMLAPQPSGALPIIGHLHKLGGXNPLCRTLAS  63

Query  1511  WADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFS  1332
              ADKYGP+FTI+LG    LV+SN++ V++CFT ND   A R  +  G+YLGY+YA   FS
Sbjct  64    MADKYGPIFTIQLGKHPALVISNYDAVKECFTKNDIAFATRSKSAQGRYLGYNYAALGFS  123

Query  1331  TNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPK  1152
                +YWRN+RK+ +VELLSSRR++ LKHV +SE+ + I   Y        K  N  S  K
Sbjct  124   QYGTYWRNMRKMAIVELLSSRRLQTLKHVQISEVDSFIKGLYEIC---KTKGENGQS--K  178

Query  1151  VNMSRWFGHLTLNLIMQIVAGRRY----EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSG  984
             V +S W  HLTLN+I Q++AG+RY    +  +D     E +R++++  + M + G+ V  
Sbjct  179   VVISEWIEHLTLNVITQMIAGKRYFDWGKVGNDSDNEGENKRIREMVKEFMCVAGKPVVS  238

Query  983   DAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR---RKERRSNEDQKFIDVMLS  813
             D I    F  W+D  G VK+MKR  KD D+++  W++     R+E  S +   FIDVMLS
Sbjct  239   DVI---GFPDWIDLMGQVKNMKRIGKDFDSLMASWIEEHKNAREEIDSRDKLDFIDVMLS  295

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
             +I+D    G+S  R+T+IKA   +++   S+T AT LTWIL++LL +   LK  Q+ I+ 
Sbjct  296   VIEDNTVLGHS--RETIIKATSQNLILAGSDTTATSLTWILSLLLNNRHILKHAQEXINL  353

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +G ERW ED+D+K+L YLQ +VKETLR+YP  P   PHEA EDC V G+HIPKGT+L+ 
Sbjct  354   QVGTERWVEDTDIKDLTYLQAIVKETLRLYPPAPLSVPHEAXEDCQVCGFHIPKGTRLFA  413

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             N+W+LHRDP +W DPE F P+RF+T         + ++F+PFG GRRSCPG  +A Q+  
Sbjct  414   NLWKLHRDPSVWSDPEVFCPDRFLTTQASTDVSGQHFEFIPFGSGRRSCPGLTFAMQVIH  473

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + + RL QGF  +T  + P+DM E +GI +PK T LEV++TPRL P+ F
Sbjct  474   LTLGRLIQGFELATPLDMPVDMAEGLGITMPKATSLEVVLTPRL-PSQF  521



>ref|XP_010664626.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=534

 Score =   473 bits (1216),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 237/525 (45%), Positives = 336/525 (64%), Gaps = 24/525 (5%)
 Frame = -1

Query  1664  SILGIAA----LVLLWFSWRKQS---KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWA  1506
             S + +AA    L L +FS   +S   KR  PEA GAWP+IGHLH         KTL   A
Sbjct  21    STIAMAAMFTFLFLYYFSKIAKSSERKRTAPEAAGAWPVIGHLHLLGGPELPHKTLGAMA  80

Query  1505  DKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTN  1326
             DKYGPVF I+LG+ R+L++SNWE  ++CFTTNDK  A RP + A + LGY+YA+F F   
Sbjct  81    DKYGPVFLIKLGVQRVLMLSNWEMAKECFTTNDKVFANRPKSIAVEVLGYNYAMFGFGPY  140

Query  1325  NSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVN  1146
              SYWR VRK+V   LLS+RR+E +KHVW+SE++A+I E Y      N ++++N     V 
Sbjct  141   GSYWRQVRKIVTTGLLSNRRLEIVKHVWISEVKASIRELYELWI--NKRSDSNMVL--VE  196

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             M  WFG L+LN+++++++G R     D    EE  R  K+        G F+  DA+ PL
Sbjct  197   MKDWFGDLSLNMVLRMLSGGR-----DSSSKEERMRCHKLVRDFFQSMGTFLVSDAL-PL  250

Query  965   WFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQF  795
                RW D+ G+ K+M++ AKD+D +L+ W+   + +R S +   +Q F+DVMLSM+DD  
Sbjct  251   --LRWFDFGGYEKAMRKTAKDLDHLLESWLQQHKSKRSSEQADGNQDFMDVMLSMLDDMA  308

Query  794   TQG--YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             T      +  DT+ KA  L++L   ++T    L W L++LL  P+ LK  ++E+D+++G+
Sbjct  309   TDEDLKGFDADTINKATCLTILAGGTDTVTVSLIWALSLLLNKPQVLKTAREELDSHVGR  368

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             ER  E+ D+KNL YL  +VKETLR+YP GP  APHE+ EDC++ GYHIP GT+L  N+W+
Sbjct  369   ERQVEERDMKNLAYLNAIVKETLRLYPAGPLTAPHESTEDCLLGGYHIPAGTRLLANLWK  428

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             +HRDP IW DP++F PERF+T  +    + + ++ +PFG GRR CPG  +  Q  Q  +A
Sbjct  429   IHRDPSIWSDPDEFRPERFLTTHKDVDVKGQHFELIPFGSGRRICPGISFGLQFMQFTLA  488

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              L QGF F+T+ +EP+DM E +G+   K TPLEVLV PRLS  L+
Sbjct  489   SLIQGFEFATMSDEPVDMTESIGLTNLKATPLEVLVAPRLSSDLY  533



>ref|XP_009348373.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=538

 Score =   473 bits (1216),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 237/525 (45%), Positives = 334/525 (64%), Gaps = 21/525 (4%)
 Frame = -1

Query  1682  VPCCLSSILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLS  1515
             +P  L +I GI   +L  +  + QS +    L P+  GA PIIGHLH      PL +TL+
Sbjct  17    LPSHLVAIGGIFLFILYLWRVKIQSHKTKGILTPQPSGALPIIGHLHKLGGKKPLCRTLA  76

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
               ADKYGP+FTIRLG    LV+SN++ V++CFT ND    ARP +  G+YLGY+YA F F
Sbjct  77    SMADKYGPIFTIRLGKDPALVISNYDAVKECFTKNDIVFGARPKSAHGRYLGYNYAGFGF  136

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             S   +YWRN+RK+V+ ELLSSRR++ LKHV +SE+ + I   Y        K        
Sbjct  137   SPYGTYWRNMRKVVIAELLSSRRLQTLKHVQISEVDSFIKGLYEIC-----KTKGENGQG  191

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRY----EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVS  987
             KV +S W  HLTLN+I Q++AG+RY    +  +D     E +R++++  + M + G  V 
Sbjct  192   KVVISEWIEHLTLNVITQMIAGKRYFDWGKVGNDSDNEGENKRIREIVKEFMLVSGMPVI  251

Query  986   GDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR---RKERRSNEDQKFIDVML  816
              D I    +  W+D+ G VK+MKR  K++D++   W++     RKE  S +   FIDVML
Sbjct  252   SDMI---GYPDWIDFLGEVKNMKRIGKELDSLTASWIEEHNNARKEIDSRDKLDFIDVML  308

Query  815   SMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEID  636
             S+I+D    GY+  R+T+IKA   +++   S+T A  L W++++LL +   LK  Q+EI+
Sbjct  309   SVIEDNTVLGYT--RETIIKATSQNLIIAGSDTTAISLKWVISLLLNNRHVLKHAQEEIN  366

Query  635   TNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLY  456
               +G ERW ED+D++NL YLQ +VKETLR+YP GP   PHEA+EDC V G+HIPKGT+L+
Sbjct  367   LIVGTERWVEDTDIENLTYLQAIVKETLRLYPPGPLSVPHEAMEDCQVCGFHIPKGTRLF  426

Query  455   VNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQIT  276
             VN+W+LHRDP +W DPE F P+RF+T           ++F+PFG GRRSCPG  +A Q+ 
Sbjct  427   VNLWKLHRDPTVWSDPEMFYPDRFLTTQASIDVSGNHFEFIPFGSGRRSCPGLTFAMQVI  486

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
              + + RL QGF  +T  + P+DM E +G+ LPK T LEV++TPRL
Sbjct  487   HLTLGRLIQGFELATPLDMPVDMTEGLGVTLPKATSLEVVLTPRL  531



>ref|XP_010069627.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW58035.1| hypothetical protein EUGRSUZ_H00764 [Eucalyptus grandis]
Length=539

 Score =   472 bits (1215),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 232/503 (46%), Positives = 333/503 (66%), Gaps = 15/503 (3%)
 Frame = -1

Query  1601  LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDC  1422
             LPPE  GAWPIIGHLH  R   PL +TL+  ADK GP+F I LG+    V+S+ E VR+C
Sbjct  35    LPPELPGAWPIIGHLHLLRGETPLARTLAAMADKQGPMFRIWLGVHPTTVISSREAVREC  94

Query  1421  FTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVW  1242
             FTT+DK +A+RP + AG +LGY + VF F+     WR +RK+ ++ELL +RR++ LKHV 
Sbjct  95    FTTHDKELASRPKSMAGVHLGYGHTVFVFAEYGDLWREMRKITMLELLCTRRLDNLKHVQ  154

Query  1241  VSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR---  1071
              SE+ + + +  T + M N  +  N S+  V +S     LTLN++ +++A +RY  +   
Sbjct  155   ESEIDSFVKDLRT-LCMTNTDDAQNGSSKGVVISELLELLTLNIMTRMLASKRYFGQLSA  213

Query  1070  SDGVVSE--EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVD  897
             S G  ++  EA  L+++    MYL+G  V  D    L F  W D  G VK+MKR A+++D
Sbjct  214   STGSSTDYDEASHLRELIKDFMYLFGLPVVSDF---LPFPEWTDCTGTVKTMKRVARELD  270

Query  896   AILQDWVDARRKERRSNEDQK------FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
              I+  WV+  + +R  +  +       FIDVMLSMI +     + +  + +IKA V++ +
Sbjct  271   EIVGKWVEEHKLKRCDHRGEAIDVREDFIDVMLSMIGEDSFAKFGHPPERLIKATVVNNI  330

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
                S+T    LTW+L++LL H   LKR Q+E+D  +GK++W +DSD++NLPYLQ +VKET
Sbjct  331   VAGSDTTYLTLTWVLSLLLNHKHILKRAQEEMDLMVGKDKWIQDSDIENLPYLQAIVKET  390

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTN  375
             LR+YP  P +APHEA  DC V GY IPKGT++ VNVW+LHRDP++W +PEKFLPERF+TN
Sbjct  391   LRLYPTAPLVAPHEARADCTVSGYRIPKGTRIIVNVWKLHRDPQVWSNPEKFLPERFLTN  450

Query  374   LEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV  195
               G  A  + ++F+PFG GRRSCPG + A ++T + +ARL QGF+ +T  N+P+DM E +
Sbjct  451   HSGMDALGQHFEFIPFGSGRRSCPGAMLALRVTHLTLARLLQGFDLATPSNKPVDMTEGL  510

Query  194   GIILPKLTPLEVLVTPRLSPTLF  126
             G+ LPK +PL V++TPRL PTL+
Sbjct  511   GVTLPKASPLRVILTPRLPPTLY  533



>ref|XP_009348374.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   471 bits (1211),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 237/524 (45%), Positives = 334/524 (64%), Gaps = 21/524 (4%)
 Frame = -1

Query  1679  PCCLSSILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1512
             P  L +I+GI   VL  +  + QS++    L P+A GA PIIGHLH      PL +TL+ 
Sbjct  4     PSHLLAIVGILLFVLYLWRVKVQSRKTKGMLAPQASGALPIIGHLHKLGGKKPLCRTLAS  63

Query  1511  WADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFS  1332
              ADKYGP+FTIRLG    LV++N++ V++CFT ND   A+R  +  G+YLGY+YA F F+
Sbjct  64    MADKYGPIFTIRLGKHPALVINNYDAVKECFTKNDIAFASRSKSAQGRYLGYNYAGFGFA  123

Query  1331  TNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPK  1152
                +YWRN+RK+V VELLSSRR++ LKHV + E+ + I   Y        K  N  S  K
Sbjct  124   PYGTYWRNMRKMVTVELLSSRRLQTLKHVQICEVDSFIKGLYEIC---KTKGENGQS--K  178

Query  1151  VNMSRWFGHLTLNLIMQIVAGRRY----EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSG  984
             V +S W  HLTLN+I Q++AG+RY       +D     E +R++ +  + M + G+    
Sbjct  179   VVISEWIEHLTLNVITQMIAGKRYFDLGTVGNDSDNEGENKRIRGMVKEFMCVAGKPAVS  238

Query  983   DAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR---RKERRSNEDQKFIDVMLS  813
             D I    F  W+D  G VK+MKR  KD D+++  W++     RKE  S +   FIDVMLS
Sbjct  239   DVI---GFPHWIDLMGQVKNMKRIGKDFDSLMAGWIEEHKNARKEIDSRDKLDFIDVMLS  295

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
             +I+D    G++  R+T+IKA   +++   S+T AT LTWIL++LL +   LK  Q+EI+ 
Sbjct  296   VIEDNTVLGHT--RETIIKATSQTLILAGSDTTATSLTWILSLLLNNRHVLKHAQEEINL  353

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +G ERW ED+D+K+L YLQ +VKETLR+YP  P    HEA+EDC V G++IPKGT+L+ 
Sbjct  354   QVGTERWVEDTDIKDLTYLQAIVKETLRLYPPAPLSTSHEAMEDCQVCGFYIPKGTRLFT  413

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             N+W+LHRDP +W DPE F P+RF+T         + ++F+PFG GRRSCPG  +A Q+  
Sbjct  414   NLWKLHRDPSVWSDPEVFCPDRFLTTQASIDVSGQHFEFIPFGSGRRSCPGLTFAMQVIH  473

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
             + + RL QGF  +T  + P+DM E +G+ +PK T LEV++TPRL
Sbjct  474   LTLGRLIQGFELATPLDMPVDMAEGLGVTMPKATSLEVVLTPRL  517



>gb|KDP26346.1| hypothetical protein JCGZ_17504 [Jatropha curcas]
Length=515

 Score =   470 bits (1210),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 223/526 (42%), Positives = 345/526 (66%), Gaps = 24/526 (5%)
 Frame = -1

Query  1679  PCCLSSILGIAALVLLWFSWR-----KQSKRLP-PEAGGAWPIIGHLHHFRTSVPLVKTL  1518
             P  + +I G+ +LVLL+  WR      ++K L  PEA GA PIIGHLH       L +T+
Sbjct  4     PSHIVAIAGVISLVLLYNLWRFGKNGTKNKGLSVPEAPGALPIIGHLHRLGGEKTLARTM  63

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
              + ADK GP+FT+RLG  + +++SN+E +++ FTTND   ++RP +   KY+GY+YA F 
Sbjct  64    GDLADKCGPIFTVRLGAHKAIIISNYEAMKETFTTNDILFSSRPPSSQAKYIGYNYAAFG  123

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
             F+   +YWRN+RKL+++ELLS +R++ ++HV VSE+   I + Y+             S 
Sbjct  124   FAPYGTYWRNMRKLIMIELLSVQRIKLMRHVQVSEVNNMIKDLYSD------------SK  171

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
              K++MS    HL LN+I ++VAG+RY   +     E  + + K+  + M++ G  V GD 
Sbjct  172   KKIDMSEMLEHLILNIITRMVAGKRYFDGNSEGRDEHGRPIGKIMREFMFVVGALVPGDL  231

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARR-KERRSNEDQKFIDVMLSMIDD  801
             I    F  W D +G  K+MK+ +K++D I+  W++  + K+ +++ ++ FIDVMLS+I+D
Sbjct  232   I---PFLGWWDIQGIKKTMKKVSKELDVIMSTWIEEHKTKKNKTDSNKDFIDVMLSVIED  288

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
               T G+    D +IK+  +S++   S+T +  +TW L+ LL + ++L+R+Q+E+D  +G+
Sbjct  289   DTTFGHKC--DVIIKSTAMSLIVAGSDTTSITMTWALSSLLNNRKTLERLQEELDQKVGR  346

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             +RW +DSD++ L Y   V+KETLR+YP GP   P EA EDC + GYHIPKGT+L+ N+W+
Sbjct  347   DRWVDDSDIEKLDYFSAVIKETLRLYPPGPLGVPREATEDCTIAGYHIPKGTRLFTNLWK  406

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             LHRDP +W DPE+F PERF+T+        + ++++PFG GRRSCPG  +A Q+  + +A
Sbjct  407   LHRDPNVWADPEEFKPERFLTDNANLDVSGQHFEYLPFGAGRRSCPGLNFAMQVMNITLA  466

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             RL Q ++F T  NEP+DM E  GI LPK+TPLEV++TPRL+P L++
Sbjct  467   RLLQAYDFRTPGNEPVDMTEGKGIALPKITPLEVVLTPRLAPELYQ  512



>gb|ABD39483.1| CYP82E2v2 [Nicotiana tabacum]
Length=517

 Score =   469 bits (1206),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 236/533 (44%), Positives = 339/533 (64%), Gaps = 35/533 (7%)
 Frame = -1

Query  1670  LSSILGIAALV----LLWFSWRKQSKRLPPEAG----GAWPIIGHLHHFRTSV---PLVK  1524
             LS I     LV    LL+F W K+S++LP        G WP+IGHL HF       PL +
Sbjct  2     LSPIEAFVGLVTFTFLLYFLWTKKSQKLPKPLPPKIPGGWPVIGHLFHFNNDGDDRPLAR  61

Query  1523  TLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAV  1344
              L + ADKYGPVFT RLG+  +LVVS++E ++DCF+TND   + RP    G+YLGY+  +
Sbjct  62    KLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPALLYGEYLGYNNTM  121

Query  1343  FTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNP  1164
                +    YWR  RKLV+ E+LS+ R+EK K V  + +Q +I   YT I         N 
Sbjct  122   LFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTSIKNLYTRI---------NG  172

Query  1163  SAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSG  984
             ++  +N++ W   L   LI++++AG+ YE    G   E+ +R K  F   M L  EFV  
Sbjct  173   NSSTINLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMVLSMEFVLW  229

Query  983   DAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDV  822
             DA FP+  F+W+D++GH+K+MKR  KD+D++ Q+W++    +R   E      +Q FIDV
Sbjct  230   DA-FPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREKIEVGAEGNEQDFIDV  288

Query  821   MLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDE  642
             +LS +  ++     YSRDTVIKA V S++ DA++T A H+ W + +L+ +  +L + Q+E
Sbjct  289   VLSKLSKEYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMTLLINNQNALMKAQEE  347

Query  641   IDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQ  462
             IDT +GK+RW E+SD+K+L YLQ +VK+ LR+YP GP L PHE V+DC+V GYHIPKGT+
Sbjct  348   IDTKVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHENVKDCVVSGYHIPKGTR  407

Query  461   LYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSCPGNLYAT  285
             L+ NV +L RDPK+  +P+KF PERF+    G+   +   Y+F+PFG GRRSCPG  YA 
Sbjct  408   LFANVMKLQRDPKLLSNPDKFDPERFIA---GDIDFRGHHYEFIPFGSGRRSCPGMTYAL  464

Query  284   QITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             Q+  + +A L QGFN+ T  +E LDM E  GI + K+ P+E+++TPRL+P L+
Sbjct  465   QVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPRLAPELY  517



>ref|XP_003523888.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
 gb|KHN04535.1| Cytochrome P450 82C4 [Glycine soja]
Length=526

 Score =   469 bits (1207),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 230/521 (44%), Positives = 339/521 (65%), Gaps = 22/521 (4%)
 Frame = -1

Query  1652  IAALVLLWFSWR-----KQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGP  1491
             ++ LV LW + R     K   +  P   GAWP+IGHLH       L+ +TL   AD+YGP
Sbjct  14    VSLLVFLWHTKRNRGGSKNKSKEAPIPAGAWPLIGHLHLLGGDDQLLYRTLGTMADQYGP  73

Query  1490  VFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWR  1311
              F I LG  R  VVS+WE  ++CFT+NDK +A+RPTT A K++GY+YAVF F+  + +WR
Sbjct  74    AFNIWLGTRRAFVVSSWEVAKECFTSNDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWR  133

Query  1310  NVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWF  1131
              +RK+  +ELLS+RR+E LKHV VSEL   + + Y +      +N + P    V ++RW 
Sbjct  134   EMRKIATLELLSNRRLEMLKHVMVSELNMVMRDLYNSWV----QNRSRPVL--VELNRWL  187

Query  1130  GHLTLNLIMQIVAGRRYEYRSDGVVSE-EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR  954
               LTLN+++++VAG+RY   S    ++ EA+R +K  +Q  +L G FV  DA   L F R
Sbjct  188   EDLTLNMVVRMVAGKRYFGASASCDNDDEARRCQKAINQFFHLIGIFVVSDA---LPFLR  244

Query  953   WLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDVMLSMIDDQFTQ  789
             W D +GH ++MK+ AK++DAIL+ W+   R++R   E     +Q FID+MLS+       
Sbjct  245   WFDVQGHERAMKKTAKELDAILEGWLKEHREQRVDGEIKAEGEQDFIDIMLSLQKGGHLS  304

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
              + Y  DT IK+  L+++   S+T A  +TW +++LL + ++LK+ Q+E+D N+G ER  
Sbjct  305   NFQYDSDTSIKSTCLALILGGSDTTAGTVTWAISLLLNNRQALKKAQEELDLNVGMERQV  364

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
             E+SD++NL Y+Q ++KETLR+YP GP L P EA EDC V GYH+P GT+L VN+W++HRD
Sbjct  365   EESDIRNLAYVQAIIKETLRLYPAGPLLGPREAQEDCNVAGYHVPAGTRLVVNLWKIHRD  424

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ  249
             P++W +P  F PERF+T+ +    + + ++ +PFG GRRSCPG  +A Q+  + +ARL  
Sbjct  425   PRVWQEPSAFRPERFLTS-DAVDVRGQNFELIPFGSGRRSCPGMSFALQVLHLTLARLLH  483

Query  248   GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              F F+T  ++P+DM E  G+ +PK TPLEVL+TPRL   L+
Sbjct  484   AFEFATPSDQPVDMTESPGLTIPKATPLEVLLTPRLPAKLY  524



>ref|XP_007227272.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
 gb|EMJ28471.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
Length=518

 Score =   469 bits (1206),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 235/506 (46%), Positives = 326/506 (64%), Gaps = 25/506 (5%)
 Frame = -1

Query  1604  RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             R  PE  GAWPIIGHLH       L+ +TL   ADKYG  F IRLG  R  VVS+WE  +
Sbjct  24    REAPEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKYGSAFNIRLGSRRAFVVSSWEVAK  83

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +CFT NDK +A+RPTT A K++GY+YAVF F+  + +WR +RK+  +ELLS+RR+E LKH
Sbjct  84    ECFTFNDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATIELLSNRRLEMLKH  143

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPKV-NMSRWFGHLTLNLIMQIVAGRRYEYR  1071
             V  SEL   I E      + N    N  S P V  ++RW   LTLN+++++VAG+RY   
Sbjct  144   VRTSELDTGIKE------LQNLWVQNGSSRPVVVELNRWLEELTLNVVVRMVAGKRYFGA  197

Query  1070  S----DGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKD  903
             S    DG   +EA+R +K   Q  +L G FV  DA+  LW   WLD +GH K+MK+ AKD
Sbjct  198   SAKCDDG---DEARRCQKAIGQFFHLIGIFVVSDALPFLW---WLDLQGHEKAMKKTAKD  251

Query  902   VDAILQDWVDARRKER-------RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVL  744
             +DAIL  W+D  R+ R       ++  D+ FIDVMLS+ ++     + +S DT IK+  L
Sbjct  252   LDAILGGWLDEHRQRRVLSHEKGKTEADEDFIDVMLSLQEEGQLSNFQHSSDTSIKSTCL  311

Query  743   SMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVV  564
             +++   S+T A  LTW +++LL +P  +K+ Q+E++  +G ER  ++SD+KNL YLQ ++
Sbjct  312   AIILGGSDTTAGTLTWAISLLLNNPHVMKKAQEELELQVGTERQVDESDIKNLVYLQAII  371

Query  563   KETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERF  384
             KETLR+YP GP L P EA+EDC V GYH+P GT+L VNVW++ RDP +W +P  F PERF
Sbjct  372   KETLRLYPAGPLLGPREALEDCTVAGYHVPAGTRLVVNVWKIQRDPSVWENPSAFEPERF  431

Query  383   MTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMM  204
             +T+      + +Q++ +PFG GRRSCPG  +A Q+  + +ARL   F F T   + +DM 
Sbjct  432   LTSHGHVDVRGQQFELMPFGSGRRSCPGVSFAMQVLHLTLARLLHAFEFETPLGQRIDMT  491

Query  203   EDVGIILPKLTPLEVLVTPRLSPTLF  126
             E  G+ +PK TPLEVL+TPRL   L+
Sbjct  492   ESPGLTIPKATPLEVLLTPRLPGNLY  517



>ref|XP_009599169.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=523

 Score =   468 bits (1205),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 231/520 (44%), Positives = 341/520 (66%), Gaps = 19/520 (4%)
 Frame = -1

Query  1652  IAALVLLWFSWRKQ---SKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVF  1485
             +  ++ L+F ++ +   SK+  PE  GAWPIIGHLH    +  L+ +TL   AD YGP F
Sbjct  10    LGVVIFLYFLFKNKNSTSKKHAPEPAGAWPIIGHLHLLGGAEQLLYRTLGAMADNYGPAF  69

Query  1484  TIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNV  1305
             +IRLG  R  VVS+WE  ++CFT NDK +A+RPTT A K++GY YAVF F+  +++WR +
Sbjct  70    SIRLGSRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFAPYSTFWREM  129

Query  1304  RKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP-KVNMSRWFG  1128
             RK+ + ELLS+RR++ LKHV VSE++  I E Y         NNN+   P  V +  WF 
Sbjct  130   RKIAMYELLSNRRLDTLKHVQVSEVEMGIQELYKLWV-----NNNSGYRPILVELKHWFE  184

Query  1127  HLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL  948
              LTLN+I+++VAG+RY         +EA+R +K  +Q  +L G FV  DA FP+    W 
Sbjct  185   DLTLNVIVRMVAGKRYFGAGASCDDDEARRCQKAINQFFHLIGIFVPSDA-FPI--LGWF  241

Query  947   DYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNED-----QKFIDVMLSMIDDQFTQGY  783
             D +GH K+MKR AK++D+IL+ W+   R++RR +E      Q FIDVMLS+ ++     +
Sbjct  242   DIQGHEKAMKRTAKELDSILESWLQEHREKRRLSEGKNEGAQDFIDVMLSLQEEGRLSNF  301

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              Y  DT IK+  L+++   S+T A  LTW +++LL +PE L++ Q+EID ++GK+R  ++
Sbjct  302   QYDADTSIKSTCLALILGGSDTTAGTLTWAISLLLNNPEILRKAQEEIDVHVGKDRQVDE  361

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             SD++NL Y+Q ++KETLR+YP GP L P EA+++C V GY I  GT+L VNVW++ RDP+
Sbjct  362   SDIQNLAYIQAIIKETLRLYPAGPLLGPREAMDECEVGGYKITPGTRLIVNVWKIQRDPR  421

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             IW DP+ F P+RF+ +      + + ++ +PFG GRRSCPG   A Q+  + +AR  Q F
Sbjct  422   IWEDPDSFKPDRFLMSNSNVDVKGQDFELIPFGSGRRSCPGVSLALQVLHLTLARFLQAF  481

Query  242   NFST-VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              FS  V ++ +D+ E  G+ +PK TPL+VL+TPRL+  L+
Sbjct  482   EFSKPVGDQLIDLTESPGLTIPKATPLDVLITPRLNANLY  521



>gb|KDO84376.1| hypothetical protein CISIN_1g036812mg [Citrus sinensis]
Length=499

 Score =   467 bits (1202),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 225/493 (46%), Positives = 324/493 (66%), Gaps = 15/493 (3%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCF  1419
             PE  GAWPIIGHLH       L+ +TL   ADK+GP F IRLG     VVS+WE V++CF
Sbjct  11    PEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECF  70

Query  1418  TTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWV  1239
             T NDK +A+RP T A K++GYDYAVF F+    +WR +RK+  +ELLS+RR+E LKHV +
Sbjct  71    TINDKALASRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKIATLELLSNRRLEALKHVRI  130

Query  1238  SELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGV  1059
             SE+   + + +   A    KNN+ P    V + +W   +TLN+++++VAG+RY   S   
Sbjct  131   SEVDMGLRDLHGLWA----KNNSRPVL--VELKKWLEDMTLNMVVRMVAGKRYFGASATC  184

Query  1058  VSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDW  879
                EA++ +K  +Q  +L G F   DA   L FF WLD++GH  +MK+ AK++DAIL+ W
Sbjct  185   DDSEARQCQKAINQFFHLIGIFTVSDA---LPFFWWLDWQGHEMAMKKTAKELDAILEGW  241

Query  878   VDARRKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
             ++  R+ R      S  +Q FIDVMLS+ ++     + +S D  IK+  L+++   S+T 
Sbjct  242   LEEHRQRRVSGGIESESEQDFIDVMLSLQEEGHLSQFQHSADISIKSTCLALILGGSDTT  301

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
             +  LTW +++LL +P  LK+ Q+E+D  IG +R  +DSD+KNL YLQ ++KETLR+YP G
Sbjct  302   SGTLTWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAG  361

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P L P EA+EDC V GYHIP GT+L VNVW++ RDP++W +P  F PERF+T+      +
Sbjct  362   PLLGPREAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHTDVDFR  421

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
              +Q++ +PFG GRRSCPG  +A Q+  + +ARL   F  +T  ++P+DM E  G+ +PK 
Sbjct  422   GQQFELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKA  481

Query  173   TPLEVLVTPRLSP  135
             TPLEV+++PRL P
Sbjct  482   TPLEVVLSPRLPP  494



>gb|ABA07806.2| cytochrome P450 monooxygenase CYP82E2 [Nicotiana tabacum]
Length=517

 Score =   468 bits (1203),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 232/530 (44%), Positives = 339/530 (64%), Gaps = 32/530 (6%)
 Frame = -1

Query  1670  LSSILGIAALV-LLWFSWRKQSKRLPPEAG----GAWPIIGHLHHFRTSV---PLVKTLS  1515
             + + +G+     LL+F W K+S++LP        G WP+IGHL HF       PL + L 
Sbjct  5     IEAFVGLVTFTFLLYFLWTKKSQKLPKPLPPKIPGGWPVIGHLFHFNNDGDDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYGPVFT RLG+  +LVVS++E ++DCF+TND   + RP    G+YLGY+  +   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +    YWR  RKLV+ E+LS+ R+EK K V  + +Q +I   YT I         N ++ 
Sbjct  125   ANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTSIKNLYTRI---------NGNSS  175

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R K  F   M L  EFV  DA 
Sbjct  176   TINLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMVLSMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLS  813
             FP+  F+W+D++GH+K+MKR  KD+D++ Q+W++    +R   E      +Q FIDV+LS
Sbjct  232   FPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEHINKREKMEVGAEGNEQDFIDVVLS  291

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
              +  ++     YSRDTVIKA V S++ DA++T A H+ W + +L+ +  +L + Q+EIDT
Sbjct  292   KLSKEYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMTLLINNQNALMKAQEEIDT  350

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +GK+RW E+SD+K+L YLQ +VK+ LR+YP GP L PHE V+DC+V GYHIPKGT+L+ 
Sbjct  351   KVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHENVKDCVVSGYHIPKGTRLFA  410

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSCPGNLYATQIT  276
             NV +L RDPK+  +P+KF PERF+    G+   +   Y+F+PFG GRRSCPG  YA Q+ 
Sbjct  411   NVMKLQRDPKLLSNPDKFDPERFIA---GDIDFRGHHYEFIPFGSGRRSCPGMTYALQVE  467

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              + +A L QGFN+ T  +E LDM E  GI + K+ P+E+++TPRL+P L+
Sbjct  468   HLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKVNPVELIITPRLAPELY  517



>ref|XP_008372515.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=524

 Score =   468 bits (1204),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 241/529 (46%), Positives = 336/529 (64%), Gaps = 21/529 (4%)
 Frame = -1

Query  1679  PCCLSSILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1512
             P  L +I GI   VL  +  + QS +    L P+  GA PIIGHLH      PL +TL+ 
Sbjct  4     PSHLLAIAGILLFVLYLWRVKIQSHKTKGVLTPQPSGALPIIGHLHKLGGKNPLCRTLAS  63

Query  1511  WADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFS  1332
              ADKYGP+FTIRLG    LV+SN + V++CFT ND   AARP +  G+YLGY+YA F FS
Sbjct  64    MADKYGPIFTIRLGKHPALVISNHDAVKECFTKNDIVFAARPKSAHGRYLGYNYAGFGFS  123

Query  1331  TNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPK  1152
                +YWRN+RK+V+ ELLSSRR++ LKHV +SE+ + I   Y    +   K  N  S  K
Sbjct  124   PYGTYWRNMRKMVIAELLSSRRLQTLKHVQISEVDSFIKGLY---EICKTKGXNGQS--K  178

Query  1151  VNMSRWFGHLTLNLIMQIVAGRRY----EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSG  984
             V +S W  HLTL +I Q++AG+RY    +  +D     E +R++++  + M + G  V  
Sbjct  179   VVISEWIEHLTLXVITQMIAGKRYFDWGKVGNDSDNEGENKRIREIVKEFMLVSGMPVIS  238

Query  983   DAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR---RKERRSNEDQKFIDVMLS  813
             D I    +  W+D+ G VK+MKR  K++DA+   W++     RKE  S +   FIDVMLS
Sbjct  239   DMI---GYPDWIDFLGQVKNMKRIGKELDALTASWIEEHNNARKEIDSRDKLDFIDVMLS  295

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
             +I+D    G++  R+T+IKA   +++   S+T A  L WI+++LL +   LK  Q+EI+ 
Sbjct  296   VIEDNTVLGHT--RETIIKATSQNLIIAGSDTTAISLKWIISLLLNNRHVLKHAQEEINL  353

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +G ERW ED+D++NL  LQ +VKETLR+YP GP   PHEA+EDC V G+HI KGT+L+V
Sbjct  354   KVGTERWVEDTDIENLTXLQAIVKETLRLYPPGPLSVPHEAMEDCQVCGFHIXKGTRLFV  413

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             N+W+LHRDP +W DPE F P+RF+T      A    ++F+PFG GRRSCPG  +A Q+  
Sbjct  414   NLWKLHRDPTMWSDPEMFYPDRFLTTQASIDASGNHFEFIPFGSGRRSCPGLTFAMQVIH  473

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + + RL QGF  +T  + P+DM E +G+ LPK T LEV++TPRL   L+
Sbjct  474   LTLGRLIQGFELATPLDMPVDMTEGLGVTLPKATSLEVVLTPRLPIELY  522



>ref|XP_010104162.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXB99094.1| Cytochrome P450 82C4 [Morus notabilis]
Length=482

 Score =   466 bits (1199),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 226/493 (46%), Positives = 328/493 (67%), Gaps = 39/493 (8%)
 Frame = -1

Query  1520  LSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCA-----------  1374
             +++ ADKYGP+F  RLG++ +LV+SN+E V++CFTTND   A+RP+ CA           
Sbjct  1     MADIADKYGPIFLFRLGMNPVLVISNYEAVKECFTTNDITFASRPSFCAKPSTIRAGAPC  60

Query  1373  ----------------GKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVW  1242
                             G +LGYD+A F F+    YWR +RKLV++ELLS+RR+E L+HV 
Sbjct  61    GPVQPTPAFMRSWSTHGTHLGYDFAAFGFAPYGPYWRTMRKLVMIELLSNRRLETLRHVQ  120

Query  1241  VSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDG  1062
             VSE++  +N  Y        KN   P+  +V +S W  H TLN+I +++AG+RY   S  
Sbjct  121   VSEVETLVNGLYGQC----KKNGFGPT--EVVISEWIEHFTLNIITEMIAGKRYFDSSGK  174

Query  1061  VVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQD  882
             VV  EA+R+ KV  + M + G F+  D I P+   +W+D+ G++K+MKR  +++D ++Q 
Sbjct  175   VVGGEAERIGKVIKEYMCISGAFIVSDLI-PVP--KWVDFNGNLKAMKRIGREIDVLIQS  231

Query  881   WVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHL  702
             WV+  ++   S++ Q FID+MLS+I++    GY+  RDT+IK  V +++   S+T A +L
Sbjct  232   WVEEHKRSEASDK-QDFIDIMLSLIEENHELGYA--RDTIIKGTVSTLIIAGSDTTAINL  288

Query  701   TWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLA  522
             TWILA+LL +  +L R Q+E+D  +GKERW E SD+KNL YLQ +VKETLR+YP GP   
Sbjct  289   TWILALLLNNRRALNRAQEELDLIVGKERWVEGSDIKNLVYLQAIVKETLRLYPPGPLAV  348

Query  521   PHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQY  342
             PH+A EDC V G+H+ KGT+L+VN+W+LHRDP  WPDPE F PERF+T+  G     + +
Sbjct  349   PHQAREDCTVCGFHVRKGTRLFVNLWKLHRDPNTWPDPEAFSPERFLTSHAGIDVLGQHF  408

Query  341   QFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLE  162
             + +PFG GRRSCPG  +A Q+T +A+ARL QGF F+T  +EP+DM E +GI LP+ TP+E
Sbjct  409   ELIPFGSGRRSCPGMAFALQVTHLALARLLQGFVFATKLDEPVDMSEGLGITLPRATPVE  468

Query  161   VLVTPRLSPTLFR  123
              ++TPRL   L++
Sbjct  469   AVLTPRLPAELYQ  481



>ref|XP_006434890.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
 gb|ESR48130.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
Length=521

 Score =   467 bits (1202),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 225/493 (46%), Positives = 324/493 (66%), Gaps = 15/493 (3%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCF  1419
             PE  GAWPIIGHLH       L+ +TL   ADK+GP F IRLG     VVS+WE V++CF
Sbjct  33    PEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECF  92

Query  1418  TTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWV  1239
             T NDK +A+RP T A K++GYDYAVF F+    +WR +RK+  +ELLS+RR+E LKHV +
Sbjct  93    TINDKALASRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKIATLELLSNRRLEALKHVRI  152

Query  1238  SELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGV  1059
             SE+   + + Y   A    KN++ P    V + +W   +TLN+++++VAG+RY   S   
Sbjct  153   SEVDMGLRDLYGLWA----KNDSRPVL--VELKKWLEDMTLNMVVRMVAGKRYFGASATC  206

Query  1058  VSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDW  879
                EA++ +K  +Q  +L G F   DA   L FF WLD++GH  +MK+ AK++DAIL+ W
Sbjct  207   DDSEARQCQKAINQFFHLIGIFTVSDA---LPFFWWLDWQGHEMAMKKTAKELDAILEGW  263

Query  878   VDARRKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
             ++  R+ R      S  +Q FIDVMLS+ ++     + +S D  IK+  L+++   S+T 
Sbjct  264   LEEHRQRRVSGGIESESEQDFIDVMLSLQEEGHLSQFQHSADISIKSTCLALILGGSDTT  323

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
             +  LTW +++LL +P  LK+ Q+E+D  IG +R  +DSD+KNL YLQ ++KETLR+YP G
Sbjct  324   SGTLTWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAG  383

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P L P EA+EDC V GYHIP GT+L VNVW++ RDP++W +P  F PERF+T+      +
Sbjct  384   PLLGPREAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHTDVDFR  443

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
              +Q++ +PFG GRRSCPG  +A Q+  + +ARL   F  +T  ++P+DM E  G+ +PK 
Sbjct  444   GQQFELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKA  503

Query  173   TPLEVLVTPRLSP  135
             TPLEV+++PRL P
Sbjct  504   TPLEVVLSPRLPP  516



>ref|XP_011045174.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Populus 
euphratica]
Length=531

 Score =   467 bits (1202),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 228/531 (43%), Positives = 345/531 (65%), Gaps = 30/531 (6%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFSWRK--QSKR------LPPEAGGAWPIIGHLHHFRTSVPLVKTLS  1515
             L +I  + ALVL W++ R+  +S+R        PE  GA P+IGHLH       L +TL+
Sbjct  11    LLAISTVLALVL-WYTLRRVRESRRKTEKGLQAPEPSGALPLIGHLHLLGAQKTLARTLA  69

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
               ADKYGP+FTIRLG    +VVSN E +++CFTT+D+ +++RP +  G+YL Y+YA F F
Sbjct  70    AIADKYGPIFTIRLGKHPTVVVSNLEAIKECFTTHDRILSSRPRSSHGEYLSYNYAAFGF  129

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             + +  +WR +RK+V ++LLSS R++ L+HV VSE+   IN+ Y          +N   + 
Sbjct  130   TNSGPFWREMRKIVTIQLLSSHRLKSLRHVQVSEVNTLINDLYLL------SKSNKQGST  183

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
             K+ +S  F  +T+N+I +++AG+RY + S     EE +R+ K+  + MY+ G FV  D I
Sbjct  184   KIVISECFERMTINMITRMIAGKRY-FSSTEAEKEEGKRIGKLMKEFMYISGVFVPSDLI  242

Query  974   FPLWFFRWLD-YEGHVKSMKRAAKDVDAILQDWVDARRKERRSN-------EDQKFIDVM  819
              P  F  W++ + G VK+MKR ++++D++++ W+   + +R  +       +D  FIDVM
Sbjct  243   -P--FLGWINNFLGSVKTMKRLSRELDSLMESWIQEHKLKRLESTENTNKMDDDDFIDVM  299

Query  818   LSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEI  639
             LS++DD  +    YSR+T+IKA  ++++   ++T +  LTWIL+ LL +  SL+  Q+E+
Sbjct  300   LSLLDDSMS---GYSRETIIKATAMTLIIAGADTTSITLTWILSNLLNNRRSLQLAQEEL  356

Query  638   DTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQL  459
             D  +G+ERWAEDSD+ NL Y+Q ++KETLR+YP GP   PHEA ED  V GYH+PKGT+L
Sbjct  357   DLKVGRERWAEDSDIGNLVYIQAIIKETLRLYPPGPLSVPHEATEDFCVAGYHMPKGTRL  416

Query  458   YVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQI  279
             + N+W+LHRDP +W +P++++PERF+ +          ++ +PFG GRRSCPG  +A Q+
Sbjct  417   FTNLWKLHRDPNLWSNPDEYMPERFLNDHANLDVLGHHFELIPFGSGRRSCPGITFALQV  476

Query  278   TQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
               +  ARL QGF+  T   E +DM E V I LPK TPLE+ +TPRLSP L+
Sbjct  477   LHLTFARLLQGFDMKTPRGESVDMTEGVAITLPKATPLEIHITPRLSPELY  527



>ref|XP_002531094.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31308.1| cytochrome P450, putative [Ricinus communis]
Length=525

 Score =   466 bits (1200),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 222/514 (43%), Positives = 334/514 (65%), Gaps = 30/514 (6%)
 Frame = -1

Query  1622  WRKQSKR----------LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRL  1473
             WR + KR          L PE  GA PIIGHLH       L +TL   AD YGP+FTI L
Sbjct  25    WRVRVKRQNYESNKSLLLAPEPSGALPIIGHLHLLGKENTLARTLGRLADNYGPIFTIWL  84

Query  1472  GISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLV  1293
             G+ R +VVS++E +++CF++ND+ +A+RP +  G+YL Y+YA F F++   YW ++RKLV
Sbjct  85    GVHRTVVVSSYEAIKECFSSNDRILASRPRSSHGQYLSYNYAAFGFASYGPYWSHMRKLV  144

Query  1292  VVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLN  1113
              ++LLSS R++ LKHV +SE+   I E Y       +K  +N     +N+S  F HLTLN
Sbjct  145   AIQLLSSHRIKLLKHVQISEVNTLIKELY-------EKQGSNKKI--INISECFEHLTLN  195

Query  1112  LIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGH  933
             +I +++AG+RY   +D    +E +R+ K+  + MY+ G FV  D I P  F  W+++ G 
Sbjct  196   MITRMIAGKRYFSSADSDSEQEGKRIGKIMKEFMYISGVFVPSDLI-P--FLGWMNFAGP  252

Query  932   VKSMKRAAKDVDAILQDWVDARRKERRSNEDQK-----FIDVMLSMIDDQFTQGYSYSRD  768
             VK+MKR ++++D++ + W+D  + +R  +E+ K     FIDVMLS+++D F   + +S++
Sbjct  253   VKTMKRLSRELDSLTETWIDEHKLKRVKSEESKNMEEDFIDVMLSLLEDDF---FGHSKE  309

Query  767   TVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKN  588
              +IK  V +++   ++T +  LTWIL+ LL +  +L+  Q E+D  +G+ R  +DSD+ N
Sbjct  310   DIIKGTVTNLIIAGADTTSITLTWILSNLLNNRRTLELAQQELDLKVGRNRCVQDSDIDN  369

Query  587   LPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDP  408
             L YL  +VKETLR+YP GP   PHEA EDC + GYHIPKGT+++ N+W+LHRDP +W  P
Sbjct  370   LVYLNAIVKETLRLYPPGPLAVPHEASEDCSIAGYHIPKGTRVFANLWKLHRDPNVWSSP  429

Query  407   EKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTV  228
              +F+PERF+T+        + ++++PFG GRRSCPG  +A Q   + +A+L Q F+F+T 
Sbjct  430   NEFVPERFLTSQANMDVSGQNFEYIPFGSGRRSCPGLNFAIQAIHLTLAKLLQAFSFTTP  489

Query  227   PNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              N P+DM E +GI LPK TPLE+ + PRLSP L+
Sbjct  490   LNVPVDMTEGLGITLPKATPLEIHIIPRLSPELY  523



>ref|XP_010264712.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   466 bits (1198),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 230/502 (46%), Positives = 325/502 (65%), Gaps = 13/502 (3%)
 Frame = -1

Query  1613  QSKRLPPEAGGAWPIIGHLHHFRT-SVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWE  1437
             + +++ PEA GAWP+IGHL       +P + TL   ADKYGP FTIRLG+ R LVVS+WE
Sbjct  35    KKRKMAPEAAGAWPVIGHLPLLGGPELPHI-TLGAMADKYGPAFTIRLGVRRALVVSDWE  93

Query  1436  GVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEK  1257
               ++CFT ND+ +A RP+  A K++GY+YA+F F+    YWR VRK+  +ELLS+RR+E 
Sbjct  94    VAKECFTINDRALATRPSGVAMKHMGYNYAMFAFAPYGPYWREVRKIATLELLSNRRLEM  153

Query  1256  LKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             LKHV VSE+  ++ E Y       +KN     + KV M RWFG LTLN ++++VAG+RY 
Sbjct  154   LKHVRVSEVNMSVRELYGLWL--KNKNATGADSVKVEMKRWFGDLTLNNVLRMVAGKRYF  211

Query  1076  YRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVD  897
               +    S EA R + V      L G+FV  DAI    F  WLD +GH K+MKR AK++D
Sbjct  212   GATAACGSAEAVRCQTVMRSFFRLVGQFVIADAI---PFLGWLDMQGHEKAMKRTAKELD  268

Query  896   AILQDWVDARRKERRSNED----QKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD  729
             +IL+ W++  RK R SN++    Q F+DVMLS++ D    GY    DT+ KA  ++++  
Sbjct  269   SILEGWMEEHRKMRLSNDEANGEQDFMDVMLSILKDSKLSGYDA--DTINKATCMNLILG  326

Query  728   ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR  549
              ++T    LTW L++L+ + E LKRVQDE+D ++GK+R  E+SD+K L YLQ VVKE LR
Sbjct  327   GNDTIKVCLTWALSLLVNNQEVLKRVQDELDRHVGKDRNVEESDMKKLEYLQAVVKEALR  386

Query  548   MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE  369
             +YP  P   PHEA+E+C V GYH+P GT++ VN+ ++ RDP++W DP +F PERF+T+  
Sbjct  387   LYPPAPLSGPHEAMEECTVAGYHVPVGTRILVNLSKIQRDPRVWSDPLEFRPERFLTSHV  446

Query  368   GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI  189
             G     + ++ +PFG GRR+CPG     ++  +A+ARL   F+  T    P+DM E  G+
Sbjct  447   GVDVLGQHFELIPFGSGRRACPGTSLGLKVVHLALARLLHAFHLHTPSGAPVDMTESFGL  506

Query  188   ILPKLTPLEVLVTPRLSPTLFR  123
                K TPLEVL+ PRL   L++
Sbjct  507   TNLKATPLEVLLLPRLPSHLYQ  528



>ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
 emb|CBI19595.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   465 bits (1197),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 235/504 (47%), Positives = 330/504 (65%), Gaps = 16/504 (3%)
 Frame = -1

Query  1616  KQSK-RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSN  1443
             K SK R  PE GGAWPIIGHLH       L+ +TL   ADKYGP F IRLG  R  VVS+
Sbjct  31    KSSKSRDAPEPGGAWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSS  90

Query  1442  WEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRM  1263
             WE  ++CFT NDK +A RPTT A K++GY+YAVF F+  + +WR +RK+  +ELLS+RR+
Sbjct  91    WEVAKECFTINDKALATRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRL  150

Query  1262  EKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRR  1083
             E LKHV  SE+   I E Y        KN++ P    V ++RW   +TLN+I+++VAG+R
Sbjct  151   EILKHVRTSEVDMGIRELYGLWV----KNSSRPLL--VELNRWLEDMTLNVIVRMVAGKR  204

Query  1082  YEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKD  903
             Y   +    S EA+R +K  SQ   L G FV  DA+  LW   WLD +GH ++MK  AK+
Sbjct  205   YFGAAAASDSSEARRCQKAISQFFRLIGIFVVSDALPFLW---WLDLQGHERAMKTTAKE  261

Query  902   VDAILQDWVDARRKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSM  738
             +D+IL+ W++  R+ R     ++  +Q FIDVMLS+ ++    G+ Y  +T IK+  L++
Sbjct  262   LDSILEGWLEEHRQRRVSSLIKAEGEQDFIDVMLSLQEEGRLSGFQYDSETSIKSTCLAL  321

Query  737   LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE  558
             +   S+T A  LTW +++LL +  +LK+ Q+E+D  +G ER  E+SDVKNL YLQ ++KE
Sbjct  322   ILGGSDTTAGTLTWAISLLLNNRHALKKAQEELDLCVGMERQVEESDVKNLVYLQAIIKE  381

Query  557   TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT  378
             TLR+YP GP L P EA++DC V GY++P GT+L VN+W+L RDP +W +P  F PERF+ 
Sbjct  382   TLRLYPAGPLLGPREALDDCTVAGYNVPAGTRLIVNIWKLQRDPSVWTNPCAFQPERFLN  441

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
                    + +Q++ +PFG GRRSCPG  +A Q+  + +ARL   F  ST  ++P+DM E 
Sbjct  442   AHADVDVKGQQFELMPFGSGRRSCPGVSFALQVLHLTLARLLHAFELSTPVDQPVDMTES  501

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              G+ +PK TPLEVL+TPRL+  L+
Sbjct  502   SGLTIPKATPLEVLLTPRLNSKLY  525



>ref|XP_007017403.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
 gb|EOY14628.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
Length=527

 Score =   465 bits (1197),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 221/501 (44%), Positives = 325/501 (65%), Gaps = 15/501 (3%)
 Frame = -1

Query  1604  RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             R  P+  GAWPI+GHLH    S  L+ +TL   AD+YGP FTIRLG     VVS+WE  +
Sbjct  36    RTAPQPKGAWPILGHLHLLGGSDQLLYRTLGAMADEYGPAFTIRLGSRCAFVVSSWELAK  95

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +CFT NDK +A+RPTT A K++GY+YAVF F+  + +WR +RK+  +ELLS+RR+E LKH
Sbjct  96    ECFTINDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEMLKH  155

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
             V +SE+   I E Y+       +++N      V + +W   LTLN+++++VAG+RY   S
Sbjct  156   VRISEVDMGIRELYSL------RHDNGSIPVLVELKQWLEDLTLNVVVRMVAGKRYFGAS  209

Query  1067  DGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAIL  888
                V  EA+R +K   +   L G FV  DA+  LW   WLD  GH K+MK  AK++D +L
Sbjct  210   AVCVDGEARRCQKAIKEFFRLIGMFVVSDALPLLW---WLDVHGHEKAMKMTAKELDDLL  266

Query  887   QDWVDARRKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
             + W+   R+ R     ++  +Q FIDVMLS+ ++     + Y  D  IK+  L+++   +
Sbjct  267   EAWLKEHRQRRISGGIKAEGEQDFIDVMLSLQEEGHLANFQYDADISIKSTCLALILGGT  326

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             +T A  LTW +++LL +PE LK+ Q+E+D  +G+ER  ++SD++NL YLQ ++KETLR+Y
Sbjct  327   DTTAGTLTWAISLLLNNPELLKKAQEELDLQVGRERLVDESDIQNLVYLQAIIKETLRLY  386

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P GP L P EA+ DC V GYH+P GT+L VNVW++ RDP++W +P  F+PERF+T+    
Sbjct  387   PAGPLLGPREAMNDCTVAGYHVPAGTRLIVNVWKIQRDPRVWSNPSAFVPERFLTSHANV  446

Query  362   AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
               + +Q++ +PFG GRRSCPG  +A Q+  + +AR    F  ST  ++P+DM E  G+ +
Sbjct  447   DVRGQQFELIPFGSGRRSCPGASFALQLLHLTLARFLHAFELSTPLDQPVDMTESPGLTI  506

Query  182   PKLTPLEVLVTPRLSPTLFRL  120
             PK TPLEVL+ PR+   ++ L
Sbjct  507   PKATPLEVLLKPRVPANVYAL  527



>ref|XP_004292356.1| PREDICTED: cytochrome P450 82C4-like [Fragaria vesca subsp. vesca]
Length=492

 Score =   464 bits (1193),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 227/496 (46%), Positives = 325/496 (66%), Gaps = 14/496 (3%)
 Frame = -1

Query  1601  LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDC  1422
             + PE  GA PI+GHLH      PL +TL+  ADKYGP+FTI LG +R LV+SN+E  ++C
Sbjct  5     MSPEPYGALPILGHLHQLGGRNPLFQTLANMADKYGPIFTIWLGKNRALVISNYEAAKEC  64

Query  1421  FTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVW  1242
             FTTND+  A RP++  GKYLGY+YA F  S    YWR+ RKLVV+ELLSSRR+E LKHV 
Sbjct  65    FTTNDRVFATRPSSAQGKYLGYNYAAFGVSPYGKYWRDTRKLVVMELLSSRRLETLKHVQ  124

Query  1241  VSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDG  1062
             +SE+ A +   Y+      +K ++ PS  KV +S    HLT N++ +I+AG+RY      
Sbjct  125   ISEVDAFVIGLYSVW---KNKGHDGPS--KVVISTGIEHLTCNVMTKIIAGKRYFGVKSD  179

Query  1061  VVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQD  882
                 E ++++K+  + MY     V+    + +    W+D++GH+++MK     +D+++  
Sbjct  180   EFDGEVKKIRKLMKEFMY---AAVNRVVSYVVGIPEWIDFKGHLRTMKNVGGQLDSLMTS  236

Query  881   WVD----ARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
             WV+     +RK   SNE+Q FIDV+LS I+D    G++  RDT+IK+  L ++   SET 
Sbjct  237   WVEEHNTKKRKNDSSNEEQDFIDVLLSEIEDGSMLGHT--RDTIIKSTALILVLAGSETT  294

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
             +  LTW+L++LL +  +LK  Q+E+D  +G+ RW ED+D+KNL YLQ + KETLR+YP G
Sbjct  295   SVSLTWMLSLLLNNRRTLKLAQEELDRIVGRHRWVEDTDIKNLVYLQAIAKETLRLYPPG  354

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P   PHEA+EDC V G+H+PKGT LYVN+W+LHRDP +WPDPE F PERF+T      A 
Sbjct  355   PLSVPHEAMEDCKVGGFHVPKGTHLYVNLWKLHRDPNVWPDPEVFSPERFLTTQASVDAF  414

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
              + ++F+PFG GRR CPG   A Q+  + VARL QGF  +T  ++ +DM E  G+ + + 
Sbjct  415   GQHFEFIPFGAGRRICPGITLAFQLMHLTVARLIQGFELATPLDKAVDMTEGSGLSMARA  474

Query  173   TPLEVLVTPRLSPTLF  126
             T LEV++T RL+  L+
Sbjct  475   TALEVVLTARLAYELY  490



>ref|XP_010069626.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=542

 Score =   465 bits (1197),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 226/512 (44%), Positives = 333/512 (65%), Gaps = 18/512 (4%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNW  1440
             + +   LPPE  GAWPIIGH+H      PL +TL+  ADK GP+F IRLG+    ++S+ 
Sbjct  29    KPKGTALPPELPGAWPIIGHIHLLGGETPLARTLAAMADKQGPMFRIRLGVHPATIISSR  88

Query  1439  EGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRME  1260
             E VR+CFTT+DK +A+RP + AG +LGY YA F F     +WR +RK+ ++ELLS+RR++
Sbjct  89    EAVRECFTTHDKDLASRPKSKAGIHLGYGYAGFGFVEYGDFWREMRKITMLELLSTRRLD  148

Query  1259  KLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY  1080
              LKHV  SE+   + + +  +   N  +  N S+  V +S+    LTLN+I++++A +RY
Sbjct  149   NLKHVQASEIDTFVKDLHA-LCRTNSIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRY  207

Query  1079  EYRSDGVVS------EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMK  918
                S           EEA  L++V  + MY+ G F +   + P  F  W D  G VK+MK
Sbjct  208   FGLSSASTGSSADDDEEASHLRRVIKEFMYISG-FPAVSDLVP--FTGWTDCVGTVKTMK  264

Query  917   RAAKDVDAILQDWVDARRKERRSNE--------DQKFIDVMLSMIDDQFTQGYSYSRDTV  762
             R A+++D I+  WV+  + +R  ++         + FIDVMLS+I +     + +S +T+
Sbjct  265   RVARELDEIVGKWVEEHKLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETL  324

Query  761   IKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLP  582
             IKA +++++   S++ + +LTW+L++LL H   LKR Q+EID  +GK+RW +DSD++NL 
Sbjct  325   IKATIVNIIVAGSDSTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDRWVQDSDIENLL  384

Query  581   YLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEK  402
             YLQ +VKETLR+YP GP L PHEA  DC V GY IPKGT+++VN W+LHRDP++W +PEK
Sbjct  385   YLQAIVKETLRLYPPGPLLVPHEARADCNVRGYLIPKGTRIFVNAWKLHRDPQVWSEPEK  444

Query  401   FLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN  222
             FLPERF+TN  G  A  + ++F+PFG GRR CPG  +A + T + +ARL QGF+ +T  +
Sbjct  445   FLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLATSLD  504

Query  221   EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             E +DM E +G+ LPK TPL V++ PRL   L+
Sbjct  505   ELVDMTEGLGVNLPKATPLRVVLNPRLPSVLY  536



>ref|XP_008378409.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=529

 Score =   464 bits (1193),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 231/533 (43%), Positives = 333/533 (62%), Gaps = 29/533 (5%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFSWRKQS-----KRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEW  1509
             L+ I    +L+ L  S+ K+       R  PE  G WPIIGHLH       L+ +TL   
Sbjct  7     LTVISLFVSLIFLIRSFLKKKVQDSKSREAPEPAGGWPIIGHLHLLGGGDQLLYRTLGAM  66

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             ADKYGP F IRLG  R  VVS+WE  +DCFT ND+ +A+RPTT A K++GY+YAVF F+ 
Sbjct  67    ADKYGPAFNIRLGSRRAFVVSSWEVAKDCFTVNDRALASRPTTVAAKHMGYNYAVFGFAP  126

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
              + +WR +RK+  +ELLS+RR++ L+HV  SEL   I E Y+         N       V
Sbjct  127   YSPFWREMRKIATLELLSNRRLDMLRHVRTSELDMGIKELYSLWV-----QNGGLRPAVV  181

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRS----DGVVSEEAQRLKKVFSQVMYLWGEFVSGD  981
              ++ W   LTLN+++++VAG+RY   S    DG   +EA+R +K   Q  +L G FV  D
Sbjct  182   ELNHWLEELTLNVVVRMVAGKRYFGASAKCEDG---DEARRCQKAIGQFFHLIGIFVVAD  238

Query  980   AIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE--------DQKFID  825
             A+  LW   WLD +GH K+MK+ AK++D IL  W++  R+ R ++         D+ FID
Sbjct  239   ALPFLW---WLDLQGHEKAMKKTAKELDGILGGWLEEHRQRRGASHGEAEDEGGDEDFID  295

Query  824   VMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQD  645
             VMLS+ ++     + YS DT IK+  L+++   S+T A  LTW +++LL +P+++K  Q+
Sbjct  296   VMLSLEEEGQLSNFQYSSDTSIKSTCLALILGGSDTTAGTLTWAISLLLNNPDAMKMAQE  355

Query  644   EIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGT  465
             E+D ++G ER  E+SD+ NL YLQ ++KETLR+YP GP L P EA+EDC V GY +P GT
Sbjct  356   ELDLHVGTERQVEESDITNLVYLQAIIKETLRLYPAGPLLGPREALEDCTVAGYRVPAGT  415

Query  464   QLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYAT  285
             +L VNVW++ RDP++W +P  F+PERF+ +      + +Q+  +PFG GRRSCPG  +A 
Sbjct  416   RLVVNVWKIQRDPRVWENPSAFVPERFLESHSHVDVRGQQFNLMPFGFGRRSCPGVSFAM  475

Query  284   QITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             Q+  + +ARL  GF   T   + +D+ E  G+ +PK TPLEVL++PRL   L+
Sbjct  476   QVLHLTLARLLHGFKIETASGQSVDLTESPGLTIPKATPLEVLLSPRLPSELY  528



>ref|XP_009364162.1| PREDICTED: cytochrome P450 82C4-like [Pyrus x bretschneideri]
Length=529

 Score =   463 bits (1192),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 224/506 (44%), Positives = 319/506 (63%), Gaps = 24/506 (5%)
 Frame = -1

Query  1604  RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             R  PE  G WPIIGHLH       L+ +TL   ADKYGP F IRLG  R  VVS+WE  +
Sbjct  34    REAPEPAGGWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSSWEVAK  93

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             DCFT ND+ +A+RPTT A K++GY+YAVF F+  + +WR +RK+  +ELLS+RR++ LKH
Sbjct  94    DCFTVNDRALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLDMLKH  153

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
             V  SEL   I E Y          N       V ++ W   LTLN+++++VAG+RY   S
Sbjct  154   VRTSELDMGIKELYNL-----GVQNGGLRPAVVELNHWLEELTLNVVVRMVAGKRYFGAS  208

Query  1067  ----DGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDV  900
                 DG   +EA+R +K   Q  +L G FV  DA+  LW   WLD +GH K+MK+ AK++
Sbjct  209   AKCEDG---DEARRCQKAIGQFFHLIGIFVVADALPFLW---WLDLQGHEKAMKKTAKEL  262

Query  899   DAILQDWVDARRKERRSNE--------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVL  744
             D IL  W++  R+ R ++         D+ FIDVMLS+ ++     + YS DT IK+  L
Sbjct  263   DGILGGWLEEHRQRRGASHGKAEDEGGDEDFIDVMLSLEEEGQLSNFQYSSDTSIKSTCL  322

Query  743   SMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVV  564
             +++   S+T A  LTW +++L+ +P ++K+ Q+E+D ++G ER  E+SD+ NL YLQ ++
Sbjct  323   ALILGGSDTTAGTLTWAISLLINNPHAMKKAQEELDLHVGTERQVEESDITNLVYLQAII  382

Query  563   KETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERF  384
             KETLR+YP GP L P EA+EDC V GY +P GT+L VNVW++ RDP++W  P  F+PERF
Sbjct  383   KETLRLYPAGPLLGPREALEDCTVAGYRVPAGTRLVVNVWKIQRDPRVWESPSAFVPERF  442

Query  383   MTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMM  204
             + +      + +Q+  +PFG GRRSCPG  +A Q+  + +ARL  GF   T   + +D+ 
Sbjct  443   LESHSHVDVRGQQFNLMPFGFGRRSCPGVSFAMQVLHLTLARLLHGFKIETASGQAIDLT  502

Query  203   EDVGIILPKLTPLEVLVTPRLSPTLF  126
             E  G+ +PK TPLE L++PRL   L+
Sbjct  503   ESPGLTIPKATPLEALLSPRLPSELY  528



>ref|XP_006443550.1| hypothetical protein CICLE_v10019727mg [Citrus clementina]
 ref|XP_006479221.1| PREDICTED: cytochrome P450 82G1-like isoform X1 [Citrus sinensis]
 ref|XP_006479222.1| PREDICTED: cytochrome P450 82G1-like isoform X2 [Citrus sinensis]
 gb|ESR56790.1| hypothetical protein CICLE_v10019727mg [Citrus clementina]
Length=520

 Score =   463 bits (1191),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 222/491 (45%), Positives = 324/491 (66%), Gaps = 11/491 (2%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             PE  GAWP+IGHL       P+ K L   ADKYGP++++RLG    L+VS+WE V+DCFT
Sbjct  39    PEPFGAWPLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFT  98

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
             TND+ +A RP+  AGKYLGYD AVF  +    YWR++RK+   +LLSS R+E LKHV  S
Sbjct  99    TNDRVLATRPSIAAGKYLGYDNAVFALAPYGRYWRDIRKIATTDLLSSHRLELLKHVRYS  158

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E+   I + Y+  +    +N  NP+  KV +S+    LT N+ ++++AG+R+  R  G  
Sbjct  159   EVDTFIKDLYSRCS----ENAFNPA--KVVISKLIEQLTFNISLRLIAGKRFSAREFGEQ  212

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV  876
               E  R+ +   +  YL G FV GDAI P  +  W+D++GH+ SM+R AK +D ++ +W+
Sbjct  213   GSEGWRINRAIKEATYLTGVFVLGDAI-P--WLEWIDFQGHIGSMRRTAKKIDDVIGNWL  269

Query  875   DARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTW  696
             +    +R+   +  F+DV+LS I+D  T    ++RDTVIKA  L ++   SE+    + W
Sbjct  270   E-EHAQRKLQGEGDFMDVLLSKIEDN-TVMSGHTRDTVIKATALILIFTGSESTYLGIIW  327

Query  695   ILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPH  516
              L++LL HP+ LK+ Q+E+D ++G++RW  +SD+KNL YL+ +VKETLR+YP GP     
Sbjct  328   TLSLLLNHPKELKKAQEELDVHVGRDRWVNESDMKNLKYLRAIVKETLRIYPPGPVTGIR  387

Query  515   EAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQF  336
             EA+EDC + GYH+PKGT+L VNVW+LHRDP++W +P +F PERF+T         + +++
Sbjct  388   EAMEDCEIGGYHVPKGTRLIVNVWKLHRDPRMWENPCEFRPERFLTTHADVDVNTQHFEY  447

Query  335   VPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVL  156
             +PF  GRRSCPG     QI Q+ +AR+ QGF+ +TV   P+DM E +GI LPKL P+EV+
Sbjct  448   IPFSFGRRSCPGMTSGLQIVQLTLARILQGFDLATVGGIPVDMKEGLGIALPKLNPVEVV  507

Query  155   VTPRLSPTLFR  123
             + PRLS  L++
Sbjct  508   IKPRLSDDLYQ  518



>gb|ABD39484.1| CYP82E2v3 [Nicotiana tabacum]
Length=517

 Score =   462 bits (1190),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 231/530 (44%), Positives = 337/530 (64%), Gaps = 32/530 (6%)
 Frame = -1

Query  1670  LSSILGIAALV-LLWFSWRKQSKRLPPEAG----GAWPIIGHLHHFRTSV---PLVKTLS  1515
             + + +G+     LL+F W K+S++LP        G WP+IGHL HF       PL + L 
Sbjct  5     IEAFVGLVTFTFLLYFLWTKKSQKLPKPLPPKIPGGWPVIGHLFHFNNDGDDRPLARKLG  64

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             + ADKYGPVFT RLG+  +LVVS++E  +DCF+TND   + RP    G+YLGY+  +   
Sbjct  65    DLADKYGPVFTFRLGLPLVLVVSSYEATKDCFSTNDAIFSNRPAFLYGEYLGYNNTMLFL  124

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +    YWR  RKLV+ E+LS+ R+EK K V  + +Q +I   YT I         N ++ 
Sbjct  125   ANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTSIKNLYTRI---------NGNSS  175

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              +N++ W   L   LI++++AG+ YE    G   E+ +R K  F   M L  EFV  DA 
Sbjct  176   TINLTDWLEELNFGLIVKMIAGKNYE---SGKGDEQVERFKNAFKDFMVLSMEFVLWDA-  231

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKFIDVMLS  813
             FP+  F+W+D++GH+K+MKR  KD+D++ Q+W++    +R   E      +Q FIDV+LS
Sbjct  232   FPIPLFKWVDFQGHIKTMKRTFKDIDSVFQNWLEEHINKREKMEVGAEGNEQDFIDVVLS  291

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
              +  ++     YSRDTVIKA V S++ DA++T A H+ W + +L+ +  +L + Q+EIDT
Sbjct  292   KLSKEYLDE-GYSRDTVIKATVFSLVLDAADTVALHINWGMTLLINNQNALMKAQEEIDT  350

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +GK+RW E+SD+K+L YLQ +VK+ LR+YP GP L PHE V+DC+V GYHIPKGT+L+ 
Sbjct  351   KVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPGPLLVPHENVKDCVVSGYHIPKGTRLFA  410

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA-QNRQYQFVPFGLGRRSCPGNLYATQIT  276
             NV +L RDPK+  +P+KF PERF+    G+   +   Y+F+P G GRRSCPG  YA Q+ 
Sbjct  411   NVMKLQRDPKLLSNPDKFDPERFIA---GDIDFRGHHYEFIPSGSGRRSCPGMTYALQVE  467

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              + +A L QGFN+ T  +E LDM E  GI + K+ P+E+++TPRL+P L+
Sbjct  468   HLTMAHLIQGFNYKTPNDEVLDMKEGAGITIRKVNPVELIITPRLAPELY  517



>ref|XP_011040244.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=544

 Score =   461 bits (1187),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 232/528 (44%), Positives = 335/528 (63%), Gaps = 29/528 (5%)
 Frame = -1

Query  1667  SSILGIAALVL-----LWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD  1503
             S  LG+  L +     L  S ++    LPPE  GAWP+IGHL    + +PL +TL + AD
Sbjct  32    SFFLGLVLLCMIIWRILSTSHKRNKTLLPPEPSGAWPLIGHLRILNSQIPLFRTLGDLAD  91

Query  1502  KYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNN  1323
             K+GPVF+IRLG+ R LV+S+WE V++CF TND+    RP+  A KY+GYD A F F    
Sbjct  92    KHGPVFSIRLGMRRTLVISSWESVKECFKTNDRKFLNRPSVAASKYMGYDDAFFGFHPYG  151

Query  1322  SYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNM  1143
              YW  +RK+   ELLS+ R+E LKHV VSE++  I E +TT +        N S   ++M
Sbjct  152   EYWLEMRKIATQELLSNSRLELLKHVRVSEIETCIKELHTTCS--------NGSV-LLDM  202

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             S+WF  +  N++ +++AG+RY     G   +++    ++  +  YL G  V+ D I P  
Sbjct  203   SQWFSCIVANVMFRLIAGKRY----CGGTGKDSGACGRLIKEFFYLSGVLVTSDLI-P--  255

Query  962   FFRWLDYEGHVKSMKRAAKDVDAILQ-DWVDARRKERRSN----EDQKFIDVMLSMIDDQ  798
             F  W+D++GH+KSMKR AK++D ++   W+    + R       E++ F+DVML  +D  
Sbjct  256   FTEWMDFQGHLKSMKRVAKELDDVVSGQWLVEHLQRREEGLVRKEEKDFMDVMLESLDSL  315

Query  797   FTQG---YSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
                    + Y R+T++KA  L++L    +T +  LTW L++LL H E LKR Q EID ++
Sbjct  316   AIGEEPIFVYKRETIVKATALNLLLAGIDTTSITLTWALSLLLNHTEVLKRAQKEIDIHV  375

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             G  RW E+SD+KNL YLQ +VKETLR+YP GP L P E++EDC VDGY +P+GTQL VN 
Sbjct  376   GTTRWVEESDIKNLVYLQAIVKETLRLYPPGPLLVPRESLEDCYVDGYLVPRGTQLLVNA  435

Query  446   WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             W+LHRD +IW +P +F PERF+T+      + +Q+++VPFG GRRSCPG   + Q+  + 
Sbjct  436   WKLHRDARIWENPYEFHPERFLTSHGSTDVRGQQFEYVPFGSGRRSCPGISSSLQMLHLT  495

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             ++RL QGFNFST  N  +DM E +G+ +PK TPLEV++TPRL   +++
Sbjct  496   LSRLLQGFNFSTPMNAQVDMSEGLGLTMPKATPLEVVLTPRLENEIYQ  543



>emb|CAN75482.1| hypothetical protein VITISV_020998 [Vitis vinifera]
Length=500

 Score =   460 bits (1183),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 237/529 (45%), Positives = 332/529 (63%), Gaps = 42/529 (8%)
 Frame = -1

Query  1682  VPCCLSSILGIAALVLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKT  1521
              P  L +I GI  LVLL+  WR      K   +  PE  GAWP +GHL   R   P+ +T
Sbjct  3     TPSQLVAISGILGLVLLYGVWRVMTLAGKSKGKSAPEPSGAWPFLGHLPLLRGQTPIFRT  62

Query  1520  LSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVF  1341
             L   ADK+GPVF IRLG+ R LVVS+ E V++CFTTNDK  A+RP++ AGK LGY++A F
Sbjct  63    LGAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKAFASRPSSSAGKILGYNHAGF  122

Query  1340  TFSTNNSYWRNVRKLVVVELLSSRRMEKLKHV--WVSELQANINEFYTTIAMDNDKNNNN  1167
              F+   + WR +RKL ++E+LS+   + +K    WV  +                     
Sbjct  123   GFAPYGALWREMRKLSMMEILSASSPQCVKSCSDWVHPV---------------------  161

Query  1166  PSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVS  987
                 KV MS WF HL+ N++++++AG+R    SD   +EEA+R      ++++L G FV 
Sbjct  162   ----KVVMSEWFQHLSFNIVLKMIAGKRSFNTSDHG-NEEARRAIATIHKLLFLTGAFVL  216

Query  986   GDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLS  813
              DAI  +    W+D +G++ SMKR AK+VD+++  WV+    R  R  N+ Q FIDVMLS
Sbjct  217   SDAIPGV---EWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEMRLNREGNKRQDFIDVMLS  273

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
             +++D  T  + YSR+TVIKA ++ ++   ++T +T  TW+L+ LL +  +LK  Q+E+D 
Sbjct  274   VLED--TSMFGYSRETVIKATIMILIVGGTDTLSTTSTWLLSALLNNKHALKCAQEELDL  331

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +G+ RW E+SD+ NL YLQ V+KETLR+Y   P  APHEA+EDC V GYHIPKGT+L+V
Sbjct  332   KVGRGRWVEESDIPNLLYLQAVIKETLRLYTATPLSAPHEAMEDCHVAGYHIPKGTRLFV  391

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             N W+LHRDP +W DPE F PERF+T         + ++ +PFG GRRSCPG   A ++  
Sbjct  392   NAWKLHRDPSVWSDPEDFQPERFLTTHADLDVLGQHFELIPFGSGRRSCPGITMALKLLP  451

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + + RL QGF+ ST  N P+DM E + I L KLTPLEV++TPRL P+ F
Sbjct  452   LVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTPLEVMLTPRL-PSQF  499



>ref|XP_009768110.1| PREDICTED: cytochrome P450 82A4-like [Nicotiana sylvestris]
Length=520

 Score =   460 bits (1183),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 226/533 (42%), Positives = 333/533 (62%), Gaps = 30/533 (6%)
 Frame = -1

Query  1694  VMDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTS----VPLV  1527
             ++  +   ++ ++ +A +    +++RK SK LPPE  G WP+IGHL +F+        L 
Sbjct  8     LLSPIEAIIAGLVTLAFVFYFLWNFRKSSKTLPPEIPGGWPVIGHLFYFKNDGDHDRTLA  67

Query  1526  KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYA  1347
             + L + ADK+GPVFT +LG  R LVVS++E +++CFTTND   + RP    G +L Y+ A
Sbjct  68    QKLGDLADKHGPVFTYKLGFRRFLVVSSYEAIKECFTTNDIRFSNRPALLYGDHLCYNNA  127

Query  1346  VFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNN  1167
             +   +    YWR +RKLV  E+LS  R+EK K +  S +Q N+ E Y            +
Sbjct  128   MLFIAKYGPYWRKIRKLVNQEVLSVNRLEKFKCIRFSIVQKNVKELY------------D  175

Query  1166  PSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVS  987
                  +N++ W   L+ ++I++++AG+ Y        +   + LK  F + M +  EF  
Sbjct  176   HCDSTINLTDWIDKLSFDIILKMIAGKSYN-------NGHGEILKIAFQKFMVIAMEFEL  228

Query  986   GDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDV  822
              D IFP+  F+W+D+ G++K +K   KD+D + Q W+D   K+R  NE     ++ FID 
Sbjct  229   YD-IFPIPLFKWVDFSGNIKVVKETFKDIDTVFQGWLDEHIKKRERNETLDENEEDFIDS  287

Query  821   MLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDE  642
             MLS   ++   G ++S +T IKA + S++ DA+ET A H+ W++A+L+ +   +K+ Q E
Sbjct  288   MLSKTSNEHL-GDTHSPNTTIKATIFSLVLDATETLALHIKWVMALLINNKLEMKKAQKE  346

Query  641   IDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQ  462
             IDT +GK+RW E+SD+KNL YLQ +VKE LR+YP  P   PHE+VEDC+V+GYHIPKGT 
Sbjct  347   IDTIVGKDRWVEESDIKNLVYLQAIVKEALRLYPPAPLSVPHESVEDCVVNGYHIPKGTV  406

Query  461   LYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQ  282
             L  NV +L RDPKIW DP+KF PERF+T       + + Y+F+PFG GRR+CP   YA Q
Sbjct  407   LLPNVMKLQRDPKIWSDPDKFDPERFLTTHAKIDYRGQHYEFIPFGTGRRACPAMTYALQ  466

Query  281   ITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             +  +++A L QGFNF+T  NE LDM E VGI  PK  P+EVL+TPRLS TL++
Sbjct  467   VEYLSIAHLIQGFNFNTPSNESLDMKEGVGITSPKKNPIEVLITPRLSTTLYQ  519



>ref|XP_004510285.1| PREDICTED: uncharacterized protein LOC101505071 [Cicer arietinum]
Length=1052

 Score =   476 bits (1224),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 238/533 (45%), Positives = 349/533 (65%), Gaps = 23/533 (4%)
 Frame = -1

Query  1691  MDAVPCCLSSILGIAALVLLWFSWR-------KQSKRLPPEAGGAWPIIGHLHHFRTSVP  1533
             M+  P   ++I+   ALV+L+  WR       K   + PP+   A P IGHLH      P
Sbjct  531   MEYFPSQQTTIVLAIALVVLYNIWRIKKHSNNKLKGKQPPQPSYALPFIGHLHLLGNQTP  590

Query  1532  LVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYD  1353
             L +  + +ADKYGP+F I LG    LV+SN E +++CFTTNDK +A+RP +  G YLGY+
Sbjct  591   LARIFASFADKYGPIFQIYLGSYPALVISNQESIKECFTTNDKILASRPKSSHGIYLGYN  650

Query  1352  YAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNN  1173
             YA F F+   +Y+  +RKL ++ELLSSRR+E L+H++ SE+   +N+ +  +       +
Sbjct  651   YAGFGFAPYGTYFTKLRKLTMLELLSSRRIESLRHLYESEIDTLVNDLWLYV------KD  704

Query  1172  NNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY-EYRSDGVVSEEAQRLKKVFSQVMYLWGE  996
             NN     V +S+W   LT N+I ++++G+RY EY  D V   EA  + K+  + M++ GE
Sbjct  705   NNKVTKAVVISKWLEKLTFNIITKMISGKRYFEYLQD-VDDVEAHGIVKLIKEFMHISGE  763

Query  995   FVSGDAIFPLWFFRWLDYEGHV-KSMKRAAKDVDAILQDWVD--ARRKERRSNEDQKFID  825
             FV  D I P+    W  +EG V KSMKR  +D+D ++  WVD   ++ +   NE   FID
Sbjct  764   FVPSDLI-PI--IGWFGFEGQVLKSMKRVGRDLDKVVGRWVDEHVQKIDDGVNEKHDFID  820

Query  824   VMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQD  645
             VMLS+I+D  + G+   RDT+IKA +++++   S+T +T +TWILA+LL +  +LKR Q+
Sbjct  821   VMLSVIEDDPSSGHD--RDTIIKANIMNLMLAGSDTTSTTMTWILAILLNNTNALKRAQE  878

Query  644   EIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGT  465
             EI+ +IGK+R  E SD+KNL YLQ ++KETLR+YP GP L PHEA +DC + GY++PKGT
Sbjct  879   EINHHIGKKRRVESSDIKNLVYLQAIMKETLRLYPPGPLLVPHEATKDCYIQGYNVPKGT  938

Query  464   QLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYAT  285
             +++ NVW+LHRDP IW + EKF PERF+    GE  +   ++++PFGLGRR+CPG+++AT
Sbjct  939   RVFANVWKLHRDPSIWLEAEKFSPERFINEKNGELYEGHNFEYLPFGLGRRACPGSMFAT  998

Query  284   QITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             Q+  + +ARL  GF+      E +DM E +GI LPKLTPL V++TPRL+  L+
Sbjct  999   QVCLITLARLIHGFDLEVPMGEDVDMREGLGITLPKLTPLNVILTPRLTYELY  1051


 Score =   432 bits (1112),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 215/498 (43%), Positives = 313/498 (63%), Gaps = 17/498 (3%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             PE  G+ P IGHLH   T VP  +T S  A+KYG +F++RLG  + LVVS+ E  R+C T
Sbjct  24    PEPCGSLPFIGHLHLLSTQVPYFRTFSTMAEKYGSIFSLRLGCHKTLVVSSREIARECLT  83

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
             TNDK  A+RP   AG+YLGY+ A+   +   +YWR++RK+  +ELLSS R+EKL HV  S
Sbjct  84    TNDKVFASRPNISAGRYLGYNNAILALAPYGNYWRDMRKISTLELLSSHRLEKLMHVRDS  143

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E+ + + + YT +     KNNN+    +V +S++  H+T N+I++++AG+R+   +    
Sbjct  144   EIFSLVKDLYTFL-----KNNNSNGLIEVPISKFLDHMTFNIIVRMIAGKRFRGETIYQE  198

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV  876
               EA RL+       YL G FV GDAI    F  W D++GHV  MKR  K++D IL  W+
Sbjct  199   DSEAWRLRNAIKDTTYLSGVFVVGDAI---PFLSWFDFQGHVGFMKRTFKEMDFILDKWM  255

Query  875   DARRKERRSNEDQK------FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETF  714
               R    + NE Q       F+DV++SM D  + +   + R+ VIKA  + ++  AS + 
Sbjct  256   --REHYTKINEGQHGKYENDFMDVLISMFDG-YDEICGHKREIVIKATTMILILTASGST  312

Query  713   ATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQG  534
             A  LTW L++LL +P  LK+ Q E+D NIGK +W ++S++KNL YLQ ++KETLR+YP  
Sbjct  313   AITLTWALSLLLNNPRVLKQAQQELDNNIGKHKWVQESNIKNLKYLQAIIKETLRLYPPA  372

Query  533   PYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ  354
             P     E+++DC V GYH+PKGT+L +N+W+L RDP IWP+P +F PERF+T+     +Q
Sbjct  373   PLTGLRESIDDCHVAGYHVPKGTRLLINIWKLQRDPHIWPNPNEFQPERFLTSNGQIDSQ  432

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
             +  + FVPF  GRRSC G+ +  Q+  + +ARL QGF+  T     +DM E VG+ LPK 
Sbjct  433   HYDFGFVPFSYGRRSCVGSTFGLQVLHLTLARLIQGFDIYTKDGGVVDMSEGVGLALPKE  492

Query  173   TPLEVLVTPRLSPTLFRL  120
              PL +++ PRL   L+ +
Sbjct  493   NPLSLMLQPRLPLDLYEI  510



>gb|KCW58034.1| hypothetical protein EUGRSUZ_H00762, partial [Eucalyptus grandis]
Length=529

 Score =   459 bits (1181),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 223/505 (44%), Positives = 329/505 (65%), Gaps = 18/505 (4%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNW  1440
             + +   LPPE  GAWPIIGH+H      PL +TL+  ADK GP+F IRLG+    ++S+ 
Sbjct  29    KPKGTALPPELPGAWPIIGHIHLLGGETPLARTLAAMADKQGPMFRIRLGVHPATIISSR  88

Query  1439  EGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRME  1260
             E VR+CFTT+DK +A+RP + AG +LGY YA F F     +WR +RK+ ++ELLS+RR++
Sbjct  89    EAVRECFTTHDKDLASRPKSKAGIHLGYGYAGFGFVEYGDFWREMRKITMLELLSTRRLD  148

Query  1259  KLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY  1080
              LKHV  SE+   + + +  +   N  +  N S+  V +S+    LTLN+I++++A +RY
Sbjct  149   NLKHVQASEIDTFVKDLHA-LCRTNSIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRY  207

Query  1079  EYRSDGVVS------EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMK  918
                S           EEA  L++V  + MY+ G F +   + P  F  W D  G VK+MK
Sbjct  208   FGLSSASTGSSADDDEEASHLRRVIKEFMYISG-FPAVSDLVP--FTGWTDCVGTVKTMK  264

Query  917   RAAKDVDAILQDWVDARRKERRSNE--------DQKFIDVMLSMIDDQFTQGYSYSRDTV  762
             R A+++D I+  WV+  + +R  ++         + FIDVMLS+I +     + +S +T+
Sbjct  265   RVARELDEIVGKWVEEHKLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETL  324

Query  761   IKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLP  582
             IKA +++++   S++ + +LTW+L++LL H   LKR Q+EID  +GK+RW +DSD++NL 
Sbjct  325   IKATIVNIIVAGSDSTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDRWVQDSDIENLL  384

Query  581   YLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEK  402
             YLQ +VKETLR+YP GP L PHEA  DC V GY IPKGT+++VN W+LHRDP++W +PEK
Sbjct  385   YLQAIVKETLRLYPPGPLLVPHEARADCNVRGYLIPKGTRIFVNAWKLHRDPQVWSEPEK  444

Query  401   FLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN  222
             FLPERF+TN  G  A  + ++F+PFG GRR CPG  +A + T + +ARL QGF+ +T  +
Sbjct  445   FLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLATSLD  504

Query  221   EPLDMMEDVGIILPKLTPLEVLVTP  147
             E +DM E +G+ LPK TPL V++ P
Sbjct  505   ELVDMTEGLGVNLPKATPLRVVLNP  529



>ref|XP_007049681.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX93838.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   459 bits (1180),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 219/531 (41%), Positives = 337/531 (63%), Gaps = 19/531 (4%)
 Frame = -1

Query  1691  MDAVPCCLSSILGIAALVLLWFSWR----KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVK  1524
             MD    C+ +I G+ AL++L+  WR      +K   PE  G+WP+IGHLH       L K
Sbjct  1     MDLFYNCVQAIEGLLALLVLYVIWRYIARNSNKSRIPEPSGSWPLIGHLHLLGGKETLCK  60

Query  1523  TLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAV  1344
              L   ADKYGP+++++LG  R+LVVS+WE  +DC T ND+ +A RP+  AG+++GY+ A+
Sbjct  61    KLGAMADKYGPLYSLKLGHRRVLVVSSWEIAKDCLTNNDRALATRPSIAAGRHIGYNNAI  120

Query  1343  FTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNP  1164
             F  +    YWRN+RK+V +ELLSS R+EKLKH+  SE+   I E +  + ++N  N    
Sbjct  121   FALAPYGEYWRNIRKIVTIELLSSYRLEKLKHIRFSEMDLFIKELFR-LCVENADN----  175

Query  1163  SAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSG  984
                +V MS     LT N+ ++++ G+R+   S      +  R +K   Q +YL G FV  
Sbjct  176   -CAQVTMSEVLERLTFNINLRMLVGKRFASSSYAQAHSQPWRYEKAIKQTLYLSGIFVLA  234

Query  983   DAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDA---RRKERRSNEDQKFIDVMLS  813
             DA   L F  W+D +GHV+SMK+ AK++D+I+  W++    R++E + + +  F+DVML+
Sbjct  235   DA---LPFLEWMDIQGHVRSMKQTAKELDSIISVWLENHLRRKRESQGSCESDFMDVMLA  291

Query  812   MI-DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEID  636
              +  D    G++  RDT++KA  L +     E+ +  +TW+L++LL HP  LK  Q E+D
Sbjct  292   NLPQDAVISGHT--RDTIVKATTLILTMTGGESTSVTMTWVLSLLLNHPSVLKAAQQELD  349

Query  635   TNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLY  456
              ++G +RW E+SD+K+L YLQ +VKETLR+YP GP     EA+EDC + GYH+PKGT+L 
Sbjct  350   LHVGIDRWVEESDIKSLKYLQAIVKETLRLYPPGPLTGIREAMEDCCIAGYHVPKGTRLI  409

Query  455   VNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQIT  276
             VN+W+L RDP++W +P +F PERF+T       + + ++++PF  GRRSCP   +  Q+ 
Sbjct  410   VNLWKLQRDPRVWENPGEFQPERFLTTHADFDVRGQNFEYIPFSSGRRSCPAITFGLQVV  469

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
              + +A+L QGF+  T   +P+DM E +G+ LPK TPL+V++TPRL+   ++
Sbjct  470   HLTLAKLLQGFDIRTPDGKPVDMGEGLGLALPKRTPLDVVLTPRLAHEFYK  520



>ref|XP_006355071.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=525

 Score =   459 bits (1180),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 229/516 (44%), Positives = 330/516 (64%), Gaps = 29/516 (6%)
 Frame = -1

Query  1673  CLSSILGIAALVLLWFSWRKQSKR-LPPEAGGAWPIIGHLHHFRTSV---PLVKTLSEWA  1506
              ++++L +A +   + S +K SK  LPPE  G WP+IGHL +F       PL + LS+ A
Sbjct  13    AIAALLTLAFIFYFFLSTKKSSKPPLPPEIAGGWPVIGHLFYFDNDGDDRPLARKLSDLA  72

Query  1505  DKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTN  1326
             DKYGPVFT RLG+ R+LV+S+ + V+DC++ ND   A RP    G+YLGY+ A+   +  
Sbjct  73    DKYGPVFTFRLGLPRVLVISSSDAVKDCYSKNDAVFANRPACLYGEYLGYNNAMLFLANY  132

Query  1325  NSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVN  1146
               YWRN+RKLV+ E+LS+ R+EKLK + + +++ NI   ++ I        N      VN
Sbjct  133   GPYWRNIRKLVIQEVLSNTRLEKLKQIKLCKIRNNIKNLHSRI-------QNTEEKSVVN  185

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             ++ W   L   LI+Q++AG+ YE   DG    E +R K+ F + + L  EFV  DA FP+
Sbjct  186   LTDWLEELNFGLIVQMIAGKNYESGGDG----EMERFKEAFRKFLVLSMEFVLWDA-FPI  240

Query  965   WFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSN--------EDQKFIDVMLS-  813
               F+W+D++GHVK MK+  KD+D+I Q W+D   K R ++         ++ FIDVMLS 
Sbjct  241   PLFKWIDFQGHVKLMKKTFKDIDSIFQRWLDEHVKTRETSLMEVNGGGNERDFIDVMLSK  300

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
             M ++   +GYS  RDTVIKA V S++ DA++T + H+ W + +L+ +   LK+ Q+EID 
Sbjct  301   MSNEHLHEGYS--RDTVIKATVFSLVLDAADTVSLHINWGMTLLINNQHVLKKAQEEIDM  358

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              IGK+RW +D+D+K+L YLQ ++KE LR+YP GP L PHE  EDC+V GYHIPKGT+LY 
Sbjct  359   KIGKDRWIDDNDIKDLVYLQAIIKEVLRLYPPGPLLVPHENTEDCVVSGYHIPKGTRLYT  418

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             NV +L RD KIW +P++F P+RF T       Q+  Y+F+PFG GRRSCPG  YA Q+  
Sbjct  419   NVMKLQRDLKIWSNPDQFNPDRFFTTDIDFRGQD--YEFIPFGSGRRSCPGMTYALQVEY  476

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPL  165
             + +  L QGF++ T  +EPLDM E  G+ + K+  L
Sbjct  477   LTIGHLIQGFDYKTPSDEPLDMKEGPGMTMRKVMVL  512



>ref|XP_011045172.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
 ref|XP_011045173.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
Length=541

 Score =   459 bits (1181),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 228/541 (42%), Positives = 345/541 (64%), Gaps = 40/541 (7%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFSWRK--QSKR------LPPEAGGAWPIIGHLHHFRTSVPLVKTLS  1515
             L +I  + ALVL W++ R+  +S+R        PE  GA P+IGHLH       L +TL+
Sbjct  11    LLAISTVLALVL-WYTLRRVRESRRKTEKGLQAPEPSGALPLIGHLHLLGAQKTLARTLA  69

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
               ADKYGP+FTIRLG    +VVSN E +++CFTT+D+ +++RP +  G+YL Y+YA F F
Sbjct  70    AIADKYGPIFTIRLGKHPTVVVSNLEAIKECFTTHDRILSSRPRSSHGEYLSYNYAAFGF  129

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             + +  +WR +RK+V ++LLSS R++ L+HV VSE+   IN+ Y          +N   + 
Sbjct  130   TNSGPFWREMRKIVTIQLLSSHRLKSLRHVQVSEVNTLINDLYLL------SKSNKQGST  183

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
             K+ +S  F  +T+N+I +++AG+RY + S     EE +R+ K+  + MY+ G FV  D I
Sbjct  184   KIVISECFERMTINMITRMIAGKRY-FSSTEAEKEEGKRIGKLMKEFMYISGVFVPSDLI  242

Query  974   FPLWFFRWLD-YEGHVKSMKRAAKDVDAILQDWVDARRKERRSN-------EDQKFIDVM  819
              P  F  W++ + G VK+MKR ++++D++++ W+   + +R  +       +D  FIDVM
Sbjct  243   -P--FLGWINNFLGSVKTMKRLSRELDSLMESWIQEHKLKRLESTENTNKMDDDDFIDVM  299

Query  818   LSMIDDQFTQGYSYSRDTVIKAIVL----------SMLQDASETFATHLTWILAVLLKHP  669
             LS++DD  +    YSR+T+IKA  +          +++   ++T +  LTWIL+ LL + 
Sbjct  300   LSLLDDSMS---GYSRETIIKATAMDQDVLFLHEQTLIIAGADTTSITLTWILSNLLNNR  356

Query  668   ESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVD  489
              SL+  Q+E+D  +G+ERWAEDSD+ NL Y+Q ++KETLR+YP GP   PHEA ED  V 
Sbjct  357   RSLQLAQEELDLKVGRERWAEDSDIGNLVYIQAIIKETLRLYPPGPLSVPHEATEDFCVA  416

Query  488   GYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRS  309
             GYH+PKGT+L+ N+W+LHRDP +W +P++++PERF+ +          ++ +PFG GRRS
Sbjct  417   GYHMPKGTRLFTNLWKLHRDPNLWSNPDEYMPERFLNDHANLDVLGHHFELIPFGSGRRS  476

Query  308   CPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTL  129
             CPG  +A Q+  +  ARL QGF+  T   E +DM E V I LPK TPLE+ +TPRLSP L
Sbjct  477   CPGITFALQVLHLTFARLLQGFDMKTPRGESVDMTEGVAITLPKATPLEIHITPRLSPEL  536

Query  128   F  126
             +
Sbjct  537   Y  537



>ref|XP_006376421.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP54218.1| cytochrome P450 family protein [Populus trichocarpa]
Length=511

 Score =   458 bits (1178),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 228/519 (44%), Positives = 327/519 (63%), Gaps = 17/519 (3%)
 Frame = -1

Query  1661  ILGIAALVLLWFSWR-----KQSKRLP--PEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD  1503
             ILG   L++L+  W+     ++SK+L   PE  GAWP+IGHL   R   P  KTL+  AD
Sbjct  2     ILGALVLLILYGFWKTLARERESKKLARAPEPSGAWPVIGHLPRLRGQDPACKTLAAIAD  61

Query  1502  KYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNN  1323
             KYGP++++RLG  RI+VVS+WE V+DC TTND+ +A R    AGK++GY+ A F  S   
Sbjct  62    KYGPIYSLRLGSHRIVVVSSWETVKDCLTTNDRILATRANIAAGKHMGYNNAAFALSPYG  121

Query  1322  SYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNM  1143
              YWR+VRKLV ++LLS+ R+E LKHV V E+ A I   + + A    +    P+  KV M
Sbjct  122   KYWRDVRKLVTLQLLSNHRLEMLKHVRVLEVDAFIKGLHNSYA----ETAEYPA--KVTM  175

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             S+ F  LT N+ ++ + G+RY        + E  R KK   + +YL G FV  DAI    
Sbjct  176   SKLFESLTFNISLRTIVGKRYCSSLYDKENSEPWRYKKAIEKALYLSGIFVMSDAIP---  232

Query  962   FFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGY  783
             +  W+D++GH+ +MKR AK++DA++  W++   K+    E   F+DV++S + D   +  
Sbjct  233   WLEWIDFQGHISAMKRTAKELDAVIGSWLEEHLKKEIQGESD-FMDVIISNLADGAAEMS  291

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              YSRD VIKA  L +    + + A  LTW L++LL HP  LK  Q+E+D  +G+E+W E+
Sbjct  292   GYSRDVVIKATTLILTLTGAGSTAVTLTWALSLLLNHPSVLKAAQEELDKQVGREKWVEE  351

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             SD++NL YLQ +VKETLR+YP GP     EA+EDC + GY++PKGT+L VN+W+LHRDP+
Sbjct  352   SDIQNLMYLQAIVKETLRLYPPGPLTGIREAMEDCHICGYYVPKGTRLVVNIWKLHRDPR  411

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             +W +P+ F PERF+T       + + ++F+PF  GRRSCP       +  + +ARL QGF
Sbjct  412   VWKNPDDFQPERFLTTHADLDFRGQDFEFIPFSSGRRSCPAINLGMAVVHLTLARLLQGF  471

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + +TV   P+DM E  GI LPKL PLE ++ PRL   L+
Sbjct  472   DLTTVAGLPVDMNEGPGIALPKLIPLEAVIKPRLGLPLY  510



>ref|XP_010069621.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Eucalyptus 
grandis]
Length=542

 Score =   459 bits (1180),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 226/512 (44%), Positives = 328/512 (64%), Gaps = 18/512 (4%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNW  1440
             + +   LPPE  GAWPIIGHLH      PL +TL+  ADK GP+F IRLG+    ++S+ 
Sbjct  29    KPKGTALPPELPGAWPIIGHLHLLGGETPLARTLAAMADKQGPMFRIRLGVHPATIISSQ  88

Query  1439  EGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRME  1260
             E VR CFTT+DK +A+RP +  G + GY YA F F+     WR +RK+ ++ELLS+RR++
Sbjct  89    EAVRKCFTTHDKDLASRPKSKVGIHFGYGYAGFGFAEYGDLWREMRKITMLELLSTRRLD  148

Query  1259  KLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY  1080
              LKHV  SE+   + + +  +   N  +  N S+  V +S+    LTLN+I++++A +RY
Sbjct  149   NLKHVQASEIDTFVKDLHA-LCRTNAIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRY  207

Query  1079  ------EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMK  918
                      S     EEA  L+KV  + MY+ G F +   + P  F  W D  G VK+MK
Sbjct  208   FGLLSASTGSSTDDDEEASHLRKVIKEFMYISG-FPTVSELVP--FTGWTDCVGTVKTMK  264

Query  917   RAAKDVDAILQDWVDARRKERRSNE--------DQKFIDVMLSMIDDQFTQGYSYSRDTV  762
             R A+++D I+  WV+  + +R  ++         + FIDVMLS+I +     + +S +T+
Sbjct  265   RVAREMDEIVGKWVEEHKLKREGDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETL  324

Query  761   IKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLP  582
             IKA V++++   S+T + +LTW+L++LL H   LKR Q+EID  +GK++W +DSD+ +L 
Sbjct  325   IKATVVNIIVAGSDTTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDKWVQDSDIGSLH  384

Query  581   YLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEK  402
             YLQ +VKETLR+YP GP   PHEA  DC V GY IPKGT+++VNVW+LHRDP++W DPEK
Sbjct  385   YLQAIVKETLRLYPPGPLSIPHEARADCNVRGYLIPKGTRIFVNVWKLHRDPQVWSDPEK  444

Query  401   FLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPN  222
             FLPERF+TN  G  A  + ++F+PFG GRR CPG  +A + T + +ARL QGF+ +   +
Sbjct  445   FLPERFLTNHSGVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLAISSD  504

Query  221   EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             E +DM E +G+ LPK TPL V++ PRL   L+
Sbjct  505   ELVDMTEGIGLNLPKATPLRVVLNPRLPSMLY  536



>ref|XP_007134137.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris]
 gb|ESW06131.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris]
Length=526

 Score =   458 bits (1178),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 228/511 (45%), Positives = 332/511 (65%), Gaps = 25/511 (5%)
 Frame = -1

Query  1640  VLLWFSWRKQSKRL------PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTI  1479
             +L++ +WRK+          PPE  GA P+IGHLH      PL +T +  ADKYGP+F I
Sbjct  18    ILIYNTWRKKKGSQKSKGAEPPEPSGALPLIGHLHLLGAQTPLARTFAALADKYGPMFQI  77

Query  1478  RLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRK  1299
             RLG    LV+ N E +++CFTTNDK +A+RP +  G +LGY++A F F+   +YW  +RK
Sbjct  78    RLGAYPALVICNQEAIKECFTTNDKVLASRPKSSHGVHLGYNFAGFGFAPYGTYWTKIRK  137

Query  1298  LVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLT  1119
             L ++ELLS+RR++ L HV+ SE+   + + +  +           +  KV +S W    T
Sbjct  138   LTMLELLSARRLQFLSHVYESEIDTLVKDLWLYLG--------GKTHVKVTISEWLERFT  189

Query  1118  LNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYE  939
              N+I++++AG+RY    + V   EA  + K+  + M++ GEFV  D I  L    W    
Sbjct  190   FNIIIKMIAGKRYFSYLEDVDDAEAHGVVKLIKEFMHISGEFVPSDLIPVLG---WFGVH  246

Query  938   GHV-KSMKRAAKDVDAILQDWVDARRKE----RRSNEDQKFIDVMLSMIDDQFTQGYSYS  774
             G V KSMKR AKD+D+++  WV+  +       +S E   FIDVMLS+I D    G+   
Sbjct  247   GKVLKSMKRIAKDLDSLVGGWVEEHKNSDPLRNKSLEKHDFIDVMLSVIQDDPLSGHD--  304

Query  773   RDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDV  594
             RDT+IKA V +++   S+T +T +TWILA+L+K+PE+LKR Q+EI+  +G+ER  E  D+
Sbjct  305   RDTIIKANVTNLVLAGSDTTSTTMTWILAMLMKNPEALKRAQEEIEDEVGRERKVEACDL  364

Query  593   KNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWP  414
             KNL YLQ VVKETLR+YP GP L PHEA EDC + GY +PKGT+++ NVW+LHRDP++W 
Sbjct  365   KNLIYLQAVVKETLRLYPPGPLLVPHEAREDCCIQGYRVPKGTRVFANVWKLHRDPRVWS  424

Query  413   DPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS  234
             + EKF PERF+ N  GE  + ++++++PFG GRR+CPG+ +ATQ+T + +ARL Q F+  
Sbjct  425   EAEKFSPERFL-NENGEVDEGQRFEYLPFGSGRRACPGSTFATQLTLITLARLLQAFHLD  483

Query  233   TVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
                +EP+D+ E +GI LPK+ PL++L T RL
Sbjct  484   EPLDEPVDLEEGLGITLPKINPLQILFTSRL  514



>ref|XP_006435895.1| hypothetical protein CICLE_v10031217mg [Citrus clementina]
 gb|ESR49135.1| hypothetical protein CICLE_v10031217mg [Citrus clementina]
Length=528

 Score =   457 bits (1177),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 226/500 (45%), Positives = 329/500 (66%), Gaps = 16/500 (3%)
 Frame = -1

Query  1616  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWE  1437
             KQ+K+  P AGGAWP+IGHLH  R   P  + L   ADKYG +FT++LG+ + LVVSNWE
Sbjct  41    KQAKQ-APVAGGAWPLIGHLHLLRGPEPAHRVLGNLADKYGTIFTMKLGVKQALVVSNWE  99

Query  1436  GVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEK  1257
               ++CFTTNDK  A RP T A + +GY++ V  F+   +YWR  RK+V +ELLS+RR+EK
Sbjct  100   IAKECFTTNDKAFAGRPKTMAVELMGYNFLVIGFAPYGNYWRQSRKIVTIELLSNRRLEK  159

Query  1256  LKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             LKHV  SE++A+I   Y         ++++     V M  W     L++I++I+AG+R+ 
Sbjct  160   LKHVRESEVKASIQRLYKNCIS----SSSSRKVVSVEMIHWLEGTALDIILRIIAGKRHT  215

Query  1076  YRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVD  897
              +S     EEA   ++  +++  L+G+FV  DA   L F R LD  G+ + M + AK  D
Sbjct  216   SQS-----EEANDWQQQITKIAALFGQFVVSDA---LPFLRRLDIGGYERLMSKTAKYFD  267

Query  896   AILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA  726
              ILQ+WVD  + +R S E   D+ FI V+LS++DD   Q      DTVIKAI L+++  A
Sbjct  268   IILQEWVDEHKMKRVSGEIKGDEDFIYVLLSLLDDNAEQLPDRDADTVIKAICLTLIVAA  327

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             ++T A  LTW +A+LL +P+ LK+ QDE+D  +G ER   +SD++NL YLQ ++KET+R+
Sbjct  328   TDTTAVTLTWAIALLLNNPDVLKKAQDELDIQVGTERQVNESDMRNLVYLQAIIKETMRL  387

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP GP L PHE++E+CIV+GY +P GTQL+VN W++ RDP +W +P +F PERF+T  + 
Sbjct  388   YPAGPLLLPHESIEECIVNGYLVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKD  447

Query  365   EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII  186
                  + ++ +PFG GRR CP   +  Q+ Q+ +A L  GF+F+T  +EP+DM E +G+ 
Sbjct  448   IDVGGQDFELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLT  507

Query  185   LPKLTPLEVLVTPRLSPTLF  126
             + K TPLEVLV+PRLS +L+
Sbjct  508   IAKATPLEVLVSPRLSASLY  527



>ref|XP_002531093.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31307.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   457 bits (1176),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 218/524 (42%), Positives = 335/524 (64%), Gaps = 19/524 (4%)
 Frame = -1

Query  1664  SILGIAALVLLWFSWRKQSKRLP------PEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD  1503
             +I G++ L+ L+  WR  +++        PE  GAWP+IGH H      P  + L + AD
Sbjct  7     TITGLSTLLFLFVLWRSLARKSKSKNINVPEPTGAWPLIGHFHLLARQEPACRILGDIAD  66

Query  1502  KYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNN  1323
             K GP++++RLGI+RI+V S WE V++CFTTND+  A R +  AGKY+GY+ A+F  +   
Sbjct  67    KTGPLYSLRLGINRIMVASGWEVVKECFTTNDRIFATRASIAAGKYIGYNNAIFALAPYG  126

Query  1322  SYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNM  1143
              YWR+VRKL  ++LLSS R+EKLKHV +SE+   + + +       D N+      KV +
Sbjct  127   QYWRDVRKLATLKLLSSNRLEKLKHVRLSEVDTFLKDLHNLYVESADSNH-----AKVII  181

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             +  F  LT N+ ++++ G+++   + G  + E  R KK   + +YL G FV  DAI P  
Sbjct  182   NTLFERLTFNISLRMIVGKQFSSSTYGEENSEPWRYKKAIEEAVYLSGTFVMSDAI-P--  238

Query  962   FFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNEDQK----FIDVMLSMIDDQF  795
             +  W+D++GH+ +MKR AK++DA+++ W++   K+R S+E  K    F+DVMLS +D+  
Sbjct  239   WLEWIDHQGHISAMKRTAKELDAVIETWLEEHIKKRSSDECHKGENDFMDVMLSDLDEDA  298

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
                  +SRDTVIKA  + +    S + A  LTW L++LL +P  LK  Q+E+D ++G+E+
Sbjct  299   VMS-GHSRDTVIKATAMILTLTGSGSTAVTLTWALSLLLNNPGVLKAAQEELDIHVGREK  357

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W ++SD++NL YLQ +VKETLR+YP GP     EA EDC + GY +PKGT+L +N+W+L 
Sbjct  358   WVQESDIENLKYLQAIVKETLRLYPPGPLTGIREASEDCNLGGYFVPKGTRLIINIWQLQ  417

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP++W DP +F PERF+T       + + ++F+PF  GRRSCP   +  Q+  + +AR+
Sbjct  418   RDPRVWKDPGEFQPERFLTTHSDVDFRGQNFEFIPFSSGRRSCPAITFGLQVVHLTLARV  477

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
              QGF+ +T+   P+DM E +GI LPK+ P+EV++ PRL   L++
Sbjct  478   LQGFDLTTIGGLPVDMTEGLGIALPKVNPVEVIIKPRLGLELYQ  521



>ref|XP_002323130.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
 gb|EEF04891.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
Length=499

 Score =   456 bits (1172),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 229/503 (46%), Positives = 329/503 (65%), Gaps = 21/503 (4%)
 Frame = -1

Query  1616  KQSKRLPP-EAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNW  1440
             K++K LPP E  GAWP+IGHL    + +P  + L + A K+GPVF+IRLG+ R LV+S+W
Sbjct  12    KRNKTLPPPEPSGAWPLIGHLRILNSQIPFFRILGDLAVKHGPVFSIRLGMRRTLVISSW  71

Query  1439  EGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRME  1260
             E V++CF TND+    RP+  A KY+GYD A F F     YW  +RK+   ELLS+RR+E
Sbjct  72    ESVKECFKTNDRKFLNRPSFAASKYMGYDDAFFGFHPYGEYWLEMRKIATQELLSNRRLE  131

Query  1259  KLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY  1080
              LKHV VSE++  I E +TT +        N S   V+MS+WF  +  N++ +++AG+RY
Sbjct  132   LLKHVRVSEIETCIKELHTTCS--------NGSV-LVDMSQWFSCVVANVMFRLIAGKRY  182

Query  1079  EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDV  900
                  G+  +++    ++  +  YL G  V  D I P  F  W+D +GHVKSMKR AK++
Sbjct  183   ---CSGI-GKDSGAFGRLVREFFYLGGVLVISDLI-P--FTEWMDLQGHVKSMKRVAKEL  235

Query  899   DAILQDWVD---ARRKERRSNEDQK-FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ  732
             D ++  W+     RR+E R  +++K F+DVML  +       + Y R+T++KA  L+++ 
Sbjct  236   DHVVSGWLVEHLQRREEGRVRKEEKDFMDVMLESLAVGDDPIFGYKRETIVKATALNLIL  295

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
               ++T +  LTW L++LL H E LKR Q EID ++G  RW E+SD+KNL YLQ +VKETL
Sbjct  296   AGTDTTSVTLTWALSLLLNHTEVLKRAQKEIDVHVGTTRWVEESDIKNLVYLQAIVKETL  355

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R+YP GP L P E++EDC VDGY +P+GTQL VN W+LHRD +IW +P +F PERF+T+ 
Sbjct  356   RLYPPGPLLVPRESLEDCYVDGYLVPRGTQLLVNAWKLHRDARIWENPYEFHPERFLTSH  415

Query  371   EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVG  192
                  + +Q+++VPFG GRR CPG   + Q+  + ++RL QGFNFST  N  +DM E +G
Sbjct  416   GSTDVRGQQFEYVPFGSGRRLCPGISSSLQMLHLTLSRLLQGFNFSTPMNAQVDMSEGLG  475

Query  191   IILPKLTPLEVLVTPRLSPTLFR  123
             + LPK TPLEV++TPRL   +++
Sbjct  476   LTLPKATPLEVVLTPRLENEIYQ  498



>ref|XP_009792748.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   456 bits (1174),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 232/533 (44%), Positives = 336/533 (63%), Gaps = 36/533 (7%)
 Frame = -1

Query  1670  LSSILGIAALV----LLWFSW-RKQSK---RLPPEAGGAWPIIGHLHHFRTSVP----LV  1527
             LS I  I  LV    LL+F W +KQSK    LPP+  G WP+IGHL +F+ +        
Sbjct  5     LSPIEAIVGLVTFAFLLYFLWTKKQSKILNPLPPKIPGGWPVIGHLFYFKNNGDDDRHFS  64

Query  1526  KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYA  1347
             + L + ADKYGPVFT RLG  R L VS++E +++CF+TND H A RP    G+YL Y+ A
Sbjct  65    QKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFSTNDIHFADRPALLYGEYLCYNNA  124

Query  1346  VFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNN  1167
             +   +    YW+  RKLV  ELLS  R+EK KHV  S +Q NI E Y         + ++
Sbjct  125   MLAVAKYGPYWKKNRKLVNQELLSVSRLEKFKHVRFSIVQKNIKELY---------DGDS  175

Query  1166  PSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVS  987
             P   K+N+S W   LT ++I+++V G+ Y        +   + LK  F + M    E   
Sbjct  176   PMV-KINLSDWIDKLTFDIILKMVVGKTYN-------NGHGEILKAAFQKFMVQAMEIEL  227

Query  986   GDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDV  822
              D +F + FF+WLD  G++K+MK+  KD+D I+Q W+D   K+R + +     +Q FIDV
Sbjct  228   YD-VFHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDEHIKKRETKDVGGENEQDFIDV  286

Query  821   MLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDE  642
             +LS   ++   G  YS DT IKA V +++ DA++T A H+ W++A+++ +   +K+ Q+E
Sbjct  287   VLSKRSNEHL-GDGYSHDTTIKATVFTLVLDATDTLALHIKWVMALMINNKNVMKKAQEE  345

Query  641   IDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQ  462
             +DT +G++RW E+SD+KNL YLQ +VKE LR++P  P    H +V+DC+V+GYHIPKGT 
Sbjct  346   MDTIVGRDRWVEESDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSVKDCVVNGYHIPKGTA  405

Query  461   LYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQ  282
             L  N+ +L RDP+IW DP+KF PERF+T       + + Y+ +PFG GRR+CP   Y+ Q
Sbjct  406   LLTNIMKLQRDPQIWADPDKFDPERFLTTHAAIDYRGQHYELIPFGTGRRACPAMNYSLQ  465

Query  281   ITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             +  +++A + QGFNF+T  NEPLDM + VG+ LPK T +EVL+TPRL PTL++
Sbjct  466   VEHLSIAHMIQGFNFATTTNEPLDMKQGVGLTLPKKTDVEVLITPRLPPTLYQ  518



>ref|XP_009770601.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   456 bits (1173),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 231/533 (43%), Positives = 336/533 (63%), Gaps = 36/533 (7%)
 Frame = -1

Query  1670  LSSILGIAALV----LLWFSW-RKQSK---RLPPEAGGAWPIIGHLHHFRTSVP----LV  1527
             LS I  I  LV    LL+F W +KQSK    LPP+  G WP+IGHL +F+ +        
Sbjct  5     LSPIEAIVGLVTFAFLLYFLWTKKQSKILNPLPPKIPGGWPVIGHLFYFKNNGDDDRHFS  64

Query  1526  KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYA  1347
             + L + ADKYGPVFT RLG  R L VS++E +++CF+TND H A RP    G+YL Y+ A
Sbjct  65    QKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFSTNDIHFADRPALLYGEYLCYNNA  124

Query  1346  VFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNN  1167
             +   +    YW+  RKLV  ELLS  R+EK KHV  S +Q NI E Y         + ++
Sbjct  125   MLAVAKYGPYWKKNRKLVNQELLSVSRLEKFKHVRFSIVQKNIKELY---------DGDS  175

Query  1166  PSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVS  987
             P   K+N+S W   LT ++I++++ G+ Y        +   + LK  F + M    E   
Sbjct  176   PMV-KINLSDWIDKLTFDIILKMIVGKTYN-------NGHGEILKAAFQKFMVQAMEIEL  227

Query  986   GDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDV  822
              D +F + FF+WLD  G++K+MK+  KD+D I+Q W+D   K+R + +     +Q FIDV
Sbjct  228   YD-VFHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDEHIKKRETKDVGGENEQDFIDV  286

Query  821   MLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDE  642
             +LS   ++   G  YS DT IKA V +++ DA++T A H+ W++A+++ +   +K+ Q+E
Sbjct  287   VLSKRSNEHL-GDGYSHDTTIKATVFTLVLDATDTLALHIKWVMALMINNKNVMKKAQEE  345

Query  641   IDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQ  462
             +DT +G++RW E+SD+KNL YLQ +VKE LR++P  P    H +V+DC+V+GYHIPKGT 
Sbjct  346   MDTIVGRDRWVEESDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSVKDCVVNGYHIPKGTA  405

Query  461   LYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQ  282
             L  N+ +L RDP+IW DP+KF PERF+T       + + Y+ +PFG GRR+CP   Y+ Q
Sbjct  406   LLTNIMKLQRDPQIWADPDKFDPERFLTTHAAIDYRGQHYELIPFGTGRRACPAMNYSLQ  465

Query  281   ITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             +  +++A + QGFNF+T  NEPLDM + VG+ LPK T +EVL+TPRL PTL++
Sbjct  466   VEHLSIAHMIQGFNFATTTNEPLDMKQGVGLTLPKKTDVEVLITPRLPPTLYQ  518



>ref|XP_009595933.1| PREDICTED: cytochrome P450 82A4-like [Nicotiana tomentosiformis]
Length=523

 Score =   455 bits (1171),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 229/526 (44%), Positives = 325/526 (62%), Gaps = 37/526 (7%)
 Frame = -1

Query  1652  IAALVLLWF------SWRKQSKRLPPEAGGAWPIIGHLHHFRTSV----PLVKTLSEWAD  1503
             IA LV L F      ++RK SK L PE  G WP+IGHL +F+        L + L + AD
Sbjct  18    IAGLVTLAFVFYFLWNFRKSSKTLAPEIPGGWPVIGHLFYFKNDADHDRTLAQKLGDLAD  77

Query  1502  KYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNN  1323
             K+GPVFT +LG  R LVVS+++ +++CFTTND   + RP    G +L Y+ A+   +   
Sbjct  78    KHGPVFTYKLGFRRFLVVSSYDAIKECFTTNDIRFSNRPALLYGDHLCYNNAMLFIAKYG  137

Query  1322  SYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNM  1143
              YWR +RKLV  E+LS  R+EK K++  S +Q N+ E Y            +     +N+
Sbjct  138   PYWRKIRKLVNQEVLSVNRLEKFKYIRFSIVQENVKELY------------DHCDSTINL  185

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             + W   L+ ++I++++AG+ Y        +   + LK  F + M +  EF   D IFP+ 
Sbjct  186   TDWIDKLSFDIILKMIAGKSYN-------NGHGEILKIAFQKFMVIAMEFELYD-IFPIP  237

Query  962   FFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNED------QKFIDVMLSMIDD  801
              F+W+D+ G+VK +K   KD+D + Q W+D   K+R SN +      Q FID MLS   +
Sbjct  238   LFKWVDFSGNVKVVKETFKDIDTVFQGWLDEHIKKRESNNEVLDENEQDFIDSMLSKTSN  297

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             +   G +YS  T IKA + S++ DA+ET A H+ W++A+L+ +   +K+ Q+EIDT +GK
Sbjct  298   E-RLGDTYSPSTTIKATIFSLVLDATETLALHIKWVMALLINNKLEMKKAQEEIDTIVGK  356

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             +RW E+SD+KNL YLQ +VKE LR+YP  P   PHE+VEDC+V+GYHIPKGT L  NV +
Sbjct  357   DRWVEESDIKNLVYLQAIVKEALRLYPPAPLSVPHESVEDCVVNGYHIPKGTVLLPNVMK  416

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             L RDPK+W DP KF PERF+T       + + Y+ +PFG GRR+CP   YA Q+  +++A
Sbjct  417   LQRDPKMWLDPNKFDPERFLTTHAKIDYRGQHYELIPFGTGRRACPAMTYALQVEYLSIA  476

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
              L QGFNF+T  NEPLDM E VGI  PK  P+EVL+TPRL   L++
Sbjct  477   HLIQGFNFNTPSNEPLDMKEGVGITSPKKNPIEVLITPRLPTMLYQ  522



>gb|ABC69420.1| CYP82E8 [Nicotiana tabacum]
Length=519

 Score =   455 bits (1170),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 230/533 (43%), Positives = 336/533 (63%), Gaps = 36/533 (7%)
 Frame = -1

Query  1670  LSSILGIAALV----LLWFSW-RKQSK---RLPPEAGGAWPIIGHLHHFRTSVP----LV  1527
             LS I  I   V    L +F W +KQSK    LPP+  G WP+IGHL +F+ +        
Sbjct  5     LSPIEAIVGFVTFSFLFYFLWTKKQSKILNPLPPKIPGGWPVIGHLFYFKNNGDEDRHFS  64

Query  1526  KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYA  1347
             + L + ADKYGPVFT RLG  R L VS++E +++CFTTND H A RP+   G+YL Y+ A
Sbjct  65    QKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFTTNDIHFADRPSLLYGEYLCYNNA  124

Query  1346  VFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNN  1167
             +   +    YW+  RKLV  E+LS  R+EK KHV  S +Q NI + Y         N ++
Sbjct  125   MLAVAKYGPYWKKNRKLVNQEVLSVSRLEKFKHVRFSIIQKNIKQLY---------NCDS  175

Query  1166  PSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVS  987
             P   K+N+S W   LT ++I+++V G+ Y        +   + LK  F + M    E   
Sbjct  176   PMV-KINLSDWIDKLTFDIILKMVVGKNYN-------NGHGEILKVAFQKFMVQAMEMEL  227

Query  986   GDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDV  822
              D +F + FF+WLD  G++K+MK+  KD+D I+Q W+D   K+R + +     +Q FIDV
Sbjct  228   YD-VFHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDEHIKKRETKDVGGENEQDFIDV  286

Query  821   MLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDE  642
             +LS + D+   G  YS DT IKA V +++ DA++T A H+ W++A+++ +   +K+ Q+E
Sbjct  287   VLSKMSDEHL-GEGYSHDTTIKATVFTLVLDATDTLALHIKWVMALMINNKHVMKKAQEE  345

Query  641   IDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQ  462
             +DT +G++RW E+SD+KNL YLQ +VKE LR++P  P    H +VEDC+V+GYHIPKGT 
Sbjct  346   MDTIVGRDRWVEESDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSVEDCVVNGYHIPKGTA  405

Query  461   LYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQ  282
             L  N+ +L RDP+ WP+P+KF PERF+T       + + Y+ +PFG GRR+CP   Y+ Q
Sbjct  406   LLTNIMKLQRDPQTWPNPDKFDPERFLTTHATIDYRGQHYESIPFGTGRRACPAMNYSLQ  465

Query  281   ITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             +  +++A + QGF+F+T  NEPLDM + VG+ LPK T +EVL+TPRL PTL++
Sbjct  466   VEHLSIAHMIQGFSFATTTNEPLDMKQGVGLTLPKKTDVEVLITPRLPPTLYQ  518



>ref|XP_006443549.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
 ref|XP_006479223.1| PREDICTED: cytochrome P450 82G1-like [Citrus sinensis]
 gb|ESR56789.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
Length=525

 Score =   454 bits (1169),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 218/524 (42%), Positives = 329/524 (63%), Gaps = 21/524 (4%)
 Frame = -1

Query  1661  ILGIAALVLLWFSWR-------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD  1503
             I  + +L++++  WR       K+ K   PE  GAWP+IGHL       P+ K L   AD
Sbjct  10    IFELLSLLIVYCFWRIIAKSINKREKNTAPEPSGAWPLIGHLPLLNGQEPICKILGALAD  69

Query  1502  KYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNN  1323
             KYGP++++RLG   IL+VS+WE V+DCFTTND+ +A R    AGK +GYD A+F  +   
Sbjct  70    KYGPIYSLRLGKHPILIVSSWEIVKDCFTTNDRILATRAKIVAGKLMGYDNAIFALAPYG  129

Query  1322  SYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNM  1143
              YWR++RK+   ELLSS R+E LKHV  SE+   I + Y+  +    +N  NP+  KV +
Sbjct  130   PYWRDIRKIATTELLSSHRLELLKHVRYSEVDTFIKDLYSLCS----ENAFNPA--KVVI  183

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLW  963
             S+    LT N+ ++++AG+R+  +       EA R+ +   +  +L+G F+ GDAI    
Sbjct  184   SKLIEQLTFNISLKLIAGKRFSAKDYEEQGSEAWRINRAIKEATHLFGVFILGDAIP---  240

Query  962   FFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNEDQK----FIDVMLSMIDDQF  795
             +  W+D++GHV SMK  AK++D ++ +W+  R + +   E        IDV+LS + +  
Sbjct  241   WLEWIDFQGHVGSMKSTAKEIDDVIGNWLKERLQNKLQGEGHNGKGDLIDVLLSKLQEDA  300

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
               G  ++RDTV+KA  L ++   SE+    + W +++LL HP+ LK+ Q+E+D ++G++R
Sbjct  301   VMG-GHTRDTVVKATALILILTGSESTYLGIIWTMSLLLNHPKELKKAQEELDVHVGRDR  359

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
             W  +SD+K L YL+ +VKETLR+YP GP     EA+EDC + GYH+PKGT+L VN+W+LH
Sbjct  360   WVNESDMKKLKYLRAIVKETLRIYPPGPVTGIREAMEDCEIGGYHVPKGTRLIVNIWKLH  419

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP++W +P +F PERF+T         + +++VPF  GRRSCPG     QI Q+ +AR+
Sbjct  420   RDPRMWENPCEFRPERFLTTHADVDVNTQHFEYVPFSFGRRSCPGMTSGLQIVQLTLARI  479

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
              QGF+ +TV   P+DM   +G+ LPK  PLEV++ PRL+  LFR
Sbjct  480   LQGFDLATVGGTPVDMQIGLGLALPKSNPLEVIIKPRLAEDLFR  523



>emb|CAN66023.1| hypothetical protein VITISV_042713 [Vitis vinifera]
Length=491

 Score =   453 bits (1165),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 225/495 (45%), Positives = 314/495 (63%), Gaps = 19/495 (4%)
 Frame = -1

Query  1682  VPCCLSSILGIAALVLLWFSWR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKT  1521
              P  L +I GI  LVLL+  WR      K   R  PE  GAWP +GHL   R   P+ +T
Sbjct  3     TPSQLVAISGILGLVLLYGVWRVMTLAGKSKGRSAPEPSGAWPFLGHLPLLRGQTPIFRT  62

Query  1520  LSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVF  1341
             L   ADK+GPVF IRLG+ R LVVS+ E V++CFTTNDK  A+RP+  AGK LGY+ A F
Sbjct  63    LGAMADKHGPVFMIRLGVQRALVVSSREAVKECFTTNDKVFASRPSXSAGKJLGYNXAGF  122

Query  1340  TFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPS  1161
              F+   + WR +RKL ++E+LS+RR++  KHV +SEL  +I + Y+       K ++   
Sbjct  123   XFAPYGALWREMRKLSMMEILSARRLDAJKHVQISELDLSIKDLYSL-----GKGSDWVH  177

Query  1160  APKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGD  981
               KV MS WF HL+ N+ ++++ G+RY + + G   EEA+R      + + L G FV  D
Sbjct  178   PVKVVMSEWFQHLSFNIXLKMIXGKRY-FNTSGHGIEEARRAIATIQEFLSLXGAFVLSD  236

Query  980   AIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSMI  807
             AI  +    W+D +G++ SMKR AK+ D+++  WV+    R     N+ Q FIDVMLS++
Sbjct  237   AIPGV---EWMDLQGYLGSMKRVAKEXDSLVGGWVEEHEXRLNSEGNKXQDFIDVMLSVL  293

Query  806   DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
             +D  T  + +SR+TVIKA ++ ++   +ET AT  TW+L+ LL    +LKR Q+E+D  +
Sbjct  294   ED--TSMFGHSRETVIKATIMILIVGGTETVATTSTWLLSALLNXKHALKRAQEELDLKV  351

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             G+ RW E+SD+ NL YLQ V+KETLR+Y   P   PHEA+EDC V GYHIPKGT+L+VN 
Sbjct  352   GRGRWVEESDIPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPKGTRLFVNA  411

Query  446   WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             W+LHRDP +W DPE F PERF+T+        + ++ +PFG GRRSCPG   A ++  + 
Sbjct  412   WKLHRDPSVWSDPEDFQPERFLTSHADXDVLGQHFELIPFGSGRRSCPGITMALKLLPLV  471

Query  266   VARLFQGFNFSTVPN  222
             + RL QGF+ ST  N
Sbjct  472   IGRLLQGFDLSTPLN  486



>ref|XP_010437977.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=525

 Score =   454 bits (1168),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 227/507 (45%), Positives = 325/507 (64%), Gaps = 32/507 (6%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCF  1419
             P+  GAWPIIGHLH       L+ +TL   AD+YGPV ++RLG S   VVS++E  +DCF
Sbjct  33    PKLSGAWPIIGHLHLLVGKEQLLYRTLGRMADRYGPVMSLRLGSSEAFVVSSFEVAKDCF  92

Query  1418  TTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWV  1239
             T NDK +A+RP T A K++GY+YAVF F+  N++WR +RK+  +ELLS+RR++ LKHV V
Sbjct  93    TVNDKALASRPMTAAAKHMGYNYAVFGFAPYNAFWREMRKIATIELLSNRRLQMLKHVSV  152

Query  1238  SELQANINEFYTTIAMDNDKNNNNPSAP-KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDG  1062
             SE+   + + Y+          N  S P  V++ RW  ++TLN+I+++VAG+RY     G
Sbjct  153   SEISMGVKDLYSLWV------KNGGSEPVMVDLKRWLDNMTLNMIVRMVAGKRY---FGG  203

Query  1061  VV-------SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKD  903
             VV       +EEA++ K   S+  +L G F   DA FP    RW D++GH K MK+   +
Sbjct  204   VVGSESSEDTEEARQCKMAISKFFHLIGIFTVSDA-FPR--LRWFDFQGHEKEMKQTGSE  260

Query  902   VDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             +D IL+ W+D  R+ER+       D  FIDVMLS+ +        Y  +  IK+  L+++
Sbjct  261   LDVILERWIDNHRQERKVSGTKENDSDFIDVMLSLAEQGKLSHLQYDANISIKSTCLALI  320

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
                SET ++ LTW +A+LL + E LK+ QDEID ++G++R  EDSD+ NL YLQ ++KET
Sbjct  321   LGGSETTSSTLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKET  380

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTN  375
             LR+YP GP L P EA+EDC V GY++  GT+L VNVW++ RDPK++ +P +F PERF+T 
Sbjct  381   LRLYPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYKEPNEFRPERFIT-  439

Query  374   LEGEAAQ----NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDM  207
               GEA +     + ++ +PFG GRRSCPG+  A Q+  + +AR    F   TV + P+DM
Sbjct  440   --GEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDM  497

Query  206   MEDVGIILPKLTPLEVLVTPRLSPTLF  126
              E  G+ +PK TPLEVL++PRL+   F
Sbjct  498   TESPGLTIPKATPLEVLISPRLNEHFF  524



>ref|XP_007049687.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOX93844.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=527

 Score =   454 bits (1167),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 233/528 (44%), Positives = 329/528 (62%), Gaps = 23/528 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFSWRKQSKR-------LPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1512
             L +I G   LVL +  W+K +         L PE  GA PIIGH+H       L +TL  
Sbjct  7     LFAIAGFLGLVLFYKLWKKGTPSHQRKGILLAPEPPGALPIIGHIHLLGGKRTLAQTLGA  66

Query  1511  WADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFS  1332
              ADKYGP+F+IR G    L++SN E V++CFTTND+ +A+RP + AG YLGYD+A F F+
Sbjct  67    MADKYGPIFSIRFGAFPALIISNHEAVKECFTTNDRVLASRPKSNAGTYLGYDHAGFGFA  126

Query  1331  TNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPK  1152
                 YWR  RKL VVELLSS R+E  KHV   E+ A I   Y        K N   + PK
Sbjct  127   PYGEYWRETRKLAVVELLSSHRLETSKHVLDFEVNAFIKNLYLFC-----KKNGPDANPK  181

Query  1151  VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
               +S  F  LTLN I +++AG+RY    D     EA+ + KV    MY+ G     +A  
Sbjct  182   AVISHKFEALTLNTITRMIAGKRYISDGDEEDDVEARHVIKVIKDFMYVSGLIAPSEA--  239

Query  971   PLWFFRWLD--YEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE----DQKFIDVMLSM  810
              + F  W++  + G VKSMKR AK++D+I+  WVD  + +R  +E    +Q FID++LS 
Sbjct  240   -MPFLGWMESIFGGPVKSMKRVAKEIDSIIGRWVDEHKLKRLMSEADHNNQDFIDLLLSA  298

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
             I +     + Y+R+T+IKA V+++    ++T +  LTWIL+ L+ +  +LK  Q+E+D  
Sbjct  299   IGED--SMFGYTRETIIKATVMNLFLAGADTTSIALTWILSNLMNNRHTLKTAQEELDLT  356

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +G+++W +DSD++ L YLQ V+KETLR+YP GP   PHEA EDC + GYH+ KGT++ VN
Sbjct  357   VGRDKWVQDSDIEKLVYLQAVIKETLRLYPPGPISVPHEAREDCSISGYHVQKGTRVIVN  416

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             + RLHRDP+IW +P++F PERF+T+        + ++ +PFG GRRSCPG   A QIT +
Sbjct  417   LRRLHRDPRIWSNPDEFQPERFLTSHANVDVLGQHFELIPFGSGRRSCPGMPLALQITHL  476

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +AR  QGF+ +T  NE +DM E +GI +PK TPL+VL++PRL   L+
Sbjct  477   TIARTLQGFDLTTPFNESVDMTEGLGITMPKATPLDVLLSPRLPAALY  524



>ref|XP_010253830.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 224/503 (45%), Positives = 324/503 (64%), Gaps = 20/503 (4%)
 Frame = -1

Query  1604  RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRD  1425
             R  P+  GAWPIIGHLH FR S  L   L   ADKYGP F +RLG+ R LVVS+W+  + 
Sbjct  35    RQAPQPSGAWPIIGHLHLFRASELLHPKLGAMADKYGPAFMLRLGMRRALVVSSWDAAKQ  94

Query  1424  CFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHV  1245
             CFTTNDK  + RP T A K++GY+YA+  F+    YWR +RK+  VELLS RR++  KH+
Sbjct  95    CFTTNDKVFSTRPRTVAIKHMGYNYALPGFAPYGPYWREMRKISTVELLSHRRLDMFKHI  154

Query  1244  WVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSD  1065
               SE+  ++ + YT         N + S   V M +WF  LT+N++ +++AG+RY   ++
Sbjct  155   RTSEIDLSMKDLYTRWV-----KNGHGSPVLVEMKQWFSDLTMNIVTRMIAGKRYFGAAN  209

Query  1064  --GVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAI  891
                   EE Q+ KK  ++ M+L G FV  DA   L F  WLD +GH ++MKR AK +D +
Sbjct  210   YTDFSEEEVQKCKKAITEFMHLVGIFVVSDA---LPFLGWLDLQGHERAMKRTAKQLDHM  266

Query  890   LQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD  729
             L+ W+   R ++R++E      ++ F+DV+LS++DD   Q   Y  DTV+KA  L ++  
Sbjct  267   LESWLKEHRCKKRASEGIATADERDFMDVLLSILDDH--QCIGYGTDTVVKATCLGLILG  324

Query  728   ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR  549
              S+T +  LTW L++LL + ++LK+ QDE+DT +G++   E+SD++NL YLQ +VKETLR
Sbjct  325   GSDTTSVTLTWALSLLLNNRQALKKAQDELDTKVGRDGLVEESDIRNLVYLQAIVKETLR  384

Query  548   MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE  369
             +YP     AP EA+EDC V G+HIP GTQL VN+W+L RDP IWP P +F PERF+T+  
Sbjct  385   LYPAAAVSAPREAMEDCTVAGFHIPAGTQLLVNIWKLQRDPSIWPHPCEFSPERFLTSHA  444

Query  368   GEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFST-VPNEPLDMMEDV  195
              +   + + ++ +PFG GRR+CPG  +A Q+  + +ARL QGF+  T   +  +DM + +
Sbjct  445   ADIDVRGQHFELLPFGSGRRACPGISFAIQVLHLTLARLIQGFDLGTPCCDAMVDMTQGI  504

Query  194   GIILPKLTPLEVLVTPRLSPTLF  126
             G+   K TPL+VL+TPRL P L+
Sbjct  505   GLTNHKKTPLDVLLTPRLHPLLY  527



>ref|XP_006486179.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 219/503 (44%), Positives = 324/503 (64%), Gaps = 15/503 (3%)
 Frame = -1

Query  1625  SWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVS  1446
             + +K+  +  PEAGGAWP+IGHLH  R S P  + L   ADKYGP+FT++LG+ + LVVS
Sbjct  37    TLKKKQAQQAPEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVS  96

Query  1445  NWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRR  1266
             NWE  ++CFTTNDK  A RP T A + LGY++ V  F+   +YWR  RK+  +ELLS+RR
Sbjct  97    NWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRR  156

Query  1265  MEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGR  1086
             +EKLKHV  SE++A+I   Y         ++++     V M  W     L++I++I+AG+
Sbjct  157   LEKLKHVRESEVKASIQRLYKNCIS----SSSSRKVVSVEMIHWLEGTVLDIILRIIAGK  212

Query  1085  RYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAK  906
             RY  +S     +E    ++  ++   L G+FV  DA   L F RWLD  G+ + M + AK
Sbjct  213   RYTSQS-----QEVNDWQQQITKFTALSGQFVVSDA---LPFLRWLDIGGYERLMSKTAK  264

Query  905   DVDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
               D ILQ+W+D  + +R S +   D+ F+ V+LS++DD   Q      D VIKAI ++++
Sbjct  265   YFDIILQEWLDEHKMKRDSGDAKGDEDFMYVLLSLLDDNAEQLPDRDADAVIKAICVTLI  324

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
               A++T    LTW +A+L+ + + LK+ QDE+D  +G ER   +SD +NL YLQ ++KET
Sbjct  325   VAAADTSVVTLTWAIALLVNNRDVLKKAQDELDIQVGTERPVNESDARNLVYLQAIIKET  384

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTN  375
             +R+YP  P L PHE +E+CIV+GYH+P GTQL+VN W++ RDP +W +P +F PERF+T 
Sbjct  385   MRLYPAAPLLLPHECIEECIVNGYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTR  444

Query  374   LEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV  195
              +      + ++ +PFG GRR CP   +  Q+ Q+ +A L  GF+F+T  +EP+DM E +
Sbjct  445   HKDIDVGGQDFELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAM  504

Query  194   GIILPKLTPLEVLVTPRLSPTLF  126
             G+ + K TPLEVLV+PRLS +L+
Sbjct  505   GLTIAKATPLEVLVSPRLSASLY  527



>ref|XP_004247061.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=518

 Score =   452 bits (1163),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 224/517 (43%), Positives = 327/517 (63%), Gaps = 25/517 (5%)
 Frame = -1

Query  1658  LGIAALVLLWFSWRKQSKRL---PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPV  1488
             L IA  + ++ + + +S+ +    P+A GAWP IGHLH     +P+ +TL   ADKYGP+
Sbjct  20    LSIAWFLAVFIARKYKSRNITSAAPKAPGAWPFIGHLHLLSGHLPVCRTLGLMADKYGPI  79

Query  1487  FTIRLGISRILVVSNWEGVRDCFTT-NDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWR  1311
             F ++LG    +VVSNWE V+DCFT  NDK  A+RP     KYLGY+ A+F  +    YWR
Sbjct  80    FQLQLGDHPAIVVSNWEMVKDCFTAKNDKIFASRPNMAISKYLGYNGAIFALAPYGPYWR  139

Query  1310  NVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWF  1131
             N+RK+V +ELL++ R+EKLKHV  SE+ + I E Y+         NN P   +VN+S WF
Sbjct  140   NIRKMVTLELLTNSRLEKLKHVRTSEVNSCIKELYS---------NNCPG--QVNLSSWF  188

Query  1130  GHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW  951
              ++T N+I++++AG+R+        S E    K+   + +YL G FV  D+I P  +F W
Sbjct  189   ENITCNIIIRMLAGKRF------TGSAEEMNFKESIKKALYLGGTFVFSDSI-P--WFEW  239

Query  950   LDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSR  771
             +D  GH+K+MK   K+VD++   W+          E   FID+MLS + ++      Y+R
Sbjct  240   MDIGGHIKAMKDTYKEVDSVFDSWLKQHINSIGDGEQSDFIDIMLSTLPEETNMESGYNR  299

Query  770   DTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVK  591
             D +IKA  L ++  ASE+ A  L W L++LL +  SLK  QDE+D +IG+ +W E+SD+K
Sbjct  300   DAIIKATTLILIMTASESTAETLIWALSLLLNNTHSLKLAQDELDEHIGRNKWVEESDIK  359

Query  590   NLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPD  411
             NLPYLQ +VKETLR+YP GP   P EA+EDC VD YHI KGT+L VN+W+L RD +IW D
Sbjct  360   NLPYLQAIVKETLRLYPPGPLAGPREALEDCYVDKYHIKKGTRLIVNLWKLQRDSRIWKD  419

Query  410   PEKFLPER-FMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFS  234
             P +F PER F+        + + ++++PF  GRR CPG  + +Q+  + +A+L  GFN S
Sbjct  420   PNEFKPERWFLKEHTNINFRGQNFEYIPFSSGRRMCPGLTFGSQVVHLTLAKLLHGFNVS  479

Query  233   TVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
              +  EP+D+ E +GI LPK+ PL+ L++PRL+  L++
Sbjct  480   MLKEEPVDLSEGLGIALPKVKPLQPLLSPRLAVELYQ  516



>ref|XP_007017417.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
 gb|EOY14642.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
Length=528

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/492 (45%), Positives = 319/492 (65%), Gaps = 9/492 (2%)
 Frame = -1

Query  1607  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             KR  PEA GA P +GHLH    S P    L + AD YGP+FTIRLG+   LVVSNWE  +
Sbjct  38    KRKAPEASGARPFLGHLHLLGGSKPAHVVLGDLADTYGPIFTIRLGVRLTLVVSNWEIAK  97

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +CFTTNDK  A RP T A + LGY+YA+F FS    YWR +RK+V +E+LS+ R+EKLKH
Sbjct  98    ECFTTNDKAFANRPRTLAAELLGYNYAMFGFSPYGPYWRQIRKIVTLEVLSNHRLEKLKH  157

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
             +  SE++ +I E Y  + ++   N+++     V M RWF  L +N++ ++V G+RY    
Sbjct  158   IRESEVRTSIKELYK-LGVEGVSNSSSGKV-LVEMKRWFWTLNINMVFKMVVGKRYSEAE  215

Query  1067  DGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAIL  888
                  +E  R +K       L G F  GD+   L F RWLD  GH K+MK+ AK++D IL
Sbjct  216   TSHGKDENDRRRKALRDFFELTGTFTVGDS---LPFLRWLDLGGHEKAMKKTAKELDHIL  272

Query  887   QDWVDARRKERRSN---EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET  717
             ++W++  +++R S     +  F+ +MLS+++D   +  SY  DT+ KA  LS++  AS+T
Sbjct  273   EEWLEEHKQKRNSGNAESEHDFMGMMLSLLNDA-AELPSYDADTINKATCLSLILAASDT  331

Query  716   FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ  537
                 LTW L++LL +  +LK+ Q+E+D ++G+++  E+SD+K L YLQ ++KETLR+YP 
Sbjct  332   TMVTLTWALSLLLNNRNALKKAQEELDIHVGRDKLVEESDIKKLVYLQAIIKETLRLYPA  391

Query  536   GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA  357
              P   PHE++EDC+V GYHIP GT+L +N++++HRDP  W DP +F PERF+T  +    
Sbjct  392   APLSVPHESMEDCVVSGYHIPAGTRLLINLYKIHRDPHAWSDPCEFQPERFLTTYKDFDV  451

Query  356   QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPK  177
             + + ++ +PFG GRR CPG   A Q+ ++ +A L QGF   T  +EP+DM E +GI   K
Sbjct  452   RGQNFELIPFGSGRRMCPGVSLALQVLELTLANLLQGFELGTPLDEPVDMGEAIGITNLK  511

Query  176   LTPLEVLVTPRL  141
             ++PLEVL+TPRL
Sbjct  512   VSPLEVLITPRL  523



>ref|XP_010918630.1| PREDICTED: cytochrome P450 82C4-like [Elaeis guineensis]
Length=493

 Score =   451 bits (1160),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 225/503 (45%), Positives = 319/503 (63%), Gaps = 18/503 (4%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNW  1440
             +K   + PP+  G+WPIIGHLH  R+  PL     E ADKYGPVF + LG+ R LVV++W
Sbjct  3     KKTKIKEPPKPSGSWPIIGHLHLLRSQKPLAHLFGEMADKYGPVFMLHLGMRRTLVVNSW  62

Query  1439  EGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRME  1260
             E  ++C  TNDK  A RP   AGK+LGY+YA+  F+   SYWR+VRK+++VELLS+ R+E
Sbjct  63    EAAKECLATNDKVFATRPGNAAGKHLGYNYAMVGFAPYGSYWRSVRKIIMVELLSNARLE  122

Query  1259  KLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY  1080
              LKHV   E+   I E Y        +NN  P   KV M RW G L  N+++++VAG+R 
Sbjct  123   TLKHVRSMEMDTCIRELYELWL----RNNRRPV--KVEMKRWLGGLAYNIVVRVVAGKR-  175

Query  1079  EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDV  900
              Y   G  S+EA R +K  S++  L   FV+ D +FP    +W+D+ GH  +MK  A++V
Sbjct  176   -YFGSGTGSDEAWRFRKAISRLFGLLDAFVASD-MFPC--LKWMDWRGHESAMKNTAQEV  231

Query  899   DAILQDWVDARRKERRSNED----QKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ  732
             D+I+   ++  R+ R S +     Q F+DVMLS+++D    G     D VIKA  L+++ 
Sbjct  232   DSIMAGLLEEHRQRRLSGKATGGPQDFMDVMLSIVEDAEFSGMDV--DAVIKATSLALIM  289

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
               ++T  T L W LA+L+K+P+ LK+ QDEID  +GK+R  E+SDVKNL YLQ +VKE L
Sbjct  290   GGTDTTTTSLAWTLALLVKNPQVLKKAQDEIDAVVGKDRHVEESDVKNLLYLQAIVKEVL  349

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R+YP    L  HEA+ DC + GY +  GT+L+VNVW+L RDP +W +P +F PERF++  
Sbjct  350   RLYPAAKLLVQHEAMADCRIGGYDVAAGTRLHVNVWKLQRDPLVWSEPNEFRPERFLSAP  409

Query  371   E-GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV  195
               G   + + ++ +PFG GRRSCPG  +A Q+  + +ARL QGF   T    P +M +D+
Sbjct  410   HAGVDVRGQHFELIPFGSGRRSCPGISFALQVMHLTLARLIQGFELETPGGGPSEMADDL  469

Query  194   GIILPKLTPLEVLVTPRLSPTLF  126
             G+  P  TPLEVL++PRL+  L+
Sbjct  470   GLPYPNTTPLEVLLSPRLADMLY  492



>ref|XP_010447469.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=527

 Score =   452 bits (1162),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 232/534 (43%), Positives = 337/534 (63%), Gaps = 38/534 (7%)
 Frame = -1

Query  1658  LGIAALVLLWFSWRKQSKR------LPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADK  1500
             L +  +V ++ +  K+SK+       PP+  GAWPIIGHLH       L+ +TL   AD+
Sbjct  8     LFVPIIVFVFIALFKKSKKPKHVLVKPPKPSGAWPIIGHLHLLVGKEQLLYRTLGRLADR  67

Query  1499  YGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNS  1320
             YGP  ++RLG S   VVS++E  +DCFT NDK +A+RP T A K++GY+YAVF F+  N+
Sbjct  68    YGPTMSLRLGSSEAFVVSSFEVAKDCFTVNDKALASRPMTAAAKHMGYNYAVFGFAPYNA  127

Query  1319  YWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP-KVNM  1143
             +WR +RK+  +ELLS+RR++ LKHV VSE+   + + Y+          N  S P  V++
Sbjct  128   FWREMRKIATIELLSNRRLQMLKHVSVSEISMGVKDLYSLWV------KNGGSEPVMVDL  181

Query  1142  SRWFGHLTLNLIMQIVAGRRYEYRSDGVV-------SEEAQRLKKVFSQVMYLWGEFVSG  984
              RW  ++TLN+I+++VAG+RY     GVV       +EE ++ K   S+  +L G F   
Sbjct  182   RRWLDNMTLNMIVRMVAGKRY---FGGVVGSESSEDTEEGRQCKTAISKFFHLIGIFTVS  238

Query  983   DAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE----DQKFIDVML  816
             DA FP    RW D++GH K MK+   ++D IL+ W+D  R+ER+ +     D  FI VML
Sbjct  239   DA-FP--SLRWFDFQGHEKEMKQTGSELDVILEKWIDNHRQERKVSGTEEIDSDFIHVML  295

Query  815   SMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEID  636
             S+ +        Y  +  IK+  L+++   SET ++ LTW +A+LL + E LK+ QDEID
Sbjct  296   SLAEQGKLSHLQYDANISIKSTCLALILGGSETTSSTLTWAIALLLNNKEMLKKAQDEID  355

Query  635   TNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLY  456
              ++G++R  E SD+ NL YLQ VVKETLR+YP GP L P EA+EDC V GY++ +GT+L 
Sbjct  356   LHVGRDRNVEVSDINNLVYLQAVVKETLRLYPAGPLLGPREAMEDCTVAGYNVTRGTRLI  415

Query  455   VNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYA  288
             VNVW++ RDPK++ +P +F PERF+T   GEA +     + ++ +PFG GRRSCPG+  A
Sbjct  416   VNVWKIQRDPKVYKEPNEFRPERFIT---GEAKEFDVRGQNFELMPFGSGRRSCPGSSLA  472

Query  287   TQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              Q+  + +AR    F   TV + P+DM E  G+ +PK TPLEVL++PRL+  LF
Sbjct  473   MQVLHLGLARFLHSFEVKTVLDMPVDMTESPGLTIPKATPLEVLISPRLNEHLF  526



>ref|XP_002510298.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52485.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   451 bits (1159),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 234/528 (44%), Positives = 333/528 (63%), Gaps = 26/528 (5%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFSWRKQSK-------RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLS  1515
             L++I  I + + +  +W +  K       R  PE  G+WPIIGHLH    +  L+ +TL 
Sbjct  7     LTAIAVIISFIFVCSTWLRGKKKSVGSKSREAPEPAGSWPIIGHLHLLGGADKLLHRTLG  66

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
               ADKYGP F IR+G  R LVV++ E  ++CFT NDK +A+R TT A K++ YD+AVF F
Sbjct  67    SLADKYGPAFNIRIGSHRALVVASKELAKECFTINDKTLASRSTTAATKHMCYDHAVFGF  126

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +  +S+WR +RK+V++ELLS+RR+E +KHV  SE+   I + Y   A    +N   P   
Sbjct  127   APYSSHWREMRKIVMLELLSNRRLEMVKHVQASEVDLGIRKLYNLWA----QNRCLPVI-  181

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              V + ++F  LTL++I+++VAG+RY   SD    +EA++ +K  SQ  +L G FV  DA 
Sbjct  182   -VELKQFFEDLTLDVIVRVVAGKRYTGSSD---DDEARQYQKAISQFFHLMGIFVVSDA-  236

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDVMLSM  810
               L F RWLD EGH K+MK+ AKD+DA+L  W+D  R+ R S E     DQ FIDVMLS+
Sbjct  237   --LPFLRWLDLEGHEKAMKKTAKDLDAVLAGWLDEHRRRRVSGEVKSEGDQDFIDVMLSL  294

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
              +     G+ Y  DT IK+  L+++  AS+T  T L W +++LL +  +LK  ++E++ +
Sbjct  295   EEKGHLSGFQYDADTSIKSTCLALIAGASDTTTTTLVWAISLLLNNQLALKNAKEELEKH  354

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             IG ER  ++SD+KNL YLQ V+KETLR+YP  P L P E VEDC V GYH+P GT+L VN
Sbjct  355   IGTERQVDESDLKNLVYLQAVIKETLRLYPVAP-LIPREFVEDCRVGGYHVPAGTRLLVN  413

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             VW++ RDP +W     F PERF+T+      +   ++ +PFG GRRSCPG  +A     +
Sbjct  414   VWKIQRDPMLWTKASAFQPERFLTSHADIDVRGHHFELLPFGSGRRSCPGASFALHALHL  473

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +AR    F+ +T  ++P+DM E  G  LPK TPLEVL++PRL   L+
Sbjct  474   TLARFLHAFDVATPMDQPVDMTERSGTTLPKATPLEVLLSPRLPAKLY  521



>ref|XP_006435903.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
 gb|ESR49143.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
Length=528

 Score =   450 bits (1158),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 218/503 (43%), Positives = 323/503 (64%), Gaps = 15/503 (3%)
 Frame = -1

Query  1625  SWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVS  1446
             + +K+  +  PEAGGAWP+IGHLH  R S P  + L   ADKYGP+FT++LG+ + LVVS
Sbjct  37    TLKKKQAQQAPEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVS  96

Query  1445  NWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRR  1266
             NWE  ++CFTTNDK  A RP T A + LGY++ V  F+   +YWR  RK+  +ELLS+RR
Sbjct  97    NWEIAKECFTTNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRR  156

Query  1265  MEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGR  1086
             +EKLKHV  SE++A+I   Y         ++++     V M  W     L++I++I+AG+
Sbjct  157   LEKLKHVRESEVKASIQRLYKNCIS----SSSSRKVVSVEMIHWLEGTVLDIILRIIAGK  212

Query  1085  RYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAK  906
             RY  +S     +E    ++  ++   L G+FV  DA   L F RWLD  G+ + M + AK
Sbjct  213   RYTSQS-----QEVNDWQQQITKFTALSGQFVVSDA---LPFLRWLDIGGYERLMSKTAK  264

Query  905   DVDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
               D ILQ+W+D  + +R S +   D+ F+ V+LS++DD   Q      D VIKAI ++++
Sbjct  265   YFDIILQEWLDEHKMKRDSGDAKGDEDFMYVLLSLLDDNAEQLPDRDADAVIKAICVTLI  324

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
               A++T    LTW +A+L+ + + LK+ QDE+D  +G ER   +SD +NL YLQ ++KET
Sbjct  325   VAAADTSVVTLTWAIALLVNNRDVLKKAQDELDIQVGTERPVNESDARNLVYLQAIIKET  384

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTN  375
             +R+YP  P L PHE +E+CIV+GYH+P GTQL+VN W++ RDP +W +P +F PERF+T 
Sbjct  385   MRLYPAAPLLLPHECIEECIVNGYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTR  444

Query  374   LEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV  195
              +      + ++ +PFG GRR CP   +  Q+ Q+ +A L  GF+F+T  +EP+DM E +
Sbjct  445   HKDIDVGGQDFELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAM  504

Query  194   GIILPKLTPLEVLVTPRLSPTLF  126
             G+ + K TPLEVLV+PR S +L+
Sbjct  505   GLTIAKATPLEVLVSPRHSASLY  527



>ref|XP_006435899.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
 gb|ESR49139.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
Length=528

 Score =   450 bits (1158),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 223/500 (45%), Positives = 322/500 (64%), Gaps = 16/500 (3%)
 Frame = -1

Query  1616  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWE  1437
             KQS++  P AGGAWP+IGHLH  R   P  + L   ADKYG +FT++LG+ + LVVSNWE
Sbjct  41    KQSQQ-APVAGGAWPLIGHLHLLRGPEPAHRVLGNLADKYGTIFTMKLGVKQALVVSNWE  99

Query  1436  GVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEK  1257
               ++CFTTNDK  A+RP   A + +GY+++V  F+    YWR  RK+V +ELLS+RR+EK
Sbjct  100   IAKECFTTNDKAFASRPKRMAVELMGYNFSVIGFAPYGKYWRQSRKIVTIELLSNRRLEK  159

Query  1256  LKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             LKHV  SE++A+I   Y      +           V M  W     L++I++I+AG+R+ 
Sbjct  160   LKHVRESEVKASIQRLYKNCISSSSSRKVV----SVEMIHWLEGTALDIILRIIAGKRHT  215

Query  1076  YRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVD  897
              +S     EEA   ++  +++  L+G+FV  DA   L F R LD  G+ + M + AK  D
Sbjct  216   SQS-----EEANDWQQQITKIAALFGQFVVSDA---LPFLRRLDIGGYERLMSKTAKYFD  267

Query  896   AILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA  726
              ILQ+W+D  + +R S E   D+ FI V+LS++DD   Q      DTVIKAI LS++   
Sbjct  268   IILQEWLDEHKMKRVSGEVKGDEDFIYVLLSLLDDNAEQLPDRDADTVIKAICLSLIVAG  327

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             ++T    LTW +A+LL +PE LK+ +DEID  +G ER   +SD +NL YLQ ++KET+R+
Sbjct  328   TQTTVVTLTWAIALLLNNPEVLKKARDEIDIQVGTERPVNESDTRNLVYLQAIIKETMRL  387

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP GP L PHE++E+CIV+GYH+P GTQL+VN W++ RDP +W +P +F PERF+T  + 
Sbjct  388   YPAGPLLLPHESIEECIVNGYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKD  447

Query  365   EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII  186
                  + ++ +PFG GRR CP   Y  Q+  + +A L +GF+F+T   EP+DM E +G+ 
Sbjct  448   IDVGGQDFELIPFGSGRRMCPAVSYGLQVMPLMLASLVRGFDFTTPSGEPVDMGESMGLS  507

Query  185   LPKLTPLEVLVTPRLSPTLF  126
             + K TPLEVL++PRLS + +
Sbjct  508   IAKATPLEVLLSPRLSASSY  527



>emb|CDP15728.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   450 bits (1158),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 215/496 (43%), Positives = 316/496 (64%), Gaps = 11/496 (2%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             PE  GA P IGHLHH    +PL + L   ADK+GP+F++RLG    +VVS+WE V+DCFT
Sbjct  40    PEPPGALPFIGHLHHLGGQLPLARILGSMADKHGPIFSLRLGSRPAIVVSSWEMVKDCFT  99

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
             TNDK  A+RP     KY+G + A+F+ +    YWR+VRK+V +ELL+++R+EKLKHV  S
Sbjct  100   TNDKTFASRPNMAVAKYMGNNNAIFSLAPYGPYWRDVRKMVTLELLTNQRLEKLKHVRAS  159

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E    I + Y+  + ++  + + P+  KV ++ WF  LT NLI++++ GR +   S G  
Sbjct  160   EFNKWIRDLYSLCSKNDRPDVDVPT--KVVLNEWFELLTFNLILRMLVGRPFSTSSQGND  217

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV  876
             + E +RLK+   + +YL G FV  D I    +  WLD  GH+KSMK+A K++D +L  W+
Sbjct  218   NSEDRRLKEAIKKALYLSGVFVFSDVIP---WIEWLDIGGHIKSMKKAGKELDEVLGQWL  274

Query  875   D-----ARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
                   A++    S     F+DVMLS I  +  +   + RD +IK+   +++   SE+ A
Sbjct  275   QEHIQKAKQSHPESEAVHDFMDVMLSTIP-EIGEISGHKRDAIIKSTTATLILTGSESTA  333

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
               L W L++LL HP  LK  Q+E+D  +GK+RW E++D+KNL +LQ +VKET R+YP GP
Sbjct  334   ETLIWALSLLLNHPNILKIAQNELDVQVGKQRWIEEADIKNLSFLQAIVKETFRLYPPGP  393

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN  351
                P EA EDC +  + +PKG +L VN+W+LHRDP+IW DP +F PERFM + E  + + 
Sbjct  394   LSGPREATEDCYLGNFFVPKGARLIVNLWKLHRDPRIWSDPLEFKPERFMNSHENISLKG  453

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
             + ++++PF  GRR CP   Y   + Q+ +AR+ Q F+ +T    P+DM E +G+ LPKL 
Sbjct  454   QSFEYIPFSSGRRMCPAVNYGMNVVQLTLARMLQAFDITTPMGMPVDMGEGLGVALPKLK  513

Query  170   PLEVLVTPRLSPTLFR  123
             PLEVL+TPRL   L++
Sbjct  514   PLEVLLTPRLPVELYQ  529



>dbj|BAA35080.1| putative cytochrome P450 [Nicotiana tabacum]
 gb|AAK62347.1| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=519

 Score =   449 bits (1155),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 230/533 (43%), Positives = 333/533 (62%), Gaps = 36/533 (7%)
 Frame = -1

Query  1670  LSSILGIAALV----LLWFSW-RKQSK---RLPPEAGGAWPIIGHLHHFRTSVP----LV  1527
             LS I  I  LV    LL+  W +KQSK    LPP+  G WP+IGHL +F  +        
Sbjct  5     LSPIEAIVGLVTFAFLLYLLWTKKQSKILNPLPPKIPGGWPVIGHLFYFNNNGDDDRHFS  64

Query  1526  KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYA  1347
             + L + ADKYGPVFT RLG  R L VS++E +++CF+TND H A RP    G+YL Y+ A
Sbjct  65    QKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFSTNDIHFADRPALLYGEYLCYNNA  124

Query  1346  VFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNN  1167
             +   +    YW+  RKLV  ELLS  R+EK KHV  S +Q NI + Y         N ++
Sbjct  125   MLAVAKYGPYWKKNRKLVNQELLSVSRLEKFKHVRFSIVQKNIKQLY---------NCDS  175

Query  1166  PSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVS  987
             P   K+N+S W   LT ++I+++V G+ Y        +   + LK  F + M    E   
Sbjct  176   PMV-KINLSDWIDKLTFDIILKMVVGKTYN-------NGHGEILKAAFQKFMVQAMEIEL  227

Query  986   GDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE-----DQKFIDV  822
              D +F + FF+WLD  G++K+MK+  KD+D I+Q W+D   K+R + +     +Q FIDV
Sbjct  228   YD-VFHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDEHIKKRETKDVGGENEQDFIDV  286

Query  821   MLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDE  642
             +LS   ++   G  YS DT IKA V +++ DA++T A H+ W++A+++ +   +K+ Q+E
Sbjct  287   LLSKRSNEHL-GDGYSHDTTIKATVFTLVLDATDTLALHIKWVMALMINNKNVMKKAQEE  345

Query  641   IDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQ  462
             +DT +G++RW E++D+KNL YLQ +VKE LR++P  P    H +V+DC+V+GYHIPKGT 
Sbjct  346   MDTIVGRDRWVEENDIKNLVYLQAIVKEVLRLHPPAPLSVQHLSVKDCVVNGYHIPKGTA  405

Query  461   LYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQ  282
             L  N+ +L RDP+IW DP+ F PERF+T       + + Y+ +PFG GRR+CP   Y+ Q
Sbjct  406   LLTNIMKLQRDPQIWVDPDTFDPERFLTTNAAIDYRGQHYELIPFGSGRRACPAMNYSLQ  465

Query  281   ITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             +  +++A L QGFNF+T  NEPLDM + VG+ LPK T +EVL+TPRL PTL++
Sbjct  466   VEHLSIAHLIQGFNFATTTNEPLDMKQGVGLTLPKKTDVEVLITPRLPPTLYQ  518



>gb|KEH25406.1| cytochrome P450 family protein [Medicago truncatula]
Length=516

 Score =   449 bits (1154),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 236/518 (46%), Positives = 341/518 (66%), Gaps = 29/518 (6%)
 Frame = -1

Query  1643  LVLLWFSWR--KQSKRL----PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT  1482
             LVL++  W+  K S +     PPE   A P+IGHLH     +PL +  + ++DKYGPVF 
Sbjct  17    LVLIYNIWKIKKPSNKFKGMKPPEPLFALPLIGHLHLLGKQIPLARIFASFSDKYGPVFQ  76

Query  1481  IRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVR  1302
             IRLG    L++SN E +++CFTTNDK +A+RP +  G +LGY+YA F+F+ +  Y+  ++
Sbjct  77    IRLGAYPALIISNKEAIKECFTTNDKILASRPKSSHGIHLGYNYAGFSFAPSGPYFSKLK  136

Query  1301  KLVVVELLSSRRMEKLKHVWVSELQANINE--FYTTIAMDNDKNNNNPSAPKVNMSRWFG  1128
             K+ +VELLSSRR+E L+HV+ SE+   I +  FY        K NNN    KV +S W  
Sbjct  137   KITMVELLSSRRLESLRHVYESEIHTWIKDLSFYV-------KGNNNV---KVVISEWLK  186

Query  1127  HLTLNLIMQIVAGRRYEYRSDGVVSEEAQ-RLKKVFSQVMYLWGEFVSGDAIFPLWFFRW  951
              L+ N I +++ G+RY + +  V   EA   +  +  + M + G+FV  D I P+    W
Sbjct  187   RLSFNTITKMIGGKRY-FENLNVEDVEAHGNIVNLIREFMLIAGDFVPKDLI-PI--IGW  242

Query  950   LDYEGHV-KSMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYS  774
               +EG V KSMKR  KD++ ++  W++       SNE   FIDVMLS+I+D   + Y ++
Sbjct  243   FGFEGQVLKSMKRVGKDLETLVGSWIE-EHIVNNSNEKHDFIDVMLSVIEDD--RVYGHN  299

Query  773   RDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDV  594
             RDT+IKA +  ++   S++ +T LTWI+A+LL +   LKR Q+EID +IGK R  E SD+
Sbjct  300   RDTIIKANITDLMLAGSDSTSTTLTWIVALLLNNRNVLKRAQEEIDHHIGKGRRVESSDI  359

Query  593   KNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWP  414
             KNL YLQ ++KETLR+YP  P LAPHEA EDC + GY++PKGT+++ NVW+LHRDP IW 
Sbjct  360   KNLVYLQAILKETLRLYPAAPLLAPHEATEDCNIQGYYVPKGTRVFFNVWKLHRDPSIWS  419

Query  413   DPEKFLPERFMTNLEGEA-AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF  237
             +PEKFLPERF+ N  GE   ++  ++++PFGLGRR+CPG+L+ATQ + + +A L  GF+ 
Sbjct  420   EPEKFLPERFI-NENGEIDHESHHFEYLPFGLGRRACPGSLFATQNSLITLACLLHGFDL  478

Query  236   STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
                 +E +DM E +GI LPKLTPL+V++TPRL   L++
Sbjct  479   EVPMDEVVDMREGLGITLPKLTPLQVVLTPRLPFELYQ  516



>ref|XP_006486181.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
Length=526

 Score =   449 bits (1154),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 217/501 (43%), Positives = 325/501 (65%), Gaps = 16/501 (3%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNW  1440
             +KQ++R  P AGGAWP++GHLH      P  + L + ADKYGP+FT++LG+ + L+VSNW
Sbjct  38    KKQAQR-APRAGGAWPLVGHLHLLGGPEPAHRVLGDMADKYGPIFTMKLGVKQALMVSNW  96

Query  1439  EGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRME  1260
             E  ++CFTTNDK  A+RP T A + L Y+++V +F+   +YWR   K+  +ELLSS R+E
Sbjct  97    EIAKECFTTNDKAFASRPKTMAMELLEYNFSVISFAPYGNYWRQSLKIATIELLSSHRLE  156

Query  1259  KLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY  1080
             KLKHV   E++A+I   Y      +           V+M  W     L+++++I+AG+R+
Sbjct  157   KLKHVREYEVKASIQRLYKNCVSSSSSRK----VVLVDMIHWLEGTVLDVVLRIIAGKRH  212

Query  1079  EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDV  900
               +S     +E    ++  ++   L G+FV  DA   L F RWLD  G+ + M + AK  
Sbjct  213   TSQS-----QEINDWQRQITKFTALTGQFVVSDA---LPFLRWLDIGGYERLMSKTAKYF  264

Query  899   DAILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD  729
             D ILQ+W+D  + +R S E   D+ FI V+LS++DD   Q      DTVIKAI ++++  
Sbjct  265   DIILQEWLDEHKMKRVSGEVKGDEDFIYVLLSLLDDNAEQLPDRDADTVIKAICVTLIVA  324

Query  728   ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR  549
             A++T A  LTW +A+LL +P+ LK+ QDE+D  +G ER   +SD++NL YLQ ++KET+R
Sbjct  325   ATDTTAVTLTWAIALLLNNPDVLKKAQDELDIQVGTERQVNESDMRNLVYLQAIIKETMR  384

Query  548   MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE  369
             +YP GP L PHE++E+CIV+GY +P GTQL+VN W++ RDP +W +P +F PERF+T  +
Sbjct  385   LYPAGPLLLPHESIEECIVNGYLVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHK  444

Query  368   GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI  189
                   + ++ +PFG GRR CP   +  Q+ Q+ +A L  GF+F+T  +EP+DM E +G+
Sbjct  445   DIDVGGQDFELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGL  504

Query  188   ILPKLTPLEVLVTPRLSPTLF  126
              + K TPLEVLV+PRLS +L+
Sbjct  505   TIAKATPLEVLVSPRLSASLY  525



>emb|CBI29738.3| unnamed protein product [Vitis vinifera]
Length=727

 Score =   455 bits (1170),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 234/515 (45%), Positives = 323/515 (63%), Gaps = 29/515 (6%)
 Frame = -1

Query  1667  SSILGIAALVL---LWFS-WR------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1518
             S  L IA L+L   LW++ WR      K     PPE  GAWP +GHLH     VP+ +TL
Sbjct  5     SHFLAIAGLILGLVLWYNHWRGKTLTHKSKGMSPPEPSGAWPFVGHLHLLHGKVPVFRTL  64

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
                ADK GPVF IRLG+ R LVVSN E  ++CFTTNDK  A+RP + A K LGY+YA F 
Sbjct  65    GAMADKVGPVFVIRLGMYRTLVVSNREAAKECFTTNDKIFASRPNSSAAKILGYNYAAFA  124

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
             F+ +  YWR +RKL ++E+LS+RR+  L HV VSEL A I + Y    +  D N  NP  
Sbjct  125   FAPHGPYWREMRKLSMLEILSTRRLGDLMHVQVSELHAGIKDLYI---LGKDNNWVNPK-  180

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV--SEEAQRLKKVFSQVMYLWGEFVSG  984
              KV +S WF HLT N+++++VAG+RY    + VV   EEA+       +V+ L G  V+ 
Sbjct  181   -KVVISEWFEHLTFNVVLRMVAGKRY---FNNVVHGGEEARSAIAAIKKVLLLVGASVAS  236

Query  983   DAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLSM  810
             D I P  F  W+D +GH+ SMK  AK++D++++ WV     R    ++    FID+ML+ 
Sbjct  237   DVI-P--FLEWVDLQGHLSSMKLVAKEMDSLIESWVKEHTGRLNSEASSSLDFIDIMLTK  293

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
             + D     + YSR+T+IKA VL+M+   S+T +   TW+L+ LL +   +K  Q+E+D  
Sbjct  294   LKD--ASLFGYSRETIIKATVLTMIVAGSDTTSLTSTWLLSALLNNKHVMKHAQEELDLK  351

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +G++RW E SD++NL Y++ +VKETLR+Y   P L PHEA+EDC V GYHI KGT+L VN
Sbjct  352   VGRDRWVEQSDIQNLVYIKAIVKETLRLYTTFPLLVPHEAMEDCHVGGYHISKGTRLLVN  411

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
              W+LHRDP +W +PE+F PERF+T+        + ++ +PFG GRRSCPG     Q+  +
Sbjct  412   AWKLHRDPAVWSNPEEFQPERFLTSHANVDVFGQHFELIPFGSGRRSCPGLNMGLQMLHL  471

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPL  165
              +ARL QGF+ +   N P+DM E  GI + KL PL
Sbjct  472   TIARLLQGFDMTKPSNSPVDMTE--GITIKKLVPL  504


 Score =   163 bits (413),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/254 (39%), Positives = 148/254 (58%), Gaps = 23/254 (9%)
 Frame = -1

Query  1163  SAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVS-EEAQRLKKVFSQVMYLWGEFVS  987
             S P +NM     HLT+  ++Q   G      S+  V   E   +KK+      L G FV+
Sbjct  458   SCPGLNMGLQMLHLTIARLLQ---GFDMTKPSNSPVDMTEGITIKKLVP----LAGAFVA  510

Query  986   GDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLS  813
              D I P  F  W+D +GH+ SMK+ AK++D++L+ WV+    R    ++  Q FID+ML+
Sbjct  511   SDLI-P--FLEWVDLQGHLSSMKQVAKEMDSVLESWVEEHTGRLNTEASSRQDFIDIMLT  567

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
              + D     + YSR+T+IKA VL ++   S+T +   TW+L+ LL +   +K  Q+E+D 
Sbjct  568   KLKD--ASLFGYSRETIIKATVLILIVVGSDTTSITSTWLLSALLNNRHVMKHAQEELDL  625

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVD------GYHIPK  471
              +G++RW E SD++NL YL+ +VKETLR+ P  P L P EA+ED  V       GYHIPK
Sbjct  626   KVGRDRWVEQSDIQNLVYLKAIVKETLRLCPAIPLLVPLEAMEDYHVGYHSNSPGYHIPK  685

Query  470   GTQLYVN--VWRLH  435
             GT+L  +  +W +H
Sbjct  686   GTRLLSHFLLWNVH  699



>gb|KFK29809.1| hypothetical protein AALP_AA7G181800 [Arabis alpina]
Length=524

 Score =   447 bits (1150),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 223/503 (44%), Positives = 321/503 (64%), Gaps = 25/503 (5%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCF  1419
             PE  GAWPIIGHLH       L+ +TL E AD YGP  ++RLG S   VVS++E  +DCF
Sbjct  33    PEPSGAWPIIGHLHLLGGKDQLLYRTLGEMADHYGPAMSLRLGSSEAFVVSSFEVAKDCF  92

Query  1418  TTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWV  1239
             TTNDK +A+RP T A K++GY++AVF F+  +S+WR +RK+  VELLS+RR++ LKHV V
Sbjct  93    TTNDKALASRPMTAAAKHMGYNFAVFGFAPYSSFWREMRKIATVELLSNRRLQMLKHVRV  152

Query  1238  SELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGV  1059
             SE+   + + Y+       K  + P    V++  W   +TLN+I+++VAG+RY +    V
Sbjct  153   SEIAMGVQDLYSLWV---KKGGSEPVM--VDLKTWLEDMTLNMIVRMVAGKRY-FGCGSV  206

Query  1058  VSE---EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAIL  888
              SE   EA++ KK  ++  +L G F   DA FP     W D +GH K MKR   ++D IL
Sbjct  207   SSEDTDEARQCKKAIAKFFHLIGIFTVSDA-FPT--LTWFDLQGHEKKMKRTGSELDVIL  263

Query  887   QDWVDARRKER-----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
             + W++  +++R     + N D  FIDVMLS+ +        Y  DT IK+  L+++   S
Sbjct  264   ERWIENHKQQRNDSGTKENNDSDFIDVMLSLAEQGKLSHLQYDADTSIKSTCLALILGGS  323

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             +T A+ LTW +A+LL + E LK+ QDEID  +G +R  EDSD++NL YLQ ++KETLR+Y
Sbjct  324   DTTASTLTWAIALLLNNKEMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLY  383

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P GP L P EA+E+C V GY++ +G +L VNVW++ RDPK++ +P +F PERF+T   GE
Sbjct  384   PAGPLLGPREALENCTVAGYNVSRGKRLIVNVWKIQRDPKVYMEPNEFRPERFIT---GE  440

Query  362   AAQ----NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV  195
             A +     + ++ +PFG GRRSCPG+  A Q+  + +AR    F   T+ + P+DM E  
Sbjct  441   AKEFDVRGKNFELIPFGSGRRSCPGSSLALQVLHLGLARFLHSFEVKTILDLPVDMSESP  500

Query  194   GIILPKLTPLEVLVTPRLSPTLF  126
             G+ +PK TP EVL++PRL   LF
Sbjct  501   GLTIPKATPFEVLISPRLEKQLF  523



>ref|XP_006375032.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
 gb|ERP52829.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
Length=538

 Score =   447 bits (1150),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/502 (44%), Positives = 318/502 (63%), Gaps = 15/502 (3%)
 Frame = -1

Query  1607  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             K+  P+AGGAWP+IGHLH    + P  K L   A+KYGP+FTI++G+ R LVVSNWE  +
Sbjct  42    KKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAK  101

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +CFTT+DK  + RP T A + L YD A+  FS    YWR VRK+  VELLS+ R+EKLK 
Sbjct  102   ECFTTHDKAFSGRPRTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKD  161

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPK-----VNMSRWFGHLTLNLIMQIVAGRR  1083
             V  SE++A + E Y       D+N  + S  K     V M RWFG LTLN++++ + G+ 
Sbjct  162   VRESEVRAFLKELYKLW----DENRCSASKSKSSLVLVEMKRWFGDLTLNIVLRTIVGKT  217

Query  1082  YEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKD  903
               Y S+    E  +  KK      +  G F   DA   L F R+LD  GH ++MK+ AK+
Sbjct  218   VGYISNVEDEESVEGWKKGLKDFFHWTGVFSVSDA---LPFLRFLDLGGHGEAMKKTAKE  274

Query  902   VDAILQDWVDARRKERRSN---EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ  732
             +D +++DW+   +++R +      + F+D+ML + D+          DT IKA  L+++ 
Sbjct  275   LDLVVEDWLQEHKRKRAAGIVKGKEDFMDLMLDVFDNDAEAVQGGDSDTTIKATSLALIL  334

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
              AS T A  L W L++L+ +P  LK+ Q E+DT++GKER  E+SDV+NL YL+ V+KETL
Sbjct  335   AASNTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETL  394

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R+YP GP L PHEA+EDC +DGYH+P+GT+L +NV ++HRD ++W +P +F PERF+T  
Sbjct  395   RLYPAGPLLVPHEAIEDCTIDGYHVPRGTRLLINVPKIHRDERVWSNPNEFDPERFLTTH  454

Query  371   EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVG  192
              G   + + ++F PFG GRR CPG  +A  +  +A+A L  GF+F+T   EP+DM E  G
Sbjct  455   RGFDVRGKNFEFFPFGSGRRKCPGVSFALHVMDLALATLLHGFDFATPSGEPVDMHESSG  514

Query  191   IILPKLTPLEVLVTPRLSPTLF  126
             +   + TPLEVL++PRL   L+
Sbjct  515   LTNLRATPLEVLLSPRLPSRLY  536



>ref|XP_006375031.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
 gb|ERP52828.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
Length=538

 Score =   447 bits (1150),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/502 (44%), Positives = 318/502 (63%), Gaps = 15/502 (3%)
 Frame = -1

Query  1607  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             K+  P+AGGAWP+IGHLH    + P  K L   A+KYGP+FTI++G+ R LVVSNWE  +
Sbjct  42    KKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGNMAEKYGPIFTIKMGVHRALVVSNWETAK  101

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +CFTT+DK  + RP T A + L YD A+  FS    YWR VRK+  VELLS+ R+EKLK 
Sbjct  102   ECFTTHDKAFSGRPRTLASELLTYDGAMVGFSPYGPYWRQVRKITTVELLSNYRLEKLKD  161

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPKVN-----MSRWFGHLTLNLIMQIVAGRR  1083
             V  SE++A + E Y       D+N  + S  K N     M RWFG LTLN++++ + G+ 
Sbjct  162   VRESEVRAFLKELYKLW----DENRGSASKSKSNLALVEMKRWFGDLTLNIVLRTIVGKT  217

Query  1082  YEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKD  903
               Y ++    E  +  KK      +  G F   DA   L F R+LD  GH ++MK+ AK+
Sbjct  218   VGYITNVEDEESVEGWKKGLKDFFHWTGVFSVSDA---LPFLRFLDLGGHGEAMKKTAKE  274

Query  902   VDAILQDWVDARRKERRSN---EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ  732
             +D +++DW+   +++R +      + F+DVML + D+          DT IKA  L+++ 
Sbjct  275   LDLVVEDWLKEHKRKRAAGIVKGKEDFMDVMLDVFDNDAEAVQGGDSDTTIKATSLALIL  334

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
              AS+T A  L W L++L+ +P  LK+ Q E+DT++GKER  E+SDV+NL YL+ V+KETL
Sbjct  335   AASDTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETL  394

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R+YP GP L PHEA+EDC +DGYH+P+GT+L VNV ++HRD ++W +P +F PERF+T  
Sbjct  395   RLYPAGPLLVPHEAIEDCTIDGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPERFLTTH  454

Query  371   EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVG  192
              G   + + ++F PFG GRR CPG  +A  +  +A+A L  G +F+T   EP+DM E  G
Sbjct  455   RGFDVRGKNFEFFPFGSGRRMCPGVSFALHVMDLALATLLHGLDFATPSGEPVDMHESSG  514

Query  191   IILPKLTPLEVLVTPRLSPTLF  126
             +   + TPLEVL++PRL   L+
Sbjct  515   LTNLRATPLEVLLSPRLPSRLY  536



>ref|XP_002283952.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   446 bits (1148),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 226/529 (43%), Positives = 337/529 (64%), Gaps = 21/529 (4%)
 Frame = -1

Query  1691  MDAVPCCLS-------SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVP  1533
             MD +  CL+       +IL ++  +LLW +   +S R+ PEA GAWPIIGHLH    S  
Sbjct  1     MDFLLQCLNPVMVGAFAILVLSYHLLLWRTGAGKS-RMAPEASGAWPIIGHLHLLGGSKN  59

Query  1532  LVKTL-SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGY  1356
             L   L    ADKYGPVF+IRLG+ R +VV++WE  ++CFTT+D  +A+RP   A KYLGY
Sbjct  60    LPHLLFGTMADKYGPVFSIRLGLKRAVVVNSWEMAKECFTTHDLALASRPEVEAAKYLGY  119

Query  1355  DYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKN  1176
             +YA+F FS + +YWR VRK+  +ELLS+RR+E LK+V +SE++  + E Y   A    + 
Sbjct  120   NYAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMKELYKLWA----EK  175

Query  1175  NNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGE  996
              N      V+M  WFGHLTLN+I+ +VAG+RY   +     +EAQ+ +K   +   LWG 
Sbjct  176   KNEAGVVLVDMKEWFGHLTLNVILMMVAGKRYFGYTGESKEKEAQQCRKAIREFFRLWGL  235

Query  995   FVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE---DQKFID  825
             FV  DAI P  FF WLD  GH+K+MK+ AK++D I Q+W++  R+ + S E   +Q F+D
Sbjct  236   FVVSDAI-P--FFGWLDVGGHLKAMKKTAKELDGIAQEWLEEHRQRKDSGEADGNQDFMD  292

Query  824   VMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQD  645
             V LS++  +      Y  DT+ KA  L ++   ++T +  LTW++++LL +P+ L++ Q+
Sbjct  293   VTLSILGGRDIT--DYDADTINKATALILIGGGTDTTSATLTWVISLLLNNPDVLRKAQE  350

Query  644   EIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGT  465
             E+D ++GKER   + D+  L YLQ +VKETLR+ P  P   P + ++D I+ GYHI KGT
Sbjct  351   ELDAHVGKERLVNEMDISKLVYLQAIVKETLRINPTAPLSGPRQFIQDSILGGYHISKGT  410

Query  464   QLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYAT  285
             +L +N+ ++ RDP++W +P +F P+RF+T  +    + +Q++  PFG GRR CPG ++A 
Sbjct  411   RLILNLTKIQRDPRVWLNPMEFQPDRFLTTHKDVDVRGKQFELTPFGGGRRICPGAVFAL  470

Query  284   QITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
             Q+  + +A     F  ST  + P+DM E  G+   K TPLEVL++PRL+
Sbjct  471   QVLHLTLANFLHRFQLSTPSDAPVDMSESFGLTNIKSTPLEVLISPRLA  519



>emb|CAN81014.1| hypothetical protein VITISV_025152 [Vitis vinifera]
Length=519

 Score =   446 bits (1146),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 231/529 (44%), Positives = 335/529 (63%), Gaps = 27/529 (5%)
 Frame = -1

Query  1670  LSSILGIAAL---VLLWFS-WR-----KQSKRL-PPEAGGAWPIIGHLHHFRTSVPLVKT  1521
             L+ +L  A L   +L W++ WR       SK +  P+  GAWPIIGHLH     VP+ +T
Sbjct  4     LTHLLAFAGLFLGLLXWYNRWRVRXLTHNSKGISAPKPPGAWPIIGHLHLLSGQVPIFRT  63

Query  1520  LSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVF  1341
             L   ADK+GPVF I+LG+   +VVS+ E V++CFTTNDK  A+RP +   K LGY+YA F
Sbjct  64    LGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFTTNDKVFASRPRSSVSKLLGYNYAGF  123

Query  1340  TFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPS  1161
              F+    +WR +RKL VVE+LS+RR+ +LK V +SEL A I + Y+       K+NN  S
Sbjct  124   GFAPYGPFWREMRKLSVVEILSARRLNELKDVRISELDACIQDLYSL-----GKDNNWIS  178

Query  1160  APKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV--SEEAQRLKKVFSQVMYLWGEFVS  987
               +V MS WF HLT N +++++AG+RY    D  V  +EEA+       + + L G FV 
Sbjct  179   PIEVVMSEWFEHLTFNFVLRMIAGKRY---FDNAVHGNEEARGAIIAIKKFLSLSGAFVP  235

Query  986   GDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDAR--RKERRSNEDQKFIDVMLS  813
              D +FP  F   LD +G++ SMK  A+++D ++  WV+    R +        FIDV+LS
Sbjct  236   SD-VFP--FLERLDLKGYLGSMKHVAEELDCLVGSWVEEHVMRLKSEPGSRHDFIDVLLS  292

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
              + D  T  + +SR+TVIKA + +++   S++ +   TWIL+ LL + E++K  Q+E+D 
Sbjct  293   AVQD--TSMFGHSRETVIKATIGNLIVGGSDSTSITSTWILSALLNNREAMKXAQEELDL  350

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +G+ RW E+SD++ L YL+ ++KE+LR+Y   P L PHEA +DC V GYHIPKGT+L+V
Sbjct  351   KVGRSRWVEESDIQKLDYLRAIIKESLRLYXAAPLLVPHEATQDCHVCGYHIPKGTRLFV  410

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             N W+LHRDP++W +PE+F PERF+ +         Q++ +PFG GRR+CPG   A Q+  
Sbjct  411   NAWKLHRDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINMALQMLH  470

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +  ARL QGF+ +T  N P+DM E +   +PKLTPL V++TPRL   L+
Sbjct  471   LTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTPLXVMLTPRLPSHLY  519



>gb|AJD25202.1| cytochrome P450 CYP82U4 [Salvia miltiorrhiza]
Length=522

 Score =   445 bits (1145),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 215/514 (42%), Positives = 326/514 (63%), Gaps = 17/514 (3%)
 Frame = -1

Query  1646  ALVLLWFSWRKQSKRL--PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRL  1473
             A +L+ +S+   +K++  PPE  GAWP+IGHLH      P+ +TL   AD++GPVF++RL
Sbjct  18    ATILIIYSYFSSTKKVTTPPEPPGAWPLIGHLHLLDGLSPVARTLGAMADRHGPVFSLRL  77

Query  1472  GISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLV  1293
             G  R LVVS+WE +++C T ND+  A RP+    KYLGY  A F  +    YWR+VRK+V
Sbjct  78    GSHRGLVVSSWEAIKECLTANDRVFATRPSIAVAKYLGYGGASFGLAPYGPYWRDVRKMV  137

Query  1292  VVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLN  1113
              V+LL++R ++   HV  +E+   + + ++         N   S   V +S     LT N
Sbjct  138   TVDLLTARHLDDFSHVRTAEVDGFVKDLHSMCG----GGNGGESKMVVALSGRIELLTFN  193

Query  1112  LIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGH  933
             +I++++ G+R+ +       ++  R ++   +V+YL G FV  DAI  L    WLD  G+
Sbjct  194   IILRMLVGKRFSFSKGD--DDKNWRFQEAIKKVLYLGGVFVFSDAIPSL---EWLDIGGY  248

Query  932   VKSMKRAAKDVDAILQDWVDAR---RKERRSNEDQKFIDVMLSMID-DQFTQGYSYSRDT  765
             +KSMK+  K VD +L+DWV  R   RK++ +  D  F+DVMLS ID ++   GY+  R+T
Sbjct  249   IKSMKQTFKQVDNVLEDWVQERIQTRKQKDAQTDSDFMDVMLSTIDKNEMMAGYT--RET  306

Query  764   VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL  585
             VIKA +L ++   SE+ +  + W +++LL +P ++K  QDEID NIG++R+ ++SD+ NL
Sbjct  307   VIKATILMLIMTGSESTSETIIWAISLLLNNPHTMKTAQDEIDNNIGRDRFVQESDINNL  366

Query  584   PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE  405
              YLQ + KETLR+YP GP   P EA+EDC + GYH+P+GT+L +N+W+LHRDP IW +P+
Sbjct  367   TYLQAIFKETLRLYPPGPLSGPREALEDCHIGGYHVPRGTRLVLNLWKLHRDPNIWFNPD  426

Query  404   KFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVP  225
             +F PERF+        + + ++F+PF  GRR CPG  +  Q+  + +ARL Q F+FS   
Sbjct  427   EFRPERFLNEKSQMNFKGQYFEFIPFSSGRRMCPGMTFGLQVIHLTLARLLQSFDFSMPN  486

Query  224   NEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
              E +DM E +GI LPKL PL+V++TPRL   L++
Sbjct  487   GETVDMGEGLGIALPKLKPLDVVLTPRLPKKLYQ  520



>ref|XP_010061805.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW68805.1| hypothetical protein EUGRSUZ_F02404 [Eucalyptus grandis]
Length=533

 Score =   445 bits (1145),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 219/501 (44%), Positives = 319/501 (64%), Gaps = 26/501 (5%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             PEAGGAWP+IGHLH     VP    L+  ADKYGP+F +++GI R L+VSNW+  + C T
Sbjct  49    PEAGGAWPLIGHLHLLGGPVPPHIVLANMADKYGPIFIVKMGIHRALIVSNWQIAKQCLT  108

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
              ND+  A RP + + + + Y+YA+F  +   SYWR+ RKL ++ELLS+ R+E LKH+  S
Sbjct  109   VNDRVFATRPKSISSEIMAYNYAMFGLAPYGSYWRHARKLTMLELLSNHRLELLKHIRES  168

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E+QA+IN  Y       +  N+ P    V+M R FG +TLN+I +++ G+RYE       
Sbjct  169   EVQASINHIYRRCI---ENYNDAPKKVLVDMKRRFGDITLNVIFRMIVGKRYE-------  218

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV  876
              E+ ++ +    +   L G F+  DA   L   RW D +G+ K MK+ A+++D ++Q W+
Sbjct  219   DEQDEKGRDALREFFDLAGRFIVSDA---LPILRWFDLDGYEKMMKKTARELDRVVQGWL  275

Query  875   DARRKERRSNE--------DQKFIDVMLSMID--DQFTQGYSYSRDTVIKAIVLSMLQDA  726
             +  +  R SN+        DQ F+DVMLS++D  ++F     Y  DT IKA  + ++   
Sbjct  276   NEHKIRRNSNKRRGNDKNNDQDFMDVMLSIVDATEEFP---GYDADTFIKATCMGLVLAG  332

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             S+T +  LTW L++LL H E+LK+ Q E+DT IG+E+  ++SD+KNL Y+Q ++KETLR+
Sbjct  333   SDTTSVSLTWALSLLLNHREALKKAQHELDTQIGREKRVKESDLKNLVYIQAIIKETLRL  392

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP GP   PHE++EDC VDGYH+PKGT+L  N W++HRDP IW DP KF PERF+T  + 
Sbjct  393   YPAGPLGVPHESMEDCTVDGYHVPKGTRLLFNFWKIHRDPHIWSDPLKFRPERFLTTYKD  452

Query  365   EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII  186
                + + ++ +PFG GRR CPG   A Q+  +++A L  GF  +T+ NEP+ M E +G+ 
Sbjct  453   VDIRGQNFELIPFGSGRRMCPGINLAMQLMSLSLAALLHGFEVTTLANEPVGMTEAIGLT  512

Query  185   LPKLTPLEVLVTPRLSPTLFR  123
               K TPLEVLVTPRL    ++
Sbjct  513   NLKATPLEVLVTPRLQERAYK  533



>emb|CDP15727.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   447 bits (1149),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 213/496 (43%), Positives = 315/496 (64%), Gaps = 11/496 (2%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             PEA GA P IGHLHH    +PL + L   ADKYGP F++RLG    +VVS+WE V++CFT
Sbjct  87    PEAPGALPFIGHLHHLGGQLPLARILGSMADKYGPTFSLRLGSRPAIVVSSWEMVKECFT  146

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
              NDK  A+RP T   KY+G + A+F  +    YWR+VRK+V +ELL+++R+EKLKHV  S
Sbjct  147   INDKTFASRPNTALAKYMGNNNAIFALAPYGPYWRDVRKMVTLELLTNQRLEKLKHVRAS  206

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E    I + Y+  + ++  + + P+  KV ++ WF  LT NLI++++ GR +   S G  
Sbjct  207   EFNKWIRDLYSLCSKNDRPDVDVPT--KVVLNEWFELLTFNLILRMLVGRPFSTSSQGND  264

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV  876
             + E +R+K+   +++YL G FV  D I    +  WLD  GH+KSMK+A K++D +L  W+
Sbjct  265   NSEDRRMKEAIKKMLYLGGVFVFSDVI---PWIEWLDIGGHIKSMKKAGKELDEVLGQWL  321

Query  875   D-----ARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
                   A++    S     F+DVMLS I +   +   + RD +IK+   +++   SE+ A
Sbjct  322   QEHIQKAKQSHPESEAVHDFMDVMLSTIPET-GEISGHKRDAIIKSTTATLIMTGSESTA  380

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
               L W L++LL HP  LK  Q+E+D  +GK+RW E++D+KNL +LQ +VKET R+YP GP
Sbjct  381   ETLIWALSLLLNHPNILKIAQNELDVQVGKQRWIEEADIKNLSFLQAIVKETFRLYPPGP  440

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN  351
                P EA EDC +  + +PKG +L VN+W+LHRDP+IW DP +F PERF+ +    + + 
Sbjct  441   LSGPREATEDCYLGNFFVPKGARLIVNLWKLHRDPRIWSDPLEFKPERFLNSHANISLKG  500

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
             + ++++PF  GRR CP   Y   + Q+ +AR+ Q F+ +T    P+DM E +G+ LPKL 
Sbjct  501   QSFEYIPFSSGRRMCPAVNYGMNVVQLTLARMLQAFDIATPMGMPVDMGEGLGVALPKLK  560

Query  170   PLEVLVTPRLSPTLFR  123
             PLEVL+TPRL   L++
Sbjct  561   PLEVLLTPRLPVELYQ  576



>ref|XP_010547839.1| PREDICTED: cytochrome P450 82C4-like [Tarenaya hassleriana]
Length=501

 Score =   444 bits (1142),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 221/506 (44%), Positives = 325/506 (64%), Gaps = 14/506 (3%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSN  1443
             +K + R  PE  G+WP+IGHLH       L+ +TL   AD +GP    R+G  R  VVS+
Sbjct  4     KKPNHRNAPEPAGSWPVIGHLHLLGGKEQLLYRTLGAMADDHGPASPRRVGSRRAFVVSS  63

Query  1442  WEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRM  1263
             WE  ++CFT NDK +A+RP T A K++GY+YAVF F+  +S+WR +RK+  VELLS+RR+
Sbjct  64    WEVAKECFTVNDKALASRPMTVASKHMGYNYAVFGFAPYSSFWRKMRKIATVELLSNRRL  123

Query  1262  EKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRR  1083
             + LKHV +SE+   I + +    + + K  ++P    V++ RW   + LN+I+++VAG+R
Sbjct  124   QMLKHVRISEISTGIKDLH---GLWSKKGGSSPVL--VDLKRWLEDMNLNMIVKMVAGKR  178

Query  1082  YEYRSDGVV-SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAK  906
             Y   S  +  +EEA++ ++  ++  +L G FV  DA   L F  W D +GH K M++ A 
Sbjct  179   YFGSSAKMEDAEEARQCQRAIARFFHLIGIFVVSDA---LPFLGWFDLQGHEKEMRKTAS  235

Query  905   DVDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             ++D IL+ W+D  ++ R S +   D  FIDVMLS+  +       Y   T IK+  L+++
Sbjct  236   ELDGILERWIDEHQRRRVSGQSEGDSDFIDVMLSLEGEGKLSDLQYDPRTSIKSTCLALI  295

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
                S+T A  LTW +A+LL + E LK+ Q+EID ++GK R  EDSD++NL YLQ ++KET
Sbjct  296   LGGSDTTAGTLTWAIALLLNNREMLKKAQEEIDIHVGKNRQVEDSDIENLVYLQAIIKET  355

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTN  375
             LR+YP GP L P EA+EDC V GY +  GT+L VNVW++ RDPK+W +PE+F PERF+T 
Sbjct  356   LRLYPAGPLLGPREAMEDCTVAGYQVAAGTRLIVNVWKIQRDPKVWRNPEEFRPERFLTG  415

Query  374   LEGE-AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
              E E   + + ++ +PFG GRRSCPG   A Q+  +++AR+   F+  TV +  +DM E 
Sbjct  416   KETEYDVRGQNFELMPFGSGRRSCPGASLALQVLHLSLARVLHSFDLLTVSDSEVDMRES  475

Query  197   VGIILPKLTPLEVLVTPRLSPTLFRL  120
              G+ +PK TPLEVL+TPRL   L+ L
Sbjct  476   PGLTIPKATPLEVLLTPRLEQELYEL  501



>emb|CDY53704.1| BnaC03g67210D [Brassica napus]
Length=523

 Score =   444 bits (1143),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 227/534 (43%), Positives = 333/534 (62%), Gaps = 24/534 (4%)
 Frame = -1

Query  1691  MDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLS  1515
             MDA    L S L +  L+ L+   +K      PE  GAWPIIGHLH       L+ +TL 
Sbjct  1     MDAFLFSLLSPLLVFVLIALFKKKKKPKHVKAPEPSGAWPIIGHLHLLGGKEQLLYRTLG  60

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             E A++YGP  ++RLG S   VVS++E  ++CFT NDK +A+RP T A K++GY+YAVF F
Sbjct  61    EMANRYGPAMSLRLGSSEAFVVSSFEVAKECFTVNDKALASRPMTAAAKHMGYNYAVFGF  120

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +  +S+WR +RK+  +ELLS+RR++ LKHV VSE+   + + Y+       K  + P   
Sbjct  121   APYSSFWREMRKIATIELLSNRRLQMLKHVRVSEISMGVKDLYSLWV---KKGGSEPVM-  176

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV---SEEAQRLKKVFSQVMYLWGEFVSG  984
              VN+ RW   +TLN+I+++VAG+RY +         +EEA++ +K  ++  +L G F   
Sbjct  177   -VNLKRWLEDMTLNMIVRMVAGKRY-FGGGSTTPEDTEEARQCQKAITKFFHLIGIFTMS  234

Query  983   DAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVML  816
             DA FP     W D +GH K MK+   ++D IL+ W++  R++R+       D  FIDVML
Sbjct  235   DA-FPT--LGWFDLQGHEKEMKKTGSELDVILERWIENHRQQRKVSGNKENDSDFIDVML  291

Query  815   SMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEID  636
             S+ +        Y  +T IK+  L+++   S+T A+ LTW +A+LL + + LK+ QDEID
Sbjct  292   SLAEQGKLSHLQYDANTSIKSTCLALILGGSDTTASTLTWAIALLLNNKDMLKKAQDEID  351

Query  635   TNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLY  456
               +G +R  EDSD++NL YLQ ++KETLR+YP GP L P EA+EDC + GYH+  GT+L 
Sbjct  352   LQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTIAGYHVSCGTRLI  411

Query  455   VNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYA  288
             VNVW++ RDPK+W +P +F PERF+T   GEA +     + ++ +PFG GRRSCPG+  A
Sbjct  412   VNVWKIQRDPKVWVEPNEFRPERFLT---GEAKEFDVRGQNFELIPFGSGRRSCPGSSLA  468

Query  287   TQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              Q+  + +AR    F+  T  +  +DM E  G+ +PK TPLEV+++PRL   LF
Sbjct  469   MQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEVMISPRLEKHLF  522



>ref|XP_002282035.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=528

 Score =   445 bits (1144),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 230/518 (44%), Positives = 325/518 (63%), Gaps = 19/518 (4%)
 Frame = -1

Query  1664  SILGIAALVLLWFSW-------RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWA  1506
             +I  I  L +L+ S+       R   +R+ PEA GAWPIIGHLH    S     TL   A
Sbjct  14    NITTIGVLGILFLSYYLLVRRSRAGKRRIAPEAAGAWPIIGHLHLLGGSQLPHVTLGTMA  73

Query  1505  DKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTN  1326
             DKYGP+FTIRLG+ R LVVS+ E  ++CFTTND  ++ RP   A ++LGY+YA+F FS  
Sbjct  74    DKYGPIFTIRLGVHRALVVSSREVAKECFTTNDSAVSGRPKLVAPEHLGYNYAMFAFSPY  133

Query  1325  NSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVN  1146
             ++YWR VRK+V  ELLS+RR+E LK V  SE++ +I E Y   A    +  N      V 
Sbjct  134   DAYWREVRKIVNTELLSNRRLELLKDVRASEVETSIKELYKLWA----EKKNELGHVLVE  189

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             M +WFG L++N+I+++V G+RY     G   EEA+R +K   +   L G FV  D I  L
Sbjct  190   MKQWFGDLSMNVILRMVVGKRYFGVGAGGEEEEARRCQKAIREFFRLLGLFVVKDGIPSL  249

Query  965   WFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNED---QKFIDVMLSMIDDQF  795
                 WLD  GH K+MK+ AK++D+I Q+W++  R+ +   ED     F+DV+LS++D + 
Sbjct  250   G---WLDLGGHEKAMKKTAKEIDSIAQEWLEEHRRRKDWGEDNGMHDFMDVLLSVLDGKA  306

Query  794   TQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKER  615
                  Y  DT+ KA  ++++   ++T    LTW L+++L + E+LK+ ++E+DT++GKER
Sbjct  307   LP--EYDADTINKATSMALISGGTDTMTVTLTWALSLILNNRETLKKAKEELDTHVGKER  364

Query  614   WAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLH  435
                 SD+  L YLQ +VKETLR+ P GP   P +  EDCI+ GYH+PKGT+L +N+ +LH
Sbjct  365   LVNASDISKLVYLQAIVKETLRLRPPGPLSGPRQFTEDCIIGGYHVPKGTRLVLNLSKLH  424

Query  434   RDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             RDP +W DPE+F PERF+T      A+ + +Q +PFG GRRSCPG  +A Q+  +A+A  
Sbjct  425   RDPSVWLDPEEFQPERFLTTHRDVDARGQHFQLLPFGAGRRSCPGITFALQMLHLALASF  484

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
               GF  ST  N P+DM E  G+   K TPLE+L+ PRL
Sbjct  485   LHGFEVSTPSNAPVDMSEIPGLTNIKSTPLEILIAPRL  522



>ref|XP_006464328.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=521

 Score =   444 bits (1143),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 218/500 (44%), Positives = 319/500 (64%), Gaps = 19/500 (4%)
 Frame = -1

Query  1616  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWE  1437
             K +    PEAGGAWP+IGHLH F    P  + L   A+KYGP+FT+++G++R LVVSN E
Sbjct  37    KNAHSQAPEAGGAWPMIGHLHLFGGPEPTHRILGNMANKYGPIFTMKMGVNRALVVSNSE  96

Query  1436  GVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEK  1257
               ++CFTTNDK +A+RP   A + LGY++     S   SYWR  RK+  VELLS+ R+EK
Sbjct  97    ITKECFTTNDKALASRPRRMAMEILGYNFLATPSSPYGSYWRETRKIATVELLSNHRLEK  156

Query  1256  LKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYE  1077
             LKHV  SE+ A+I   +       D  N+      V M  W    T ++I++I+ G+RY 
Sbjct  157   LKHVRESEVTASIKGLF------KDCQNSATGKVSVEMKHWLEGTTFDIIIRIIEGKRY-  209

Query  1076  YRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVD  897
                    S+E   L +  +    L+G+FV  DA   L F RWLD  G+ K MK+ AK+ D
Sbjct  210   ------TSQEGTDLHEHAASFFTLFGKFVVSDA---LPFLRWLDIGGNEKLMKKTAKEFD  260

Query  896   AILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA  726
              ILQ W+D  + +R S+E   D+ FI VMLS++ D   Q      DTVIKA+ L+++  A
Sbjct  261   IILQQWLDEHKIKRGSSEVEGDEDFIYVMLSLLYDNAKQLPDSDADTVIKALCLTVILGA  320

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             ++T +  LTW +++LL + ++LK+ QDE++ ++G  R   +SD+KNL YLQ ++KET+R+
Sbjct  321   ADTTSVTLTWAISLLLNNRDALKKAQDELNIHVGANRQVNESDIKNLVYLQAILKETMRL  380

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP  P L PH+++EDC + GYH+P GTQL+VN W++H DPK+W +P KFLPERF+T  + 
Sbjct  381   YPAAPLLLPHQSMEDCTISGYHVPAGTQLFVNAWKVHHDPKVWKEPCKFLPERFLTTHKD  440

Query  365   EAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGII  186
                + + ++ +PFG GRR CPG  +A Q+  + +A L  GF+ +T  +EP+DM E   + 
Sbjct  441   IDLRGQNFELIPFGSGRRICPGISFAFQVMPLILASLLHGFDLATPLDEPVDMEEAKSLT  500

Query  185   LPKLTPLEVLVTPRLSPTLF  126
             + + TPL+VL+TPRLS +L+
Sbjct  501   ITRATPLKVLLTPRLSASLY  520



>gb|KDO40892.1| hypothetical protein CISIN_1g009347mg [Citrus sinensis]
Length=537

 Score =   445 bits (1144),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 223/535 (42%), Positives = 332/535 (62%), Gaps = 23/535 (4%)
 Frame = -1

Query  1685  AVPCCLSSILGIAALVLLWFSWRK----QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1518
             AV   L+ I+ +  L+L  F  R     + KR PPEAGGAWP+IGHLH      PL + L
Sbjct  10    AVAAILTLIIFLYTLLL--FVSRNYASNKKKRGPPEAGGAWPVIGHLH-LLGRFPLHRVL  66

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
              + ADKYGP+FTIR+G+ R LVVSNWE  ++C TT+D+  A+RP     + LG+++++F 
Sbjct  67    GDMADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFASRPKALVAEILGFNFSMFG  126

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFY-----TTIAMDNDKNN  1173
             FS    +WR +RK+  +ELLS+ R+EKLKHV   E++  + E Y     T     +D NN
Sbjct  127   FSPYGPHWRQIRKIATLELLSNHRLEKLKHVREGEVKTCLKELYDFWERTNNYKSSDHNN  186

Query  1172  NNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEF  993
             N      V M++WF  +TLN I+++  G+R    S    ++     K+  ++     G+F
Sbjct  187   NKKVL--VEMNKWFEDVTLNAILRVTVGQRCNSSSSQEDTDHEGAWKEELTKFFAFSGKF  244

Query  992   VSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKF  831
             V  D+   L F RW D  G  ++MK+ A+++D + Q W+D  +++R S +       + F
Sbjct  245   VVSDS---LPFLRWFDIGGDERAMKKNARELDVLAQGWLDEHKRKRESGQMINKEGHEDF  301

Query  830   IDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRV  651
             +DVMLS++ D   Q      DT+ KA  L+++  AS+T    LTWIL++LL H + LK+ 
Sbjct  302   MDVMLSILRDDAQQLPGDDADTINKATCLALILAASDTSKITLTWILSLLLNHRDVLKKA  361

Query  650   QDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPK  471
             Q+E+D +IGK R   + D+KNL YLQ ++KE +R+YP GP  APH + EDC V+ Y +P 
Sbjct  362   QNELDVHIGKRRQVNELDIKNLVYLQAIIKEAMRLYPAGPLAAPHASTEDCTVNDYFVPA  421

Query  470   GTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLY  291
             GT LYVNVW++HRDP++WP+P KF PERF+T  +    + + ++ +PF  GRR CPG  +
Sbjct  422   GTVLYVNVWKIHRDPRVWPEPYKFKPERFLTTHKHIDVRGQNFELLPFSSGRRMCPGPSF  481

Query  290   ATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             A  +T + +A L  GF+F T  +EP+DM E + + L K TP++VL+TPRLS +L+
Sbjct  482   AIPVTHLTLATLLHGFDFETPLDEPVDMSEGMSLTLVKTTPVKVLITPRLSASLY  536



>ref|XP_006432712.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
 ref|XP_006471502.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45952.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
Length=537

 Score =   445 bits (1144),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 223/535 (42%), Positives = 332/535 (62%), Gaps = 23/535 (4%)
 Frame = -1

Query  1685  AVPCCLSSILGIAALVLLWFSWRK----QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1518
             AV   L+ I+ +  L+L  F  R     + KR PPEAGGAWP+IGHLH      PL + L
Sbjct  10    AVAAILTLIIFLYTLLL--FVSRNYASNKKKRGPPEAGGAWPVIGHLH-LLGRFPLHRVL  66

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
              + ADKYGP+FTIR+G+ R LVVSNWE  ++C TT+D+  A+RP     + LG+++++F 
Sbjct  67    GDMADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFASRPKALVAEILGFNFSMFG  126

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFY-----TTIAMDNDKNN  1173
             FS    +WR +RK+  +ELLS+ R+EKLKHV   E++  + E Y     T     +D NN
Sbjct  127   FSPYGPHWRQIRKIATLELLSNHRLEKLKHVREGEVKTCLKELYEFWERTNNYKSSDHNN  186

Query  1172  NNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEF  993
             N      V M++WF  +TLN I+++  G+R    S    ++     K+  ++     G+F
Sbjct  187   NKKVL--VEMNKWFEDVTLNTILRVTVGQRCNSSSSQEDTDHEGAWKEELTKFFAFSGKF  244

Query  992   VSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE------DQKF  831
             V  D+   L F RW D  G  ++MK+ A+++D + Q W+D  +++R S +       + F
Sbjct  245   VVSDS---LPFLRWFDIGGDERAMKKNARELDVLAQGWLDEHKRKRESGQMINKEGHEDF  301

Query  830   IDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRV  651
             +DVMLS++ D   Q      DT+ KA  L+++  AS+T    LTWIL++LL H + LK+ 
Sbjct  302   MDVMLSILRDDAQQLPGDDADTINKATCLALILAASDTSKITLTWILSLLLNHRDVLKKA  361

Query  650   QDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPK  471
             Q+E+D +IGK R   + D+KNL YLQ ++KE +R+YP GP  APH + EDC V+ Y +P 
Sbjct  362   QNELDVHIGKRRQVNELDIKNLVYLQAIIKEAMRLYPAGPLAAPHASTEDCTVNDYFVPA  421

Query  470   GTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLY  291
             GT LYVNVW++HRDP++WP+P KF PERF+T  +    + + ++ +PF  GRR CPG  +
Sbjct  422   GTVLYVNVWKIHRDPRVWPEPYKFKPERFLTTHKHIDVRGQNFELLPFSSGRRMCPGPSF  481

Query  290   ATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             A  +T + +A L  GF+F T  +EP+DM E + + L K TP++VL+TPRLS +L+
Sbjct  482   AIPVTHLTLATLLHGFDFETPLDEPVDMSEGMSLTLVKTTPVKVLITPRLSASLY  536



>ref|XP_011037409.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
 ref|XP_011037412.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
Length=511

 Score =   444 bits (1142),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 222/499 (44%), Positives = 313/499 (63%), Gaps = 12/499 (2%)
 Frame = -1

Query  1616  KQSKRLP--PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSN  1443
             ++SK+L   PE  GAWP+IGHL   R   P  KTL+   DKYGP++++RLG  RI+VVS+
Sbjct  22    RESKKLARVPEPSGAWPVIGHLPCLRGQDPACKTLAAIDDKYGPIYSLRLGSHRIVVVSS  81

Query  1442  WEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRM  1263
              E V+DC TTND+ +A R    AGK++GY+ A F  S    YWR+VRKLV ++LLS+ R+
Sbjct  82    RETVKDCLTTNDRILATRANIAAGKHMGYNNAAFALSPYGKYWRDVRKLVTLQLLSNHRL  141

Query  1262  EKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRR  1083
             E LKHV   E+ A I   + + A    +    P+  KV MS+ F  LT N+ ++ + G+R
Sbjct  142   EMLKHVRKLEVDAFIKGLHNSYA----ETAEYPA--KVTMSKLFESLTFNISLRTIVGKR  195

Query  1082  YEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKD  903
             Y        + E  R KK   + +YL G FV  DAI    +  W+D++GHV +MKR AK+
Sbjct  196   YCSTIYDKENSEPWRYKKAIEKALYLSGIFVMSDAIP---WLEWIDFQGHVSAMKRTAKE  252

Query  902   VDAILQDWVDARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
             +DA++  W++   K+    E   F+DVM+S + D   +   YSRD VIKA  L +    +
Sbjct  253   LDAVIGSWLEEHLKKEIQGESD-FMDVMISNLADGAAEMSGYSRDVVIKATTLILTLTGA  311

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
              + A  LTW L++LL HP  LK  Q+E+D  +G+E+W E+SD++NL YLQ +VKETLR+Y
Sbjct  312   GSTAVTLTWALSLLLNHPSVLKAAQEELDKQVGREKWVEESDIQNLVYLQAIVKETLRLY  371

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P GP     EA+EDC + GY++PKGT+L VN+W+LHRDP++W +P  F PERF+T     
Sbjct  372   PPGPLTGIREAMEDCHICGYYVPKGTRLVVNIWKLHRDPRVWKNPNDFQPERFLTTHADL  431

Query  362   AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
               + + ++F+PF  GRRSCP       +  + +ARL QGF+ +TV   P+DM E  GI L
Sbjct  432   DFRGQDFEFIPFSSGRRSCPAINLGMAVVHLTLARLLQGFDLTTVAGLPVDMNEGPGIAL  491

Query  182   PKLTPLEVLVTPRLSPTLF  126
             PKL PLE +V PRL   L+
Sbjct  492   PKLIPLEAVVKPRLGLRLY  510



>ref|XP_011030967.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   445 bits (1144),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 222/509 (44%), Positives = 320/509 (63%), Gaps = 15/509 (3%)
 Frame = -1

Query  1628  FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVV  1449
             F  R   K+  P+AGGAWP+IGHLH    + P  K L   A+KYGP+FTI++G+ R LVV
Sbjct  35    FLARTGKKKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVV  94

Query  1448  SNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSR  1269
             SNWE  ++CFTT+DK  + RP T A + L YD A+  FS    YWR VRK+  VELLS+ 
Sbjct  95    SNWETAKECFTTHDKAFSGRPKTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNY  154

Query  1268  RMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPK-----VNMSRWFGHLTLNLIM  1104
             R+EKLK V  SE++A + E Y       D N    S  K     V M RWFG LTLN+++
Sbjct  155   RLEKLKDVRESEVRAFLKELYKLW----DDNRGGASKSKGSMVLVEMERWFGDLTLNIVL  210

Query  1103  QIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKS  924
             + + G+   Y ++    E  +  KK      +  G F   DA   L F R+LD  GH ++
Sbjct  211   RTIVGKTVGYITNVEDEESVKGWKKGLKDFFHWTGVFPVSDA---LPFLRFLDLGGHGEA  267

Query  923   MKRAAKDVDAILQDWVDARRKERRSN---EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKA  753
             MK+ AK++D +++DW++  +++R +      + F+D+ML + D+          DT+ KA
Sbjct  268   MKKTAKELDLVVEDWLEEHKRKRAAGIVKGKEDFMDLMLDVFDNDAEAVQGGDSDTINKA  327

Query  752   IVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQ  573
               L+++  AS+T A  L W L++L+ +P +LK+ Q E+DT++ KER  E+SDV+NL YL+
Sbjct  328   TSLTLILAASDTTAVTLIWALSLLVNNPNALKKAQLELDTHVSKERQVEESDVQNLVYLK  387

Query  572   GVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLP  393
              V+KETLR+YP GP L PHEA+EDC +DGYH+P+GT+L VNV ++HRD ++W +P +F P
Sbjct  388   AVLKETLRLYPPGPLLIPHEAIEDCTIDGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDP  447

Query  392   ERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPL  213
             ERF+T   G   + + ++F+PFG GRR CPG  +A     +A+A L  GF+F+T   EP+
Sbjct  448   ERFLTTHRGFDVRGKNFEFLPFGSGRRMCPGVSFALHAMDLALATLLHGFDFATPSGEPV  507

Query  212   DMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             DM E+ G+   + TPLEVL+ PRL   L+
Sbjct  508   DMHENSGLTNLRATPLEVLLCPRLPSRLY  536



>ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52500.1| cytochrome P450, putative [Ricinus communis]
Length=528

 Score =   444 bits (1143),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 211/525 (40%), Positives = 323/525 (62%), Gaps = 11/525 (2%)
 Frame = -1

Query  1688  DAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEW  1509
             +A+   ++ ++ + ++  +  S +K  K+  PEAGGAWP+IGHLH  R   P        
Sbjct  10    NAIATAVAFLIFVCSVFCITRSMKK--KKAAPEAGGAWPLIGHLHLLRGPQPSHIVFGNM  67

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             ADKYGP+FTI++G+   LV SNWE  ++CFTTNDK  A RP   A   LGY  ++F FS 
Sbjct  68    ADKYGPIFTIKMGVHPTLVASNWEMAKECFTTNDKAFANRPNILAMDLLGYGRSMFAFSP  127

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
               +YWR +RK+  +ELLS+ R++   HV  SE+   + E Y     +   N+NN     V
Sbjct  128   YGNYWRQIRKISTLELLSNHRLQMFNHVRESEVGTALKELYKLWEKNKTTNSNNKVL--V  185

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFP  969
              M RWFG +TLN+I++I+ G+   Y +     E  +  K+      +L G F++ DA+ P
Sbjct  186   EMKRWFGDITLNIILRIIVGKFIGYETADEGKESNEGWKQALRDFFHLSGRFIAADAV-P  244

Query  968   LWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSN----EDQKFIDVMLSMIDD  801
               F RWLD  GH K+MK  A  +D ++ +W++  ++++ S      ++ F+D++L ++DD
Sbjct  245   --FLRWLDIGGHEKTMKHTANKLDIVVTEWLNEHKEKKASGCVKKGEEDFMDLILDIMDD  302

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             +     S   DT+ KA  L++   AS+T +  L W L++L+ +P+ LK+ QDE+D  +G+
Sbjct  303   EAEATLSRDSDTINKATCLALTLAASDTTSVTLIWALSLLVNNPDVLKKAQDELDVQVGR  362

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             ER   +SDV NL +L+ +VKETLR+YP GP   PHE+++DC V GYHIP GT+L  N+ +
Sbjct  363   ERQVHESDVNNLIFLKAIVKETLRLYPAGPLSVPHESMKDCTVAGYHIPAGTRLVTNLSK  422

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             +HRDP++W +P ++  ERF+T+ +    + + ++F+PFG GRR CPG  +A Q+  + +A
Sbjct  423   IHRDPRVWSNPSEYQQERFLTSHQDFDVRGKTFEFIPFGSGRRMCPGVSFALQVLHITLA  482

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              L  GFNF T   EPLDM E+ G+   + TPLEV + PRL P L+
Sbjct  483   TLLHGFNFGTPTGEPLDMTENFGLTNLRATPLEVAINPRLGPHLY  527



>ref|XP_011008137.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
Length=516

 Score =   444 bits (1142),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 225/525 (43%), Positives = 324/525 (62%), Gaps = 23/525 (4%)
 Frame = -1

Query  1661  ILGIAALVLLWFSWR--------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWA  1506
             IL    LV L+  W+        K+S R  PE  GAWP+ GHL       P  KTL   A
Sbjct  2     ILEALILVFLYCFWKILARNSESKKSTR-APEPSGAWPLFGHLPSLVGKDPACKTLGAIA  60

Query  1505  DKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTN  1326
             DKYGP+++++ GI R LVVS+WE V+DC  TND+ +A R    AGK++ Y+ A F  +T 
Sbjct  61    DKYGPIYSLKFGIHRTLVVSSWETVKDCLNTNDRVLATRAGIAAGKHMFYNNAAFALATY  120

Query  1325  NSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVN  1146
               YWR+VRKL  ++LLS++R+E LKHV VSE+   I   ++  A   D      S  KVN
Sbjct  121   GQYWRDVRKLATLQLLSNQRLEMLKHVRVSEVDTFIKGLHSFYAGSVD------SPAKVN  174

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             +S+    LT N+ ++ + G+RY   +    + E  R KK   + +YL G FV  DAI P 
Sbjct  175   ISKLLESLTFNINLRTIVGKRYCSSTYDKENSEPWRYKKAIKKALYLSGIFVMSDAI-P-  232

Query  965   WFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKER-----RSNEDQKFIDVMLSMIDD  801
              F  WLDY+GHV +MK+ AK++DA++++W+D   K++      S+ +  F+DVM+S + +
Sbjct  233   -FLEWLDYQGHVSAMKKTAKELDAVIRNWLDEHLKKKIDGELGSDRESDFMDVMISNLAE  291

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
                +   YSRD VIKA  L +    + + AT L W L++LL +P  LK  Q+E+D  +G+
Sbjct  292   GPDKISGYSRDVVIKATALILTLTGAGSTATTLVWTLSLLLNNPTVLKAAQEELDKQVGR  351

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             ERW E+SD+++L YLQ +VKETLR+YP GP     EA+EDC + GY +PKGT+L VN+W+
Sbjct  352   ERWVEESDIQDLKYLQAIVKETLRLYPPGPLTGIREAMEDCSIGGYDVPKGTRLVVNIWK  411

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             LHRDP++W +P +F P+RF+T       + +  +F+PF  GRRSCP       +  + +A
Sbjct  412   LHRDPRVWKNPNEFKPDRFLTTHADLDFRGQNMEFIPFSSGRRSCPAINLGLIVVHLTLA  471

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             R+ QGF+ +TV   P+DM+E  GI LPK TPLEV++ PRL   L+
Sbjct  472   RILQGFDLTTVAGLPVDMIEGPGIALPKETPLEVVIKPRLGLELY  516



>emb|CDY23316.1| BnaA08g12300D [Brassica napus]
Length=523

 Score =   444 bits (1142),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 227/533 (43%), Positives = 332/533 (62%), Gaps = 22/533 (4%)
 Frame = -1

Query  1691  MDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLS  1515
             MDA    L S L +  L+ L+   +K      PE  G+WPIIGHLH       L+ +TL 
Sbjct  1     MDAFLFSLLSPLLVFVLIALFKKTKKPKHVKAPEPSGSWPIIGHLHLLGGKEQLLYRTLG  60

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             E A++YGP  ++RLG S   VVS++E  ++CFT NDK +A+RP T A K++GY+YAVF F
Sbjct  61    EMANRYGPAMSLRLGSSEAFVVSSFEVAKECFTVNDKALASRPMTAAAKHMGYNYAVFGF  120

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +  +S+WR +RK+  +ELLS+RR++ LKHV VSE+   + + Y+       K  + P   
Sbjct  121   APYSSFWREMRKIATIELLSNRRLQMLKHVRVSEISMGVKDLYSLWV---KKGGSEPVM-  176

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV--SEEAQRLKKVFSQVMYLWGEFVSGD  981
              VN+ RW   +TLN+I+++VAG+RY          +EEA++ +K  ++  +L G F   D
Sbjct  177   -VNLKRWLEDMTLNMIVRMVAGKRYFGGGSTTPEDTEEARQCQKAITKFFHLIGIFTMSD  235

Query  980   AIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLS  813
             A FP     W D +GH K MK+   ++D IL+ W++  R++R+       D  FIDVMLS
Sbjct  236   A-FPT--LGWFDLQGHEKEMKKTGSELDVILERWIENHRQQRKVSGNKENDSDFIDVMLS  292

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
             + +        Y  +T IK+  L+++   S+T A+ LTW +A+LL + + LK+ QDEID 
Sbjct  293   LAEQGKLSHLQYDANTSIKSTCLALILGGSDTTASTLTWAIALLLNNKDMLKKAQDEIDL  352

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +G +R  EDSD++NL YLQ ++KETLR+YP GP L P EA+EDC V GYH+  GT+L V
Sbjct  353   QVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHVACGTRLIV  412

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYAT  285
             NVW++ RDPK+W +P +F PERF+T   GEA +     + ++ +PFG GRRSCPG+  A 
Sbjct  413   NVWKIQRDPKVWVEPNEFRPERFLT---GEAKEFDVRGQNFELIPFGSGRRSCPGSSLAM  469

Query  284   QITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             Q+  + +AR    F+  T  +  +DM E  G+ +PK TPLEV+++PRL   LF
Sbjct  470   QVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEVMISPRLEKHLF  522



>emb|CAN74205.1| hypothetical protein VITISV_031127 [Vitis vinifera]
Length=525

 Score =   444 bits (1142),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 227/529 (43%), Positives = 329/529 (62%), Gaps = 21/529 (4%)
 Frame = -1

Query  1691  MDAVPCCLS-------SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVP  1533
             MD +  CL+       +IL ++  +LLW S   +S R+ PEA GAWPIIGHLH    S  
Sbjct  1     MDFLLQCLNPVMVGAFAILVLSYHLLLWRSGAGKS-RMAPEASGAWPIIGHLHLLGGSKN  59

Query  1532  LVKTL-SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGY  1356
             L   L    ADKYGPVF+IRLG  R +VVS+WE  ++CFTT+D  +A+RP   A KYLGY
Sbjct  60    LPHLLFGTMADKYGPVFSIRLGXKRAVVVSSWEMAKECFTTHDLALASRPEVVAAKYLGY  119

Query  1355  DYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKN  1176
             +YA+F FS + +YWR VRK+  +ELLS+RR+E LK+V +SE++  + E Y   A    + 
Sbjct  120   NYAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMKELYKLWA----EK  175

Query  1175  NNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGE  996
              +      V+M +WFGHL+LN+I+++V G+RY   +     +EAQ+ +K   +   L G 
Sbjct  176   KSEAGVVLVDMKQWFGHLSLNVILKMVVGKRYFGYAAESKEKEAQQCQKAIREFFRLLGL  235

Query  995   FVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE---DQKFID  825
             FV  DA   L F  WLD  GHVK+MK+ AK++D I Q+W++  R+ + S E   DQ F+D
Sbjct  236   FVVSDA---LPFLGWLDVGGHVKAMKKTAKELDGIAQEWLEEHRRRKDSGEADGDQDFMD  292

Query  824   VMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQD  645
             VMLS++      GY    D + KA  L ++   ++T +  LTW +++LL +P  L++ Q+
Sbjct  293   VMLSILGATDPNGYD--ADXINKATSLILIAGGTDTTSXTLTWAISLLLNNPHVLRKAQE  350

Query  644   EIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGT  465
             E+DT++GKER   + D+  L YLQ +VKETLR+YP  P     + ++D ++ GYHIPKGT
Sbjct  351   ELDTHVGKERLVNEMDISKLVYLQAIVKETLRLYPAAPLSGQRQFIQDSVLGGYHIPKGT  410

Query  464   QLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYAT  285
             +L +N+ ++ RDP++W +P  F P RF+T  +    + + +   PFG GRR CPG  +A 
Sbjct  411   RLLLNLTKIQRDPRVWLNPTXFQPSRFLTTYKDVDVKGKHFVLTPFGGGRRICPGAAFAL  470

Query  284   QITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
             Q+  + +A     F  ST  N P+DM E  GI   K TPLEVL++PRL+
Sbjct  471   QVLPLTLANFLHKFQLSTPSNSPIDMSESFGITNIKSTPLEVLISPRLA  519



>ref|XP_006342717.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=527

 Score =   444 bits (1141),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 228/529 (43%), Positives = 337/529 (64%), Gaps = 30/529 (6%)
 Frame = -1

Query  1658  LGIAALVLLWFSWRKQ---SKRLPPEAGGAWPIIGHLHHFR-TSVPLVKTLSEWADKYGP  1491
             L I  L+ L+F ++ +   + +  PE  GAWPIIGHLH    T   L +TL   AD YGP
Sbjct  9     LIIGVLIFLYFIFKNKNYSTSKQVPEPAGAWPIIGHLHLLGGTEQLLYRTLGAMADNYGP  68

Query  1490  VFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWR  1311
              F +RLG  R  VVS+WE  ++CFT NDK +A+RPTT A K++GY YAVF F+  + +WR
Sbjct  69    AFNLRLGTRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFAPYSPFWR  128

Query  1310  NVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWF  1131
              +RK+ + ELLS+RR++ LK+V VSE+   I E Y       D N++ P    V + RWF
Sbjct  129   EMRKIAMFELLSNRRLDALKYVQVSEVDIGIQELYKLWV---DNNSDRPIL--VELKRWF  183

Query  1130  GHLTLNLIMQIVAGRRYEYRSDGVVS--EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
               LTLN+I+++VAG+RY + +       +EA+R +K  +Q  +L G FV  DA FP+   
Sbjct  184   EDLTLNVIVRMVAGKRY-FGAGATCDNDDEARRCQKAINQFFHLIGIFVPSDA-FPI--L  239

Query  956   RWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR-------SNED---QKFIDVMLSMI  807
              W D  GH K+MK+ AK++D IL+ W+   R++R+       S  D   Q FIDVMLS+ 
Sbjct  240   GWFDINGHEKAMKKTAKELDFILEGWLKEHREKRKCTSIEVKSTTDSAVQDFIDVMLSLE  299

Query  806   DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
             ++     + Y  DT IK+  L+++   S+T A  LTW +++LL +P+ L + Q+EID ++
Sbjct  300   EEGRLSNFPYDADTSIKSTCLALILGGSDTTAGTLTWAISLLLNNPKILTKAQEEIDLHV  359

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             GK R  ++SD+ NL Y+Q ++KETLR+YP GP L P EA+++C + GY I  GT+L VNV
Sbjct  360   GKNRQIDESDINNLIYIQAIIKETLRLYPAGPLLGPREAMDNCEISGYKITPGTRLIVNV  419

Query  446   WRLHRDPKIWPDPEKFLPERF-MTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             W++ RDP+IW DP+ F P+RF M+N++    + + ++ +PFG GRRSCPG   A Q+  +
Sbjct  420   WKIQRDPRIWEDPDCFNPDRFLMSNVD---VKGKDFELIPFGSGRRSCPGASLALQVLHL  476

Query  269   AVARLFQGFNFST-VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +AR+   F F+  +  +P+D+ E  G+ +PK TPL+VL+ PRLS  L+
Sbjct  477   TLARILHAFEFTKPIDGQPIDLTESPGLTIPKATPLDVLIAPRLSANLY  525



>ref|XP_002264473.1| PREDICTED: cytochrome P450 82C4-like [Vitis vinifera]
Length=519

 Score =   444 bits (1141),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 228/529 (43%), Positives = 333/529 (63%), Gaps = 27/529 (5%)
 Frame = -1

Query  1670  LSSILGIAAL---VLLWF------SWRKQSKRL-PPEAGGAWPIIGHLHHFRTSVPLVKT  1521
             L+ +L  A L   +L W+      +    SK +  P+  GAWPIIGHLH     VP+ +T
Sbjct  4     LTQLLAFAGLFLGLLFWYNRWIVRTLTHNSKGISAPKPPGAWPIIGHLHLLSGQVPIFRT  63

Query  1520  LSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVF  1341
             L   ADK+GPVF I+LG+   +VVS+ E V++CFTTNDK  A+RP +   K LGY+YA+F
Sbjct  64    LGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFTTNDKVFASRPRSSVSKLLGYNYAMF  123

Query  1340  TFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPS  1161
               +    +WR +RKL VVE+LS+RR+ +LK V +SEL A I + Y+       K+NN  S
Sbjct  124   GSAPYGLFWREMRKLSVVEILSARRLNELKDVRISELDACIKDLYSL-----GKDNNWIS  178

Query  1160  APKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV--SEEAQRLKKVFSQVMYLWGEFVS  987
               KV MS WF HLT N  ++++AG+RY    D  V  +EEA+       + + L G FV 
Sbjct  179   PIKVVMSEWFEHLTFNFALRMIAGKRY---FDNAVHGNEEARGAIITIKKYLSLSGAFVP  235

Query  986   GDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNED--QKFIDVMLS  813
              D +FP  F   LD +G++ SMK   +++D ++  WV+      +S       FIDV+LS
Sbjct  236   SD-VFP--FLERLDLQGYLGSMKHVTEELDCLVGSWVEEHVMRLKSEPGCRHDFIDVLLS  292

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
              + D  T  + ++R+TVIKA +++++   S++ +   TWIL+ LL + E++K  Q+E+D 
Sbjct  293   TVQD--TSMFGHTRETVIKATIVNLIVGGSDSTSITSTWILSALLNNREAMKHAQEELDL  350

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
              +G+ RW E+SD++ L YL+ ++KE+LR+YP  P L PHEA +DC V GYHIPKGT+L+V
Sbjct  351   KVGRSRWVEESDIQKLDYLRAIIKESLRLYPAAPLLVPHEATQDCHVCGYHIPKGTRLFV  410

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             N W+LHRDP++W +PE+F PERF+ +         Q++ +PFG GRR+CPG   A Q+  
Sbjct  411   NAWKLHRDPRVWSNPEEFEPERFLGSHANLDVFGHQFELIPFGSGRRACPGINMALQMLH  470

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +  ARL QGF+ +T  N P+DM E +   +PKLTPL V++TPRL   L+
Sbjct  471   LTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTPLRVMLTPRLPSHLY  519



>emb|CDP00859.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   444 bits (1141),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 227/524 (43%), Positives = 328/524 (63%), Gaps = 23/524 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFSWRKQS------KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEW  1509
             L +I  + AL L +  W+ +S      ++ PPE  GAWP+IGHL      + + +TL+  
Sbjct  7     LVAIPVVLALFLSYIQWKPRSQISDEKRKSPPEPEGAWPVIGHLLQMNPKIHVAETLAAM  66

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             ADK GPVF+IRLG+  +LVV+NWE V++CFTTNDK  A+RP +   KYL YDYA F  + 
Sbjct  67    ADKNGPVFSIRLGMLPVLVVNNWESVKECFTTNDKTFASRPPSSFAKYLCYDYAAFGIAP  126

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
                YWR+VRK+V+ ELLS++R+EKLK V +SE+Q +I E +  I+  N   N   +  +V
Sbjct  127   YGPYWRDVRKMVLRELLSTQRLEKLKQVRISEVQTSIKEIFLNISEVNKHGNEIKAPARV  186

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFP  969
             ++   F  LTLN++++ +AG RY      V  E     ++V  +        V  D I P
Sbjct  187   DLGDVFEKLTLNIVLRKIAGGRYT--DSDVGKERDAEFRRVLKEFEAFARILVVSD-IIP  243

Query  968   LWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSN-----EDQKFIDVMLSMID  804
               F +WLD +G++KSMKR AK++D  +Q WVD  ++ R  N     ++  FIDV+LS I 
Sbjct  244   FRFLKWLDPQGNIKSMKRLAKELDKYMQIWVDEHKEGRMKNSGDGDDELDFIDVLLSTIK  303

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
             D+   G  +S++ VIK+ +L ++   + T +  L+W++++LL H   L++ Q+EID+ +G
Sbjct  304   DESICG--FSKEVVIKSTILVLIVAGTSTTSRALSWVISLLLNHRHVLQKAQEEIDSFVG  361

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             KERW E+SD+KNL YLQ +VKET+R++P  P   P +A EDC V GY IPKGTQLYVNVW
Sbjct  362   KERWVEESDIKNLVYLQAIVKETMRLHPPAPVPMPRQADEDCNVAGYFIPKGTQLYVNVW  421

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAA---QNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             ++ RDP+IWP+PEKF PERF++     A     ++ ++  PFG GRR CPG  +A Q+  
Sbjct  422   KIQRDPRIWPEPEKFFPERFLSGDHAGAQLDFSSQNFELNPFGNGRRICPGMSFALQVMH  481

Query  272   VAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
             + +ARL Q F+ S V + P+D     G    K  PLE L+ PRL
Sbjct  482   LTLARLLQAFDISRVSDLPVDTAGYEG----KAPPLEALMMPRL  521



>gb|KEH18125.1| cytochrome P450 family protein [Medicago truncatula]
Length=506

 Score =   443 bits (1139),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 228/497 (46%), Positives = 323/497 (65%), Gaps = 32/497 (6%)
 Frame = -1

Query  1598  PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCF  1419
             PPE   A P+IGHLH     +PL +  + ++DKYGP+F I  G    L++SN E +++CF
Sbjct  38    PPEPSYALPLIGHLHLLGNQIPLARIFASFSDKYGPIFQIHFGAYPALIISNKEAIKECF  97

Query  1418  TTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWV  1239
             TTNDK +A+RP +  G +LGY+YA F F+    YW  +RKL ++ELLSSRR+E L+HV+ 
Sbjct  98    TTNDKILASRPKSSHGIHLGYNYAGFGFAPYGPYWTKLRKLTMLELLSSRRLESLRHVYE  157

Query  1238  SELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGV  1059
             SE+   I +    + +            KV +S W               R +EY  D  
Sbjct  158   SEIDTLIKDLSLYVKV---------GKVKVVISEWLE-------------RYFEYLKDVD  195

Query  1058  VSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV-KSMKRAAKDVDAILQD  882
               E    + K+  + M++ GEFV  D I P+    W  +EG V KSMKR A+D+DA++  
Sbjct  196   DVEAHGNIVKLIKEFMHISGEFVPKDLI-PI--LGWFGFEGKVLKSMKRIARDLDAVVGS  252

Query  881   WVDAR--RKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFAT  708
             WV+      E +SNE   FIDVMLS+I+D  T G++  RDT+IKA V++++   S+T +T
Sbjct  253   WVEEHDVEIESKSNEKYDFIDVMLSVIEDDPTSGHN--RDTIIKANVMNLMLAGSDTTST  310

Query  707   HLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPY  528
              +TWILA+L+ +  +LK  Q+EID +IG++R  E SD+KNL YLQ +VKETLR+YP GP 
Sbjct  311   TMTWILAILMNNMNALKHAQEEIDHHIGRDRRVESSDIKNLVYLQAIVKETLRLYPPGPL  370

Query  527   LAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA-AQN  351
             L PHE  EDC +  Y++PKGT+++ NVW+LHRDP IW +PEKFLPERF+ N  GE   ++
Sbjct  371   LVPHEVTEDCYIQDYYVPKGTRVFANVWKLHRDPSIWLEPEKFLPERFI-NENGEIDHES  429

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
               ++++PFGLGRR+CPG+L+ATQ+  + +ARL  GF+     +E +DM E +GI LPKLT
Sbjct  430   HHFEYLPFGLGRRACPGSLFATQVILITLARLLHGFDLEVPMDEVVDMREGLGITLPKLT  489

Query  170   PLEVLVTPRLSPTLFRL  120
             PL+V++TPRLS  L+RL
Sbjct  490   PLQVVLTPRLSCELYRL  506



>ref|XP_002264520.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=567

 Score =   445 bits (1144),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 222/494 (45%), Positives = 320/494 (65%), Gaps = 17/494 (3%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             P+  GAWPIIGHLH     VP+ +TL   ADK+GPVF I+LG+   +VVS+ E V++CFT
Sbjct  87    PKPPGAWPIIGHLHLLSGQVPIFRTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFT  146

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
             TNDK  A+RP +   K LGY+YA F F+    +WR +RKL VVE+LS+RR+ +LK V +S
Sbjct  147   TNDKVFASRPRSSVSKLLGYNYAGFGFAPYGPFWREMRKLSVVEILSARRLNELKDVRIS  206

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             EL A I + Y+       K+NN  S  +V MS WF HLT N +++++AG+RY    D  V
Sbjct  207   ELDACIQDLYSL-----GKDNNWISPIEVVMSEWFEHLTFNFVLRMIAGKRY---FDNAV  258

Query  1055  --SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQD  882
               +EEA+       + + L G FV  D +FP  F   LD +G++ SMK  A+++D ++  
Sbjct  259   HGNEEARGAIIAIKKFLSLSGAFVPSD-VFP--FLERLDLKGYLGSMKHVAEELDCLVGS  315

Query  881   WVDAR--RKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFAT  708
             WV+    R +        FIDV+LS + D  T  + +SR+TVIKA + +++   S++ + 
Sbjct  316   WVEEHVMRLKSEPGSRHDFIDVLLSAVQD--TSMFGHSRETVIKATIGNLIVGGSDSTSI  373

Query  707   HLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPY  528
               TWIL+ LL + E++KR Q+E+D  +G+ RW E+SD++ L YL+ ++KE+LR+Y   P 
Sbjct  374   TSTWILSALLNNREAMKRAQEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYSAAPL  433

Query  527   LAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNR  348
             L PHEA +DC V GYHIPKGT+L+VN W+LHRDP++W +PE+F PERF+ +         
Sbjct  434   LVPHEATQDCHVCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHANLDVFGH  493

Query  347   QYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTP  168
             Q++ +PFG GRR+CPG   A Q+  +  ARL QGF+ +T  N P+DM E +   +PKLTP
Sbjct  494   QFELIPFGSGRRACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTP  553

Query  167   LEVLVTPRLSPTLF  126
             L V++TPRL   L+
Sbjct  554   LCVMLTPRLPSHLY  567



>ref|XP_006375030.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
 gb|ERP52827.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
Length=538

 Score =   444 bits (1141),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 221/502 (44%), Positives = 317/502 (63%), Gaps = 15/502 (3%)
 Frame = -1

Query  1607  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             K+  P+AGGAWP+IGHLH    + P  K L   A+KYGP+FTI++G+ R LVVSNWE  +
Sbjct  42    KKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWETAK  101

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +CFTT+DK  + RP T A + L YD A+  FS    YWR VRK+  VELLS+ R+EKLK 
Sbjct  102   ECFTTHDKAFSGRPRTLASELLTYDGAMLGFSPYGPYWRQVRKITTVELLSNYRLEKLKD  161

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPKVN-----MSRWFGHLTLNLIMQIVAGRR  1083
             V  SE++A + E Y       D+N  + S  K N     M RWFG LTLN++++ + G+ 
Sbjct  162   VRESEVRAFLKELYKLW----DENRGSASKSKSNLVLVEMKRWFGDLTLNIVLRTIVGKT  217

Query  1082  YEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKD  903
               Y ++    E  +  KK      +    F   DA   L F R+LD  GH ++MK+ AK+
Sbjct  218   VGYITNVEDEESVEGWKKGLKDFFHWTRVFSVSDA---LPFLRFLDLGGHGEAMKKTAKE  274

Query  902   VDAILQDWVDARRKERRSN---EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ  732
             +D +++DW+   +++R +      + F+DVML + D+          DT IKA  L+++ 
Sbjct  275   LDLVVEDWLKEHKRKRAAGIVKGKEDFMDVMLDVFDNDAEAVQGGDSDTTIKATSLALIL  334

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
              AS+T A  L W L++L+ +P  LK+ Q E+DT++GKER  E+SDV+NL YL+ V+KETL
Sbjct  335   AASDTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVYLKAVLKETL  394

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R+YP  P   PHEA+EDC +DGYH+P+GT+L VNV ++HRD ++W +P +F PERF+T  
Sbjct  395   RLYPAAPLSLPHEAIEDCTIDGYHVPRGTRLLVNVSKIHRDERVWSNPNEFDPERFLTTH  454

Query  371   EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVG  192
              G   + + ++F PFG GRR CPG  +A  +  +A+A L  GF+F+T   EP+DM E  G
Sbjct  455   RGFDVRGKNFEFSPFGSGRRMCPGVSFALHVMDLALATLLHGFDFATPSGEPVDMHESSG  514

Query  191   IILPKLTPLEVLVTPRLSPTLF  126
             +   + TPLEVL++PRLS  L+
Sbjct  515   LTNLRATPLEVLLSPRLSSRLY  536



>ref|XP_007017416.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
 gb|EOY14641.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
Length=798

 Score =   452 bits (1163),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 219/497 (44%), Positives = 320/497 (64%), Gaps = 9/497 (2%)
 Frame = -1

Query  1607  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             KR  PEA GA P +GHLH    S P    L + AD YGP+FTIRLG+   LVVSNWE  +
Sbjct  308   KRKAPEASGARPFLGHLHLLGGSKPAHVVLGDLADTYGPIFTIRLGVRLTLVVSNWEIAK  367

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +CFTTNDK  A RP T A + LGY+YA+F FS    YWR +RK+V +E+LS+ R+EKLKH
Sbjct  368   ECFTTNDKAFANRPRTLAAELLGYNYAMFGFSPYGPYWRQIRKIVTLEVLSNHRLEKLKH  427

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
             +  SE++ +I E Y  + ++   N+++     V M RWF  L +N++ ++V G+RY    
Sbjct  428   IRESEVRTSIKELYK-LGVEGVSNSSSGKV-LVEMKRWFWTLNINMVFKMVVGKRYSEAE  485

Query  1067  DGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAIL  888
                  +E  R +K       L G F  GD+   L F RWLD  GH K+MK+ AK++D IL
Sbjct  486   TSHGKDENDRRRKALRDFFELTGTFTVGDS---LPFLRWLDLGGHEKAMKKTAKELDHIL  542

Query  887   QDWVDARRKERRSN---EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET  717
             ++W++  +++R S     +  F+ +MLS+++D   +  SY  DT+ KA  LS++  AS+T
Sbjct  543   EEWLEEHKQKRNSGNAESEHDFMGMMLSLLNDA-AELPSYDADTINKATCLSLILAASDT  601

Query  716   FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ  537
                 LTW L++LL +  +LK+ Q+E+D ++G+++  E+SD+K L YLQ ++KETLR+YP 
Sbjct  602   TMVTLTWALSLLLNNRNALKKAQEELDIHVGRDKLVEESDIKKLVYLQAIIKETLRLYPA  661

Query  536   GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA  357
              P   PHE++EDC+V GYHIP GT+L +N++++HRDP  W DP +F PERF+T  +    
Sbjct  662   APLSVPHESMEDCVVSGYHIPAGTRLLINLYKIHRDPHAWSDPCEFQPERFLTTYKDFDV  721

Query  356   QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPK  177
             + + ++ +PFG GRR CPG   A Q+ ++ +A L QGF   T  +EP+DM E +GI   K
Sbjct  722   RGQNFELIPFGSGRRMCPGVSLALQVLELTLANLLQGFELGTPLDEPVDMGEAIGITNLK  781

Query  176   LTPLEVLVTPRLSPTLF  126
             ++PLEVL+TPRL    +
Sbjct  782   VSPLEVLITPRLPAVCY  798


 Score =   101 bits (251),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = -1

Query  1616  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWE  1437
             +  KR  PEAG +WP+IGHLH      P    L + A+KYG +FTI++G+ R LVV+NWE
Sbjct  179   RDKKRAAPEAGSSWPVIGHLHLLGGPQPPHIVLGDMAEKYGSIFTIKMGVYRALVVNNWE  238

Query  1436  GVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFS  1332
               ++C TTNDK  A+RP T A ++L +++ +  F+
Sbjct  239   TAKECLTTNDKAFASRPKTLAMEFLSFEHTMVGFT  273


 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 55/95 (58%), Gaps = 0/95 (0%)
 Frame = -1

Query  1604  RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRD  1425
             R  PE  GA P +GHL     S P    L + AD YGP+FTIRLG+   LVVSNWE  ++
Sbjct  3     RKAPEVSGARPFLGHLQLLGGSKPAQVVLGDLADTYGPIFTIRLGMQSTLVVSNWEMAKE  62

Query  1424  CFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNS  1320
             CFTTN K    RP T A + LGY+YA+       S
Sbjct  63    CFTTNHKAFVNRPRTLAAELLGYNYAMMVIGKRYS  97


 Score = 59.3 bits (142),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 3/85 (4%)
 Frame = -1

Query  1100  IVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSM  921
             +V G+RY         ++  R +      + L G F  GD+   L F RWLD  GH K+M
Sbjct  90    MVIGKRYSEVEASHGKDDNDRCRNAVRNFLELTGTFTVGDS---LPFLRWLDLGGHEKAM  146

Query  920   KRAAKDVDAILQDWVDARRKERRSN  846
             K+ AK++D IL+ W++  +++R S 
Sbjct  147   KKTAKELDQILEKWLEEHKQKRNSG  171



>gb|KDO40894.1| hypothetical protein CISIN_1g009786mg [Citrus sinensis]
Length=525

 Score =   443 bits (1140),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 218/503 (43%), Positives = 322/503 (64%), Gaps = 19/503 (4%)
 Frame = -1

Query  1622  WRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSN  1443
             +  + KR  PEAGGAWP+IGHLH      P  + L   ADKYGP+FTI++GI+R LVVSN
Sbjct  37    YTSKKKRGAPEAGGAWPVIGHLHLLGGPEPPHRVLGCMADKYGPIFTIKMGINRALVVSN  96

Query  1442  WEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRM  1263
             WE  ++C TT+DK  A+RP T A + LGY++++F FS   SYWR  RK+  +ELLS+ R+
Sbjct  97    WEMAKECLTTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRL  156

Query  1262  EKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRR  1083
             EKLK V   EL+  + E Y     DN+K+ N      V M RW      N++++++ G+ 
Sbjct  157   EKLKQVREYELKTCLKELYQL--WDNNKSTNK--MLLVEMKRWLADSIRNVVLRMIVGK-  211

Query  1082  YEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKD  903
                   G  S +++  K++ ++   + G+FV  DA   L F RWLD  G  +SMK+ AK+
Sbjct  212   ------GCNSMDSEEWKELLTRFFEMSGKFVVSDA---LPFLRWLDIGGDERSMKKIAKE  262

Query  902   VDAILQDWVDARRKERRSNE----DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             +D ++Q W++  + +R S E    ++ F+ VMLS++ D   Q Y    DT+ KAI L ++
Sbjct  263   LDVVVQGWLEEHKMKRDSQEMNQEEEDFMYVMLSILGDT-DQYYGRDVDTINKAICLGLI  321

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
               A++T A  LTWI+++LL H + L + ++E+D  +G +R   +SD+KNL YLQ ++KE 
Sbjct  322   LAATDTTAVTLTWIISLLLNHHDILNKARNELDIQVGTKRQVNESDIKNLVYLQAILKEA  381

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTN  375
             +R+YP  P L PHE++E+C V GY++P GTQL++NVW+L RDP +W +P KF PERF+T 
Sbjct  382   MRLYPAAPLLIPHESIEECTVSGYNVPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTR  441

Query  374   LEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV  195
              +    + + ++ +PF  GRR CPG  +A Q+ Q  +A L  GF+ +T  NEPLDM E +
Sbjct  442   HKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLHGFDIATPSNEPLDMGEGL  501

Query  194   GIILPKLTPLEVLVTPRLSPTLF  126
             G+ + K TPLEVLV PRLS +L+
Sbjct  502   GLTVEKSTPLEVLVAPRLSASLY  524



>ref|XP_006366435.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=517

 Score =   443 bits (1139),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 219/508 (43%), Positives = 322/508 (63%), Gaps = 20/508 (4%)
 Frame = -1

Query  1634  LWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRIL  1455
             L+FS +KQSK +P EA GAWPIIGHLH         K   + A+KYGP+F ++LG++ ++
Sbjct  23    LFFSAKKQSKNVP-EAAGAWPIIGHLHLLNGPQMPHKIFGQMAEKYGPIFRLKLGVNDVV  81

Query  1454  VVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLS  1275
             +VS+ +  ++CFTTNDK  A RP + A + LGY+YA+F       YWR +RK+V  E LS
Sbjct  82    IVSDHKIAKECFTTNDKAFANRPKSIASEILGYNYAMFGLGPYGPYWREIRKIVTTEFLS  141

Query  1274  SRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIV  1095
             +RR+E LKHV   E+++ + E Y        KNN N  A K+ M  WFG+L +N +++++
Sbjct  142   ARRIEMLKHVREFEVKSAVKETYEYWL----KNNLN-GAVKIEMKEWFGNLIMNTMVKLL  196

Query  1094  AGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKR  915
              G +Y    D    EE  +  K   +++ L G FV  D    L + RWLD  GH K MK 
Sbjct  197   FGVQYTGNED----EERSKAHKAIQRLLELLGAFVVADF---LPYLRWLDIGGHEKIMKS  249

Query  914   AAKDVDAILQDWVDARRKERR-----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAI  750
              AK++D I++DW+   R++R+       +++ F+DVMLS+ +D+   G+    D +IKA 
Sbjct  250   TAKEIDFIVEDWLAEHRRKRKLRGNNCGDEEDFMDVMLSICEDKNLHGFD--TDAIIKAT  307

Query  749   VLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQG  570
              +++    ++T    L WIL++LL + E+LK+ QDE+DT+IGK RW ++SD+KNL YLQ 
Sbjct  308   CMALQTAGTDTTIVTLIWILSLLLNNYEALKKAQDELDTHIGKNRWVQESDIKNLVYLQA  367

Query  569   VVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPE  390
             +VKE+ R+YP  P + PHE++EDC+V GY IPKGT+L VNVW+L  DP+IWP+P +F PE
Sbjct  368   IVKESFRLYPAAPLMLPHESIEDCVVSGYDIPKGTRLLVNVWKLQYDPEIWPNPHEFKPE  427

Query  389   RFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD  210
             RF+T  +    +   ++ +PFG GRR CPG   A Q+ Q  V+ L QGF+     +E +D
Sbjct  428   RFLTTHKDVDVRGNHFELIPFGSGRRMCPGVSLALQVLQYVVSVLLQGFDIKRPSDEAID  487

Query  209   MMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             M E  G+ + K +PLEV +TPRL   L+
Sbjct  488   MSESFGLTILKASPLEVQLTPRLDSNLY  515



>ref|XP_008464765.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=523

 Score =   443 bits (1139),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 231/524 (44%), Positives = 320/524 (61%), Gaps = 23/524 (4%)
 Frame = -1

Query  1664  SILGIAALVLLWFSWRK---------QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1512
             ++ GI AL++  ++  K           KRLPPE GGA P+IGHLH    + P  KT ++
Sbjct  11    TVTGIFALIIFLYALFKIYRGGVGARHRKRLPPEVGGALPLIGHLHLLAKNEPAHKTFAK  70

Query  1511  WADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFS  1332
              AD YGP+FT+RLG+   L+VSNWE  R+CFTTNDK  A+RP   A K LGYDYA+F  S
Sbjct  71    MADAYGPIFTLRLGLYTNLIVSNWEIARECFTTNDKIFASRPKLVASKLLGYDYAMFGLS  130

Query  1331  TNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPK  1152
                 +WR+VRKL ++ELLS+ R+EKL+H+ VSE+Q ++   Y  + + N KN        
Sbjct  131   PYGPHWRHVRKLAMLELLSNYRLEKLQHIRVSEVQTSMKNLYE-LCLKNKKN------AL  183

Query  1151  VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
             V M  WFG +TLN I +IV G+++    D   + E +  +K        +G FV  D+ F
Sbjct  184   VEMKTWFGDITLNTISRIVVGKKFSTAVDAS-NNENEEYRKALRDFFEWFGVFVPSDS-F  241

Query  971   PLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKE--RRSNEDQKFIDVMLSMIDDQ  798
             P  F +WLD  GH K+MK+ AK +D +   W+   +        E+  F+DVMLS + D 
Sbjct  242   P--FLKWLDLGGHEKAMKKTAKVLDEVFDKWIQDHKNNLGEVKMEEHDFMDVMLSNVRDD  299

Query  797   FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE  618
               Q   Y   TV KA  LS++   S+T    + W L++LL + E LKR Q E+D  +G++
Sbjct  300   -GQLSKYDAHTVTKATCLSLILAGSDTTTVTMIWALSLLLNNQEVLKRAQLELDERVGRQ  358

Query  617   RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL  438
             R  ++SDVKNL YLQ +VKETLR+YP  P L PHE+V+DC+V GYHIP GT+L VNV +L
Sbjct  359   RQVKESDVKNLLYLQAIVKETLRLYPAAPILVPHESVDDCVVAGYHIPVGTRLIVNVQKL  418

Query  437   HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR  258
              RDP+IW DP +F PERF+T+ +    + +  + +PFG GRR CPG  +A Q+  +A+A 
Sbjct  419   QRDPQIWEDPCEFRPERFLTSAKDFDVRGQNPRLIPFGSGRRMCPGISFALQVMHLALAN  478

Query  257   LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             L  GF  S    E LDM E  G+   +  PLEV++TPRL P ++
Sbjct  479   LLHGFEISRPSKEFLDMEESAGMTSIRKNPLEVVLTPRLPPHVY  522



>gb|KHG07864.1| Cytochrome P450 protein [Gossypium arboreum]
Length=515

 Score =   442 bits (1138),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 216/521 (41%), Positives = 329/521 (63%), Gaps = 24/521 (5%)
 Frame = -1

Query  1661  ILGIAALVLLWFSWRKQS-----KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1497
             I  IA+L+L  + + +++     K   PE  G+ P+IGHLH      P+ K L+  ADK+
Sbjct  7     IPSIASLLLFLYIFSRKAPKNSKKNCIPEPTGSLPLIGHLHLLGGKEPICKNLATMADKH  66

Query  1496  GPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSY  1317
             GP+++++LG  RILVVS+WE  +DCFT ND+ +A R    AG+Y+GYD A+F+ +    Y
Sbjct  67    GPLYSLKLGTHRILVVSSWEIAKDCFTNNDRTLATRANIVAGRYMGYDNAIFSLAPYGEY  126

Query  1316  WRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSR  1137
             WRN+RK+  VELLSS R+EKLKH+  SE+ + I E Y  ++ + DK         V +S 
Sbjct  127   WRNIRKMATVELLSSHRLEKLKHIRFSEMDSFIKELYG-LSRNGDK---------VTISE  176

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
                 LT N+ ++++ G+R+     G V  E  R  K   + +YL+G FV  DA+   W  
Sbjct  177   ALERLTFNINLRMLFGKRFSGNDYGEVDSEPWRFMKAIKRALYLFGIFVLPDAL--QWLE  234

Query  956   RWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLSMI-DDQFTQ  789
             R+ D +GHV+SMK  AK++D+I+  W++   K++R N+   +  F+DVML+ + +D    
Sbjct  235   RF-DIQGHVRSMKENAKELDSIINVWLEEHLKKKRENQGASESDFMDVMLTHLREDTVIS  293

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
             G++  RDT++KA  L +     E+ +  +TW+L++LL HP  L   Q+EID ++GK+RW 
Sbjct  294   GHT--RDTIVKATTLVLSLTGGESTSVTITWVLSLLLNHPNVLITAQEEIDHHVGKQRWV  351

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
             E+SD+KNL YLQ +VKETLR+YP GP     EA++DC + GY +PKGT+L VN+W+LHRD
Sbjct  352   EESDIKNLKYLQAIVKETLRLYPPGPITGIREAMQDCCIAGYDVPKGTRLIVNIWKLHRD  411

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ  249
             P++W +  +F PERFMT       + + ++++PF  GRRSCPG  +  Q+  + V++L Q
Sbjct  412   PRVWENANEFHPERFMTTHVDFDVKGQNFEYMPFSSGRRSCPGMTFGLQVVHLTVSKLIQ  471

Query  248   GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             GF+        +DM E +G+ LPKL PLEV+++PRL    +
Sbjct  472   GFDIRVAEGTAVDMEEGLGLALPKLNPLEVVLSPRLGTEFY  512



>emb|CDP03915.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   441 bits (1133),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 214/439 (49%), Positives = 306/439 (70%), Gaps = 14/439 (3%)
 Frame = -1

Query  1613  QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEG  1434
             ++++ PPE  GAWP+IGHL    +   L +T    ADKYGPVF+IRLG++R LVVSNWE 
Sbjct  36    KARKQPPEPSGAWPVIGHLLQLNSHDTLARTFGALADKYGPVFSIRLGMTRALVVSNWEA  95

Query  1433  VRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKL  1254
             V++CFTTNDK +A+RP + AG YLGY+ A F F+    +WR +RKLV++++LS+RR+E L
Sbjct  96    VKECFTTNDKVLASRPDSNAGVYLGYNNAAFGFAPYGHFWRQMRKLVLLQVLSNRRLETL  155

Query  1253  KHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEY  1074
             +HV VSE+Q +  E ++ I    ++  N P+  KV +S W   LTLN+I++ VAG+RY  
Sbjct  156   RHVRVSEIQTSTRELFSVI----NREENAPA--KVVISEWVEQLTLNIIVRTVAGKRYS-  208

Query  1073  RSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDA  894
              S+     +AQ  KKV  + MY+ G+    D I P    RWLD  GH+KSMKR  K++DA
Sbjct  209   DSEAGNRIDAQYFKKVVKEYMYVTGQLDLSDVI-PFPPLRWLDPLGHIKSMKRLFKELDA  267

Query  893   ILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA  726
             I+Q W+D   ++RR    S ++Q FIDV+LS+I+D F  G    R+T+IKA + +++   
Sbjct  268   IMQIWIDEHVEKRRTKSISGDEQSFIDVLLSVIEDDFALGQP--RETLIKATINNLILAG  325

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             S+T + HLTW+L++L+ + + +++ Q+EID+++GKERW  +SD+KNL YLQ +VKE LR+
Sbjct  326   SDTTSVHLTWLLSLLVNNRQVMEQAQEEIDSSVGKERWVNESDIKNLVYLQAIVKEALRL  385

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP GP   PH A EDC V GYH+PKGT+++VNVW+LHRDP+IW +P+KF PERFMT+   
Sbjct  386   YPPGPLSVPHLAREDCEVSGYHVPKGTRVFVNVWKLHRDPRIWSEPDKFCPERFMTSHAE  445

Query  365   EAAQNRQYQFVPFGLGRRS  309
                  + ++F PFG GRRS
Sbjct  446   VDVSGQHFEFTPFGSGRRS  464



>ref|XP_002305292.2| hypothetical protein POPTR_0004s10630g [Populus trichocarpa]
 gb|EEE85803.2| hypothetical protein POPTR_0004s10630g [Populus trichocarpa]
Length=516

 Score =   442 bits (1137),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 223/525 (42%), Positives = 323/525 (62%), Gaps = 23/525 (4%)
 Frame = -1

Query  1661  ILGIAALVLLWFSWR--------KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWA  1506
             IL    LV L+  W+        K+S R  PE  GAWP+ GHL       P  KTL   A
Sbjct  2     ILEALILVFLYGFWKILARNSEGKKSTR-APEPSGAWPLFGHLPSLVGKDPACKTLGAIA  60

Query  1505  DKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTN  1326
             DKYGP+++++ GI R LVVS+WE V+DC  TND+ +A R    AGK++ Y+ A F  +  
Sbjct  61    DKYGPIYSLKFGIHRTLVVSSWETVKDCLNTNDRVLATRAGIAAGKHMFYNNAAFALAPY  120

Query  1325  NSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVN  1146
               YWR+VRKL  ++LLS++R+E LKHV VSE+   I   ++  A + D      S  KVN
Sbjct  121   GQYWRDVRKLATLQLLSNQRLEMLKHVRVSEVDTFIKGLHSFYAGNVD------SPAKVN  174

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             +S+    LT N+ ++ + G+RY   +    + E  R KK   + +YL G FV  DAI   
Sbjct  175   ISKLLESLTFNINLRTIVGKRYCSSTYDKENSEPWRYKKAIKKALYLSGIFVMSDAIP--  232

Query  965   WFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKER-----RSNEDQKFIDVMLSMIDD  801
              F  WLDY+GHV +MK+ AK++DA++++W++   K++      S+ +  F+DVM+S + +
Sbjct  233   -FLEWLDYQGHVSAMKKTAKELDAVIRNWLEEHLKKKIDGELGSDRESDFMDVMISNLAE  291

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
                +   YSRD VIKA  L +    + + AT L W L++LL +P  LK  Q+E+D  +G+
Sbjct  292   GPDKISGYSRDVVIKATALILTLTGAGSTATTLVWTLSLLLNNPTVLKAAQEELDKQVGR  351

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             ERW E+SD++NL YLQ +VKETLR+YP GP     EA+EDC + GY +PKGT+L VN+W+
Sbjct  352   ERWVEESDIQNLKYLQAIVKETLRLYPPGPLTGIREAMEDCSIGGYDVPKGTRLVVNIWK  411

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             LHRDP++W +P +F P+RF+T       + +  +F+PF  GRRSCP       +  + +A
Sbjct  412   LHRDPRVWKNPNEFKPDRFLTTHADLDFRGQNMEFIPFSSGRRSCPAINLGLIVVHLTLA  471

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             R+ QGF+ +TV   P+DM+E  GI LPK TPLEV++ PRL   L+
Sbjct  472   RILQGFDLTTVAGLPVDMIEGPGIALPKETPLEVVIKPRLGLELY  516



>ref|XP_006432714.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
 ref|XP_006471503.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45954.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
Length=525

 Score =   442 bits (1137),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 218/503 (43%), Positives = 321/503 (64%), Gaps = 19/503 (4%)
 Frame = -1

Query  1622  WRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSN  1443
             +  + KR  PEAGGAWP+IGHLH      P  + L   ADKYGP+FTI++GI+R LVVSN
Sbjct  37    YTSKKKRGAPEAGGAWPVIGHLHLLGGPEPPHRVLGCMADKYGPIFTIKMGINRALVVSN  96

Query  1442  WEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRM  1263
             WE  ++C TT+DK  A+RP T A + LGY++++F FS   SYWR  RK+  +ELLS+ R+
Sbjct  97    WEMAKECLTTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRL  156

Query  1262  EKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRR  1083
             EKLK V   EL+  + E Y     DN+K+ N      V M RW      N++++I+ G+ 
Sbjct  157   EKLKQVREYELKTCLKELYQL--WDNNKSTNK--MLLVEMKRWLADSIRNVVLRIIVGK-  211

Query  1082  YEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKD  903
                   G  S +++  K++ ++   + G+FV  DA   L F RWLD  G  +SMK+ AK+
Sbjct  212   ------GCNSMDSEEWKELLTRFFEMSGKFVVSDA---LPFLRWLDIGGDERSMKKIAKE  262

Query  902   VDAILQDWVDARRKERRSNE----DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSML  735
             +D ++Q W++  + +R S E    ++ F+ VMLS++ D   Q Y    DT+ KAI L ++
Sbjct  263   LDVVVQGWLEEHKMKRDSQEMNQEEEDFMYVMLSILGDT-EQYYGRDVDTINKAICLGLI  321

Query  734   QDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKET  555
               A++T A  LTWI+++LL H + L + ++E+D  +G +R   +SD+K L YLQ ++KE 
Sbjct  322   LAATDTTAVTLTWIISLLLNHHDILNKARNELDIQVGTKRQVNESDIKKLVYLQAILKEA  381

Query  554   LRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTN  375
             +R+YP  P L PHE++E+C V GY++P GTQL++NVW+L RDP +W +P KF PERF+T 
Sbjct  382   MRLYPAAPLLIPHESIEECTVSGYNVPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTR  441

Query  374   LEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV  195
              +    + + ++ +PF  GRR CPG  +A Q+ Q  +A L  GF+ +T  NEPLDM E +
Sbjct  442   HKDTDVRGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLHGFDIATPSNEPLDMGEGL  501

Query  194   GIILPKLTPLEVLVTPRLSPTLF  126
             G+ + K TPLEVLV PRLS +L+
Sbjct  502   GLTVEKSTPLEVLVAPRLSASLY  524



>ref|XP_002281431.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=516

 Score =   442 bits (1136),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 226/522 (43%), Positives = 321/522 (61%), Gaps = 26/522 (5%)
 Frame = -1

Query  1664  SILGIA-ALVLLWFSWRKQSK---RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1497
             ++ GI  A++ LW    K +K   R PPE  GAWP++GHLH      PL +T    AD+Y
Sbjct  11    TVFGILFAIICLWLVNAKGNKNKGRSPPEPSGAWPVMGHLHLLGADKPLHRTFGAMADEY  70

Query  1496  GPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSY  1317
             GP+F+IRLG+   LVVS+ E  ++C+TT DK +A RP + A K +GY++A+F F  +  Y
Sbjct  71    GPIFSIRLGLRTALVVSSSEVAKECYTTKDKALANRPRSLAVKLMGYEHAMFAFERHGPY  130

Query  1316  WRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSR  1137
             WR+VR+L +VELLS+R+ E LKHV  SE+   I E Y          +N  S   V+M +
Sbjct  131   WRDVRRLAMVELLSNRQHEMLKHVRDSEVTFFIQELYGQWV------DNGGSPVLVDMKK  184

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
              F HL  NL+M+ VAG+R              R  +     M L G+F+  DA+ P  F 
Sbjct  185   KFEHLVANLVMRTVAGKR--------CGNGESRWCQALGDFMNLMGQFMVSDAV-P--FL  233

Query  956   RWLD-YEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE----DQKFIDVMLSMIDDQFT  792
              WLD   G+   MK  A+ +D ++  WV+  R++R S      +Q FI  MLS+IDD   
Sbjct  234   GWLDTVRGYTAKMKGTARQLDQVIGRWVEEHRQKRLSGSINEAEQDFIHAMLSVIDDAQF  293

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
              G+ +  DTVIKA  L+++  +++T A  LTW L++L+ +P +LK+ Q+E+D ++G+ + 
Sbjct  294   SGHDHDHDTVIKATCLTVMLASNDTIAITLTWALSLLMNNPHALKKAQEELDFHVGRNQQ  353

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
               +SD+K L YLQ ++KETLR+YP GP   PHEA+EDC + G+HI  GT+L VN+W+LHR
Sbjct  354   VYESDIKKLVYLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQAGTRLLVNLWKLHR  413

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP IW DP +F PERF+T   G   + + ++ +PFG GRR CPG  +A +I Q+ +ARL 
Sbjct  414   DPTIWSDPLEFQPERFLTKHVGLDVRGQHFELLPFGSGRRMCPGISFALEILQLTLARLL  473

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              GF    V + PLDM E VG+ LPK TPLEV + PRL   L+
Sbjct  474   HGFELGVVADSPLDMTEGVGLALPKATPLEVTLVPRLPSELY  515



>ref|XP_003548652.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
Length=521

 Score =   441 bits (1134),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 232/536 (43%), Positives = 343/536 (64%), Gaps = 28/536 (5%)
 Frame = -1

Query  1691  MDAVPCCLSSILGIAALVLLWFSWRKQSKRL-------PPEAGGAWPIIGHLHHFRTSVP  1533
             MD +P   + ++ +  +VLL+  WRK+S  +       PPE   A P+IGHLH      P
Sbjct  1     MDFLPQP-TLVVIVITIVLLYNIWRKKSSTIHKIKGLQPPEPSFALPLIGHLHLLGAKTP  59

Query  1532  LVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYD  1353
             L +  +  ADKYGP+F I LG    LV+ N E +++CFTTNDK +A+RP +  G +L Y+
Sbjct  60    LARIFASLADKYGPIFQIHLGAYPALVICNQEAIKECFTTNDKVLASRPKSSHGVHLSYN  119

Query  1352  YAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNN  1173
             +A F F+   SYW  +RKL ++ELLS+RR+E L+ V+ SE+   I + +  +   +D   
Sbjct  120   FAGFGFAPYGSYWIKLRKLTMLELLSARRLEFLRPVYESEIDTLIRDLWMYLGGKSDV--  177

Query  1172  NNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEF  993
                   KV +S W   LT N+I +++AG+RY      V   EA  + K+  + M++ GEF
Sbjct  178   ------KVTISEWLERLTFNMITKMIAGKRYFSYLQDVDDVEAHGIVKLIKEFMHISGEF  231

Query  992   VSGDAIFPLWFFRWLDYEGHV-KSMKRAAKDVDAILQDWVDARRKE----RRSNEDQKFI  828
             V  D I PL    WL   G V K+MKR AKD+D ++  WV+   K      +S E   FI
Sbjct  232   VLSDLI-PL--LGWLGVHGTVLKNMKRIAKDLDTLVGGWVEEHMKSDTLTNKSWEKHDFI  288

Query  827   DVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQ  648
             DVMLS+I+D    G  ++RDT+IKA V++++   S+T +T +TW LA+L+K+P +LKR Q
Sbjct  289   DVMLSVIEDDSVSG--HTRDTIIKANVMNLMLAGSDTTSTTMTWTLAMLMKNPHALKRAQ  346

Query  647   DEIDTNIGKE-RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPK  471
             +EID  +G+E R  E  D+K+L YLQ +VKETLR+YP GP L PHEA EDC + GYH+PK
Sbjct  347   EEIDHQVGRERRRVEARDIKDLIYLQAIVKETLRLYPPGPVLVPHEAREDCNIQGYHVPK  406

Query  470   GTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLY  291
             GT+++ NVW+LHRDP +W +PEKF PERF++   GE  +   ++++PFG GRR+CPG+ +
Sbjct  407   GTRVFANVWKLHRDPSLWSEPEKFSPERFISE-NGELDEVHHFEYLPFGSGRRACPGSTF  465

Query  290   ATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             ATQ+  + ++RL QGF+     +EP+D+ E +GI LPK+ PL+++++PRL    ++
Sbjct  466   ATQVCLLTLSRLLQGFDLHVPMDEPVDLEEGLGITLPKMNPLQIVLSPRLPSEFYQ  521



>ref|XP_006464300.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   441 bits (1134),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 221/504 (44%), Positives = 319/504 (63%), Gaps = 24/504 (5%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNW  1440
             + Q+    P A GAWP+IGHLH F    P  + L + ADKYGP+FT+++G++R LVVSNW
Sbjct  36    KTQAPHQAPVAAGAWPLIGHLHLFGGQEPTHRLLGDVADKYGPIFTMKMGLNRALVVSNW  95

Query  1439  EGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRME  1260
             E  ++CFT NDK  A RP + A   LGY++     S   +YWR  RK+  +ELLS+ +++
Sbjct  96    EIAKECFTINDKPFANRPRSMAMDLLGYNFLAIAASPYGNYWRESRKMATIELLSNNQLQ  155

Query  1259  KLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVN--MSRWFGHLTLNLIMQIVAGR  1086
             KLKHV  SE++A+I   +        +N    S+ KV+  M  W   + L++IM+I+AG+
Sbjct  156   KLKHVRESEVKASIKGLF--------ENCKRSSSHKVSVEMKHWIEGIVLDIIMRIIAGK  207

Query  1085  RYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAK  906
             RY        S+++   ++  +    L G+FV  DA   L F RWLD  G+ K MK+ AK
Sbjct  208   RY-------TSQDSSDFQEHATNFFDLCGKFVVSDA---LPFLRWLDIGGYEKLMKKTAK  257

Query  905   DVDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQ-GYSYSRDTVIKAIVLSM  738
             + D + Q W+D  + +R S+E   D+ F+ VMLS+ DD+  Q       DTVIKAI LS+
Sbjct  258   EFDLVFQGWLDEHKSKRGSSEVKGDEDFMYVMLSLFDDKAKQLPDGDDTDTVIKAICLSL  317

Query  737   LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE  558
             +  AS+T A  LTW +A+LL + + LK+ Q+E+D  +G  R   +SD+KNL YLQ ++KE
Sbjct  318   ILAASDTTAVTLTWAIALLLNNRDVLKKAQNELDAQVGTNRQVNESDMKNLAYLQVILKE  377

Query  557   TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT  378
             TLR+YP GP L PHE++EDC + GYH+P GTQL VN W++ RDP +W +P KFLPERF+ 
Sbjct  378   TLRLYPAGPLLVPHESIEDCTIRGYHVPAGTQLIVNAWKVQRDPGVWEEPCKFLPERFLK  437

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
               +    + + ++F+PFG GRR CPG  +A Q+  + +A L  GF+F+T  + P+DM E 
Sbjct  438   KYKDVDLKGQNFEFIPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEA  497

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
               +   K TPLEVL+TPRLS +L+
Sbjct  498   KSLTYAKATPLEVLLTPRLSASLY  521



>dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=511

 Score =   440 bits (1132),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 219/515 (43%), Positives = 320/515 (62%), Gaps = 17/515 (3%)
 Frame = -1

Query  1643  LVLLW---FSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRL  1473
              ++LW    S +  + +  PEA GAWPIIGHLH    S    KTL   ADKYGP+F IR+
Sbjct  7     FLILWRTRSSSKTNTCKEAPEAPGAWPIIGHLHLLGGSELRHKTLGAMADKYGPIFKIRI  66

Query  1472  GISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLV  1293
             G++  LVVSN +  ++CFTTNDK  A+RPT+ A K LGYDY +F  +    YW  +RK+ 
Sbjct  67    GVNHALVVSNSDIAKECFTTNDKAFASRPTSTASKILGYDYVMFGMAPYGQYWVELRKIT  126

Query  1292  VVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPK-VNMSRWFGHLTL  1116
             + ELLS+RR+E LKHV  SE+ A+I + Y        KN++    P  V+M +WFG LTL
Sbjct  127   MSELLSNRRLELLKHVRDSEIDASIQDLYKVW-----KNHDKAKGPVLVDMKQWFGDLTL  181

Query  1115  NLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEG  936
             N+I++++AG+RY          EA+  +K       L G F+  DA   L +  W D +G
Sbjct  182   NVILRMIAGKRYSGSMSSCDETEARTCQKGMRDFFRLLGLFIIEDA---LPYLSWFDLQG  238

Query  935   HVKSMKRAAKDVDAILQDWVDARRKERRS---NEDQKFIDVMLSMIDDQFTQGYSYSRDT  765
             + K MK  AK++D++ Q W++   + R++   N +Q F+DV++S+++D  T+   Y  DT
Sbjct  239   YKKEMKNTAKELDSVFQRWLEEHNRMRQTGELNREQDFMDVLMSILED--TRISEYDNDT  296

Query  764   VIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNL  585
             +IK+  LS++    +T    LTWIL++LL +  +LK+ QDE+D+++GK+R  E+SD+KNL
Sbjct  297   IIKSTCLSIVTGGGDTTMVTLTWILSLLLNNKHALKKAQDELDSHVGKDRQVEESDIKNL  356

Query  584   PYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPE  405
              YLQ + KE LR+YP GP   P  A  DC V GYH+P GT+L VN +++ RDP +W +P 
Sbjct  357   VYLQAITKEALRLYPAGPLSGPRVADADCTVAGYHVPAGTRLIVNTYKIQRDPLVWSEPS  416

Query  404   KFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVP  225
             +F PERF+T+      +   Y+ +PFG GRRSCPG  +  Q+  + +AR    F+  T  
Sbjct  417   EFRPERFLTSHVNMDVKGLHYELIPFGAGRRSCPGMSFTLQVVPLVLARFLHEFDSKTEM  476

Query  224   NEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFRL  120
             + P+DM E  G+   K TPLEV++TPRL P ++ L
Sbjct  477   DMPVDMTETAGLTNAKATPLEVVITPRLHPEIYGL  511



>ref|XP_002282111.2| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera]
Length=525

 Score =   441 bits (1133),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 227/529 (43%), Positives = 334/529 (63%), Gaps = 21/529 (4%)
 Frame = -1

Query  1691  MDAVPCCLS-------SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVP  1533
             MD +  CL+       +IL ++  +LLW S   +S R+ PEA GAWPIIGHLH    S  
Sbjct  1     MDFLLQCLNPVMVGAFAILVLSYHLLLWRSGAGKS-RMAPEASGAWPIIGHLHLLGGSKN  59

Query  1532  LVKTL-SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGY  1356
             L   L    ADKYGPVF+IRLG+ R +VVS+WE  ++CFTT+D  +A+RP   A KYLGY
Sbjct  60    LPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKECFTTHDLALASRPELVAAKYLGY  119

Query  1355  DYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKN  1176
             +YA+F  S + +YWR VRK+  +ELLS+RR+E LK+V +SE++  + E Y   A    K 
Sbjct  120   NYAMFGLSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMKELYELWA----KK  175

Query  1175  NNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGE  996
              +      V+M +WFGHL+LN+I+++V G+RY   +     +EAQ+ +K   +   L G 
Sbjct  176   KSEAGVVLVDMKQWFGHLSLNVILKMVVGKRYFGYAAESKEKEAQQFQKAIREFFRLMGL  235

Query  995   FVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE---DQKFID  825
             FV  DAI P  F  WLD  GHVK+MK+ AK++D I Q+W++  R+ + S E   DQ F+D
Sbjct  236   FVVSDAI-P--FLGWLDVGGHVKAMKKTAKELDGITQEWLEEHRRRKDSGEADGDQDFMD  292

Query  824   VMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQD  645
             VMLS++  + T    Y  DT+ KA  L M+   ++T +  LTW +++LL +P  L++ Q+
Sbjct  293   VMLSILGGRDTT--DYDADTINKATSLVMIGGGADTTSGTLTWAVSLLLNNPHILRKAQE  350

Query  644   EIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGT  465
             E+D ++GKER   + D+  L YLQ +VKETLR+ P  P   P + ++D I+ GYHI KGT
Sbjct  351   ELDAHVGKERLVNEMDISKLVYLQAIVKETLRLNPIAPLSGPRQFIQDSILGGYHISKGT  410

Query  464   QLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYAT  285
             +L +N+ ++ RDP++W +P +F P+RF+T  +    + + ++  PFG GRR CPG ++A 
Sbjct  411   RLILNLTKIQRDPRVWLNPMEFQPDRFLTTHKDVDVRGKHFELTPFGGGRRICPGIVFAL  470

Query  284   QITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
             Q+  + +A     F  ST  + P+DM E  G+   K TPLEVL++PRL+
Sbjct  471   QVLHLTLANFLHRFQLSTPSDAPVDMSEGFGLTNIKSTPLEVLISPRLA  519



>emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera]
Length=528

 Score =   441 bits (1133),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 219/496 (44%), Positives = 314/496 (63%), Gaps = 14/496 (3%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             P AGGAWPIIGHLH F       KTL   ADKYGPVFTIRLG++ ILV+S+ E  R+CFT
Sbjct  41    PRAGGAWPIIGHLHLFGAQQLTHKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECFT  100

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
             T+D+  + RP+  A K LGYD+A+F F+   SYWR +RK+V +ELLS+ R++ LKH+  S
Sbjct  101   THDRVFSTRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIRAS  160

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E+  +I E Y     +   +        V+M RWFG LTLNL +++V G+RY        
Sbjct  161   EVGTSIRELYEMWVSERGTDGR----VFVDMKRWFGDLTLNLAVRLVGGKRYFGAGADTK  216

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV  876
               E +  +KV     +L+G FV  DAI P  F  WLD +G+ K+MKR AK++D++   W+
Sbjct  217   EGEGRTCQKVIRDFAHLFGVFVLSDAI-P--FLSWLDLKGYKKAMKRTAKELDSLFGGWL  273

Query  875   DARRKER----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFAT  708
                +++R       +DQ F+DVML++++D    G  +  DTV KA  L+++   S+T   
Sbjct  274   QEHKEKRLLGGEGKDDQDFMDVMLTVLEDVNFSG--FDADTVNKATCLNLILAGSDTTKV  331

Query  707   HLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPY  528
              LTW L++LL HP  LK+ Q E+D  +GK+R  ++SDVKNL YLQ ++KETLR+YP  P 
Sbjct  332   TLTWALSLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPI  391

Query  527   LAPHEAVEDC-IVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN  351
             +  H A+EDC +  GY+I  GTQ+ VN W++HRD ++W +P++F PERFMT+ +    + 
Sbjct  392   ITLHAAMEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHKDTDVRG  451

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
             + ++ +PFG GRRSCPG   A Q+   A+A L   +  +   +  +DM E +G+   K T
Sbjct  452   QHFELIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKAT  511

Query  170   PLEVLVTPRLSPTLFR  123
             PLEVL++PRL   L+R
Sbjct  512   PLEVLLSPRLKAELYR  527



>ref|XP_010064745.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   440 bits (1132),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 221/537 (41%), Positives = 330/537 (61%), Gaps = 36/537 (7%)
 Frame = -1

Query  1667  SSILGIAALVLLWFSWRK--------------QSKRLPPEAGGAWPIIGHLHHFRTSVPL  1530
             +++LGI A   + + +R                 K   PEAGGAWP+IGHLH     VP 
Sbjct  10    TALLGIFAFATVLYFFRSLLVRTKNDRRSVDGHKKASLPEAGGAWPLIGHLHLLGGPVPP  69

Query  1529  VKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDY  1350
                L+  ADKYGP+FTI+ G+ R L+VSNW+  + C T ND+  A+RP + + + + Y+Y
Sbjct  70    HIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLTVNDRAFASRPKSVSSEVMAYNY  129

Query  1349  AVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNN  1170
             A+F  +    YWR+VRK+ ++ELLS+ R+E LKHV  SE+QA++   Y       +  + 
Sbjct  130   AMFGLAPYGPYWRHVRKITMLELLSNHRLELLKHVRHSEVQASVTHLYKRCM---ESYSG  186

Query  1169  NPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFV  990
              P    V+M RWFG +TLN++ +++ G+RYE        E+ ++ ++       L G F+
Sbjct  187   APMKVLVDMKRWFGDITLNVVFRMIVGKRYE-------DEQDEKGREALRSYFDLAGRFI  239

Query  989   SGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE--------DQK  834
               DA FP+   RWLD +G+ K MK+ A ++D ++Q W++  ++ R +N+        DQ 
Sbjct  240   VSDA-FPI--LRWLDLDGYEKMMKKTAHELDRVVQGWLNEHKRRRSANKRRGDNKDSDQD  296

Query  833   FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKR  654
             F+DVMLS++D    +   Y  DT IKA  ++++   S+T +  LTW L++LL H E LK+
Sbjct  297   FMDVMLSIVDAA-EELPGYDADTFIKATCMALVLAGSDTTSVSLTWALSLLLNHREVLKK  355

Query  653   VQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIP  474
              Q E+DT IG+ER   +SD+ NL Y+Q ++KET+R+YP  P   PHE++EDC VDGYHIP
Sbjct  356   AQHELDTQIGRERLVNESDLMNLVYIQAIIKETMRLYPAAPLGVPHESMEDCTVDGYHIP  415

Query  473   KGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNL  294
             KGT+L +N W++HRD  IW DP +F PERF+T       + + ++ +PFG GRR CPG  
Sbjct  416   KGTRLLLNFWKIHRDQHIWSDPLEFRPERFLTTHRNFDVRGQNFELIPFGSGRRMCPGIN  475

Query  293   YATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
              A Q+  +++A L  GF+ +T+ +EP+DM E +G+   K TPLEVLVTPRL    +R
Sbjct  476   LAMQLISLSLAALLHGFDITTLADEPVDMAEAIGMTNLKATPLEVLVTPRLPEHAYR  532



>gb|KCW68807.1| hypothetical protein EUGRSUZ_F02406 [Eucalyptus grandis]
Length=502

 Score =   439 bits (1129),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 215/499 (43%), Positives = 318/499 (64%), Gaps = 22/499 (4%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             PEAGGAWP+IGHLH     VP    L+  ADKYGP+FTI+ G+ R L+VSNW+  + C T
Sbjct  18    PEAGGAWPLIGHLHLLGGPVPPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLT  77

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
              ND+  A+RP + + + + Y+YA+F  +    YWR+VRK+ ++ELLS+ R+E LKHV  S
Sbjct  78    VNDRAFASRPKSVSSEVMAYNYAMFGLAPYGPYWRHVRKITMLELLSNHRLELLKHVRHS  137

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E+QA++   Y       +  +  P    V+M RWFG +TLN++ +++ G+RYE       
Sbjct  138   EVQASVTHLYKRCM---ESYSGAPMKVLVDMKRWFGDITLNVVFRMIVGKRYE-------  187

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV  876
              E+ ++ ++       L G F+  DA FP+   RWLD +G+ K MK+ A ++D ++Q W+
Sbjct  188   DEQDEKGREALRSYFDLAGRFIVSDA-FPI--LRWLDLDGYEKMMKKTAHELDRVVQGWL  244

Query  875   DARRKERRSNE--------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASE  720
             +  ++ R +N+        DQ F+DVMLS++D    +   Y  DT IKA  ++++   S+
Sbjct  245   NEHKRRRSANKRRGDNKDSDQDFMDVMLSIVDAA-EELPGYDADTFIKATCMALVLAGSD  303

Query  719   TFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYP  540
             T +  LTW L++LL H E LK+ Q E+DT IG+ER   +SD+ NL Y+Q ++KET+R+YP
Sbjct  304   TTSVSLTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDLMNLVYIQAIIKETMRLYP  363

Query  539   QGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA  360
               P   PHE++EDC VDGYHIPKGT+L +N W++HRD  IW DP +F PERF+T      
Sbjct  364   AAPLGVPHESMEDCTVDGYHIPKGTRLLLNFWKIHRDQHIWSDPLEFRPERFLTTHRNFD  423

Query  359   AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILP  180
              + + ++ +PFG GRR CPG   A Q+  +++A L  GF+ +T+ +EP+DM E +G+   
Sbjct  424   VRGQNFELIPFGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEPVDMAEAIGMTNL  483

Query  179   KLTPLEVLVTPRLSPTLFR  123
             K TPLEVLVTPRL    +R
Sbjct  484   KATPLEVLVTPRLPEHAYR  502



>ref|XP_004252778.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=527

 Score =   440 bits (1131),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 227/527 (43%), Positives = 334/527 (63%), Gaps = 29/527 (6%)
 Frame = -1

Query  1652  IAALVLLWFSWRKQ----SKRLPPEAGGAWPIIGHLHHFR-TSVPLVKTLSEWADKYGPV  1488
             I  L+ L+F ++K     + +  PE  GAWPIIGHL     T   L +TL   AD YGP 
Sbjct  10    IGVLIFLYFIFKKNKNCSTSKQAPEPAGAWPIIGHLPLLGGTDQLLYRTLGAMADNYGPA  69

Query  1487  FTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRN  1308
             F +RLG  R  VVS+WE  ++CFT NDK +A+RPTT A K++GY YAVF F+  + +WR 
Sbjct  70    FNLRLGTRRAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFAPYSPFWRE  129

Query  1307  VRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFG  1128
             +RK+ + ELLS+RR++ LK+V VSE+   I   Y       D N++ P    V + RWF 
Sbjct  130   MRKIAMFELLSNRRLDTLKYVQVSEVDMGIQALYKLWV---DNNSDRPIL--VELKRWFE  184

Query  1127  HLTLNLIMQIVAGRRYEYRSDGVVS--EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR  954
              LTLN+I+++VAG+RY + +       +EA+R +K  +Q  +L G FV  DA FP+  F 
Sbjct  185   DLTLNVIVRMVAGKRY-FGAGATCDNDDEARRCQKAINQFFHLIGIFVPSDA-FPILGF-  241

Query  953   WLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR-------SNED---QKFIDVMLSMID  804
              LD  GH K+MK+ AK++D IL+ W+   R++R+       S  D   Q FIDVMLS+ +
Sbjct  242   -LDINGHEKAMKKTAKELDFILEGWLKEHREKRKCTSIEAKSTTDSAVQDFIDVMLSLEE  300

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
             +     + Y  DT IK+  L+++   S+T A  LTW +++LL +P+ L++ Q+EID +IG
Sbjct  301   EGRLSNFPYDADTSIKSTCLALILGGSDTTAGTLTWAISLLLNNPKILRKAQEEIDNHIG  360

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             K R  ++SD+ NL Y+Q ++KETLR+YP GP L P EA+++C + GY I  GT+L VNVW
Sbjct  361   KNRQIDESDINNLIYIQAIIKETLRLYPAGPLLGPREAMDNCEISGYKITPGTRLIVNVW  420

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             ++ RDP+IW +P  F P+RF+T+      + + ++ +PFG GRRSCPG   A Q+  + +
Sbjct  421   KIQRDPRIWENPNCFNPDRFLTS--NVDVKGKDFELIPFGSGRRSCPGASLALQVLHLTL  478

Query  263   ARLFQGFNFST-VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             AR+   F F+  + ++P+D+ E  G+ +PK TPL+VLV PRLS  L+
Sbjct  479   ARILHAFEFTKPIDDQPIDLTESPGLTIPKATPLDVLVAPRLSANLY  525



>ref|NP_194922.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
 sp|Q9SZ46.1|C82C4_ARATH RecName: Full=Cytochrome P450 82C4 [Arabidopsis thaliana]
 emb|CAA16595.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79912.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE85981.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
Length=524

 Score =   440 bits (1131),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 216/503 (43%), Positives = 322/503 (64%), Gaps = 25/503 (5%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCF  1419
             P   GAWPIIGHLH       L+ +TL + AD YGP  +++LG +   VVS++E  +DCF
Sbjct  33    PAPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGPAMSLQLGSNEAFVVSSFEVAKDCF  92

Query  1418  TTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWV  1239
             T NDK +A+RP T A K++GY++AVF F+  +++WR +RK+  +ELLS+RR++ LKHV V
Sbjct  93    TVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1238  SELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGV  1059
             SE+   + + Y+         N       V++  W   +TLN+I+++VAG+RY +   G 
Sbjct  153   SEITMGVKDLYSLWF-----KNGGTKPVMVDLKSWLEDMTLNMIVRMVAGKRY-FGGGGS  206

Query  1058  VS----EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAI  891
             VS    EEA + KK  ++  +L G F   DA   L FF   D +GH K MK+   ++D I
Sbjct  207   VSSEDTEEAMQCKKAIAKFFHLIGIFTVSDAFPTLSFF---DLQGHEKEMKQTGSELDVI  263

Query  890   LQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
             L+ W++  R++R+       D  FIDVM+S+ +        Y  +T IK+  L+++   S
Sbjct  264   LERWIENHRQQRKFSGTKENDSDFIDVMMSLAEQGKLSHLQYDANTSIKSTCLALILGGS  323

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             +T A+ LTW +++LL + E LK+ QDEID ++G++R  EDSD++NL YLQ ++KETLR+Y
Sbjct  324   DTSASTLTWAISLLLNNKEMLKKAQDEIDIHVGRDRNVEDSDIENLVYLQAIIKETLRLY  383

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P GP L P EA+EDC V GY++P GT+L VNVW++ RDPK++ +P +F PERF+T   GE
Sbjct  384   PAGPLLGPREAMEDCTVAGYYVPCGTRLIVNVWKIQRDPKVYMEPNEFRPERFIT---GE  440

Query  362   AAQ----NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV  195
             A +     + ++ +PFG GRRSCPG+  A Q+  + +AR    F+  TV + P+DM E+ 
Sbjct  441   AKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTVMDMPVDMSENP  500

Query  194   GIILPKLTPLEVLVTPRLSPTLF  126
             G+ +PK TPLEVL++PR+   LF
Sbjct  501   GLTIPKATPLEVLISPRIKEELF  523



>ref|XP_009109920.1| PREDICTED: cytochrome P450 82C4 [Brassica rapa]
Length=525

 Score =   439 bits (1130),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 226/533 (42%), Positives = 332/533 (62%), Gaps = 24/533 (5%)
 Frame = -1

Query  1691  MDAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLS  1515
             MDA    L S L +  L+ L+   +K      PE  GAWPIIGHLH       L+ +TL 
Sbjct  1     MDAFLFSLLSPLLVFVLIALFKKTKKPKHAKAPEPSGAWPIIGHLHLLGGKEQLLYRTLG  60

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
             E A++YGP  ++RLG +   VVS++E  ++CFT NDK +A+RP T A K++GY+YAVF F
Sbjct  61    EMANRYGPAMSLRLGSNEAFVVSSFEVAKECFTVNDKALASRPMTAAAKHMGYNYAVFGF  120

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +  +S+WR +RK+  VELLS+RR++ LKHV VSE+   + + Y+       K  + P   
Sbjct  121   APYSSFWREMRKIATVELLSNRRLQMLKHVRVSEISMGVKDLYSLWV---KKGGSEPII-  176

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV---SEEAQRLKKVFSQVMYLWGEFVSG  984
              V++ RW   +TLN+I+++VAG+RY +         +EEA++ +K  ++  +L G F   
Sbjct  177   -VDLKRWLEDMTLNMIVRMVAGKRY-FGGGSTTPEDTEEARQCQKAITKFFHLIGIFTMS  234

Query  983   DAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVML  816
             DA FP     W D +GH K MK+   ++D IL+ W++  R++R+       D  FIDVML
Sbjct  235   DA-FPT--LGWFDLQGHEKEMKKTGSELDVILERWIENHRQQRKVSGNKENDSDFIDVML  291

Query  815   SMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEID  636
             S+ +        Y  +T IK+  L+++   S+T A+ LTW +A+LL + + LK+ QDEID
Sbjct  292   SLAEQGKLSHLQYDANTSIKSTCLALILGGSDTTASTLTWAIALLLNNKDMLKKAQDEID  351

Query  635   TNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLY  456
               +G +R  EDSD++NL YLQ ++KETLR+YP GP L P EA+EDC V GYH+  GT+L 
Sbjct  352   LQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYHVACGTRLI  411

Query  455   VNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYA  288
             VNVW++ RDPK+W +P +F PERF+T   GEA +     + ++ +PFG GRRSCPG+  A
Sbjct  412   VNVWKIQRDPKVWVEPNEFRPERFLT---GEAKEFDVRGQNFELIPFGSGRRSCPGSSLA  468

Query  287   TQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTL  129
              Q+  + +AR    F+  T  +  +DM E  G+ +PK TPLEV+++PRL   L
Sbjct  469   MQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPKATPLEVMISPRLEKHL  521



>ref|XP_010432796.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   439 bits (1130),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 223/525 (42%), Positives = 327/525 (62%), Gaps = 31/525 (6%)
 Frame = -1

Query  1652  IAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIR  1476
             +   + L+   +K      P+  GAWPIIGHLH       L+ +TL + AD YG   +++
Sbjct  14    LIVFIALFMKSKKPKHVKAPKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQ  73

Query  1475  LGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKL  1296
             LG S   VVS++E  ++CFT NDK +A+RP T A K++GY++AVF F+  +++WR +RK+
Sbjct  74    LGSSEAFVVSSFEVAKNCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKI  133

Query  1295  VVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPK-VNMSRWFGHLT  1119
               +ELLS+RR++ LKHV VSE+   + + Y+          N  S P  V++ RW   +T
Sbjct  134   ATIELLSNRRLQMLKHVRVSEISMGVKDLYSLWV------KNGGSEPVIVDLKRWSEDMT  187

Query  1118  LNLIMQIVAGRRYEYRSDGVVSE------EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
              N+I+++VAG+RY     G VSE      EA++ K+  S+  +L G F   DA FP    
Sbjct  188   QNVIVRMVAGKRY---LGGAVSESSEDAAEARQCKRAISKFFHLIGIFTVSDA-FPA--L  241

Query  956   RWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQ  789
             RW D++GH K MK+   ++D IL+ W +  R+ER+       D  FIDVMLS+ +     
Sbjct  242   RWFDFQGHEKEMKQTGSELDVILERWTENHRQERKVSGTKENDSDFIDVMLSLEEQGKLS  301

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
                Y  +T IK+  LS++   S+T ++ LTW +A+LL + E LK+ QDEID ++G++R  
Sbjct  302   HLQYDANTSIKSTCLSLILGGSDTTSSTLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNV  361

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
             EDSD+ NL YLQ ++KETLR+YP GP L P EA+EDC V GY++  GT+L VNVW++ RD
Sbjct  362   EDSDINNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRD  421

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             PK++ +P +F PERF+T   GEA +     + ++ +PFG GRRSCPG+  A Q+  + +A
Sbjct  422   PKVYKEPNEFRPERFIT---GEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLA  478

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             R    F   TV + P+DM E  G+ +PK TPLEVL++PRL   LF
Sbjct  479   RFLHSFEVKTVLDMPVDMTESPGLTIPKATPLEVLISPRLKEHLF  523



>ref|XP_010436299.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   439 bits (1129),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 222/523 (42%), Positives = 324/523 (62%), Gaps = 27/523 (5%)
 Frame = -1

Query  1652  IAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIR  1476
             +   + L+   +K      P+  GAWPIIGHLH       L+ +TL + AD YG   +++
Sbjct  14    LIVFIALFMKSKKPKHVKAPKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQ  73

Query  1475  LGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKL  1296
             LG S   VVS++E  ++CFT NDK +A+RP T A K++GY++AVF F+  +++WR +RK+
Sbjct  74    LGSSEAFVVSSFEVAKNCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKI  133

Query  1295  VVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPK-VNMSRWFGHLT  1119
               +ELLS+RR++ LKHV VSE+   + + Y+          N  S P  V++  W   +T
Sbjct  134   ATIELLSNRRLQMLKHVRVSEISMGVKDLYSLWV------KNGGSEPVIVDLKSWLEDMT  187

Query  1118  LNLIMQIVAGRRYEYRSDGVVS----EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW  951
             LN+I+++VAG+RY +   G  S    EEA + K+  S+  +L G F   DA FP    RW
Sbjct  188   LNMIVRMVAGKRY-FGGAGSESSEDTEEASQCKRAISKFFHLIGIFTVSDA-FPA--LRW  243

Query  950   LDYEGHVKSMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQGY  783
              D +GH K MK+   ++D IL+ W++  R+ER+       D  FIDVMLS+         
Sbjct  244   FDLQGHEKEMKQTGSELDVILERWIENHRQERKVSGTKENDSDFIDVMLSLAKQGKLSHL  303

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              Y   T IK+  L+++   S+T A+ LTW +A+LL + E LK  QDEID ++G++R  ED
Sbjct  304   QYDATTSIKSTCLALILGGSDTTASTLTWAIALLLNNKEMLKNAQDEIDLHVGRDRNVED  363

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
             SD+KNL YLQ ++KETLR+YP GP L P EA+EDC V GY++  GT+L VNVW++ RDPK
Sbjct  364   SDIKNLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPK  423

Query  422   IWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYATQITQVAVARL  255
             ++ +P +F PERF+T   GEA +     + ++ +PFG GRRSCPG+  A Q+  + +AR 
Sbjct  424   VYVEPNEFRPERFIT---GEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARF  480

Query  254   FQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
                F   TV + P+DM E  G+ +PK TPLEVL++PRL+   F
Sbjct  481   LHSFEVKTVLDMPVDMSESPGLTIPKATPLEVLISPRLNEQFF  523



>ref|XP_006432710.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
 ref|XP_006471501.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45950.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
Length=524

 Score =   439 bits (1129),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 212/499 (42%), Positives = 316/499 (63%), Gaps = 18/499 (4%)
 Frame = -1

Query  1613  QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEG  1434
             + KR  PEAGGAWP+IGHLH  R   P  +   + ADKYGP+F IR+G +  L+VSNWE 
Sbjct  40    KKKRGAPEAGGAWPVIGHLHLLRGPKPPYRVFDKMADKYGPIFIIRMGKNPALIVSNWEI  99

Query  1433  VRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKL  1254
              ++C TT+DK  A RP T A + LGY++++F FS   SYWR  RK+  + LLS+ R+EKL
Sbjct  100   AKECLTTHDKVFANRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLGLLSNHRLEKL  159

Query  1253  KHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEY  1074
             KHV   E++  + E Y        KN +      V M +WFG    N+++++V G+    
Sbjct  160   KHVREYEVKTCLKELYELW----HKNKSTNKILLVEMKKWFGDTLRNVVLRMVVGK----  211

Query  1073  RSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDA  894
                G  S +++  K++ ++   + G+FV  DA   L F RWLD  G  +SMK+ AK++D 
Sbjct  212   ---GCNSVDSEEWKELLTRFFEMSGKFVVSDA---LPFMRWLDIGGDERSMKKIAKELDV  265

Query  893   ILQDWVDARRKERRSNEDQK---FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
             + Q W++  +++R S E +K   F+ VMLS++ D   Q      DT+ KAI L+++  A+
Sbjct  266   VAQGWLEEHKRKRDSQEIKKEEDFMYVMLSILGDT-EQYLGRDVDTINKAICLALILGAA  324

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             +T    LTW++++LL H + L + Q+E+D  +G +R   +SD+KNL YLQ ++KE +R+Y
Sbjct  325   DTTTVTLTWVMSLLLNHRDILNKAQNELDIQVGTKRQVNESDIKNLVYLQAILKEAMRLY  384

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P GP L PHE++E+C V+GYH+P  TQL++N W++ RDP +W +P KF PERF+T  +  
Sbjct  385   PAGPLLVPHESIEECTVNGYHVPASTQLFINAWKIQRDPSVWEEPSKFQPERFLTRHKDI  444

Query  362   AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
               + + ++ +PF  GRR CPG  +A Q+ Q  +A L QGFNF+T  NEP+DM E +G+ +
Sbjct  445   DVKGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLQGFNFATPSNEPVDMGEGLGLTM  504

Query  182   PKLTPLEVLVTPRLSPTLF  126
              K  P EVLVTPRLS  ++
Sbjct  505   EKSQPFEVLVTPRLSAAVY  523



>ref|XP_010451089.1| PREDICTED: cytochrome P450 82C4 [Camelina sativa]
Length=524

 Score =   439 bits (1129),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 219/503 (44%), Positives = 321/503 (64%), Gaps = 25/503 (5%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCF  1419
             P+  GAWPIIGHLH       L+ +TL + AD YG   +++LG S   VVS++E  ++CF
Sbjct  33    PKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNCF  92

Query  1418  TTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWV  1239
             T NDK +A+RP T A K++GY++AVF F+  +++WR +RK+  +ELLS+RR++ LKHV V
Sbjct  93    TVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1238  SELQANINEFYTTIAMDNDKNNNNPSAPK-VNMSRWFGHLTLNLIMQIVAGRRYEYRSDG  1062
             SE+   + + Y+          N  S P  V++  W   +TLN+I+++VAG+RY   +  
Sbjct  153   SEISMGVKDLYSLWV------KNGGSEPVIVDLKSWLEDMTLNMIVRMVAGKRYFGGTGS  206

Query  1061  VVSE---EAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAI  891
               SE   EA++ K   S+  +L G F   DA FP    RW D +GH K MK+   ++D I
Sbjct  207   ETSEDTEEARQCKIAISKFFHLIGIFTVSDA-FPA--LRWFDLQGHEKEMKQTGSELDVI  263

Query  890   LQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
             L+ W++  R++R+       D  FIDVMLS+ +        Y  +T IK+  L+++   S
Sbjct  264   LEKWIENHRQQRKVSGTKENDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGS  323

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             +T A+ LTW +A+LL + E LK+ QDEID ++G++R  EDSD+KNL YLQ ++KETLR+Y
Sbjct  324   DTTASTLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDIKNLVYLQAIIKETLRLY  383

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P GP L P EA+EDC V GY++  GT+L VNVW++ RDPK++ +P +F PERF+T   GE
Sbjct  384   PAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYMEPNEFRPERFVT---GE  440

Query  362   AAQ----NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV  195
             A +     + ++ +PFG GRRSCPG+  A Q+  + +AR    F   TV + P+DM E  
Sbjct  441   AKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSESP  500

Query  194   GIILPKLTPLEVLVTPRLSPTLF  126
             G+ +PK TPLEVL++PRL+  LF
Sbjct  501   GLTIPKATPLEVLMSPRLNEQLF  523



>ref|XP_010445016.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   439 bits (1128),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 220/504 (44%), Positives = 319/504 (63%), Gaps = 27/504 (5%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCF  1419
             P+  GAWPIIGHLH       L+ +TL + AD YG   +++LG S   VVS++E  ++CF
Sbjct  33    PKPSGAWPIIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNCF  92

Query  1418  TTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWV  1239
             T NDK +A+RP T A K++GY++AVF F+  +++WR +RK+  +ELLS+RR++ LKHV V
Sbjct  93    TVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1238  SELQANINEFYTTIAMDNDKNNNNPSAPK-VNMSRWFGHLTLNLIMQIVAGRRYEYRSDG  1062
             SE+   + + Y+          N  S P  V++  W   +TLN+I+++VAG+RY +   G
Sbjct  153   SEISMGVKDLYSLWV------KNGGSEPVIVDLKSWLEDMTLNMIVRMVAGKRY-FGGAG  205

Query  1061  VVS----EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDA  894
               S    EEA + K+  S+  +L G F   DA FP    RW D +GH K MK+   ++D 
Sbjct  206   SESSEDTEEASQCKRAISKFFHLIGIFTVSDA-FP--SLRWFDLQGHEKEMKQTGSELDV  262

Query  893   ILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDA  726
             IL+ W++  R+ER+       D  FIDVMLS+ +        Y   T IK+  L+++   
Sbjct  263   ILERWIENHRQERKVSGTKENDSDFIDVMLSLAEQGKLSHLQYDATTSIKSTCLALILGG  322

Query  725   SETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRM  546
             S+T A+ LTW +A+LL + E LK  QDEID ++G++R  EDSD+ NL YLQ ++KETLR+
Sbjct  323   SDTTASTLTWAIALLLNNKEMLKNAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRL  382

Query  545   YPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEG  366
             YP GP L P EA+EDC V GY++  GT+L VNVW++ RDPK++ +P +F PERF+T   G
Sbjct  383   YPAGPLLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYEEPNEFRPERFIT---G  439

Query  365   EAAQ----NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
             EA +     + ++ +PFG GRRSCPG+  A Q+  + +AR    F   TV + P+DM E 
Sbjct  440   EAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSES  499

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              G+ +PK TPLEVL++PRL+  LF
Sbjct  500   PGLTIPKATPLEVLISPRLNEQLF  523



>ref|XP_006464298.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   438 bits (1127),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 220/502 (44%), Positives = 320/502 (64%), Gaps = 24/502 (5%)
 Frame = -1

Query  1613  QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEG  1434
             Q+    P AGGAWP+IGHLH F    P  + L + ADKYGP+FT+++G++R LVVSNWE 
Sbjct  38    QAPHQAPVAGGAWPLIGHLHLFGGQEPTHRLLGDMADKYGPIFTMKMGLNRALVVSNWEI  97

Query  1433  VRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKL  1254
              ++CFT NDK  A RP + A   LGY++     S   +YWR  RK+  +ELLS+ +++KL
Sbjct  98    AKECFTINDKPFANRPRSMAMDLLGYNFLAIAASPYGNYWRESRKMATIELLSNNQLQKL  157

Query  1253  KHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVN--MSRWFGHLTLNLIMQIVAGRRY  1080
             KHV  SE++A+I   +        +N    S+ KV+  M  W   + L++IM+I+AG+RY
Sbjct  158   KHVRESEVKASIKGLF--------ENCKRSSSHKVSVEMKHWIEGIVLDIIMRIIAGKRY  209

Query  1079  EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDV  900
                     S+++   ++  +    L+G+FV  DA   L F RWLD  G+ K MK+ AK+ 
Sbjct  210   -------TSQDSSDFQEHATDFFDLFGKFVVSDA---LPFLRWLDIGGYEKLMKKTAKEF  259

Query  899   DAILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQ-GYSYSRDTVIKAIVLSMLQ  732
             D + Q W+D  + +R S+E   D+ F+ VMLS+ DD+  Q       DTVIKAI LS++ 
Sbjct  260   DLVFQGWLDEHKSKRGSSEVKGDEDFMYVMLSLFDDKTKQLPGGDDTDTVIKAICLSLIL  319

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
              AS+T A  LTW +A+LL + + L++ Q+E+D ++G  R   +SD+ NL YLQ V+KETL
Sbjct  320   AASDTTAVTLTWAIALLLNNRDVLEKAQNELDVHVGTNRQVNESDMINLAYLQVVLKETL  379

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R+YP  P L PHE++EDC + GYH+P GTQL VN W++ RDP +W +P +FLPERF+T  
Sbjct  380   RLYPAAPLLVPHESIEDCNISGYHVPAGTQLIVNAWKIQRDPGVWEEPCRFLPERFLTKY  439

Query  371   EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVG  192
             +    + + ++F+PFG GRR CPG  +A Q+  + +A L  GF+F+T  + P+DM E   
Sbjct  440   KDVDLKGQNFEFIPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAPVDMEEAKS  499

Query  191   IILPKLTPLEVLVTPRLSPTLF  126
             +   K TPLEVL+TPRLS +L+
Sbjct  500   LTYAKATPLEVLLTPRLSASLY  521



>ref|XP_002869304.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45563.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   438 bits (1127),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 224/528 (42%), Positives = 332/528 (63%), Gaps = 29/528 (5%)
 Frame = -1

Query  1658  LGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYG  1494
             L +  L+ ++ +  K+SK+      P   GAWPIIGHLH       L+ +TL + AD YG
Sbjct  8     LFVPILLFVFIALFKKSKKPNHVKAPAPSGAWPIIGHLHLLGGKEHLLYRTLGKMADHYG  67

Query  1493  PVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYW  1314
             P  ++RLG S   VVS++E  +DCFT NDK +A+RP T A K++GY++AVF F+  +++W
Sbjct  68    PAMSLRLGSSEAFVVSSFEVAKDCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFW  127

Query  1313  RNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRW  1134
             R +RK+  +ELLS+RR++ LKHV VSE+   + + Y+       K    P    V++  W
Sbjct  128   REMRKIATIELLSNRRLQMLKHVRVSEISMGVKDLYSLWV---KKGGTEPVM--VDLKSW  182

Query  1133  FGHLTLNLIMQIVAGRRYEYRSDGVVS----EEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
                +TLN+I+++VAG+RY +   G  S    EEA + KK  ++  +L G F   DA FP 
Sbjct  183   LEDMTLNMIVRMVAGKRY-FGGGGSQSSEDTEEAMQCKKAIAKFFHLIGIFTVSDA-FPR  240

Query  965   WFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQ  798
                 W D +GH K MK+   ++D IL+ W++  R++R+       D  FIDVMLS+ +  
Sbjct  241   --LGWFDLQGHEKEMKQTGSELDVILERWIENHRQQRQVSGTKENDSDFIDVMLSLAEQG  298

Query  797   FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE  618
                   Y  +T IK+  L+++   S+T A+ LTW +++LL + E LK+ QDEID ++G +
Sbjct  299   KLSHLQYDANTSIKSTCLALILGGSDTSASTLTWAISLLLNNKEMLKKAQDEIDLHVGTD  358

Query  617   RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL  438
             +  EDSD++NL YLQ ++KETLR+YP GP L P EA+EDC V GY++P GT+L VNVW++
Sbjct  359   KNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCRVAGYNVPCGTRLIVNVWKI  418

Query  437   HRDPKIWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYATQITQV  270
              RDPK++ +P +F PERF+T   GEA +     + ++ +PFG GRRSCPG+  A Q+  +
Sbjct  419   QRDPKVYTEPNEFRPERFIT---GEAKEFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHL  475

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +AR    F   TV + P+DM E  G+ +PK TPLEVL++PRL+  LF
Sbjct  476   GLARFLHSFEAKTVLDLPVDMSESPGLTIPKATPLEVLISPRLNEELF  523



>gb|KDP26347.1| hypothetical protein JCGZ_17505 [Jatropha curcas]
Length=526

 Score =   438 bits (1127),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 222/535 (41%), Positives = 336/535 (63%), Gaps = 26/535 (5%)
 Frame = -1

Query  1691  MDAVPCCLSSILGIAALVLLWFSW--------RKQSKRLPPEAGGAWPIIGHLHHFRTSV  1536
             MD      + ILGI AL++ +  W        + +   LPPE  GA P IGHLH      
Sbjct  1     MDYFSSNFTVILGILALLVFYNLWGTRKTPKIKNKGGSLPPEVAGALPFIGHLHKLGDRK  60

Query  1535  PLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGY  1356
             P  + L E AD YGP+FT+RLG    +V+S+   +++ +TT+DK  A+RP +   KYL Y
Sbjct  61    PFARILGEIADNYGPIFTVRLGKHPTIVISDQNILKEFYTTHDKFFASRPPSSQSKYLAY  120

Query  1355  DYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKN  1176
             +YA F F+  ++YWR+VRKL +V++LS  R++ L+HV V+E+   + + +        K 
Sbjct  121   NYAAFGFAPYSTYWRDVRKLAMVQVLSLHRLKLLQHVRVTEVSHIVQDLFLKC-----KE  175

Query  1175  NNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQR-LKKVFSQVMYLWG  999
             N N S   V+MS    HL LN+I ++VAG+RY +  +   ++E +R + ++  + MYL G
Sbjct  176   NGNCS---VDMSELLEHLVLNIITRMVAGKRY-FDGNSTGNDENRRPIGQIMREFMYLAG  231

Query  998   EFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV---DARRKERRSNEDQKFI  828
              FV+ D I    F  W ++ G VK+MK+  K+ D I+++W+   +++R    SN  Q FI
Sbjct  232   VFVASDLI---PFLGWSEFLGPVKTMKKVMKEFDNIIENWIHEHESKRVNGESNVHQDFI  288

Query  827   DVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQ  648
             DV+LS I D  T  +  SR TVIKA +L+++   ++T +  +TWILA LL + ++L+  Q
Sbjct  289   DVLLSEIKDDST--FGNSRKTVIKATILTVIVGGADTTSITMTWILANLLNNKKALELAQ  346

Query  647   DEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKG  468
             +EID  +G++R  E+SD +NL YL+ ++KETLR+YP GP   P E++ DC   GYHIP+G
Sbjct  347   EEIDQKVGRDRILEESDCENLVYLKAIIKETLRLYPAGPLAVPRESMVDCNFYGYHIPRG  406

Query  467   TQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYA  288
             T+   N+W+LHRDPK+W +P++F PERF+T+        + ++ +PFG GRRSCPG  +A
Sbjct  407   TRFLTNLWKLHRDPKVWANPDEFKPERFLTSHADVDVVGQNFELLPFGSGRRSCPGLNFA  466

Query  287   TQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
              Q+ Q+ + RL QGFN  T  NE +DM E + I L K TPLE+++TPRL+P L++
Sbjct  467   MQVVQLGIGRLLQGFNLRTPSNELVDMTESLNISLSKETPLEIVLTPRLAPQLYQ  521



>ref|XP_010647827.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=516

 Score =   438 bits (1126),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 225/522 (43%), Positives = 317/522 (61%), Gaps = 26/522 (5%)
 Frame = -1

Query  1664  SILGIA-ALVLLWFSWRKQSK---RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1497
             ++ GI  A++ LW    K +K   R PPE  GAWP++GHLH      PL +T    AD+Y
Sbjct  11    TVFGILFAIICLWLVNAKGNKNKGRSPPEPSGAWPVMGHLHLLGADKPLHRTFGAMADEY  70

Query  1496  GPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSY  1317
             GP+F+IR+G+   LVVS+ E  ++C+TT DK +A RP + A K +GYD+A+F F  +  Y
Sbjct  71    GPIFSIRVGLRTALVVSSSEVAKECYTTKDKALATRPRSLAVKLMGYDHAMFAFERHGPY  130

Query  1316  WRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSR  1137
             WR+VR+L +V LLS+R+ E LKHV  SE++  I E Y           N  S   V+M +
Sbjct  131   WRDVRRLAMVNLLSNRQHEMLKHVRDSEVKFFIQELYGQWV------ENGGSPVLVDMKK  184

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
              F HL  NL M+ VAG+R E            R  +     M L G+F+  DA   L F 
Sbjct  185   KFEHLVANLTMRTVAGKRCE--------NGESRWCQSLGDFMNLMGQFMVSDA---LPFL  233

Query  956   RWLD-YEGHVKSMKRAAKDVDAILQDWVDARRKERRS----NEDQKFIDVMLSMIDDQFT  792
              WLD   G+   MK  A+ +D ++  WV+  R++R S    + +Q FI  MLS+IDD   
Sbjct  234   GWLDTVRGYTAKMKGTARQLDRVIGRWVEEHRQKRLSGSINDAEQDFIHAMLSVIDDAQL  293

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
              G+ +  DTVIKA  L+++   ++T A  LTW L++L+ +P +LK+ Q+E+D ++G+ + 
Sbjct  294   SGHDHDHDTVIKATCLTVMLAGNDTIAVTLTWALSLLMNNPRALKKAQEELDFHVGRNQQ  353

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
               +SD+K L YLQ ++KETLR+YP GP   PHEA+EDC + G+HI  GT+L VN+W+LHR
Sbjct  354   VYESDIKKLVYLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQAGTRLLVNLWKLHR  413

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP IW DP +F PERF+T   G     + ++ +PFG GRR CPG   A +I Q+ +ARL 
Sbjct  414   DPTIWSDPLEFQPERFLTKHVGLDVGGQHFELLPFGSGRRMCPGISLALEILQLTLARLL  473

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              GF    V + PLDM E VG+ +PK TPLEV + PRL   L+
Sbjct  474   HGFELGVVSDSPLDMTEGVGLAMPKATPLEVTLVPRLPSELY  515



>ref|XP_007049686.1| Cytochrome P450, family 82, subfamily C, polypeptide 2, putative 
[Theobroma cacao]
 gb|EOX93843.1| Cytochrome P450, family 82, subfamily C, polypeptide 2, putative 
[Theobroma cacao]
Length=590

 Score =   440 bits (1132),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 221/501 (44%), Positives = 329/501 (66%), Gaps = 17/501 (3%)
 Frame = -1

Query  1610  SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGV  1431
             S  LP    G    +G L  +  +V L +TL+  ADKYGPVFTIR+GI R L+VSN E V
Sbjct  103   SSYLPAVVAG---FLGLLILYNLTVTLARTLAAMADKYGPVFTIRIGIYRTLIVSNHEAV  159

Query  1430  RDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLK  1251
             ++CFTTNDK +A RP + AG YL YD+A F F+   +YWR +RKL V+ELLS  R+  L 
Sbjct  160   KECFTTNDKILANRPRSNAGTYLAYDHAGFGFAPYGTYWRQMRKLAVLELLSVHRLATLT  219

Query  1250  HVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR  1071
             HV VSE+ A    F   +     K+  +P+  K+++S+    L LN++++ +AG RY   
Sbjct  220   HVRVSEVDA----FIKNLCFFCKKSEQSPNQ-KISISQRLEVLNLNMMLRTIAGTRYFSD  274

Query  1070  SDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGH-VKSMKRAAKDVDA  894
             +DG   +EAQR  K+  +  YL G   +   + P  F +W+D+ GH VKSMKR +K++D+
Sbjct  275   ADGENDKEAQRAMKLIKEFSYLLG-VTALSEVVP--FLKWIDFWGHQVKSMKRISKEMDS  331

Query  893   ILQDWVDA---RRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
             +++ WVD    RR +  +  +Q FIDV+LS I+D     + ++R+T+IKA V  ++   S
Sbjct  332   LIESWVDEHKLRRFKIGAKNNQDFIDVLLSAIEDD--SMFGHTRETIIKATVTVLISAGS  389

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             ++ +  LTWIL+ L+ +  ++KR Q+E+D  IG++RW ED D++ L YLQ ++KET R+Y
Sbjct  390   DSTSRTLTWILSNLMNNRNAMKRAQEELDLKIGRDRWVEDCDIEKLVYLQAIIKETFRLY  449

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P  P   PH+A+E C + GYHIPKGT+L+VNVW+L RDP+IW +PE+F PERF+T+ +  
Sbjct  450   PAAPLSVPHQAMEYCRISGYHIPKGTRLFVNVWKLQRDPRIWSNPEEFEPERFLTSYQNV  509

Query  362   AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
                 + ++ +PFG GRRSCPG  +A Q+ ++ +ARL QGF+ +T  N P+DM E+ G  +
Sbjct  510   DILGQHFELIPFGSGRRSCPGMSWALQVIRLTIARLLQGFDLATPLNAPVDMTEEPGGTM  569

Query  182   PKLTPLEVLVTPRLSPTLFRL  120
              K TPL++++TPRL   L++L
Sbjct  570   SKATPLQLVLTPRLPDHLYQL  590



>ref|XP_007047111.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91268.1| Cytochrome P450 [Theobroma cacao]
Length=529

 Score =   438 bits (1126),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 223/521 (43%), Positives = 329/521 (63%), Gaps = 21/521 (4%)
 Frame = -1

Query  1652  IAALVLLWFSWRKQS----KRL--PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGP  1491
             +A L  ++F   K++    KR   PP+AGGA P+IGH+H         KTL   ADKYGP
Sbjct  16    VALLSCIYFYQSKKASTHGKRCCTPPQAGGALPVIGHMHLLGGQQLTHKTLGAMADKYGP  75

Query  1490  VFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWR  1311
             VF+IRLG  R+LV+++WE  ++CFT +DK  + RP+  A K+LGYD+A+F F+   SYWR
Sbjct  76    VFSIRLGSHRVLVLNSWEMAKECFTVHDKVFSTRPSIAASKHLGYDFAMFGFAPYGSYWR  135

Query  1310  NVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWF  1131
              +RK+  +ELLSS R++ LKH+  SE++  I E Y +         +  +   V+M +WF
Sbjct  136   EMRKIATIELLSSHRIDMLKHIRASEVKTAIRELYKSWL----SKGSAETEVFVDMKQWF  191

Query  1130  GHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRW  951
             G LT N+ +++V GRRY   +      +A+R +KV    +YL+G FV  DAI P  F  W
Sbjct  192   GDLTHNIALRMVGGRRYFGPNADCEEADARRCQKVMRDFVYLFGVFVLSDAI-P--FLGW  248

Query  950   LDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSN----EDQKFIDVMLSMIDDQFTQGY  783
             LD++G+ KSMKR AK +D++++ W++  +++R S     E+Q F+DVML++++D    G 
Sbjct  249   LDFQGYEKSMKRTAKQLDSLVERWLEEHKQKRLSGGGVIEEQDFMDVMLNILEDGKITG-  307

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
              +  DT+ KA  L+++   S+T    LTW L++LL +P  LKR QDE+D ++GK+R  E+
Sbjct  308   -FDADTINKATCLNLILAGSDTTMVTLTWALSLLLNNPRVLKRAQDELDMHVGKDRPLEE  366

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVD-GYHIPKGTQLYVNVWRLHRDP  426
             SD+ NL YLQ +VKETLR+YP  P +    A+EDC +  GYHIP GT+L VN W++ RD 
Sbjct  367   SDISNLVYLQSIVKETLRLYPPSPIIGLRAALEDCTLSTGYHIPSGTRLMVNAWKIQRDE  426

Query  425   KIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQG  246
             ++WPDP  F PERF+T+ +    + + ++ +PFG GRRSCPG   A ++    + R    
Sbjct  427   RVWPDPHDFQPERFLTSHKDMDFRGQTFELIPFGSGRRSCPGTSLALKMVHFILGRFLHS  486

Query  245   FNFSTVPN-EPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             F+ +     E +DM E  G+   K TPLEVLVTPRL+  L+
Sbjct  487   FDVAKPSKLEDVDMTESAGLTNLKATPLEVLVTPRLNSQLY  527



>ref|XP_009364189.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   437 bits (1125),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 217/533 (41%), Positives = 326/533 (61%), Gaps = 17/533 (3%)
 Frame = -1

Query  1691  MDAVPCCLSSILGIAALVLL-------WFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVP  1533
             MD++P   S   G+  ++++       W +   + K  PPEA GAWPI+GHL     S P
Sbjct  1     MDSLPYANSITAGLFTIIIVSYYLSRRWRAANHKGKLSPPEAKGAWPILGHLPLLGGSTP  60

Query  1532  LVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYD  1353
                TL   ADKYGP++TIRLG+   LV+S+ E  ++CFTTND  + +RP      ++GY+
Sbjct  61    PHITLGAMADKYGPLYTIRLGVYPSLVISSSEIAKECFTTNDLSVNSRPKMAVVDHIGYN  120

Query  1352  YAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNN  1173
             YA+F F+ +  YWR +RK+  +ELLS+RR+E LKH+ VSE+   + E + T +    + +
Sbjct  121   YAMFGFAPSGPYWREIRKITTLELLSNRRVELLKHIRVSEVTTFLKELHKTWSTRQKEGS  180

Query  1172  NNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEF  993
             N+     V + +WFG +TLN+I+++VAG+RY   +D    +EA R++    +     G F
Sbjct  181   NDGVV--VELKQWFGDMTLNVIVRMVAGKRYSVAADEDEKKEALRVQNALREFFNFVGMF  238

Query  992   VSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDA---RRKERRSNEDQKFIDV  822
             + GDA+    + RWLD  GH K+MK+ AKD+DA++ +WV+    RR +  +  +Q FID 
Sbjct  239   LVGDAV---PYLRWLDLGGHEKAMKKTAKDLDAMVGEWVEEHKQRRAKGGAKGEQDFIDA  295

Query  821   MLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDE  642
             MLS++D     G+    DT+ KA  L+M+   S+T    LTW +++L+ +P  LKR  +E
Sbjct  296   MLSVLDGADLGGFD--ADTINKATSLNMIAGGSDTTMVTLTWAISLLVNNPHVLKRALNE  353

Query  641   IDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQ  462
             +DT IG++R   + D+ NL Y+Q +VKETLR+YP  P   P E  EDC + G HI KGT+
Sbjct  354   LDTKIGRQRVVSEEDISNLVYIQAIVKETLRLYPAAPLSGPREFTEDCTIAGCHIRKGTR  413

Query  461   LYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQ  282
             L +N+W+L  DPKIWPDP +F PERF+T  +    +   ++ +PFG GRR+CPG  +A Q
Sbjct  414   LIMNLWKLQTDPKIWPDPLEFKPERFLTTHKDVDVKGHHFELIPFGSGRRACPGLAFALQ  473

Query  281   ITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             + Q  +A     F  S   + P+DM E  G+   K+TPL+VL+ PRLS   ++
Sbjct  474   MVQFTLASFLHAFEISNPSSAPIDMTESFGLTNMKVTPLKVLIKPRLSFEFYK  526



>ref|XP_010091295.1| Cytochrome P450 82G1 [Morus notabilis]
 gb|EXC36851.1| Cytochrome P450 82G1 [Morus notabilis]
Length=546

 Score =   438 bits (1127),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 215/504 (43%), Positives = 309/504 (61%), Gaps = 26/504 (5%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             PE  GA PIIGHLH     VP+   L   ADKYGP++++RLG  R LV+S+WE V++CFT
Sbjct  52    PEPSGALPIIGHLHLLGGQVPVALILGAMADKYGPIYSLRLGQHRALVLSSWELVKECFT  111

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
             TND+  A RP+   GKY+ YD A F  S+  +YWR+VRK+V + LLSS R+E L+H+  S
Sbjct  112   TNDRLFANRPSIAVGKYILYDSAAFAISSYGNYWRDVRKMVTLRLLSSHRLESLQHIRTS  171

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E  + I   Y       +     P AP   +S     LT NL  +++ G+R+   + G  
Sbjct  172   EFGSFIKGLYF------EYTKLGPLAP---LSELLEQLTFNLNARLIVGKRFIKSAVGDA  222

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV  876
               +A+R KK   + +YL G FV  DAI    +   LD  GHV SMKR  K++D +L  W+
Sbjct  223   DTDARRFKKAIKEALYLSGVFVWSDAI---PWVECLDIHGHVSSMKRVFKEIDLVLGKWL  279

Query  875   DARRKERRSNEDQK--------------FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSM  738
             +  R+ R   +DQ+               +DVMLS I++       YSRDT+IKA  L +
Sbjct  280   EEHRQAREVLDDQRSNDKSSSNGDVERDLMDVMLSSIEEDDAMLSCYSRDTIIKATALIL  339

Query  737   LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE  558
             +   +E+ A  L W +++LL +P  +K  Q E+DT++G++RW ++SD+ NL +L+ +VKE
Sbjct  340   ILTGTESTAVTLIWAISLLLNNPSVMKAAQRELDTHVGRDRWVQESDLSNLKFLEAIVKE  399

Query  557   TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT  378
             T+R+YP GP   P EA E+C V G+H+PKGT+L VN+W+LHRDP++W DP +F PERFMT
Sbjct  400   TIRLYPPGPITGPREATEECFVGGHHVPKGTRLIVNIWKLHRDPRMWADPCEFRPERFMT  459

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
               E    + + +Q++PF  GRRSCPG  +   + ++ +A L QGF F T  ++P+DM E 
Sbjct  460   THEDLNFRGQNFQYIPFSSGRRSCPGMTFGLLVVELMLASLVQGFEFKTKDDKPVDMREG  519

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
             +GI LPKL  L+V + PRL   L+
Sbjct  520   LGIALPKLNSLDVFLYPRLPTKLY  543



>ref|XP_006340061.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=511

 Score =   437 bits (1123),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 216/494 (44%), Positives = 310/494 (63%), Gaps = 24/494 (5%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             P+A GAWP IGHLH     +P+ +TL   ADKYGP+F ++LG    +VVSNWE V+DCFT
Sbjct  37    PKAPGAWPFIGHLHLLNGHLPVCRTLGLMADKYGPIFQLQLGDHPAIVVSNWEIVKDCFT  96

Query  1415  TN-DKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWV  1239
              N DK  ++RP     KYLGY+ AVF  +    YWR++RK+V VELL+  R+EKLKHV  
Sbjct  97    ANNDKIFSSRPNMAVSKYLGYNGAVFAMAPYGPYWRDIRKMVTVELLTHSRLEKLKHVRT  156

Query  1238  SELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGV  1059
             SE+   I E Y+          N PS  +VN+S WF ++T N+I++++AG+R+       
Sbjct  157   SEVNCCIKELYS----------NCPS--QVNLSSWFENITCNIIVRMLAGKRF------T  198

Query  1058  VSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDW  879
                E    K+   + +YL G FV  DAI P  +  W+D  GH+K+MK   K+VD++   W
Sbjct  199   GCAEEMNFKESIKKALYLGGAFVFSDAI-P--WLEWMDIGGHIKAMKETYKEVDSVFDSW  255

Query  878   VDARRKERRSNEDQKFIDVMLSMIDDQFT-QGYSYSRDTVIKAIVLSMLQDASETFATHL  702
             +          E   FID+MLS + ++   +  +Y+R  +IKA  L ++  ASE+ A  L
Sbjct  256   LKQHINSIGDGEQSDFIDIMLSTLPEETNMESAAYNRHAIIKATTLILIMTASESTAETL  315

Query  701   TWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLA  522
              W L++L+ +  SLK  Q+E+D  IG+ +W E+SD+KNLPYLQ +VKETLR+YP GP   
Sbjct  316   IWALSLLMNNTHSLKLAQNELDEQIGRNKWVEESDIKNLPYLQAIVKETLRLYPPGPLAG  375

Query  521   PHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPER-FMTNLEGEAAQNRQ  345
             P EA+EDC +  YHI KGT+L VN+W+L RD +IW DP +F PER F+        + + 
Sbjct  376   PREAIEDCYIGKYHIKKGTRLIVNLWKLQRDSRIWEDPNEFKPERWFLNEHTNINFRGQH  435

Query  344   YQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPL  165
             ++++PF  GRR CPG  +ATQ+  + +A+L  GFN S    EP+D+ E +GI LPK+ PL
Sbjct  436   FEYIPFSSGRRMCPGLTFATQVVHLTLAKLLHGFNISMPKEEPVDVSEGLGIALPKVKPL  495

Query  164   EVLVTPRLSPTLFR  123
             + L++PRL+  L++
Sbjct  496   QPLLSPRLAVELYQ  509



>ref|XP_011030916.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   437 bits (1125),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 217/502 (43%), Positives = 314/502 (63%), Gaps = 15/502 (3%)
 Frame = -1

Query  1607  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             K+  P+AGGAWP+IGHLH    + P  K L   A+KYGP+FTI++G+ R LVVS WE  +
Sbjct  42    KKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSRWETAK  101

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +CFTT+DK  + RP T A + L YD A+  FS    YWR VRK+  VELLS+ R+EKLK 
Sbjct  102   ECFTTHDKAFSGRPKTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLKD  161

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNM-----SRWFGHLTLNLIMQIVAGRR  1083
             +  SE++  + E Y       DKN    S  K NM      RWFG LTLN++++ + G+ 
Sbjct  162   IRESEVRTFLKELYKLW----DKNRGGASKSKSNMVLVEMKRWFGDLTLNIVLRTIVGKT  217

Query  1082  YEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKD  903
               Y ++    E A+  KK      +    F   DA   L F R LD  GHV++MK+ AK+
Sbjct  218   VGYITNVEDEESAKGWKKGLKDFFHWTAVFSVSDA---LPFLRLLDLGGHVEAMKKTAKE  274

Query  902   VDAILQDWVDARRKERRSN---EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQ  732
             +D +++DW++  +++R +      + F+D+ML + D+          DT+ KA  L+++ 
Sbjct  275   LDLVVEDWLEEHKRKRAAGIVKGKEDFMDLMLDVFDNDAEAVQGGDSDTINKATSLALIL  334

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
              AS+T A  L W L++L+ +P  LK+ Q E+DT++GKER  E+SDV+NL +L+ V++ETL
Sbjct  335   AASDTTAVTLIWALSLLVNNPNVLKKAQLELDTHVGKERQVEESDVQNLVFLKAVIRETL  394

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R+YP  P L PHEA EDC +DGYH+P+GT+L V+V ++HRD ++W +P +F PERF+T  
Sbjct  395   RLYPAAPLLLPHEATEDCTIDGYHVPRGTRLLVDVSKIHRDERVWSNPNEFDPERFLTTH  454

Query  371   EGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVG  192
              G  A+ + ++F PFG GRR CPG  +A     +A+A L  GF+F+T   EP+DM E  G
Sbjct  455   RGFDARGKNFEFFPFGSGRRMCPGVSFALHAMDLALATLLHGFDFATPSGEPVDMHESSG  514

Query  191   IILPKLTPLEVLVTPRLSPTLF  126
             +   + TPLEVL+ PRL   L+
Sbjct  515   LTNLRATPLEVLLCPRLPSGLY  536



>gb|AGO03797.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=518

 Score =   437 bits (1123),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 218/514 (42%), Positives = 322/514 (63%), Gaps = 15/514 (3%)
 Frame = -1

Query  1661  ILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFT  1482
             +L IA ++L      +     PP A GAWPIIGHLH    S P    L +WADKYGP+FT
Sbjct  12    VLVIAFMILNKMRVNRSKHNAPPRAKGAWPIIGHLHLVAGSRPRQHVLGDWADKYGPIFT  71

Query  1481  IRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVR  1302
             I+LG  + LVVS+ E  ++CFTTNDK  A+RP   A + +GY+YA+F  +    YWR  R
Sbjct  72    IKLGFHQALVVSSTEIAKECFTTNDKVFASRPKAKAVEIMGYNYAMFGLAPYGDYWRQER  131

Query  1301  KLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHL  1122
             K++ +E+LS RR+E L HV  SE++A++ + +  +A +N+K N   +  KV+M +WFG L
Sbjct  132   KIITLEVLSPRRVEMLGHVRESEIRASLKDIH--VAWENNKENEGSNMVKVDMKQWFGTL  189

Query  1121  TLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY  942
              LN+++++++G+R+         EE    + V  + + L G FV+ D I P  +    D 
Sbjct  190   VLNIVVRVISGKRFPAND-----EEGVHFQNVLRKNVVLMGAFVASDYI-P--YIDRFDL  241

Query  941   EGHVKSMKRAAKDVDAILQDWVDARRKERRSNE----DQKFIDVMLSMIDDQFTQGYS-Y  777
              G+ K MK   K++D I++ W+  RR+E  S +    +Q F+DV++S +     + +S +
Sbjct  242   GGYQKEMKLVWKELDDIMEGWLQERRREMESGQQLERNQAFMDVLISSLQGAPKEDFSDF  301

Query  776   SRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSD  597
               DTVIKA  L ++    +T +  LTW+L +LL +P++L+ VQ+EID ++G++R  E+SD
Sbjct  302   DHDTVIKASCLELITAGLDTTSVTLTWVLCLLLNNPKALRTVQEEIDEHVGRDRPVEESD  361

Query  596   VKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIW  417
             +KNL YL  V+KET+R+YP  P   PHE+ EDC+V GY++PKGT+L +N+W+LHRDP IW
Sbjct  362   MKNLLYLGAVIKETMRLYPAAPLAVPHESTEDCVVSGYNVPKGTRLLINLWKLHRDPNIW  421

Query  416   PDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNF  237
              DPE+F PERFMT  +    + R Y  +PFG GRR CPG  +A Q   + +A L Q F  
Sbjct  422   SDPEEFKPERFMTTNKDIDVKGRHYDLLPFGSGRRMCPGIYFALQAMHLTLATLIQQFEL  481

Query  236   STVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSP  135
                 +E +DM E  G+   K TPLEVL++PR  P
Sbjct  482   VKPTDEQIDMSERSGLTTSKATPLEVLLSPRSVP  515



>emb|CAN64371.1| hypothetical protein VITISV_016844 [Vitis vinifera]
Length=527

 Score =   436 bits (1122),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 226/504 (45%), Positives = 313/504 (62%), Gaps = 21/504 (4%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNW  1440
             +K  KR PPE  G WP+IGHLH       L +TL + ADKYGP+F +RLG+ + LVVS+W
Sbjct  34    KKXGKR-PPEPSGRWPLIGHLHLLGADKLLHRTLGDMADKYGPIFCVRLGLKKTLVVSSW  92

Query  1439  EGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRME  1260
             E  ++C+TT+DK  A RP + A K +GYD+  F F+    YWR+VRKL +VELLS+R++E
Sbjct  93    EVAKECYTTSDKVFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELLSNRQLE  152

Query  1259  KLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY  1080
               KHV  SE++  I E Y   A     N + P+   V M   FG+L LN++++ +AG+RY
Sbjct  153   MHKHVQDSEVKILIKELYGQWA----SNKDGPAL--VEMKERFGNLALNVVVRAIAGKRY  206

Query  1079  EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGHVKSMKRAAKD  903
                      +E +R KK F   + L G F+  D I    F  WLD  +G    MKR AK+
Sbjct  207   --FGTHACGDEPKRXKKAFEDFIILLGLFMVSDVI---PFLGWLDTMKGFTAEMKRVAKE  261

Query  902   VDAILQDWVDARRKERRSNED----QKFIDVMLSMIDD-QFTQGYSYSRDTVIKAIVLSM  738
             VD +L  WV+  R+ R S  D    Q FI  MLS+IDD QF+       DT+IK    ++
Sbjct  262   VDYVLGSWVEEHRQNRLSANDNGAEQDFIHAMLSVIDDGQFS---GRDPDTIIKGTCSNL  318

Query  737   LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE  558
             +   ++T +  LTW L++LL +  +LK+ Q E++ ++GK R  + SD+KNL YLQ +VKE
Sbjct  319   ILAGNDTTSITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKE  378

Query  557   TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT  378
             TLR+YP GP   PHEA+EDC V G+HI  GT+L VN+W+LHRDP++W DP +F PERF+T
Sbjct  379   TLRLYPPGPLSLPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLT  438

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
                G   + + Y+ +PFG GRR CPG  +A ++T + +ARL  GF    V + P+DM E 
Sbjct  439   KHAGLDVRGKNYELLPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTES  498

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              G+  PK TPLEV + PRL   L+
Sbjct  499   PGLTAPKATPLEVTIVPRLPFELY  522



>ref|XP_003547786.2| PREDICTED: cytochrome P450 82C2-like [Glycine max]
Length=541

 Score =   437 bits (1123),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 218/528 (41%), Positives = 325/528 (62%), Gaps = 20/528 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFSWR--------KQSK-RLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1518
             + +I GI AL++ +  +R        KQ K    PE  GA P IGHLH      P  +T 
Sbjct  18    VQTIAGILALLIAYILFRSVKSPNGSKQRKGNQVPEPRGALPFIGHLHLLNARKPYFRTF  77

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
             S  A+KYGP+F ++LG    LVV++ E  ++C TTNDK  A+RP T AGK LGY+ AVF 
Sbjct  78    SAIAEKYGPIFILKLGCHPTLVVNSREIAKECLTTNDKVFASRPITSAGKILGYNNAVFG  137

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
             FS    YWR +RK+ ++E+LSS ++EKLKHV  +E  + + + Y++I+   + N +    
Sbjct  138   FSPYGKYWREIRKMAILEILSSYKLEKLKHVRDTETLSLVKDLYSSISCPKNVNGSTTHV  197

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
             P   +S    H++ N+I++++AG+R+   +      EA RL+       YL G FV+ DA
Sbjct  198   P---ISNLLEHMSFNIIVRMIAGKRFGGDTVNQEDNEAWRLRNAIKDATYLCGVFVAADA  254

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNEDQK----FIDVMLSM  810
             I  L    W+D++G+V  MKR  K++D IL+ W++   ++R   +D K    F+DVM+S 
Sbjct  255   IPSL---SWIDFQGYVSFMKRTNKEIDLILEKWLEEHLRKRGEEKDGKCESDFMDVMISA  311

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
               ++  +   Y R+ VIKA  + ++  AS + A  LTW L++LL HP+ LK  Q E+DT+
Sbjct  312   FQEE-EEICGYKREMVIKATSVLLILTASGSTAITLTWALSLLLNHPKVLKAAQKELDTH  370

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +GKERW ++SD++NL YLQ ++KETLR+YP  P     E +EDC V GYH+PKGT+L +N
Sbjct  371   LGKERWVQESDIENLTYLQAIIKETLRLYPPAPLTGIREVMEDCCVAGYHVPKGTRLLIN  430

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             +W L RDPK+WP+P KF PERF+T        ++ ++ +PF +GRRSCPG  +  Q+  +
Sbjct  431   LWNLQRDPKVWPNPNKFEPERFLTTHHDINFMSQNFELIPFSIGRRSCPGMTFGLQVLHL  490

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +ARL QGF+  T     +DM E +G+ LPK   L+V++ PRL   L+
Sbjct  491   TLARLLQGFDICTKDGAEVDMTEGLGVALPKEHGLQVMLQPRLPLGLY  538



>gb|KHG26594.1| Cytochrome P450 [Gossypium arboreum]
Length=526

 Score =   436 bits (1122),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 227/528 (43%), Positives = 327/528 (62%), Gaps = 27/528 (5%)
 Frame = -1

Query  1661  ILGIAAL-VLLWFSW----------RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLS  1515
             ++G+A +  LL FS+              K+ PPE GGA P +GHLH      P   T+ 
Sbjct  9     VIGVAGIFALLLFSYLLFTTVITRKSSSKKKKPPEIGGARPFLGHLHLLGGPKPAHITMG  68

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
              +AD YGP+FT RLG+   LVVSNWE  ++CFTTNDK  A+RP T A + LGY++A+F F
Sbjct  69    NFADAYGPIFTFRLGMHPTLVVSNWEMAKECFTTNDKAFASRPRTLAAELLGYNFAMFGF  128

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             S+   YWR+VRK+  +E+LS+ R+EKL+HV  SE++A+I   Y  +        NN S P
Sbjct  129   SSYGPYWRHVRKIATLEVLSNYRLEKLRHVRESEIRASIKRLYELVT-------NNCSEP  181

Query  1154  KV-NMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
              V  M RWF  L +N + +IV G+RY         EE ++ +K      +L G F   D+
Sbjct  182   VVVEMKRWFWTLNINTVFKIVIGKRYSEIETSHEEEENEQRRKALRDFFHLTGTFTVADS  241

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRS----NEDQKFIDVMLSM  810
                L F RWLD  GH K+MK+ AK +D IL++ +D  +++R S    +E   F+ +MLS+
Sbjct  242   ---LPFLRWLDLGGHEKAMKKTAKKLDQILKECLDEHKRKRNSGKSYDELDNFMYMMLSL  298

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
             ++D      SY  DT+ KA  L+++   ++T    ++W L++LL H + LK+ Q+E+DT 
Sbjct  299   LEDAGDHP-SYDADTINKATCLAIIVGGTDTTTVTISWALSLLLNHRDVLKKAQNELDTF  357

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +GK+R  E+SD+KNL YLQ ++ ET R+YP  P   PHE+VEDCI  GY IP GT+L VN
Sbjct  358   VGKDRLVEESDIKNLVYLQAIINETTRLYPAAPLSVPHESVEDCITGGYFIPAGTRLLVN  417

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             + +L RDPK+W DP++F PERF+T  +    + + ++F+PFG GRR CPG  +A Q+ Q+
Sbjct  418   ISKLQRDPKVWSDPDEFRPERFLTTQKHMDVRGQNFEFIPFGSGRRVCPGISFALQVLQL  477

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +A L Q F  +T+ +EP+DM E  G+   K TPL V+ TPRL P L+
Sbjct  478   NLATLLQSFEITTLFDEPVDMREGAGLTNLKATPLNVVFTPRLPPHLY  525



>gb|KDO42182.1| hypothetical protein CISIN_1g046041mg [Citrus sinensis]
Length=531

 Score =   436 bits (1120),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 217/504 (43%), Positives = 319/504 (63%), Gaps = 22/504 (4%)
 Frame = -1

Query  1622  WRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSN  1443
             +  + KR  PEAGGAWP+IGHLH      PL + L   ADKYGP+FTI++GI+R LVVS+
Sbjct  44    YTSKKKRGAPEAGGAWPVIGHLHILGGPEPLHRVLGSMADKYGPIFTIKIGINRALVVSS  103

Query  1442  WEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRM  1263
             WE  ++C TTNDK  A+RP T A + LGY++++F FS   SYW   RK+  +ELLS+ R+
Sbjct  104   WEMAKECLTTNDKIFASRPKTLAMEILGYNFSMFGFSPYGSYWCETRKIATLELLSNHRL  163

Query  1262  EKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRR  1083
             EKL+HV   E++  + E Y     D  K+ N      V M RWF     N+I++++ G+ 
Sbjct  164   EKLRHVRDYEVKTCLKELYEL--WDKSKSTNKML---VEMKRWFADTIRNVILRMIVGK-  217

Query  1082  YEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKD  903
                   G  S +++   ++ ++ + + G+FV  DA   L F RWLD  G  +SMK+ AK+
Sbjct  218   ------GCNSVDSEEWMELLTRFLEMSGKFVVSDA---LPFLRWLDIGGDERSMKKTAKE  268

Query  902   VDAILQDWVDARRKERRS----NEDQKFIDVMLSMIDDQFTQGYS-YSRDTVIKAIVLSM  738
             +D ++Q W +  +++R S     E+  F+ VM S++ D  T+ YS    DT+ KA+ L +
Sbjct  269   LDIVVQGWFEEHKRKRDSREVKGEELDFMSVMPSILGD--TEQYSGRDVDTINKAVCLGL  326

Query  737   LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE  558
             +    +T    LTW++++LL H + L +VQ+E+D  +G +R   +SD+KNL YLQ  +KE
Sbjct  327   IIAGLDTTTVTLTWVISLLLNHRDILDKVQNELDIQVGTKRQVNESDLKNLVYLQATLKE  386

Query  557   TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT  378
              +R+YP  P L PHEA+E+C V+GYH+P  TQL +NVW+L RDP++W +P KF PERF+T
Sbjct  387   AMRLYPAVPLLIPHEAIEECTVNGYHVPARTQLLINVWKLQRDPRVWEEPCKFQPERFLT  446

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
               +    + +  + +PFG GRR CPG  +A Q+ Q  +A L QGF+F+T  NEPLDM E 
Sbjct  447   KHKDIDVRGQHLELLPFGSGRRMCPGVSFALQVMQFTIASLLQGFDFATPSNEPLDMGEG  506

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              G+ + K  PLEVL+ PRLS +L+
Sbjct  507   FGLTMEKSRPLEVLIAPRLSASLY  530



>ref|XP_006464299.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=522

 Score =   435 bits (1119),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 218/504 (43%), Positives = 319/504 (63%), Gaps = 24/504 (5%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNW  1440
             + Q+    P AGGAWP+IGHLH      P  + L + ADKYGP+FT+++G++R LVVSNW
Sbjct  36    KTQAPHQAPVAGGAWPVIGHLHLLGGQEPTHRLLGDMADKYGPIFTMKMGLNRALVVSNW  95

Query  1439  EGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRME  1260
             E  ++CFT NDK  A RP + A   LGY++     S   +YWR  RK+  +ELLS+ +++
Sbjct  96    EIAKECFTINDKPFANRPRSMAMDLLGYNFLAIAASPYGNYWRESRKMATIELLSNNQLQ  155

Query  1259  KLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVN--MSRWFGHLTLNLIMQIVAGR  1086
             KLKHV  SE++A+I   +        +N    S+ KV+  M  W   + L++IM+I+AG+
Sbjct  156   KLKHVRESEVKASIKGLF--------ENCKRSSSHKVSVEMKHWIEGIVLDIIMRIIAGK  207

Query  1085  RYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAK  906
             RY        S+++   ++  +    L+G+FV  DA   L F RWLD  G+ K MK+ AK
Sbjct  208   RY-------TSQDSSDFQEHATDFFDLFGKFVVSDA---LPFLRWLDIGGYEKLMKKTAK  257

Query  905   DVDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQ-GYSYSRDTVIKAIVLSM  738
             + D + Q W+D  + +R S+E   D+ F+ VMLS+ DD+  Q       DTVIKAI LS+
Sbjct  258   EFDLVFQGWLDEHKSKRGSSEVKGDEDFMYVMLSLFDDKTKQLPGGDDTDTVIKAICLSL  317

Query  737   LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE  558
             +  AS+T A  LTW +A+LL + + L++ Q+E+D ++G  R   +SD+ NL +LQ V+KE
Sbjct  318   ILAASDTTAVTLTWAIALLLNNRDVLEKAQNELDVHVGTNRQVNESDMINLAHLQVVLKE  377

Query  557   TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT  378
             TLR+YP  P L PHE++EDC + GYH+P GTQL VN W++ RDP +W +P KFLPERF+T
Sbjct  378   TLRLYPAAPLLLPHESIEDCTISGYHVPAGTQLIVNAWKIQRDPGVWEEPCKFLPERFLT  437

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
               +    + + ++F+PFG GRR CPG  +A Q+  + +A L  GF+F+T  +  +DM E 
Sbjct  438   KYKDVDLKGQNFEFIPFGSGRRMCPGISFAFQVMPLILASLLHGFDFATPSDAAVDMEEA  497

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
               +   K TPLEVL+TPRLS +L+
Sbjct  498   KSLTYAKATPLEVLLTPRLSASLY  521



>ref|XP_003548649.2| PREDICTED: cytochrome P450 82C2-like [Glycine max]
Length=541

 Score =   436 bits (1120),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 218/528 (41%), Positives = 324/528 (61%), Gaps = 20/528 (4%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFSWR--------KQSK-RLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1518
             + +I GI AL++ +  +R        KQ K    PE  GA P IGH+H      P  +T 
Sbjct  18    VQTIAGILALLIAYIVFRSIKSPNGSKQRKGNQVPEPRGALPFIGHVHLLNARKPYFRTF  77

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
             S  A+KYGP+F ++LG    LVV++ E  ++C TTNDK  A+RP T AGK LGY+ AVF 
Sbjct  78    SAIAEKYGPIFILKLGCHPTLVVNSREIAKECLTTNDKVFASRPITSAGKILGYNNAVFG  137

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
             FS    YWR +RK+  +E+LSS ++EKLKHV  +E  + + + Y++I+   + N +    
Sbjct  138   FSPYGKYWREIRKMATLEILSSYKLEKLKHVRDTETLSLVKDLYSSISYPKNVNGSTTHV  197

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
             P   +S    H++ N+I++++AG+R+   +      EA RL+       YL G FV+ DA
Sbjct  198   P---ISNLLEHMSFNIIVRMIAGKRFGGDTVNQEDNEAWRLRNAIRDATYLCGVFVAADA  254

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNEDQK----FIDVMLSM  810
             I  L    W+D++G+V  MKR  K++D IL+ W++   ++R   +D K    F+DVM+S 
Sbjct  255   IPSL---SWIDFQGYVSFMKRTNKEIDLILEKWLEEHLRKRGEEKDGKCESDFMDVMISA  311

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
               ++  +   Y R+ VIKA  + ++  AS + A  LTW L++LL HP+ LK  Q E+DT+
Sbjct  312   FQEE-EEICGYKREMVIKATSVLLILTASGSTAITLTWALSLLLNHPKVLKAAQKELDTH  370

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +GKERW ++SD+KNL YLQ ++KETLR+YP  P     E +EDC V GYH+PKGT+L +N
Sbjct  371   LGKERWVQESDIKNLTYLQAIIKETLRLYPPAPLTGIREVMEDCCVAGYHVPKGTRLLIN  430

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             +W L RDPK+WP+P KF PERF+T        ++ ++ +PF +GRRSCPG  +  Q+  +
Sbjct  431   LWNLQRDPKVWPNPNKFEPERFLTTHHDINFMSQNFELIPFSIGRRSCPGMTFGLQVLHL  490

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +ARL QGF+  T     +DM E +G+ LPK   L+V++ PRL   L+
Sbjct  491   TLARLLQGFDICTKDGAEVDMTEGLGVALPKEHGLQVMLQPRLPLGLY  538



>ref|NP_001236179.1| cytochrome P450 CYP82C1 [Glycine max]
 gb|AAB94590.1| CYP82C1p [Glycine max]
Length=532

 Score =   435 bits (1119),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 226/530 (43%), Positives = 327/530 (62%), Gaps = 28/530 (5%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFSWRKQSKR----LPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWAD  1503
             +S IL +   VL++   R  S        P+AGGAWPIIGHLH F       KTL   A+
Sbjct  14    ISIILAMLVGVLIYGLKRTHSGHGKICSAPQAGGAWPIIGHLHLFGGHQHTHKTLGIMAE  73

Query  1502  KYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNN  1323
             K+GP+FTI+LG  ++LV+S+WE  ++CFT +DK  + RP   A K +GY+YA+F F+   
Sbjct  74    KHGPIFTIKLGSYKVLVLSSWEMAKECFTVHDKAFSTRPCVAASKLMGYNYAMFGFTPYG  133

Query  1322  SYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPK---  1152
              YWR +RKL  ++LLS+ R+E LK+   SE +  I E Y        K  +    PK   
Sbjct  134   PYWREIRKLTTIQLLSNHRLELLKNTRTSESEVAIRELY--------KLWSREGCPKGGV  185

Query  1151  -VNMSRWFGHLTLNLIMQIVAGR-RYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
              V+M +WFG LT N+++++V G+  Y+  SD     EA+R KKV  + + L+G FV  DA
Sbjct  186   LVDMKQWFGDLTHNIVLRMVRGKPYYDGASDDYAEGEARRYKKVMGECVSLFGVFVLSDA  245

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNEDQK-----FIDVMLS  813
             I P  F  WLD  G+ K+MKR A ++D +++ W++  +++R  N D K     F+DVML+
Sbjct  246   I-P--FLGWLDINGYEKAMKRTASELDPLVEGWLEEHKRKRAFNMDAKEEQDNFMDVMLN  302

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
             ++ D    G  Y  DT+IKA  L+++   S+T    LTW+L++LL H   LK+VQDE+DT
Sbjct  303   VLKDAEISG--YDSDTIIKATCLNLILAGSDTTMISLTWVLSLLLNHQMELKKVQDELDT  360

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVD-GYHIPKGTQLY  456
              IGK+R  E+SD+  L YLQ +VKET+R+YP  P +    A+EDC    GYHIP GT+L 
Sbjct  361   YIGKDRKVEESDITKLVYLQAIVKETMRLYPPSPLITLRAAMEDCTFSGGYHIPAGTRLM  420

Query  455   VNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQIT  276
             VN W++HRD ++W DP  F P RF+T+ +    + + Y+ VPFG GRR+CPG   A ++ 
Sbjct  421   VNAWKIHRDGRVWSDPHDFKPGRFLTSHKDVDVKGQNYELVPFGSGRRACPGASLALRVV  480

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              + +ARL   FN ++  N+ +DM E +G+   K TPLE+L+TPRL   L+
Sbjct  481   HLTMARLLHSFNVASPSNQVVDMTESIGLTNLKATPLEILLTPRLDTKLY  530



>ref|XP_006432704.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
 ref|XP_006471494.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45944.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
Length=525

 Score =   435 bits (1118),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 221/535 (41%), Positives = 332/535 (62%), Gaps = 27/535 (5%)
 Frame = -1

Query  1694  VMDAVPCCLSSILG--IAALVLLWFS------WRKQSKRLPPEAGGAWPIIGHLHHFRTS  1539
             V+ + P   ++IL   I + +LL  S      +  + KR  PEAGGAWP+ GHLH     
Sbjct  5     VLTSQPTTAAAILTLLIFSYILLSVSRNLLTNYTIKKKRRAPEAGGAWPVTGHLHLLGGP  64

Query  1538  VPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLG  1359
              P  + L   ADK GP+FTI++GI+R LVVSNWE  ++C TT+DK  A+RP T A +  G
Sbjct  65    EPPHRVLGAMADKCGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFASRPKTLAMEIFG  124

Query  1358  YDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDK  1179
             Y++++F FS   SYWR  RK+  VELLS+ R+EKLKHV   E++  + E Y       DK
Sbjct  125   YNFSMFGFSPYGSYWRETRKIATVELLSNHRLEKLKHVRDYEVKTCLKELYELW----DK  180

Query  1178  NNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWG  999
             N +      V + RWF     N++++++ G+       G  S + +   ++ ++   + G
Sbjct  181   NKSTNEMLLVELKRWFADTIRNVVLRMIVGK-------GCNSVDGEEWMELLTRSFEMSG  233

Query  998   EFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNEDQK----F  831
             +FV  DA   L F RWLD  G  +SMK  A+++D +LQ W++  +++R S E ++    F
Sbjct  234   KFVVSDA---LPFLRWLDIGGDERSMKNIAEELDNLLQGWLEKHKRKRNSQEIKEEELDF  290

Query  830   IDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRV  651
             + VML ++ D+  Q      DTV KA  L ++  A++T A  LTW++++LL H + L + 
Sbjct  291   MSVMLLILGDK-EQYSGRDVDTVNKATCLGLILAATDTTAVTLTWVISLLLNHRDILNKA  349

Query  650   QDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPK  471
             Q+E+D  +G +R   +SD+KNL YLQ ++KET+R+YP  P L PHE++E+CIV+GYHIP 
Sbjct  350   QNELDIQVGSKRQVNESDIKNLVYLQAILKETMRLYPAVPLLVPHESMEECIVNGYHIPA  409

Query  470   GTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLY  291
             GTQL++N W+L RDP++W +P KF P+RF+T  +    + + ++ +PF  GRR CPG  +
Sbjct  410   GTQLFINAWKLQRDPRVWEEPYKFHPKRFLTRHKDIDVKGQNFELLPFSSGRRMCPGVSF  469

Query  290   ATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             A Q+ Q  +A L  GF+F+T  NEP+DM E +G+ + K TPL VLV PRLS +L+
Sbjct  470   ALQVMQFTLASLLHGFDFATPSNEPVDMGEGLGLTMEKSTPLVVLVAPRLSASLY  524



>ref|XP_007222622.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
 gb|EMJ23821.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
Length=525

 Score =   435 bits (1118),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 217/521 (42%), Positives = 319/521 (61%), Gaps = 11/521 (2%)
 Frame = -1

Query  1673  CLSSILGIAALVLLWFSWR-KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1497
              +++ L    +V  +FS R + +K +P EA GAWPI GHL     S P    L+  ADKY
Sbjct  10    SITAFLFTIIIVSYYFSRRWRPAKLVPTEAKGAWPIFGHLPLLGGSTPPHIKLAAMADKY  69

Query  1496  GPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSY  1317
             GP+FTIRLG+   LV+S+ E  ++CFTTND  + +RP      ++GY+ A+F F+ +  +
Sbjct  70    GPLFTIRLGVYPSLVISSSEIAKECFTTNDLVLNSRPKLAVVDHIGYNCAMFGFAPSGPF  129

Query  1316  WRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSR  1137
             WR +RK+  +ELLS+RR+E L+H+ VSE+   + E + T +    + +NN     V + +
Sbjct  130   WREMRKITTLELLSNRRLELLRHIRVSEVTTFLQELFKTWSTAEKRESNNSDGVLVELKQ  189

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
             WFG +TLN+I+++VAG+RY   +D     EA+R++    +  Y  G FV GDA+    + 
Sbjct  190   WFGDMTLNVILRMVAGKRYSVAADEDEKTEARRVQSALKEFFYYVGLFVVGDAV---PYL  246

Query  956   RWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNEDQK----FIDVMLSMIDDQFTQ  789
             RWLD  GH K+MKR AK++DAI+  WV+   K RR+  D K    FID MLS++D     
Sbjct  247   RWLDLGGHEKAMKRIAKELDAIVGGWVE-EHKRRRARGDAKGEPDFIDAMLSVLDGADLG  305

Query  788   GYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWA  609
             G+    DTV KA  L+M+   S+T    L W +++LL +P  LK  Q+E+DT IG++R  
Sbjct  306   GFD--ADTVNKATSLNMIAGGSDTTMVTLIWAISLLLNNPHVLKSAQNELDTEIGRQRVV  363

Query  608   EDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRD  429
              +SD+  L Y+Q +VKETLR+YP  P   P E  +DC + GYH+ KGT+L  N+W++  D
Sbjct  364   SESDISKLVYIQAIVKETLRLYPAAPLSGPREFTKDCTIGGYHVSKGTRLITNLWKIQTD  423

Query  428   PKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQ  249
             P+IWPDP +F PERF+T+      +   ++ +PFG GRR+CPG  +A Q+ Q  +A    
Sbjct  424   PRIWPDPLEFKPERFLTSHRDVDVKGLHFELIPFGSGRRACPGLAFALQMVQFTLASFVH  483

Query  248   GFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              F+ S   N P+DM E  G+   K TPL+VL+ PRL   L+
Sbjct  484   AFDISNPSNSPIDMTESFGLTNIKATPLQVLIKPRLPSQLY  524



>ref|XP_002281361.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=516

 Score =   434 bits (1117),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 224/522 (43%), Positives = 316/522 (61%), Gaps = 26/522 (5%)
 Frame = -1

Query  1664  SILGIA-ALVLLWFSWRKQSK---RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1497
             ++ GI  A++ LW    K +K   R PPE  GAWP++GHLH       + +T    AD+Y
Sbjct  11    TVFGILFAIICLWLVNAKGNKNKGRSPPEPSGAWPVMGHLHLLGADKQIHRTFGAMADEY  70

Query  1496  GPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSY  1317
             GP+F+IRLG+   LVVS+ E  ++C+TT DK +A RP + A K +GYD+A+F F  +  Y
Sbjct  71    GPIFSIRLGLRTALVVSSSEVAKECYTTKDKALATRPRSLAVKLMGYDHAMFAFERHGPY  130

Query  1316  WRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSR  1137
             WR+VR+L +V LLS+R+ E LKHV  SE++  I E Y           N  S   V+M +
Sbjct  131   WRDVRRLAMVNLLSNRQHEMLKHVRDSEVKFFIQELYGQWV------ENGGSPVLVDMKK  184

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
              F HL  NL M+ VAG+R E            R  +     M L G+F+  DA+ P  F 
Sbjct  185   KFEHLVANLTMRTVAGKRCE--------NGESRWCQALGDFMNLMGQFMVSDAV-P--FL  233

Query  956   RWLD-YEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE----DQKFIDVMLSMIDDQFT  792
              WLD   G+   MK  A+ +D +L  WV+  R++R S      +Q FI  MLS+IDD   
Sbjct  234   GWLDTVRGYTAKMKGTARQLDQVLGRWVEEHRQKRLSGSINEAEQDFIHAMLSVIDDAQL  293

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
               + +  DTVIKA  L+++   ++T A  LTW L++L+ +P +LK+ Q+E+D ++G+ + 
Sbjct  294   SAHDHDHDTVIKATCLTVMLAGNDTIAITLTWALSLLMNNPRALKKAQEELDFHVGRNQQ  353

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
               +SD+K L YLQ ++KETLR+YP GP   PHEA+EDC + G+HI  GT+L VN+W+LHR
Sbjct  354   VYESDIKKLVYLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQAGTRLLVNLWKLHR  413

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP IW DP +F PERF+T   G   + + ++ +PFG GRR CPG   A +I Q+ +ARL 
Sbjct  414   DPTIWSDPLEFQPERFLTKHVGLDVRGQHFELLPFGSGRRMCPGISLALEILQLTLARLL  473

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              GF    V + PLDM E VG+ +PK TPLEV + PRL   L+
Sbjct  474   HGFELGVVADSPLDMTEGVGLAMPKATPLEVTLVPRLPSELY  515



>ref|XP_006423130.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
 ref|XP_006479372.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Citrus sinensis]
 ref|XP_006479373.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
 ref|XP_006479374.1| PREDICTED: cytochrome P450 82C4-like isoform X3 [Citrus sinensis]
 gb|ESR36370.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
Length=524

 Score =   434 bits (1117),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 224/499 (45%), Positives = 314/499 (63%), Gaps = 20/499 (4%)
 Frame = -1

Query  1616  KQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNW  1440
             K+  R PPEA GAWP +GHLH    S  L+ +TL E ADKYG  F I LGI R LV+S+W
Sbjct  34    KKGGRKPPEAAGAWPCVGHLHLLAGSNQLIHQTLGEMADKYGKAFLIHLGIHRALVISSW  93

Query  1439  EGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRME  1260
             E  ++CFTTNDK  + RP + A K +GYD+A+  F+   SYWR VRKL  V+LLS+ R+E
Sbjct  94    EVTKECFTTNDKLFSTRPKSLAVKLMGYDHAMIGFAPYGSYWREVRKLSTVQLLSNHRLE  153

Query  1259  KLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY  1080
              LKHV  +E++  I E +   A        N     V M   F  L +N+I++++AG+RY
Sbjct  154   LLKHVRDTEVKVFIKELHEQCA-------KNGGHVAVEMKERFKDLAMNIIVRMIAGKRY  206

Query  1079  EYRSD-GVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGHVKSMKRAAK  906
              YRS+     +E++R +K     +YL G F++ D I    F  WLD  +G+   MKR AK
Sbjct  207   -YRSETNADDQESKRFQKALGDFLYLLGLFLASDNI---PFLGWLDIVKGYTGQMKRTAK  262

Query  905   DVDAILQDWVDARRKERRS---NEDQK-FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSM  738
             ++D +    V   R +R +   N+D++ FIDVMLS++DD  T       DTVIKA  LS+
Sbjct  263   ELDDVFGRLVQEHRHKRLNGSINKDEEDFIDVMLSVMDDGKTS--PEDADTVIKATCLSL  320

Query  737   LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE  558
             +   ++T  T +TW L++LL +   LK+ QDE+D ++GK R  E+SD+KNL YLQ +VKE
Sbjct  321   ISGGNDTTVTTITWALSLLLNNRHVLKKAQDELDIHVGKNRQVEESDIKNLIYLQAIVKE  380

Query  557   TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT  378
             TLR+ P  P  AP EA+EDC +DG+HIP GT+L VN+W++HRDP IW +P +F+P+RF+ 
Sbjct  381   TLRLCPPLPLSAPREAMEDCTIDGFHIPAGTRLIVNLWKMHRDPSIWANPSEFIPDRFLN  440

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
                      + ++F+PFG GRR CPG  +A Q+  + +ARL   F+  TV +  +DM   
Sbjct  441   ENAKLDVNGQDFEFLPFGSGRRKCPGISFALQVQHLTLARLLHAFSLGTVSDTLVDMSGS  500

Query  197   VGIILPKLTPLEVLVTPRL  141
              GI +PK TPLEV +TPR+
Sbjct  501   PGITVPKATPLEVTLTPRV  519



>emb|CBI32510.3| unnamed protein product [Vitis vinifera]
Length=607

 Score =   437 bits (1124),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 226/505 (45%), Positives = 315/505 (62%), Gaps = 21/505 (4%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNW  1440
             +K+ KR PPE  G WP+IGHLH       L +TL + ADKYGP+F +RLG+ + LVVS+W
Sbjct  102   KKRGKR-PPEPSGRWPLIGHLHLLGADKLLHRTLGDMADKYGPIFCVRLGLKKTLVVSSW  160

Query  1439  EGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRME  1260
             E  ++C+TT+DK  A RP + A K +GYD+  F F+    YWR+VRKL +VELLS+R++E
Sbjct  161   EVAKECYTTSDKVFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELLSNRQLE  220

Query  1259  KLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY  1080
               KHV  SE++  I E Y   A     N + P+   V M   FG+L LN++++ +AG+RY
Sbjct  221   MHKHVQDSEVKILIKELYGQWA----SNKDGPAL--VEMKERFGNLALNVVVRAIAGKRY  274

Query  1079  EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGHVKSMKRAAKD  903
                      +E +R KK F   + L G F+  D I    F  WLD  +G    MKR AK+
Sbjct  275   --FGTHACGDEPKRAKKAFEDFIILLGLFMVSDVI---PFLGWLDTMKGFTAEMKRVAKE  329

Query  902   VDAILQDWVDARRKERRSNED----QKFIDVMLSMIDD-QFTQGYSYSRDTVIKAIVLSM  738
             VD +L  WV+  R+ R S  D    Q FI  MLS+IDD QF+       DT+IK    ++
Sbjct  330   VDYVLGSWVEEHRQNRLSANDNGAEQDFIHAMLSVIDDGQFS---GRDPDTIIKGTCSNL  386

Query  737   LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE  558
             +   ++T +  LTW L++LL +  +LK+ Q E++ ++GK R  + SD+KNL YLQ +VKE
Sbjct  387   ILAGNDTTSITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKE  446

Query  557   TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT  378
             TLR+YP GP   PHEA+EDC V G+HI  GT+L VN+W+LHRDP++W DP +F PERF+T
Sbjct  447   TLRLYPPGPLSLPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLT  506

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
                G   + + Y+ +PFG GRR CPG  +A ++T + +ARL  GF    V + P+DM E 
Sbjct  507   KHAGLDVRGKNYELLPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTES  566

Query  197   VGIILPKLTPLEVLVTPRLSPTLFR  123
              G+  PK TPLEV + PRL   L++
Sbjct  567   PGLTAPKATPLEVTIVPRLPFELYK  591



>ref|XP_004154826.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 82C4-like [Cucumis 
sativus]
Length=532

 Score =   434 bits (1117),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 222/501 (44%), Positives = 309/501 (62%), Gaps = 12/501 (2%)
 Frame = -1

Query  1607  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             KRLPPE GGA P+IGHLH    + P   T ++ AD YGP+FT+RLG+   L+VSNWE  R
Sbjct  39    KRLPPEVGGALPLIGHLHLLDKNEPAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEIAR  98

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +CFTTNDK  A+RP   A K LGYDYA+   S    +WR+VRKL ++ELL+S R++KL+H
Sbjct  99    ECFTTNDKIFASRPKLVASKLLGYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKLQH  158

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
             + VSE+Q +I   Y     +   N        V M  WFG +TLN I +IV G+++    
Sbjct  159   IRVSEVQTSIKNLYELCLKNKKNNE---KNALVEMKTWFGDITLNTISRIVVGKQFSTAV  215

Query  1067  DGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAIL  888
             D   + E +  +K        +G FV  D+ FP  F +WLD  GH K+MK+ A+ +D + 
Sbjct  216   DVSNTNENEEYRKALRDFSNXFGVFVPSDS-FP--FLKWLDLGGHEKAMKKTAQVLDEVF  272

Query  887   QDWVDARRKERRS-----NEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
               W+   ++++ +      E+  F+DVMLS + D   Q   Y    V KA  L+++   S
Sbjct  273   DKWIQEHQQKKNNLGAVKMEEHDFMDVMLSNVRDD-GQLSKYDAHIVTKATCLALILAGS  331

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             +T    + W L++LL + E LKR Q E+D ++G++R  ++SDVKNL YLQ VVKETLR+Y
Sbjct  332   DTTTVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQAVVKETLRLY  391

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P  P L PHE++EDC+V GYHIP GT+L VNV +L RDP+IW DP +F PERF+T+ +  
Sbjct  392   PAAPILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFRPERFLTSEKDF  451

Query  362   AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
               + +  Q +PFG GRR CPG  +A Q+  +A+A L  GF  S    E LDM E  G+  
Sbjct  452   DVRGQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELLDMEESAGMTS  511

Query  182   PKLTPLEVLVTPRLSPTLFRL  120
              +  PLEV++TPRL P ++ L
Sbjct  512   IRKNPLEVVLTPRLPPQVYEL  532



>ref|XP_006283535.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
 gb|EOA16433.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
Length=524

 Score =   433 bits (1114),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 219/522 (42%), Positives = 329/522 (63%), Gaps = 25/522 (5%)
 Frame = -1

Query  1652  IAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIR  1476
             +  L+ L+   +K      P+  GAWPIIGHLH       L+ +TL + AD YG   +++
Sbjct  14    LIVLIALFKKSKKPKHVKAPKPSGAWPIIGHLHLISGKEQLLYRTLGKMADHYGAAMSLQ  73

Query  1475  LGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKL  1296
             LG S   VVS++E  +DCFT NDK +A+RP T A K++GY++AVF F+  +++WR +RK+
Sbjct  74    LGSSEAFVVSSFEVAKDCFTVNDKALASRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKI  133

Query  1295  VVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTL  1116
               +ELLS+RR++ LKHV VSE+   +N  Y+       K  + P    V++  W   +TL
Sbjct  134   ATIELLSNRRLQMLKHVRVSEISMGVNYLYSLWV---KKGGSEPVM--VDLKSWLDDMTL  188

Query  1115  NLIMQIVAGRRYEYRSDGVVS----EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWL  948
             N+++++VAG+RY +   G  S    EEA++ KK  ++  +L G F   DA FP     W 
Sbjct  189   NMVVRMVAGKRY-FGGAGSESSKDTEEARQCKKAIAKFFHLIGIFTVSDA-FPT--LGWF  244

Query  947   DYEGHVKSMKRAAKDVDAILQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYS  780
             D +GH K MK+   ++D IL+ WV+  R++R+       D  FIDVMLS+ +        
Sbjct  245   DLQGHEKEMKQTGIELDVILERWVENHRQQRKVSGPKENDSDFIDVMLSLAEQGKLSHLQ  304

Query  779   YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS  600
             Y  +  IK+  L+++   SET ++ LTW +A+LL + E LK+ QDEID ++G ER  EDS
Sbjct  305   YDANISIKSTCLALILGGSETTSSTLTWAIALLLNNKEMLKKAQDEIDLHVGTERNVEDS  364

Query  599   DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI  420
             D++NL Y+Q ++KETLR+YP GP L P EA+EDC V G+++ +GT+L VNVW++ RDP++
Sbjct  365   DIENLVYVQAIIKETLRLYPAGPLLGPREAMEDCTVAGHNVSRGTRLIVNVWKIQRDPRV  424

Query  419   WPDPEKFLPERFMTNLEGEA----AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             + +P +F PERF+T   GEA     + + ++ +PFG GRRSCPG+  A Q+  + +AR+ 
Sbjct  425   YMEPNEFRPERFVT---GEAKKFDVRGQNFELMPFGSGRRSCPGSSLAMQVLHLGLARIL  481

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             Q F+  TV +  +DM E  G+ +PK TPLEVL++PRL   LF
Sbjct  482   QSFDVKTVSDMAVDMSESPGLTIPKATPLEVLISPRLKEHLF  523



>gb|KGN59914.1| hypothetical protein Csa_3G852630 [Cucumis sativus]
Length=538

 Score =   434 bits (1115),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 222/501 (44%), Positives = 309/501 (62%), Gaps = 12/501 (2%)
 Frame = -1

Query  1607  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             KRLPPE GGA P+IGHLH    + P   T ++ AD YGP+FT+RLG+   L+VSNWE  R
Sbjct  45    KRLPPEVGGALPLIGHLHLLDKNEPAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEIAR  104

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +CFTTNDK  A+RP   A K LGYDYA+   S    +WR+VRKL ++ELL+S R++KL+H
Sbjct  105   ECFTTNDKIFASRPKLVASKLLGYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKLQH  164

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
             + VSE+Q +I   Y     +   N        V M  WFG +TLN I +IV G+++    
Sbjct  165   IRVSEVQTSIKNLYELCLKNKKNNE---KNALVEMKTWFGDITLNTISRIVVGKQFSTAV  221

Query  1067  DGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAIL  888
             D   + E +  +K        +G FV  D+ FP  F +WLD  GH K+MK+ A+ +D + 
Sbjct  222   DVSNTNENEEYRKALRDFFEWFGVFVPSDS-FP--FLKWLDLGGHEKAMKKTAQVLDEVF  278

Query  887   QDWVDARRKERRS-----NEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
               W+   ++++ +      E+  F+DVMLS + D   Q   Y    V KA  L+++   S
Sbjct  279   DKWIQEHQQKKNNLGAVKMEEHDFMDVMLSNVRDD-GQLSKYDAHIVTKATCLALILAGS  337

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             +T    + W L++LL + E LKR Q E+D ++G++R  ++SDVKNL YLQ VVKETLR+Y
Sbjct  338   DTTTVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQAVVKETLRLY  397

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P  P L PHE++EDC+V GYHIP GT+L VNV +L RDP+IW DP +F PERF+T+ +  
Sbjct  398   PAAPILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFHPERFLTSEKDF  457

Query  362   AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
               + +  Q +PFG GRR CPG  +A Q+  +A+A L  GF  S    E LDM E  G+  
Sbjct  458   DVRGQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELLDMEESAGMTS  517

Query  182   PKLTPLEVLVTPRLSPTLFRL  120
              +  PLEV++TPRL P ++ L
Sbjct  518   IRKNPLEVVLTPRLPPQVYEL  538



>ref|XP_002284810.3| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=610

 Score =   436 bits (1121),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 226/504 (45%), Positives = 314/504 (62%), Gaps = 21/504 (4%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNW  1440
             +K+ KR PPE  G WP+IGHLH       L +TL + ADKYGP+F +RLG+ + LVVS+W
Sbjct  117   KKRGKR-PPEPSGRWPLIGHLHLLGADKLLHRTLGDMADKYGPIFCVRLGLKKTLVVSSW  175

Query  1439  EGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRME  1260
             E  ++C+TT+DK  A RP + A K +GYD+  F F+    YWR+VRKL +VELLS+R++E
Sbjct  176   EVAKECYTTSDKVFATRPRSLAIKLIGYDHGSFVFAPYGPYWRDVRKLAMVELLSNRQLE  235

Query  1259  KLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRY  1080
               KHV  SE++  I E Y   A     N + P+   V M   FG+L LN++++ +AG+RY
Sbjct  236   MHKHVQDSEVKILIKELYGQWA----SNKDGPAL--VEMKERFGNLALNVVVRAIAGKRY  289

Query  1079  EYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGHVKSMKRAAKD  903
                      +E +R KK F   + L G F+  D I    F  WLD  +G    MKR AK+
Sbjct  290   --FGTHACGDEPKRAKKAFEDFIILLGLFMVSDVI---PFLGWLDTMKGFTAEMKRVAKE  344

Query  902   VDAILQDWVDARRKERRSNED----QKFIDVMLSMIDD-QFTQGYSYSRDTVIKAIVLSM  738
             VD +L  WV+  R+ R S  D    Q FI  MLS+IDD QF+       DT+IK    ++
Sbjct  345   VDYVLGSWVEEHRQNRLSANDNGAEQDFIHAMLSVIDDGQFS---GRDPDTIIKGTCSNL  401

Query  737   LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE  558
             +   ++T +  LTW L++LL +  +LK+ Q E++ ++GK R  + SD+KNL YLQ +VKE
Sbjct  402   ILAGNDTTSITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKE  461

Query  557   TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT  378
             TLR+YP GP   PHEA+EDC V G+HI  GT+L VN+W+LHRDP++W DP +F PERF+T
Sbjct  462   TLRLYPPGPLSLPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLT  521

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
                G   + + Y+ +PFG GRR CPG  +A ++T + +ARL  GF    V + P+DM E 
Sbjct  522   KHAGLDVRGKNYELLPFGSGRRVCPGISFALELTHLTLARLLHGFELGAVADSPVDMTES  581

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
              G+  PK TPLEV + PRL   L+
Sbjct  582   PGLTAPKATPLEVTIVPRLPFELY  605



>ref|XP_002284806.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=527

 Score =   433 bits (1114),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 225/497 (45%), Positives = 316/497 (64%), Gaps = 20/497 (4%)
 Frame = -1

Query  1598  PPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCF  1419
             P E  G WPIIGHLH         +TL + ADKYGP+F I LG+ + LVVS+WE  ++C+
Sbjct  40    PQEPSGRWPIIGHLHLLGADKLPHRTLGDMADKYGPIFCIHLGLRKALVVSSWEVAKECY  99

Query  1418  TTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWV  1239
             TTNDK  A RP + A K +GYD+A+  F+    YWR+VRKL +VELLS+R++E LKHV  
Sbjct  100   TTNDKVFATRPRSLAVKLMGYDHAMLGFAPYGPYWRDVRKLAMVELLSNRQLEMLKHVQD  159

Query  1238  SELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGV  1059
             SE++  I E Y   A    +N ++P+   V M   FG+L +N++++ +AG+RY       
Sbjct  160   SEVEFLIKELYGQWA----RNKDSPAL--VEMKERFGNLVMNVMVRAIAGKRY--FGTHA  211

Query  1058  VSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGHVKSMKRAAKDVDAILQD  882
               +E +R KK     M L G F+  DAI    F  WLD  +G+   MK+ AK++D +L  
Sbjct  212   CDDEPKRGKKALDDFMLLVGLFMVSDAI---PFLGWLDTVKGYTTDMKKIAKELDYLLGR  268

Query  881   WVDARRKERRSNEDQK----FIDVMLSMIDD-QFTQGYSYSRDTVIKAIVLSMLQDASET  717
             WV+  R++R S  + +    F+ VMLS+IDD QF+       DTVIKA  L+++    +T
Sbjct  269   WVEEHRQQRLSANNNRAEVDFLHVMLSVIDDGQFS---GRDPDTVIKATCLNLILAGYDT  325

Query  716   FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ  537
              +  LTW L++LL +  +LK+ Q E++ ++GK R  + SD+KNL YLQ +VKETLR+YP 
Sbjct  326   TSITLTWALSLLLNNRHALKKAQAELEIHVGKHRQVDGSDIKNLVYLQAIVKETLRLYPP  385

Query  536   GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA  357
             GP   PHEA+EDC V G+HI  GT+L VN+W+LHRDP++W DP +F PERF+TN  G   
Sbjct  386   GPLSVPHEAMEDCTVAGFHIQAGTRLLVNLWKLHRDPRVWLDPLEFQPERFLTNHAGLDV  445

Query  356   QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPK  177
             + + Y+ +PFG GRR CPG  +A ++T +A+ARL  GF    V + P+DM E  G+  PK
Sbjct  446   RGKNYELLPFGSGRRVCPGISFALELTHLALARLLHGFELGVVADSPVDMTEGPGLSAPK  505

Query  176   LTPLEVLVTPRLSPTLF  126
              TPLEV + PRL   L+
Sbjct  506   ATPLEVTIVPRLPFELY  522



>ref|XP_002282085.3| PREDICTED: cytochrome P450 82A1-like [Vitis vinifera]
Length=1053

 Score =   449 bits (1155),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 229/530 (43%), Positives = 332/530 (63%), Gaps = 21/530 (4%)
 Frame = -1

Query  1694  VMDAVPCCLS-------SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSV  1536
              MD +  CL+       +IL ++  +LLW S   +S R+ PEA GAWPIIGHLH    S 
Sbjct  528   TMDFLLQCLNPVMVGAFAILVLSYHLLLWRSGAGKS-RMAPEASGAWPIIGHLHLLGGSK  586

Query  1535  PLVKTL-SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLG  1359
              L   L    ADKYGPVF+IRLG+ R +VVS+WE  ++CFTT+D  +A+RP   A KYLG
Sbjct  587   NLPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKECFTTHDLALASRPELVAAKYLG  646

Query  1358  YDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDK  1179
             Y+YA+F FS + +YWR VRK+  +ELLS+RR+E LK+V +SE++  + E Y   A    +
Sbjct  647   YNYAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMKELYKLWA----E  702

Query  1178  NNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWG  999
               +      V+M +WFGHL+LN+I+++V G+RY   +     +EAQ+ +K   +   L G
Sbjct  703   KKSEAGVVLVDMKQWFGHLSLNVILKMVVGKRYFGYAAESKEKEAQQCQKAIREFFRLLG  762

Query  998   EFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE---DQKFI  828
              FV  DA   L F  WLD  GHVK+MK+ AK++D I Q+W++  R+ + S E   DQ F+
Sbjct  763   LFVVSDA---LPFLGWLDVGGHVKAMKKTAKELDGIAQEWLEEHRRRKDSGEADGDQDFM  819

Query  827   DVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQ  648
             DVMLS++      GY    DT+ KA  L ++   ++T +  LTW +++LL +P  L++ Q
Sbjct  820   DVMLSILGATDPNGYD--ADTINKATSLILIAGGTDTTSVTLTWAISLLLNNPHVLRKAQ  877

Query  647   DEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKG  468
             +E+DT++GKER   + D+  L YLQ +VKETLR+YP  P     + ++D ++ GYHIPKG
Sbjct  878   EELDTHVGKERLVNEMDISKLVYLQAIVKETLRLYPAAPLSGQRQFIQDSVLGGYHIPKG  937

Query  467   TQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYA  288
             T+L +N+ ++ RDP++W +P KF P RF+T  +    + + +   PFG GRR CPG  +A
Sbjct  938   TRLLLNLTKIQRDPRVWLNPTKFQPSRFLTTYKDVDVKGKHFVLTPFGGGRRICPGAAFA  997

Query  287   TQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
              Q+  + +A     F  ST  N P+DM E  GI   K TPLEVL++PRL+
Sbjct  998   LQVLPLTLANFLHKFQLSTPSNSPIDMSESFGITNIKSTPLEVLISPRLA  1047


 Score =   443 bits (1140),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 223/515 (43%), Positives = 330/515 (64%), Gaps = 17/515 (3%)
 Frame = -1

Query  1664  SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTS---VPLVKTLSEWADKYG  1494
             + L ++  +LLW S R  +K++ PEA  AWPIIGHLH        +P + TL   ADKYG
Sbjct  17    ATLFLSYCLLLWRS-RAGNKKIAPEAAAAWPIIGHLHLLAGGSHQLPHI-TLGNMADKYG  74

Query  1493  PVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYW  1314
             PVFTIR+G+ R +VVS+WE  ++C T ND+  ++RP   A K LGY+YA+F FS   SYW
Sbjct  75    PVFTIRIGLHRAVVVSSWEMAKECSTANDQVSSSRPELLASKLLGYNYAMFGFSPYGSYW  134

Query  1313  RNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRW  1134
             R +RK++ +ELLS+ R+E LK V  SE+  +I E Y   A    +  N      V M +W
Sbjct  135   REMRKIISLELLSNSRLELLKDVRASEVVTSIKELYKLWA----EKKNESGLVSVEMKQW  190

Query  1133  FGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFR  954
             FG LTLN+I+++VAG+RY   SD   +++AQR ++VF +  +L G FV  DAI P  F  
Sbjct  191   FGDLTLNVILRMVAGKRYFSASDASENKQAQRCRRVFREFFHLSGLFVVADAI-P--FLG  247

Query  953   WLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNED---QKFIDVMLSMIDDQFTQGY  783
             WLD+  H K++K+ A ++D+I Q+W++  R+ + S +D   Q F+DVM S++D +   GY
Sbjct  248   WLDWGRHEKTLKKTAIEMDSIAQEWLEEHRRRKDSGDDNSTQDFMDVMQSVLDGKNLGGY  307

Query  782   SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAED  603
                 DT+ KA  L+++   S+T    LTW L+++L + ++LK+ Q+E+D  +GKER   +
Sbjct  308   D--ADTINKATCLTLISGGSDTTVVSLTWALSLVLNNRDTLKKAQEELDIQVGKERLVNE  365

Query  602   SDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPK  423
              D+  L YLQ +VKETLR+YP GP     +  EDC + GYH+ KGT+L +N+ ++ +DP+
Sbjct  366   QDISKLVYLQAIVKETLRLYPPGPLGGLRQFTEDCTLGGYHVSKGTRLIMNLSKIQKDPR  425

Query  422   IWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGF  243
             IW DP +F PERF+T  +    + + ++F+PFG GRR+CPG  +  Q+  + +A     F
Sbjct  426   IWSDPTEFQPERFLTTHKDVDPRGKHFEFIPFGAGRRACPGITFGLQVLHLTLASFLHAF  485

Query  242   NFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
              FST  NE ++M E +G+   K TPLEVL++PRLS
Sbjct  486   EFSTPSNEQVNMRESLGLTNMKSTPLEVLISPRLS  520



>ref|XP_004147803.1| PREDICTED: cytochrome P450 82C4-like [Cucumis sativus]
Length=532

 Score =   433 bits (1113),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 222/501 (44%), Positives = 309/501 (62%), Gaps = 12/501 (2%)
 Frame = -1

Query  1607  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             KRLPPE GGA P+IGHLH    + P   T ++ AD YGP+FT+RLG+   L+VSNWE  R
Sbjct  39    KRLPPEVGGALPLIGHLHLLDKNEPAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEIAR  98

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +CFTTNDK  A+RP   A K LGYDYA+   S    +WR+VRKL ++ELL+S R++KL+H
Sbjct  99    ECFTTNDKIFASRPKLVASKLLGYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKLQH  158

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
             + VSE+Q +I   Y     +   N        V M  WFG +TLN I +IV G+++    
Sbjct  159   IRVSEVQTSIKNLYELCLKNKKNNE---KNALVEMKTWFGDITLNTISRIVVGKQFSTAV  215

Query  1067  DGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAIL  888
             D   + E +  +K        +G FV  D+ FP  F +WLD  GH K+MK+ A+ +D + 
Sbjct  216   DVSNTNENEEYRKALRDFFEWFGVFVPSDS-FP--FLKWLDLGGHEKAMKKTAQVLDEVF  272

Query  887   QDWVDARRKERRS-----NEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
               W+   ++++ +      E+  F+DVMLS + D   Q   Y    V KA  L+++   S
Sbjct  273   DKWIQEHQQKKNNLGAVKMEEHDFMDVMLSNVRDD-GQLSKYDAHIVTKATCLALILAGS  331

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             +T    + W L++LL + E LKR Q E+D ++G++R  ++SDVKNL YLQ VVKETLR+Y
Sbjct  332   DTTTVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQAVVKETLRLY  391

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P  P L PHE++EDC+V GYHIP GT+L VNV +L RDP+IW DP +F PERF+T+ +  
Sbjct  392   PAAPILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFHPERFLTSEKDF  451

Query  362   AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
               + +  Q +PFG GRR CPG  +A Q+  +A+A L  GF  S    E LDM E  G+  
Sbjct  452   DVRGQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELLDMEESAGMTS  511

Query  182   PKLTPLEVLVTPRLSPTLFRL  120
              +  PLEV++TPRL P ++ L
Sbjct  512   IRKNPLEVVLTPRLPPQVYEL  532



>emb|CBI40977.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   432 bits (1110),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 217/496 (44%), Positives = 310/496 (63%), Gaps = 28/496 (6%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             P AGGAWPIIGHLH F       KTL   ADKYGPVFTIRLG++ ILV+S+ E  R+CFT
Sbjct  70    PRAGGAWPIIGHLHLFGAQQLTHKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECFT  129

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
             T+D+  + RP+  A K LGYD+A+F F+   SYWR +RK+V +ELLS+ R++ LKH+  S
Sbjct  130   THDRVFSTRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIRAS  189

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E+  +I E Y     +   +        V+M RWFG LTLNL +++V G+RY        
Sbjct  190   EVGTSIRELYEMWVSERGTDGR----VFVDMKRWFGDLTLNLAVRLVGGKRY--------  237

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV  876
                      V     +L+G FV  DAI P  F  WLD +G+ K+MKR AK++D++   W+
Sbjct  238   ------FGAVIRDFAHLFGVFVLSDAI-P--FLSWLDLKGYKKAMKRTAKELDSLFGGWL  288

Query  875   DARRKER----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFAT  708
                +++R       +DQ F+DVML++++D    G  +  DTV KA  L+++   S+T   
Sbjct  289   QEHKEKRLLGGEGKDDQDFMDVMLTVLEDVNFSG--FDADTVNKATCLNLILAGSDTTKV  346

Query  707   HLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPY  528
              LTW L++LL HP  LK+ Q E+D  +GK+R  ++SDVKNL YLQ ++KETLR+YP  P 
Sbjct  347   TLTWALSLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPI  406

Query  527   LAPHEAVEDC-IVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN  351
             +  H A+EDC +  GY+I  GTQ+ VN W++HRD ++W +P++F PERFMT+ +    + 
Sbjct  407   ITLHAAMEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHKDTDVRG  466

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
             + ++ +PFG GRRSCPG   A Q+   A+A L   +  +   +  +DM E +G+   K T
Sbjct  467   QHFELIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKAT  526

Query  170   PLEVLVTPRLSPTLFR  123
             PLEVL++PRL   L+R
Sbjct  527   PLEVLLSPRLKAELYR  542



>ref|XP_002268915.2| PREDICTED: cytochrome P450 82C2 [Vitis vinifera]
Length=744

 Score =   438 bits (1127),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 219/496 (44%), Positives = 314/496 (63%), Gaps = 14/496 (3%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             P AGGAWPIIGHLH F       KTL   ADKYGPVFTIRLG++ ILV+S+ E  R+CFT
Sbjct  257   PRAGGAWPIIGHLHLFGAQQLTHKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECFT  316

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
             T+D+  + RP+  A K LGYD+A+F F+   SYWR +RK+V +ELLS+ R++ LKH+  S
Sbjct  317   THDRVFSTRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIRAS  376

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E+  +I E Y     +   +        V+M RWFG LTLNL +++V G+RY        
Sbjct  377   EVGTSIRELYEMWVSERGTDGR----VFVDMKRWFGDLTLNLAVRLVGGKRYFGAGADTK  432

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV  876
               E +  +KV     +L+G FV  DAI P  F  WLD +G+ K+MKR AK++D++   W+
Sbjct  433   EGEGRTCQKVIRDFAHLFGVFVLSDAI-P--FLSWLDLKGYKKAMKRTAKELDSLFGGWL  489

Query  875   DARRKER----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFAT  708
                +++R       +DQ F+DVML++++D    G+    DTV KA  L+++   S+T   
Sbjct  490   QEHKEKRLLGGEGKDDQDFMDVMLTVLEDVNFSGFDA--DTVNKATCLNLILAGSDTTKV  547

Query  707   HLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPY  528
              LTW L++LL HP  LK+ Q E+D  +GK+R  ++SDVKNL YLQ ++KETLR+YP  P 
Sbjct  548   TLTWALSLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPI  607

Query  527   LAPHEAVEDC-IVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN  351
             +  H A+EDC +  GY+I  GTQ+ VN W++HRD ++W +P++F PERFMT+ +    + 
Sbjct  608   ITLHAAMEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHKDTDVRG  667

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
             + ++ +PFG GRRSCPG   A Q+   A+A L   +  +   +  +DM E +G+   K T
Sbjct  668   QHFELIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKAT  727

Query  170   PLEVLVTPRLSPTLFR  123
             PLEVL++PRL   L+R
Sbjct  728   PLEVLLSPRLKAELYR  743



>ref|XP_006432711.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
 gb|ESR45951.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
Length=473

 Score =   429 bits (1103),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 218/501 (44%), Positives = 311/501 (62%), Gaps = 34/501 (7%)
 Frame = -1

Query  1613  QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEG  1434
             + KR  PEAGGAWP+IGHLH      PL + L   ADKYGP+FTI++GI+R LVVS+WE 
Sbjct  1     KKKRGAPEAGGAWPVIGHLHILGGPEPLHRVLGSMADKYGPIFTIKIGINRALVVSSWEM  60

Query  1433  VRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKL  1254
              ++C TTNDK  A+RP T A + LGY++++F  S   SYWR  RK+  +ELLS  R+EKL
Sbjct  61    AKECLTTNDKIFASRPKTLAMEILGYNFSMFGSSPYGSYWRETRKIATLELLSKHRLEKL  120

Query  1253  KHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEY  1074
             +HV   E++  + E Y     D  K+ N      V M RWF     N+I++++ G     
Sbjct  121   RHVRDYEVKTCLKELYEL--WDKSKSTNKML---VEMKRWFEDTICNVILRMIVG-----  170

Query  1073  RSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDA  894
                           K  + V  + G+FV  DA   L F RWLD  G  +SMK+ AK++D 
Sbjct  171   --------------KGCNSVDKMSGKFVVSDA---LPFLRWLDIGGDERSMKKTAKELDI  213

Query  893   ILQDWVDARRKERRS----NEDQKFIDVMLSMIDDQFTQGYS-YSRDTVIKAIVLSMLQD  729
             ++Q  ++  +++R S     E+  F+ VMLS++ D  T+ YS    DT+ KA+ L ++  
Sbjct  214   VVQGCLEEHKRKRDSREMKGEELDFMSVMLSILGD--TEKYSGRDVDTINKAVCLGLIIA  271

Query  728   ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR  549
               +T    LTW++++LL H + L +VQ+E+D  +G +R   +SD+KNL YLQ  +KE +R
Sbjct  272   GLDTTTVTLTWVISLLLNHRDILDKVQNELDIQVGTKRQVNESDLKNLVYLQATLKEAMR  331

Query  548   MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE  369
             +YP  P L PHEA+E+C V+GYH+P GTQL +NVW+L RDP++W +P KF PERF+T  +
Sbjct  332   LYPAVPLLIPHEAIEECTVNGYHVPAGTQLLINVWKLQRDPRVWEEPCKFQPERFLTKHK  391

Query  368   GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI  189
                 + +  + +PFG GRR CPG  +A Q+ Q  +A L QGF+F+T  NEPLDM E  G+
Sbjct  392   DIDVRGQHLELLPFGSGRRMCPGVSFALQVMQFTIASLLQGFDFATPSNEPLDMGEGFGL  451

Query  188   ILPKLTPLEVLVTPRLSPTLF  126
              + K  PLEVL+ PRLS +L+
Sbjct  452   TMEKSRPLEVLIAPRLSASLY  472



>gb|KDP38438.1| hypothetical protein JCGZ_04363 [Jatropha curcas]
Length=526

 Score =   431 bits (1108),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 218/504 (43%), Positives = 321/504 (64%), Gaps = 22/504 (4%)
 Frame = -1

Query  1613  QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEG  1434
             + +R  PEAGGAWP+IGHLH FR S PL   L + ADK GP+F I+LG+   LVVSNWE 
Sbjct  36    KRERKVPEAGGAWPLIGHLHLFRGSKPLHIILGKMADKMGPIFKIKLGMHPTLVVSNWEM  95

Query  1433  VRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKL  1254
              + C TTND+  A RP T A   +GY+ A+  FS    YWR +RK+ ++ELLS++R++  
Sbjct  96    AKQCLTTNDQVFATRPKTLASVLVGYNRAMLPFSPYGPYWRQMRKIAILELLSNQRIQTQ  155

Query  1253  KHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEY  1074
               V  SE++  + E Y       DKN N+ +   V M RWFG +TLNLI +I+ G+    
Sbjct  156   SRVRESEVRTFLKELYKFW----DKNKNSQNKVLVEMVRWFGDMTLNLICEIIVGK----  207

Query  1073  RSDGVVSEEAQRLKKVFSQ----VMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAK  906
              S G V+ E     K++ Q    +  L G+FV+ DAI P  F RW D  G  K+M + AK
Sbjct  208   -SVGYVTTEGGGESKIWKQGLRDLFDLIGKFVAADAI-P--FLRWFDIGGFEKAMIKTAK  263

Query  905   DVDAILQDWVDARRKERRSN---EDQKFIDVMLSMIDD-QFTQGYSYSRDTVIKAIVLSM  738
             ++D + + W+   +K+R S     ++ F+ +ML+++D  Q  QG     D + KA+ LS+
Sbjct  264   ELDLVAEGWLKEHKKKRASGFKQGEEHFMGLMLNILDHTQVAQGPH--SDPINKAVSLSL  321

Query  737   LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE  558
             +  AS+T A  L W L++L+ +P +LK+ QDE+D ++G+ER  ++SD+KNL YLQ ++KE
Sbjct  322   ILVASDTTAVTLNWALSLLVNNPNALKKAQDELDMHVGRERQIQESDIKNLEYLQAILKE  381

Query  557   TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT  378
             TLR+YP GP   PHE+ EDC V GY IP GT+L +N+W++H DP++W +P +F PERF+T
Sbjct  382   TLRLYPAGPLSLPHESTEDCTVGGYDIPAGTKLVINIWKIHHDPRVWENPFEFRPERFLT  441

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
             + +    + + ++F+PFG GRR CPG  +  Q+ Q+ +A L   F+  T  NEP+DM E+
Sbjct  442   SHKDFDVRGQNFEFIPFGSGRRRCPGISFGLQVMQLTLANLLHSFDIETPSNEPVDMTEN  501

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
             +G+   + TPLE+L+ PRL P L+
Sbjct  502   IGLTNLRATPLEILMHPRLPPHLY  525



>ref|XP_007017413.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14638.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   431 bits (1107),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 216/522 (41%), Positives = 328/522 (63%), Gaps = 22/522 (4%)
 Frame = -1

Query  1682  VPCCLSSILGIAALV--LLWFSW---RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTL  1518
             +P  ++++      +  LLW S     +  +R  PEAG +WP+IGHLH      P    L
Sbjct  10    IPFVIATVFAFPLFLFSLLWISKSVKNRDKRRAAPEAGSSWPVIGHLHLLGGPQPAHIVL  69

Query  1517  SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFT  1338
              + A+KYGP+FTI++G+ R LVV+NWE  ++C TTNDK  A+RP T A + L YD+A+F 
Sbjct  70    GDMAEKYGPIFTIKMGVYRALVVNNWETAKECLTTNDKAFASRPKTLAMELLSYDHAMFG  129

Query  1337  FSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSA  1158
             F+    YWR +RK+  +ELLSS R+++LKHV  SE++ ++ E Y   +    +N ++   
Sbjct  130   FAPYGPYWRQMRKVATLELLSSYRLDRLKHVRQSEIKTSLKELYQHWS----ENKDSSDK  185

Query  1157  PKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDA  978
               V M  WF  +TLN+I++++ G+R    SD     E +R K        L G+FV  DA
Sbjct  186   VLVEMKAWFRDVTLNVILRMIVGKRIP-SSDS--DAEGERWKDALRDFFDLSGKFVISDA  242

Query  977   IFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV-DARRKERRSNE--DQKFIDVMLSMI  807
                L F +WLD  G  + MK+  K++D + + W+ D +R +   N+  DQ F+DVM S++
Sbjct  243   ---LPFLKWLDIGGDERFMKKVTKELDEVAEGWLQDHKRMKASGNQESDQDFMDVMFSIL  299

Query  806   DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
              D       +  DT+ KA  L+M+  AS+T    LTW L++LL +  +LK+ Q+E+D ++
Sbjct  300   SDV----GKHDADTINKATCLAMILAASDTTMVTLTWALSLLLNNRGALKKAQEELDIHV  355

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             G+++  E+SD+K L YL+ ++KETLR+YP GP   PHE++EDCIV GYHIP GT+L +NV
Sbjct  356   GRDKLVEESDIKKLVYLRAILKETLRLYPAGPLSLPHESMEDCIVSGYHIPAGTRLLINV  415

Query  446   WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             +++HRDP++W DP +F PERF+T  +    + + ++ +PFG GRR CPG  +A Q+ ++ 
Sbjct  416   YKIHRDPRVWSDPCEFQPERFLTTYKDFDVRGQNFELIPFGSGRRMCPGVSFALQVLELT  475

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
             +A L QGF   T  +EP+DM E +G+   K +PLEVL+TPRL
Sbjct  476   LANLLQGFELGTPLDEPVDMSEAMGLTNLKASPLEVLITPRL  517



>ref|XP_004238201.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=520

 Score =   431 bits (1107),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 211/511 (41%), Positives = 323/511 (63%), Gaps = 24/511 (5%)
 Frame = -1

Query  1631  WFSWRKQSK--RLPPEAGGAWPIIGHLHHFRTS----VPLVKTLSEWADKYGPVFTIRLG  1470
             ++S +KQS   R  PEAGGAWPIIGHLH    S    +P  K L   ADKYGP+F ++LG
Sbjct  24    FYSVKKQSSSSRKVPEAGGAWPIIGHLHLLGGSESDHLPH-KMLGRLADKYGPIFGMKLG  82

Query  1469  ISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVV  1290
             + +++VVS+ +  ++CFTTND  +A RP + A + +GY +A+F   +   YWR  RK+  
Sbjct  83    VHQVVVVSDHKLAKECFTTNDLALAGRPKSMASEIIGYKHAMFGLCSYGPYWRETRKIAT  142

Query  1289  VELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNL  1110
             +EL S+RR+E LKH+   E+++ I E Y     +N + NN     K+ M  W G L +N 
Sbjct  143   IELFSARRIEMLKHIREFEVKSGIKEIY-----NNWEKNNLNGVVKMEMKEWIGDLFMNT  197

Query  1109  IMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHV  930
             + +I+ G+      D  +++  + +++ F     L G FV  D    L + RWLD  GH 
Sbjct  198   MGKILFGKGRRSNEDEGINKAHKAIRRFFE----LLGVFVVADF---LPYLRWLDIGGHE  250

Query  929   KSMKRAAKDVDAILQDWVDARRKER---RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVI  759
             K+MK  +K++D+++++W+   + +R   +S E++ F+DVMLS+ +D+   G     DT I
Sbjct  251   KAMKEVSKEMDSVVEEWLTEHKTKRGIIKSGEEEDFMDVMLSVCEDRDLPGVD--ADTAI  308

Query  758   KAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPY  579
             KA  +++L   ++T    LTWIL++LL + +SL++ QDE+D ++GK RW ++SD+KNL Y
Sbjct  309   KATCMALLSAGTDTTMVTLTWILSLLLNNYQSLQKAQDELDAHVGKNRWVQESDIKNLVY  368

Query  578   LQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKF  399
              Q +VKE LR+YP GP   PHE++EDC + GY IPKGT+L VN+W++ RDP IWP+P +F
Sbjct  369   FQAIVKEALRLYPAGPLSLPHESMEDCTISGYDIPKGTRLLVNIWKIQRDPNIWPNPHEF  428

Query  398   LPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNE  219
              PERF++  +    +   ++ +PFG GRR CPG   A Q+    +A L QGF+   + +E
Sbjct  429   KPERFLSTHKDVDVKGNHFELMPFGSGRRMCPGISLALQVLPFVIAMLLQGFDMKRLLDE  488

Query  218   PLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             P+DM E  G+ + K +PLEVL+ PRL+P L+
Sbjct  489   PIDMSESFGLTVLKASPLEVLLAPRLAPDLY  519



>gb|ABB20912.1| P450 mono-oxygenase [Stevia rebaudiana]
Length=528

 Score =   430 bits (1106),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/527 (40%), Positives = 332/527 (63%), Gaps = 21/527 (4%)
 Frame = -1

Query  1676  CCLSSILGIAALVLLWFSWRKQ-----SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSE  1512
               +++IL + A   L  S RK+     +K LPP+A GAWP+IGHL     +    + L +
Sbjct  9     TTVTAILVVTAF-FLQISKRKKVDTTKNKLLPPKAKGAWPLIGHLPLLGKNRIAHRVLGD  67

Query  1511  WADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFS  1332
              ADKYGP+FTI+LG+ ++LVVS+ + V+DCFTT+DK  A+RP + A + +GY+YA+F  +
Sbjct  68    LADKYGPIFTIKLGVYQVLVVSSADAVKDCFTTSDKAFASRPKSTAVEIMGYNYAMFGLA  127

Query  1331  TNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPK  1152
                 YWR VRK+ V+E+LS +R++ L+   VSE++ + NE Y   A   +K N       
Sbjct  128   PYGEYWRQVRKIAVLEILSQKRVDMLEWARVSEVRTSTNEVYD--AWRVNKENEGSDMVL  185

Query  1151  VNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIF  972
             V+M +WF +L LN++++I++G+R+ ++S      E  R +K+  ++  L G FV  D I 
Sbjct  186   VDMKQWFTNLILNVLVRIISGKRFPFKS-----VEGIRFQKMEKKLFELLGAFVVSDLIP  240

Query  971   PLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE----DQKFIDVMLSMID  804
              +  F   D  G+ K MK AA++++ I++ W++ R+ ++ S E    DQ F+DV++S++ 
Sbjct  241   SMKRF---DIGGYQKQMKMAAEEINDIMEGWLNNRKTQKESGEQKEGDQYFMDVLISVLK  297

Query  803   DQFTQGY-SYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
             D     +  Y  DTVIKA  +++L   S+T +  + W LA+LL HPE +K  QDEID ++
Sbjct  298   DASDADFPGYDHDTVIKATCMALLAAGSDTTSVTIIWALALLLNHPEKMKIAQDEIDKHV  357

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             G++R  E+SD+KNL Y+  ++KET+R+YP  P   PHEA+EDC+V GYHIPKGT+L  N 
Sbjct  358   GRDRLVEESDLKNLVYINAIIKETMRLYPAAPLSVPHEAMEDCVVGGYHIPKGTRLLPNF  417

Query  446   WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             W++  DP IWP+P +F PERF++  +    + + ++ +PFG GRR CP   +  QI  + 
Sbjct  418   WKIQHDPNIWPEPYEFKPERFLSTHKDVDVKGKHFELLPFGTGRRMCPAITFVLQILPLT  477

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +A L Q F      N+P+DM E  G+   + TPL+VL+ PRLS  ++
Sbjct  478   LANLIQQFEIRKPSNDPIDMTESAGLTTKRATPLDVLIAPRLSLKMY  524



>ref|XP_010664625.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=520

 Score =   430 bits (1105),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 218/504 (43%), Positives = 312/504 (62%), Gaps = 20/504 (4%)
 Frame = -1

Query  1619  RKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNW  1440
             R + KR  PEA GAWP+IGHLH    S    KTL   ADKYGP+F I+LG   +LVVSNW
Sbjct  30    RSERKRTAPEAAGAWPVIGHLHLLGGSELPHKTLGAMADKYGPIFFIKLGARPVLVVSNW  89

Query  1439  EGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRME  1260
             E  ++CFTTNDK  A RP   A + +GY+ A+F FS   SYWR +RK+V   LLS+R +E
Sbjct  90    EIAKECFTTNDKAFANRPKLIAVEVMGYNNAMFGFSPYGSYWRQMRKIVTTHLLSNRSLE  149

Query  1259  KLKHVWVSELQANINEFYTT-IAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRR  1083
              LK V +SE++A I E +   ++  +D N        V M RWFG L LNL +++ AG+R
Sbjct  150   MLKLVRISEVKATIKELHELWVSKKSDSN-----MVSVEMRRWFGDLALNLAVRMTAGKR  204

Query  1082  YEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKD  903
             +    +GV   +A R          L G+F+  DA   L F RW D  G+ K+MK+ AK 
Sbjct  205   FSSDKEGVEYHKAIRC------FFELTGKFMVSDA---LPFLRWFDLGGYEKAMKKTAKS  255

Query  902   VDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDDQFTQG--YSYSRDTVIKAIVLSM  738
             +D +L+DW+   +++R S +   DQ F+DVMLS++DD+       S   D + KA  L++
Sbjct  256   LDHLLEDWLQEHKRKRVSGQPTGDQDFMDVMLSILDDETRAQDIKSSDADIINKATCLNV  315

Query  737   LQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKE  558
             L   ++T    LTW L++LL +   L + ++E+D ++G+ER  E+ D+ NL YL  ++KE
Sbjct  316   LIATTDTVTVSLTWALSLLLNNRHVLNKAKEELDLHVGRERRVEERDMSNLVYLDAIIKE  375

Query  557   TLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMT  378
             TLR+Y     LA HE+ E+C+V G +IP GT+L +N+W++H DP +W DP++F+PERF+T
Sbjct  376   TLRLYSAVQVLAAHESTEECVVGGCYIPAGTRLIINLWKIHHDPSVWSDPDQFMPERFLT  435

Query  377   NLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
               +    +   ++ +PFG GRR CPG   A Q  Q  +A L QGF F+T  + P+DM E 
Sbjct  436   THKDVDVRGMHFELIPFGSGRRICPGVSLALQFLQFTLASLIQGFEFATASDGPVDMTES  495

Query  197   VGIILPKLTPLEVLVTPRLSPTLF  126
             +G+   K TPL+VL+TPRLS  L+
Sbjct  496   IGLTNLKATPLDVLLTPRLSSNLY  519



>ref|XP_007226598.1| hypothetical protein PRUPE_ppa023495mg [Prunus persica]
 gb|EMJ27797.1| hypothetical protein PRUPE_ppa023495mg [Prunus persica]
Length=522

 Score =   429 bits (1104),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 228/527 (43%), Positives = 328/527 (62%), Gaps = 18/527 (3%)
 Frame = -1

Query  1682  VPCCLSSILGIAALVLLWFSWRKQSK--------RLPPEAGGAWPIIGHLHHFRTSVPLV  1527
             +PC  ++I GI A++L  +   K+S         +LP  AGG WP++GH   FR S    
Sbjct  5     LPCLNTAIAGILAILLFSYFIIKRSSSAAKAKGPKLPKVAGG-WPLLGHFGLFRGSQLPH  63

Query  1526  KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYA  1347
               L+   DKYGP FTI +GI   LV+S WE  +DCFTTND  +++RP T   K+LGY++A
Sbjct  64    IALASLVDKYGPAFTINIGIHSALVISTWEAAKDCFTTNDIVVSSRPATLGAKHLGYNFA  123

Query  1346  VFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNN  1167
             +F FS   SYWR +RKL  +ELLS+RR+E LK V VSE++ ++ E YT       K   +
Sbjct  124   MFGFSPYGSYWREMRKLTSLELLSNRRLELLKKVRVSEVEMSLKELYTLWI----KRKES  179

Query  1166  PSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVS  987
                  V M +WFG LTLN+I ++VAG+R     +    +EA+R +K   +  +L G FV 
Sbjct  180   SGERLVEMKQWFGDLTLNVIFRMVAGKRCFMNGNLSEEKEARRWQKAMREFFHLAGLFVL  239

Query  986   GDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMI  807
             GDA+ P  +  WLD  G  K+MK+ AK++D+I+ +W++  +++R   +DQ F+DVMLS I
Sbjct  240   GDAV-P--WLSWLDLGGQQKAMKKTAKELDSIVAEWLEEHKQKRTKGKDQDFMDVMLSAI  296

Query  806   DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
             D     G+    DTVIKA  L ++  AS+T    LTW L++LL + + LK+V +E+D  +
Sbjct  297   DGTDVAGFD--ADTVIKATCLILIAGASDTTMVTLTWTLSLLLNNRQVLKKVYEELDQYV  354

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             GK R  ++SD+ NL YLQ  VKE +R+ P GP     E  EDC V GYH+PKGT L VN+
Sbjct  355   GKGRLLDESDINNLVYLQATVKEAMRLCPAGPLSGQREFTEDCTVGGYHVPKGTWLLVNL  414

Query  446   WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             W++  DP++W DP +F PERF+T  +    + +Q++ +PFG GRR+CPG  +  Q+T + 
Sbjct  415   WKIQTDPRVWADPMEFKPERFLTTHKDVDVRGQQFELMPFGSGRRACPGISFGLQMTLLT  474

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +A     F+ +T  N P+DM   +G+   KLTPL+VLV PRLSP L+
Sbjct  475   LASFLHSFDVTTQENAPVDMTGSIGLTNIKLTPLDVLVKPRLSPNLY  521



>ref|XP_010526010.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Tarenaya hassleriana]
Length=524

 Score =   429 bits (1104),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 224/530 (42%), Positives = 322/530 (61%), Gaps = 27/530 (5%)
 Frame = -1

Query  1670  LSSILGIAALVLLWFS-----WRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEW  1509
             L S+  I    L  FS     ++KQ  R  PE  G+WPI+GHLH       L+ +TL   
Sbjct  5     LGSLAPIFIASLFLFSVFATLFKKQKHRKAPEPTGSWPILGHLHLLGGKNNLLYRTLGAL  64

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             AD+YGP F ++LG  + LVVS+W+  ++C T ND+  A+RP T   K++GY+YA+F F+ 
Sbjct  65    ADEYGPAFGLQLGSQKALVVSSWDVAKECLTVNDRTFASRPKTVGAKHMGYNYALFGFAP  124

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
              +SY+R++RK+V  ELLS++R++KL HV +SE++  I + Y    + + K  + P    V
Sbjct  125   YDSYFRDMRKIVTFELLSNQRIQKLSHVRISEIEMGIKDIYN---LWSKKGGSGPVL--V  179

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSE--EAQRLKKVFSQVMYLWGEFVSGDAI  975
             ++ +W   L LN+I+++VAG+RY +  D    E  EA+R  K  ++   L G FV  DA 
Sbjct  180   DVKQWLEDLNLNMIVKLVAGKRYAF-GDATADEADEARRCPKATARFFQLMGLFVLSDA-  237

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLSMID  804
               L F    D +GH K MK+ A ++D IL+ W+    + R   E   D  FIDVMLS  +
Sbjct  238   --LPFLGRFDLQGHEKEMKKNAAEIDGILEGWLQEHERRRALGETDGDSDFIDVMLSQKE  295

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
                     +   T IKA  L+M+   S+T    L W  A+L  + E LK+ ++EID ++G
Sbjct  296   QGKLSNLKHDERTAIKATCLAMILGGSDTLVGTLVWAFALLANNREILKKAREEIDFHVG  355

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             K+R  EDSD++ L YLQ + KETLR+YP  P L P EA EDC V GYH+  GT+L VNVW
Sbjct  356   KDRKVEDSDIEKLVYLQAITKETLRLYPAAPLLGPREATEDCTVAGYHVTAGTRLMVNVW  415

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQ----NRQYQFVPFGLGRRSCPGNLYATQIT  276
             ++HRDPKIWP+P++F+PERF   LEG+A++     + Y+ +PFG GRRSCPG   A Q+ 
Sbjct  416   KVHRDPKIWPNPDEFIPERF---LEGKASEYSVRGQSYELLPFGSGRRSCPGISLAVQVL  472

Query  275   QVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              + +AR    F+ STV    +DM E  G+ +PK  PLEVL++PRL   L+
Sbjct  473   HLLLARFLHSFDMSTVSGMDVDMGESPGLTIPKTKPLEVLLSPRLKKELY  522



>gb|KDP38423.1| hypothetical protein JCGZ_04348 [Jatropha curcas]
Length=561

 Score =   431 bits (1107),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 216/501 (43%), Positives = 322/501 (64%), Gaps = 21/501 (4%)
 Frame = -1

Query  1604  RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             R  PE  GAWPIIGHLH    +  L+ +TL   ADKYGP F IR+G     VV++ E  +
Sbjct  72    REAPEPSGAWPIIGHLHLLGGADKLLHQTLGLMADKYGPAFNIRIGSHCAFVVASSELAK  131

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +CFT NDK +A+RPTT A K++ Y++AVF F+ ++S+WR +RK+V++ELLS+RR+E +KH
Sbjct  132   ECFTINDKDVASRPTTAATKHMCYNHAVFGFAPHSSHWREMRKIVMLELLSNRRLEMVKH  191

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
             V  SE+   I + Y   A       NN     V + +WF  LTLN+I+++VAG+RY   S
Sbjct  192   VQNSEVNLGIKKLYHLWA------ENNCLPVLVELKQWFEDLTLNVIVRVVAGKRYTGSS  245

Query  1067  DGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAIL  888
             D    + A+R +   S+  +L G FV  DA   L F +WLD EGH ++MK+ AKD+DA+L
Sbjct  246   D---DDGARRCQNAISKFFHLMGIFVVSDA---LPFLQWLDLEGHQRAMKKTAKDLDAVL  299

Query  887   QDWVDARRKER-------RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQD  729
             + W+   R++R       ++  +Q FIDVMLS+ +     G+ Y  DT IK+  L+++  
Sbjct  300   EGWLTEHRQKRVSVLGEAKTEGEQDFIDVMLSLEEKGHLSGFIYDADTSIKSTCLALIAG  359

Query  728   ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR  549
             AS+T  T LTW +++LL +  +LK+ ++E+D ++G ER  ++SD+K+L Y+Q ++KETLR
Sbjct  360   ASDTTTTTLTWAISLLLNNKSALKKAREELDLHVGPERQVDESDLKSLVYIQAIIKETLR  419

Query  548   MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE  369
             +YP  P L P E  +DC + GYH+P GT+L VN W++ RDP+ W +P  F PERF+T+  
Sbjct  420   LYPVAP-LIPREFTKDCTIAGYHVPAGTRLLVNAWKIQRDPRYWTNPSAFQPERFLTSHA  478

Query  368   GEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGI  189
                 + + ++ +PFG GRRSCPG  +A     + +AR    F+ +T  ++P+DM E  G 
Sbjct  479   NVDVRGQHHELIPFGSGRRSCPGAAFALHALHLTLARFLHAFDLATTMDKPVDMTETPGT  538

Query  188   ILPKLTPLEVLVTPRLSPTLF  126
              LPK TPL+VL++PRL   L+
Sbjct  539   TLPKATPLDVLLSPRLPAELY  559



>ref|XP_011039260.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=528

 Score =   429 bits (1103),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/495 (42%), Positives = 314/495 (63%), Gaps = 14/495 (3%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             P+AGGAWPIIGH+H F       K L   ADKYGPVFTI+LG  R+LVV++WE  RDCFT
Sbjct  42    PQAGGAWPIIGHMHLFGGKQLTHKILGAMADKYGPVFTIKLGSHRVLVVNSWEMARDCFT  101

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
              +D+  ++RP+  A K LGYD A+F F+    YWR +RK+  +ELLSS R++ L+H+  S
Sbjct  102   VHDRAFSSRPSIAASKLLGYDLAMFGFAPYGPYWREMRKITTIELLSSHRIDMLRHIRAS  161

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E++  I + +           +  S   V+M +WFG LTLN+++++V G+RY   S    
Sbjct  162   EVETAIRDLHKMWV----SKGSAESGVTVDMKQWFGELTLNIVLRMVGGKRYFGPSADGE  217

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV  876
               EA+R +KV    + L+G FV  DAI P  F  WLD+ G+ K+MKR AK++D +   W+
Sbjct  218   EAEARRNQKVMRDFVRLFGVFVLSDAI-P--FLGWLDFNGYEKAMKRTAKELDILAGGWL  274

Query  875   DARRKER----RSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFAT  708
             +  ++ R    +  ++Q F+DVML++++     G+    DT+ KA  L+++   S+T   
Sbjct  275   EEHKQRRLLGGKEKQEQDFMDVMLNILEKANIGGFDA--DTINKATCLNVILAGSDTTMV  332

Query  707   HLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPY  528
              LTW L++LL +P+ LK+ +DE+D ++GK+R  ++SD+ NL YLQ ++KETLR+YP  P 
Sbjct  333   TLTWALSLLLNNPQVLKKAKDELDIHVGKDRLVDESDINNLVYLQAIIKETLRLYPPSPL  392

Query  527   LAPHEAVEDCIVD-GYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQN  351
             +A   A EDC +  GYH+P GT+L  N W++ RD ++WP+P++F PERF+T+ +    + 
Sbjct  393   IAHRSAKEDCTLSVGYHVPSGTRLMANAWKIQRDERVWPNPDEFHPERFLTSQKEIDLKG  452

Query  350   RQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLT  171
             + ++ +PFG GRRSCPG   A +I    +ARL   F  +    E +DM E  G+   K T
Sbjct  453   QNFELIPFGSGRRSCPGIALALRIVHFTLARLLHSFEVTKPSREDVDMTESHGLTNLKAT  512

Query  170   PLEVLVTPRLSPTLF  126
             PLE+L+ PRL+P L+
Sbjct  513   PLEILLIPRLNPRLY  527



>ref|XP_009780811.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana sylvestris]
Length=708

 Score =   435 bits (1119),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 220/510 (43%), Positives = 310/510 (61%), Gaps = 20/510 (4%)
 Frame = -1

Query  1625  SWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVS  1446
             S  K S    P+A GAWP IGHLH     VP  +TL   ADKYGP+F ++LG    LVVS
Sbjct  208   STAKNSSIGAPKAPGAWPFIGHLHLLSDPVPACRTLGLMADKYGPIFQLQLGTHPALVVS  267

Query  1445  NWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRR  1266
             +WE V+DCFTTNDK  A+RP     KY  Y+ AVF  +    YWR +RK+V +EL ++ R
Sbjct  268   SWEMVKDCFTTNDKIFASRPKMTLSKYF-YNDAVFALAPYGPYWREIRKMVTLELFTNSR  326

Query  1265  MEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGR  1086
             +EKLKHV  SE+   I E Y+        NNNN    +VN+S WF H+T N+I++++AG+
Sbjct  327   LEKLKHVRASEVDCCIKELYSFC------NNNNNFPTQVNLSSWFEHITCNIIIRMLAGK  380

Query  1085  RYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAK  906
             R+    +     +  + K+   + ++L G FV  D I  L    W+D  GH+K+MK+   
Sbjct  381   RFSSSVNEQSGTKEMQFKESIKKALFLGGTFVVSDVIPSL---EWMDIGGHIKAMKQTFN  437

Query  905   DVDAILQDWVDARRKERRSNEDQK--------FIDVMLSMIDDQFTQGYSYSRDTVIKAI  750
             +VD++   W+    ++R+  E+          FIDVMLS + ++ T    Y RD +IKA 
Sbjct  438   EVDSVFDIWLKEHIQKRKDCENSNTGDDHQSDFIDVMLSTLPEE-TMVSGYDRDAIIKAT  496

Query  749   VLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQG  570
              L ++  ASE+ A  L W L++L+     LK  QDE+D ++G+ RW E+SD+KNL YLQ 
Sbjct  497   TLILIMTASESTAETLIWTLSLLMNDRRILKIAQDELDEHVGRNRWVEESDMKNLKYLQA  556

Query  569   VVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPE  390
             +VKETLR+YP GP   P EA+EDC V  YHI KGT+L VN+W+L RD  IW +P +F PE
Sbjct  557   IVKETLRLYPPGPLAGPREAIEDCYVGKYHIRKGTRLIVNLWKLQRDSSIWENPNEFQPE  616

Query  389   R-FMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPL  213
             R F+        + + ++++PF  GRR CPG  + TQ+  + +ARL  GFN S    EP+
Sbjct  617   RWFLKEHMNINFRGQSFEYIPFSSGRRMCPGLTFGTQVVHLTLARLLHGFNISMPREEPV  676

Query  212   DMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             D+ E +GI LPK+ PL+ L+TPRL   L++
Sbjct  677   DLSEGLGIALPKMKPLQPLLTPRLPMELYQ  706



>gb|KDO65988.1| hypothetical protein CISIN_1g011292mg [Citrus sinensis]
Length=489

 Score =   428 bits (1100),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 205/461 (44%), Positives = 301/461 (65%), Gaps = 11/461 (2%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             PE  GAWP+IGHL       P+ K L   ADKYGP++++RLG    L+VS+WE V+DCFT
Sbjct  39    PEPFGAWPLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFT  98

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
             TND+ +A RP+  AGKYLGYD AVF  +    YWR++RK+   +LLSS R+E LKHV  S
Sbjct  99    TNDRVLATRPSIAAGKYLGYDNAVFALAPYGRYWRDIRKIATTDLLSSHRLELLKHVRYS  158

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E+   I + Y+  +    +N  NP+  KV +S+    LT N+ ++++AG+R+  R  G  
Sbjct  159   EVDTFIKDLYSRCS----ENAFNPA--KVVISKLIEQLTFNISLRLIAGKRFSAREFGEQ  212

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV  876
               E  R+ +   +  YL G FV GDAI P  +  W+D++GH+ SM+R AK +D ++ +W+
Sbjct  213   GSEGWRINRAIKEATYLTGVFVLGDAI-P--WLEWIDFQGHIGSMRRTAKKIDDVIGNWL  269

Query  875   DARRKERRSNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTW  696
             +    +R+   +  F+DV+LS I+D  T    ++RDTVIKA  L ++   SE+    + W
Sbjct  270   E-EHAQRKLQGEGDFMDVLLSKIEDN-TVMSGHTRDTVIKATALILIFTGSESTYLGIIW  327

Query  695   ILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPH  516
              L++LL HP+ LK+ Q+E+D ++G++RW  +SD+KNL YL+ +VKETLR+YP GP     
Sbjct  328   TLSLLLNHPKELKKAQEELDVHVGRDRWVNESDMKNLKYLRAIVKETLRIYPPGPVTGIR  387

Query  515   EAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQF  336
             EA+EDC + GYH+PKGT+L VN+W+LHRDP++W +P +F PERF+T         + +++
Sbjct  388   EAMEDCEIGGYHVPKGTRLIVNIWKLHRDPRMWENPCEFRPERFLTTHADVDVNTQHFEY  447

Query  335   VPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPL  213
             +PF  GRRSCPG     QI Q+ +AR+ QGF+ +TV   PL
Sbjct  448   IPFSFGRRSCPGMTSGLQIVQLTLARILQGFDLATVGVYPL  488



>ref|XP_007017415.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14640.1| Cytochrome P450, putative [Theobroma cacao]
Length=529

 Score =   429 bits (1102),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 217/497 (44%), Positives = 313/497 (63%), Gaps = 9/497 (2%)
 Frame = -1

Query  1607  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             KR  PE  GA P +GHLH    S P    L + AD  GP+FTIRLG+   LVVSNWE  +
Sbjct  38    KRKAPEVSGARPFLGHLHLLGGSKPAHVVLGDLADTNGPIFTIRLGMHPTLVVSNWEIAK  97

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +CFTTNDK  A RP T A + LGY+YA+F FS    YWR +RK+  +E+LS+ R+EKLKH
Sbjct  98    ECFTTNDKAFANRPRTIAAELLGYNYAMFGFSPYGPYWRQIRKIATLEVLSNHRLEKLKH  157

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
             +  SE++ +I E Y  + ++   N+++     V M RWF  L +N++ ++V G+RY    
Sbjct  158   IRESEVRTSIKELYE-LGVEGVSNSSSGKV-LVEMKRWFWTLNINMVFKMVVGKRYSEAE  215

Query  1067  DGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAIL  888
                  +E    +K       L G F  GD+   L F RWLD  GH K+MK+ AK++D IL
Sbjct  216   TSHGKDENDGHRKALRDFFELTGTFTVGDS---LPFLRWLDLGGHEKAMKKTAKELDHIL  272

Query  887   QDWVDARRKERRSN---EDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASET  717
             ++W++  +++R S     +  F+ +MLS+++D   +  SY+ DT+IKA  L+++   ++T
Sbjct  273   EEWLEEHKQKRNSGNAESEHDFMGMMLSLLNDA-AELPSYNADTIIKATCLAIILGGTDT  331

Query  716   FATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQ  537
                 +TW L++LL H + L++ Q E+DT +G+ER  ++SDVKNL YLQ ++KET R+YP 
Sbjct  332   TTVTITWALSLLLNHHDVLEKAQHELDTYVGRERPVQESDVKNLVYLQAIIKETTRLYPA  391

Query  536   GPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAA  357
              P    HE+VEDC   GY IP GT+L VN+ +L RDPK W +P++F PERF+T  +    
Sbjct  392   APLSVMHESVEDCTTAGYFIPAGTRLLVNLSKLQRDPKAWSNPDEFRPERFLTTHKHFDV  451

Query  356   QNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPK  177
             + + Y+ VPFG GRR CPG  +A Q+ Q ++A L Q F  +T  +EP+DM E  G+   K
Sbjct  452   RGQNYELVPFGSGRRVCPGISFALQVLQFSLASLLQAFEITTPSDEPVDMGEGAGLTNLK  511

Query  176   LTPLEVLVTPRLSPTLF  126
              TPLEV++TPRL P L+
Sbjct  512   ATPLEVILTPRLPPHLY  528



>gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita]
Length=516

 Score =   428 bits (1100),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 217/525 (41%), Positives = 326/525 (62%), Gaps = 17/525 (3%)
 Frame = -1

Query  1688  DAVPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHF--RTSVPLVKTLS  1515
             +A  C   + + + +  L+W      + + PPEAGGAWP +GHL+     T +P V +L 
Sbjct  4     NAAVCAALAFISLLSYYLIWLR-SASTHQAPPEAGGAWPFLGHLNIISGHTGLPHV-SLG  61

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
               ADK+GP+F IR+G+ R +VVS+ E +++ FTTND  +++RP+  AGK+L YDYA+  F
Sbjct  62    NLADKHGPIFGIRIGVHRAVVVSSSEVIKELFTTNDAAVSSRPSVKAGKHLAYDYAMLGF  121

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             S+  +YWR +RKLV +EL S+RR+E  ++V VSE    INE Y+      ++  +  S  
Sbjct  122   SSYGTYWRQMRKLVSLELFSARRVELQRNVRVSETAHFINELYSAW----EERRDGSSRV  177

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
              V M   FG L++N+I+++VAG+R+   S G  +EEA+R ++V  +  +L G FV  DA 
Sbjct  178   SVEMKELFGELSMNVILKMVAGKRF---SGGDDAEEARRCRRVMREFFHLAGLFVLSDA-  233

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNED--QKFIDVMLSMIDD  801
             FP  +  WLD  GH + MKR A+++D ++ +W+   R++  S E   Q F+DVMLS +  
Sbjct  234   FP--YLGWLDLGGHERRMKRTAEEMDELVGEWLAEHRRKEYSGEGKAQDFMDVMLSEVKG  291

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
                +   Y  DT+IKA   +++   ++T A    W LA+LL +P  L++ Q E+DT++GK
Sbjct  292   ANFE-CEYDVDTIIKATCGTLIAGGTDTTAVVFIWALALLLNNPHVLQKAQHELDTHVGK  350

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             +R   +SD+ NL YLQ + KETLR+YP GP        +DC V GYHIPK T L VN+W+
Sbjct  351   QRRVNESDLNNLVYLQAITKETLRLYPPGPLGGTRRLTQDCHVGGYHIPKETWLIVNLWK  410

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             LHRDP++W DP +F PERF+   +    + + ++ +PF  GRR CPG  +  Q+  + +A
Sbjct  411   LHRDPRVWSDPSEFRPERFLNGEKSMDVKGQDFELIPFSAGRRICPGTNFGLQMLHLVLA  470

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              L Q F+ S V NE +DM E  G+   K TPL+VL+ PRL P+L+
Sbjct  471   SLLQAFDLSRVSNEEIDMSESAGLTNIKATPLDVLIAPRLPPSLY  515



>gb|KCW85809.1| hypothetical protein EUGRSUZ_B02554, partial [Eucalyptus grandis]
Length=487

 Score =   427 bits (1097),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 210/499 (42%), Positives = 313/499 (63%), Gaps = 22/499 (4%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             PEAGGAWP+IGHLH     VP    L+  ADKYGP+FTI+ G+ R L+VS W+  + C T
Sbjct  3     PEAGGAWPLIGHLHLLGGPVPPHIILASMADKYGPIFTIKTGVHRALIVSKWQIAKQCLT  62

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
              ND+  A+RP + + + + Y+YA+F  +    YWR VRK+ ++ELLS+ R+E LKHV  S
Sbjct  63    VNDRAFASRPKSVSSEVMAYNYAMFGLAPYGPYWRQVRKVTMLELLSNHRLELLKHVRHS  122

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E+QA++   Y       +     P    V+M RWFG +TLN++ +++ G+RYE       
Sbjct  123   EVQASVTHLYKRCM---ESYTGAPKKVLVDMKRWFGDITLNVVFRMIVGKRYE-------  172

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV  876
              E+ ++ ++       L G F+  DA FP+   R LD +G+ + MK+ A+++D ++Q W+
Sbjct  173   DEQDEKGREALRSYFDLAGRFIVSDA-FPI--LRRLDLDGYERMMKKTAQELDRVVQGWL  229

Query  875   DARRKERRSNE--------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASE  720
             +  +  R +N+        D+ F+DVMLS++D    +   Y  DT IKA  ++++   S+
Sbjct  230   NEHKSRRSANKRRGDNKDSDRDFMDVMLSIVDAA-EEIPGYDADTFIKATCMALILAGSD  288

Query  719   TFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYP  540
             T +  LTW L++LL H E LK+ Q E+DT IG+ER   +SD+ NL Y+Q ++KET+R+YP
Sbjct  289   TTSVTLTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDLMNLVYIQAIIKETMRLYP  348

Query  539   QGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA  360
               P   PHE++EDC VDGYHIPKGT+L  N W++HRD  IW DP +F PERF+T      
Sbjct  349   AAPLGVPHESMEDCTVDGYHIPKGTRLLFNFWKIHRDQHIWSDPLEFRPERFLTTHRNFD  408

Query  359   AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILP  180
              + + ++ +PFG GRR CPG   A Q+  +++A L  GF+ +T+ +EP+DM + +G+   
Sbjct  409   VRGQNFELIPFGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEPVDMTKAIGMTNL  468

Query  179   KLTPLEVLVTPRLSPTLFR  123
             K TPLEVLVTPRL    +R
Sbjct  469   KATPLEVLVTPRLPEHAYR  487



>ref|XP_006465163.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=527

 Score =   428 bits (1101),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 214/502 (43%), Positives = 306/502 (61%), Gaps = 18/502 (4%)
 Frame = -1

Query  1607  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             KR  PEAGG WP+IGHLH      PL K L + ADKYGP+ TI++G+ R LVVSNWE  +
Sbjct  29    KRGAPEAGGGWPVIGHLHLLGRPEPLHKVLGKIADKYGPILTIKIGVHRTLVVSNWEIAK  88

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +C TT+DK  A RP T AG  L YD ++  F     YWR +RK+  +ELLSS R+E LK+
Sbjct  89    ECLTTSDKVFATRPKTVAGDILCYDSSLLGFVPYGHYWRQIRKIATLELLSSYRLESLKY  148

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRS  1068
             V  SE++  + E Y       DK         V+M +W  ++TLN+I+++V G+R     
Sbjct  149   VRESEVRTCLKELYNLWDAGLDK-----VPVLVDMKKWCEYVTLNVILRMVVGKRCNISI  203

Query  1067  DGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAIL  888
                 +   Q  K   S+     G+ V  DA   L F RWLD  G  + MK+ A+++D I+
Sbjct  204   SQKGASSDQGWKDELSRFFEFMGKLVVSDA---LPFLRWLDIGGDERLMKKTARELDLIM  260

Query  887   QDWVDARRKERRSNEDQ------KFIDVMLSMIDDQFTQGY-SYSRDTVIKAIVLSMLQD  729
             Q W+D  R++  S +DQ       F+  MLS++DD   Q +     DT+ KA  L+++  
Sbjct  261   QRWLDEHRRKGDSGDDQIKGREGNFMGAMLSILDDIGAQEFPGRDADTINKATCLALILG  320

Query  728   ASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLR  549
              S+T +  LTW +++LL +  +LKR  +E+D  +GKER  ++SD +NL YLQ ++KETLR
Sbjct  321   GSDTTSGTLTWAISLLLNNRHALKRAHEELDQQVGKERAVDESDTQNLVYLQAIIKETLR  380

Query  548   MYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLE  369
             +YP GP LAP EA+EDC V GYH+P GT+L +N W++ RDP++W +P  F PERF+    
Sbjct  381   LYPAGPLLAPREAMEDCTVSGYHVPAGTRLMINAWKIQRDPRVWENPSAFQPERFLPGHG  440

Query  368   GEA---AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMED  198
               A    + +Q++ +PFG GRRSCPG   A Q+  + +ARL   F  +T  ++P+DM E 
Sbjct  441   AHADVDVRGQQFELIPFGSGRRSCPGASSALQVLHLTLARLLHAFELATPLDQPVDMSES  500

Query  197   VGIILPKLTPLEVLVTPRLSPT  132
              G+ +PK TPL+VL++PRL P 
Sbjct  501   PGLTIPKATPLKVLLSPRLLPA  522



>gb|KDO42181.1| hypothetical protein CISIN_1g009844mg [Citrus sinensis]
Length=524

 Score =   427 bits (1099),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 212/499 (42%), Positives = 314/499 (63%), Gaps = 18/499 (4%)
 Frame = -1

Query  1613  QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEG  1434
             + KR  PEAGGAWP+IGHLH  R   P  +   + ADKYGP+F IR+G +  L+VSNWE 
Sbjct  40    KKKRGAPEAGGAWPVIGHLHLLRGPKPPYRVFDKMADKYGPIFIIRMGKNPALIVSNWEI  99

Query  1433  VRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKL  1254
              ++C TT+DK  A RP T A + LGY++++F FS   SYWR  RK+  + LLS+ R+EKL
Sbjct  100   AKECLTTHDKVFANRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLGLLSNHRLEKL  159

Query  1253  KHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEY  1074
             KHV   E++  + E Y        KN +      V M +WFG    N+++++V G+    
Sbjct  160   KHVREYEVKTCLKELYELW----HKNKSTNKILLVEMKKWFGDTLRNVVLRMVVGK----  211

Query  1073  RSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDA  894
                G  S +++  K++ ++   + G+FV  DA   L F RWLD  G  +SMK+ AK++D 
Sbjct  212   ---GCNSVDSEEWKELLTRFFEMSGKFVVSDA---LPFMRWLDIGGDERSMKKIAKELDV  265

Query  893   ILQDWVDARRKERRSNEDQK---FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
             I Q W++  +++R S E +K   F+ VMLS++ D   Q      DT+ KAI L+++  A+
Sbjct  266   IAQGWLEEHKRKRDSQEIKKEEDFMYVMLSILGDT-EQYLGRDVDTINKAICLALILGAA  324

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             +T    LT ++++LL H + L + Q+E+D  +G +R   +SD+KNL YLQ ++KE +R+Y
Sbjct  325   DTTTVTLTLVMSLLLNHRDILNKAQNELDIQVGAKRQVNESDIKNLVYLQAILKEAMRLY  384

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P GP L PHE++E+C V+GYH+P  TQL++N W++ RDP +W +P KF PERF+T  +  
Sbjct  385   PAGPLLVPHESIEECTVNGYHVPASTQLFINAWKIQRDPSVWEEPSKFQPERFLTRHKDI  444

Query  362   AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIIL  183
               + + ++ +PF  GRR CPG  +A Q+ Q  +A L QGFNF+T  NEP+DM E +G+ +
Sbjct  445   DVKGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLQGFNFATPSNEPVDMGEGLGLTM  504

Query  182   PKLTPLEVLVTPRLSPTLF  126
              K  P EVLVTPRLS   +
Sbjct  505   EKSQPFEVLVTPRLSAAFY  523



>ref|XP_003634362.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   427 bits (1099),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 222/529 (42%), Positives = 333/529 (63%), Gaps = 21/529 (4%)
 Frame = -1

Query  1691  MDAVPCCLS-------SILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVP  1533
             MD +  CL+       +IL ++  +LLW S   +S R+ PEA GAWPIIGHLH    S  
Sbjct  1     MDFLLHCLNPVMVGAFAILVLSYHLLLWRSGAGKS-RMAPEASGAWPIIGHLHLLGGSKN  59

Query  1532  LVKTL-SEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGY  1356
             L   L    ADKYGPVF+IRLG+ R +VVS+WE  ++CFTT+D  +A+RP   A KYLGY
Sbjct  60    LPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKECFTTHDLALASRPQLVAAKYLGY  119

Query  1355  DYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKN  1176
             +Y++F FS + +YWR VRK+  +ELLS+RR+E LK+V +SE++  + E Y   A    + 
Sbjct  120   NYSMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMKELYKLWA----ET  175

Query  1175  NNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGE  996
              +      V+M +WFGHL+LN+I+++V G+RY   +     + AQ+ +K   +   L G 
Sbjct  176   KSEAGVVLVDMKQWFGHLSLNVILKMVVGKRYFGYAAESKEKGAQQCQKAIREFFRLMGL  235

Query  995   FVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE---DQKFID  825
             FV  DA   L F  WLD  GHVK+MK+ AK++D I Q+W++  R+ + S E   DQ F+D
Sbjct  236   FVVSDA---LPFLGWLDVGGHVKAMKKTAKELDGIAQEWLEEHRRRKDSGEADGDQDFMD  292

Query  824   VMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQD  645
             VMLS++  + T    Y  DT+ KA  L ++   ++T +  LTW +++LL +P  L++ Q+
Sbjct  293   VMLSILGGRDTT--DYDADTINKATALILIGGGTDTTSGTLTWAISLLLNNPHILRKAQE  350

Query  644   EIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGT  465
             E+D ++GKER   + D+  L YLQ +VKETLR+ P  P   P + ++D I+ GY+I KGT
Sbjct  351   ELDAHVGKERIVNEMDISKLVYLQAIVKETLRLNPTAPLSGPRQFIQDSILGGYYISKGT  410

Query  464   QLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYAT  285
             +L +N+ ++ RDP++W +P +F P+RF+T  +    + + ++  PFG GRR CPG ++A 
Sbjct  411   RLILNLTKIQRDPRVWLNPMEFQPDRFLTTHKDVDVRGKHFELTPFGGGRRICPGAIFAL  470

Query  284   QITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLS  138
             Q+  + +A     F  ST  + P+DM E  G+   K TPLEVL++PRL+
Sbjct  471   QVLHLTLANFLHRFQLSTPSDAPVDMSESFGLTNIKSTPLEVLISPRLA  519



>gb|KDO39483.1| hypothetical protein CISIN_1g009723mg [Citrus sinensis]
Length=527

 Score =   427 bits (1099),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 214/503 (43%), Positives = 309/503 (61%), Gaps = 20/503 (4%)
 Frame = -1

Query  1607  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             KR  PEAGG WP+IGHLH      PL K L + ADKYGP+ TI++G+ R LVVSNWE  +
Sbjct  29    KRGAPEAGGGWPVIGHLHLLGRPEPLHKVLGKIADKYGPILTIKIGVHRTLVVSNWEIAK  88

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +C TT+DK  A RP T AG  L YD ++  F     YWR +RK+  +ELLSS R+E LK+
Sbjct  89    ECLTTSDKVFATRPKTVAGHILCYDSSLLGFVPYGHYWRQIRKIATLELLSSYRLESLKY  148

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPK-VNMSRWFGHLTLNLIMQIVAGRRYEYR  1071
             V  SE++  + E Y       DK      AP  V+M +W  ++TLN+I+++V G+R    
Sbjct  149   VRESEVRTCLKELYNLWDAGLDK------APVLVDMKKWCEYVTLNVILRMVVGKRCNIS  202

Query  1070  SDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAI  891
                  +   Q  K   S+     G+ V  DA   L F RWLD  G  + MK+ A+++D I
Sbjct  203   ISQKGTSSDQGWKDELSRFFEFMGKLVVSDA---LPFLRWLDIGGDERLMKKTARELDLI  259

Query  890   LQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGY-SYSRDTVIKAIVLSMLQ  732
             +Q W+D  R++  S +      ++ F+  MLS++DD   Q +     DT+ KA  L+++ 
Sbjct  260   MQRWLDEHRRKGDSGDYQIKGREENFMGAMLSILDDIGAQEFPGRDADTINKATCLALIL  319

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
               S+T +  LTW +++LL +  +LK+ Q+E+D  +GKER  ++SD +NL YLQ ++KETL
Sbjct  320   GGSDTTSGTLTWAISLLLNNRHALKKAQEELDQQVGKERAVDESDTENLVYLQAIIKETL  379

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R+YP GP LAP EA+EDC V GYH+P GT+L +N W++ RDP++W +P  F PERF+   
Sbjct  380   RLYPAGPLLAPREAMEDCTVSGYHVPAGTRLMINAWKIQRDPRVWENPSAFQPERFLPGH  439

Query  371   EGEA---AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMME  201
                A    + +Q++ +PFG GRRSCPG   A Q+  + +ARL   F  +T  ++P+DM E
Sbjct  440   GAHADVDVRGQQFELIPFGSGRRSCPGASSALQVLHLTLARLLHAFELATPLDQPVDMSE  499

Query  200   DVGIILPKLTPLEVLVTPRLSPT  132
               G+ +PK TPL+VL++PRL P 
Sbjct  500   SPGLTIPKATPLKVLLSPRLLPA  522



>ref|XP_002869302.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45561.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   427 bits (1098),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 212/503 (42%), Positives = 319/503 (63%), Gaps = 25/503 (5%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLV-KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCF  1419
             P   GAWPIIGHLH       L+ +TL + AD YGP  ++RLG S   VVS++E  ++CF
Sbjct  33    PAPSGAWPIIGHLHLLSGKEQLLYRTLGKMADHYGPAMSLRLGSSETFVVSSFEVAKECF  92

Query  1418  TTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWV  1239
             T NDK +A+RP + A K++GY++AVF F+   ++WR +RK+  +ELLS+RR++ LKHV V
Sbjct  93    TVNDKALASRPMSAAAKHMGYNFAVFGFAPYGAFWREMRKIATIELLSNRRLQMLKHVRV  152

Query  1238  SELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGV  1059
             SE+   + + Y+       K    P    V++  W   ++LN+++++VAG+RY +   G 
Sbjct  153   SEIAMGVKDLYSLWV---KKGGAEPVM--VDLQSWLEDISLNMMVRMVAGKRY-FGGGGS  206

Query  1058  VS----EEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAI  891
             +S    EEA++ +K  +   +L G F   DA FP     W D +GH K MK+  +++D I
Sbjct  207   LSSEDTEEARQCRKGVANFFHLVGIFTVSDA-FPK--LGWFDLQGHEKEMKQTGRELDVI  263

Query  890   LQDWVDARRKERR----SNEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDAS  723
             L+ W++  R++R+     + D  FIDVMLS+ +        Y  +T IK+  L+M+   +
Sbjct  264   LERWIENHRQQRKVSGTKHNDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLAMILGGT  323

Query  722   ETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMY  543
             ET    LTW +++LL + E LK+ Q+EID ++G++R  EDSD++NL YLQ ++KETLR+Y
Sbjct  324   ETSPATLTWAISLLLNNKEMLKKAQEEIDIHVGRDRNVEDSDIENLVYLQAIIKETLRLY  383

Query  542   PQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGE  363
             P GP L   EA+EDC V GY++P GT++ VNVW++ RDPK++ +P++F PERF+T   GE
Sbjct  384   PAGPLLGHREAMEDCTVAGYNVPCGTRMLVNVWKIQRDPKVYMEPDEFRPERFIT---GE  440

Query  362   AAQ----NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDV  195
             A +     + ++ +PFG GRRSCPG   A Q+  + +AR    F   TV + P+DM E  
Sbjct  441   AKEFDVRGQNFELMPFGSGRRSCPGASLAMQVLHLGLARFLHSFEVKTVMDMPVDMSESP  500

Query  194   GIILPKLTPLEVLVTPRLSPTLF  126
             G+ +PK TPLEVL++PRL   LF
Sbjct  501   GLTIPKGTPLEVLISPRLKEELF  523



>ref|XP_010046449.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   427 bits (1098),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 210/499 (42%), Positives = 313/499 (63%), Gaps = 22/499 (4%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             PEAGGAWP+IGHLH     VP    L+  ADKYGP+FTI+ G+ R L+VS W+  + C T
Sbjct  48    PEAGGAWPLIGHLHLLGGPVPPHIILASMADKYGPIFTIKTGVHRALIVSKWQIAKQCLT  107

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
              ND+  A+RP + + + + Y+YA+F  +    YWR VRK+ ++ELLS+ R+E LKHV  S
Sbjct  108   VNDRAFASRPKSVSSEVMAYNYAMFGLAPYGPYWRQVRKVTMLELLSNHRLELLKHVRHS  167

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E+QA++   Y       +     P    V+M RWFG +TLN++ +++ G+RYE       
Sbjct  168   EVQASVTHLYKRCM---ESYTGAPKKVLVDMKRWFGDITLNVVFRMIVGKRYE-------  217

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWV  876
              E+ ++ ++       L G F+  DA FP+   R LD +G+ + MK+ A+++D ++Q W+
Sbjct  218   DEQDEKGREALRSYFDLAGRFIVSDA-FPI--LRRLDLDGYERMMKKTAQELDRVVQGWL  274

Query  875   DARRKERRSNE--------DQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASE  720
             +  +  R +N+        D+ F+DVMLS++D    +   Y  DT IKA  ++++   S+
Sbjct  275   NEHKSRRSANKRRGDNKDSDRDFMDVMLSIVDAA-EEIPGYDADTFIKATCMALILAGSD  333

Query  719   TFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYP  540
             T +  LTW L++LL H E LK+ Q E+DT IG+ER   +SD+ NL Y+Q ++KET+R+YP
Sbjct  334   TTSVTLTWALSLLLNHREVLKKAQHELDTQIGRERLVNESDLMNLVYIQAIIKETMRLYP  393

Query  539   QGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEA  360
               P   PHE++EDC VDGYHIPKGT+L  N W++HRD  IW DP +F PERF+T      
Sbjct  394   AAPLGVPHESMEDCTVDGYHIPKGTRLLFNFWKIHRDQHIWSDPLEFRPERFLTTHRNFD  453

Query  359   AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILP  180
              + + ++ +PFG GRR CPG   A Q+  +++A L  GF+ +T+ +EP+DM + +G+   
Sbjct  454   VRGQNFELIPFGSGRRMCPGINLAMQLISLSLAALLHGFDITTLADEPVDMTKAIGMTNL  513

Query  179   KLTPLEVLVTPRLSPTLFR  123
             K TPLEVLVTPRL    +R
Sbjct  514   KATPLEVLVTPRLPEHAYR  532



>ref|XP_007017410.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14635.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=628

 Score =   430 bits (1106),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 211/507 (42%), Positives = 321/507 (63%), Gaps = 19/507 (4%)
 Frame = -1

Query  1625  SWR-KQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVV  1449
             +WR    K+  PEAG +WP++GHLH      P   TLS  ADKYGP+FTI+LG+ R LVV
Sbjct  135   TWRCTNKKKAAPEAGNSWPVLGHLHLLAGRQPAHLTLSAMADKYGPIFTIKLGVRRALVV  194

Query  1448  SNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSR  1269
             S+WE  ++C TTNDK  A RP   + + LGY++A+F F+    YWRN+RK+  +ELLS+ 
Sbjct  195   SSWETAKECLTTNDKAFATRPKNISMEVLGYNHAMFGFAPYGPYWRNMRKITTLELLSNH  254

Query  1268  RMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAG  1089
             R++ LKHV  SE++ ++ E Y        +N N+     V M +WF   T N+I++++ G
Sbjct  255   RLDMLKHVRESEMKVSLQELYQLW----KENKNSSDKVLVEMDKWFRDATANVILKMIVG  310

Query  1088  RRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAA  909
             +R     +     E+ R KK   +   L G+F+  DA FP  F RWLD  G  + MK+  
Sbjct  311   KRISSLGNDA---ESGRWKKALKEFFELSGKFLVADA-FP--FLRWLDIGGDERLMKKVK  364

Query  908   KDVDAILQDWVDARRKERRS----NEDQKFIDVMLSMIDDQFTQGYSYSRDTVIKAIVLS  741
             K ++ + ++W+   +++R S    +E++ F+DVMLS++ D       Y  DT+ KA  L 
Sbjct  365   KVLNEVAEEWLQEHKQKRASGEFRDEEEDFMDVMLSILTD----AKEYDADTINKATCLI  420

Query  740   MLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVK  561
             ++  A++  A  LTW LA+LL + ++LK+ Q EID +IGK++  E++D+KNL YLQ ++K
Sbjct  421   LILAATDPTAVTLTWCLALLLNNRDALKKAQQEIDIHIGKDKPVEENDIKNLVYLQAIIK  480

Query  560   ETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM  381
             ETLR++P GP   PHE++E+C V+GYHIP GT+L +N++++HRD ++W DP KF PERF+
Sbjct  481   ETLRLHPAGPLAVPHESMENCTVNGYHIPAGTELLINLYKIHRDSRVWSDPYKFQPERFL  540

Query  380   TNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMME  201
             T  +    + + ++ +PF  GRR CPG  +A Q+ Q+ +A L  GF+ +T  +EP+DM E
Sbjct  541   TTHKNFDVRGQNFELIPFSSGRRMCPGVSFALQVVQLTLANLLHGFDLATPFDEPVDMRE  600

Query  200   DVGIILPKLTPLEVLVTPRLSPTLFRL  120
               G+   K TPLEV ++PRL  + + L
Sbjct  601   AAGLSNFKATPLEVSISPRLPNSCYEL  627


 Score = 89.4 bits (220),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -1

Query  1529  VKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDY  1350
             ++ L + A  YGP+FTI+LG+S+ ++VSN E  ++C +TNDK  A RP + A + LGY+Y
Sbjct  20    LRLLFKRAGNYGPIFTIKLGLSQAVIVSNRELAKECLSTNDKVFATRPKSIAFEILGYNY  79

Query  1349  AVFTFSTNNSYWRNVRKLVVV  1287
             AVF FS   SYW ++RKL  V
Sbjct  80    AVFGFSPYGSYWHHIRKLATV  100


 Score = 22.7 bits (47),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 7/10 (70%), Positives = 9/10 (90%), Gaps = 0/10 (0%)
 Frame = -3

Query  1578  VAYYWPPPPL  1549
             +AYYWPP P+
Sbjct  1     MAYYWPPSPI  10



>ref|XP_004147802.1| PREDICTED: cytochrome P450 82A4-like [Cucumis sativus]
 ref|XP_004168431.1| PREDICTED: cytochrome P450 82A4-like [Cucumis sativus]
Length=517

 Score =   426 bits (1096),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 221/522 (42%), Positives = 319/522 (61%), Gaps = 23/522 (4%)
 Frame = -1

Query  1685  AVPCCLSSILG-IAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEW  1509
             A+P  L ++L  + AL   +   R+   RLPP+  GAWP+IGHL        L  TL ++
Sbjct  14    ALPAILFTLLFFLYALFASFIHGRRN--RLPPQPDGAWPVIGHLPLLTGKELLHNTLGKF  71

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             AD YGP+F +R G  + L+VS WE  ++CFTTNDK  A+RP   A + LGY+YA+F  S 
Sbjct  72    ADNYGPIFMLRFGTKKTLIVSGWEVAKECFTTNDKIFASRPKFAAAQLLGYNYAMFGTSP  131

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
               S+WR++RK+V++ELL++ RM +L+H+   E+Q +I E +  +   N K         V
Sbjct  132   YGSHWRHIRKIVMLELLANHRMNRLQHIPRLEVQNSIEELHE-LCRSNKK-------AVV  183

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFP  969
              M +WFG +TLN I ++V G+R+    +G   EE Q   K F     L+  FV  D +FP
Sbjct  184   EMEKWFGDITLNTIFKMVIGKRFSTTFEGCHGEEYQNALKDF---FNLFIAFVPSD-LFP  239

Query  968   LWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSN----EDQKFIDVMLSMIDD  801
               F RW D+ G+ KSMK+ AK +D +   W+   R++R S+    EDQ  +D+MLS+  D
Sbjct  240   --FLRWFDFGGYKKSMKKTAKIMDEMHDKWLREHREKRNSDGLVIEDQDLMDIMLSITKD  297

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
             +   GY    DT+IK+  L+M+     T    + W L++LLKH E+LK+VQ E+D  +G+
Sbjct  298   EDFSGYDV--DTIIKSTCLAMILGGFHTTTAQMVWALSLLLKHEEALKKVQLELDERVGR  355

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             ER   +SD+ +L YLQ VVKE LR+YP      PHE++EDC V GYH+P GT+L+VN+++
Sbjct  356   ERQVNESDINDLIYLQAVVKEALRLYPAAQLSVPHESIEDCTVAGYHVPAGTRLWVNLYK  415

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVA  261
             L RDP +W  P +F PERF+T+ +      +  +F+PFG GRR CPG  +A Q+  + +A
Sbjct  416   LQRDPNVWESPTEFRPERFLTSEKNYDVNGQTPEFIPFGSGRRICPGISFAIQVMHLTLA  475

Query  260   RLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSP  135
             RL   F       EP++M E VG+ + K  PLEV+VTPRLSP
Sbjct  476   RLLHEFQIGLPTQEPINMEESVGLNITKKVPLEVVVTPRLSP  517



>gb|KCW68808.1| hypothetical protein EUGRSUZ_F02407 [Eucalyptus grandis]
Length=562

 Score =   428 bits (1100),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 217/527 (41%), Positives = 325/527 (62%), Gaps = 28/527 (5%)
 Frame = -1

Query  1661  ILGIAALVLLWFSWRK------QSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADK  1500
             +L +A L++ W+S  +        K   PEA GAWP+IGHLH     VP    L+  ADK
Sbjct  50    LLRLACLLIYWWSLIRYRSVDGHKKASLPEACGAWPLIGHLHLLGGPVPPHIILASMADK  109

Query  1499  YGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNS  1320
             YGP+FTI+ G+ R L+VSNW+  + C T ND+  A+RP + + + + Y+YA+F  +    
Sbjct  110   YGPIFTIKTGVHRALIVSNWQIAKQCLTVNDRAFASRPKSVSSEVMAYNYAMFGLAPYGP  169

Query  1319  YWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMS  1140
             YWR VRK+ +++LLSS R+E LKHV  SE+QA++   Y       +  +  P    V+M 
Sbjct  170   YWRYVRKVTMLDLLSSHRLELLKHVRDSEVQASMTHLYKRCM---ESYSGAPEKVLVDMK  226

Query  1139  RWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWF  960
             RWFG +TLN++ +++ G+RYE        E+ ++ ++       L G F+  DA FP+  
Sbjct  227   RWFGDITLNVVFRMIVGKRYE-------DEQDEKGREALRSYFDLAGRFIVSDA-FPI--  276

Query  959   FRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE--------DQKFIDVMLSMID  804
              RWLD +G+ + MK+ A+++D ++Q W++  +  R +N+        DQ F+DVMLS +D
Sbjct  277   LRWLDLDGYERMMKKTAQELDRVVQGWLNEHKSRRSTNKRRGDNKDSDQDFMDVMLSTVD  336

Query  803   DQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIG  624
                 +   Y  DT IKA  ++++   S+T +  LTW L++LL H E LK+ Q E+DT IG
Sbjct  337   AA-EELPGYDADTFIKATCMALVLAGSDTTSVSLTWALSLLLNHREVLKKAQHELDTQIG  395

Query  623   KERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVW  444
             +ER   +SD++NL Y+Q ++KET+R+YP  P   PHE+ EDC VDGYHIPKGT+L  N  
Sbjct  396   RERLVNESDLENLVYIQAIIKETMRLYPAAPLGVPHESTEDCTVDGYHIPKGTRLLFNFS  455

Query  443   RLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             ++HRD  IW DP++F PERF+T       + + ++ +PFG GRR CPG   A Q+  +++
Sbjct  456   KIHRDQHIWSDPQEFRPERFLTTHRNFDVRGQNFELLPFGSGRRMCPGINLAMQLISLSL  515

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             A L  GF+ +T+ +E +DM E +G+   K TPLEVLVTPRL    +R
Sbjct  516   AALLHGFDITTLADEQVDMAEAIGMTNLKATPLEVLVTPRLPEHTYR  562



>ref|XP_010061806.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=541

 Score =   427 bits (1098),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 217/536 (40%), Positives = 325/536 (61%), Gaps = 35/536 (7%)
 Frame = -1

Query  1667  SSILGIAALVLLWFSWRK-------------QSKRLPPEAGGAWPIIGHLHHFRTSVPLV  1527
             +++LGI A   + + +R                K   PEA GAWP+IGHLH     VP  
Sbjct  20    TALLGIFAFATIIYFFRSLLIRTKYDRSVDGHKKASLPEACGAWPLIGHLHLLGGPVPPH  79

Query  1526  KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYA  1347
               L+  ADKYGP+FTI+ G+ R L+VSNW+  + C T ND+  A+RP + + + + Y+YA
Sbjct  80    IILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLTVNDRAFASRPKSVSSEVMAYNYA  139

Query  1346  VFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNN  1167
             +F  +    YWR VRK+ +++LLSS R+E LKHV  SE+QA++   Y       +  +  
Sbjct  140   MFGLAPYGPYWRYVRKVTMLDLLSSHRLELLKHVRDSEVQASMTHLYKRCM---ESYSGA  196

Query  1166  PSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVS  987
             P    V+M RWFG +TLN++ +++ G+RYE        E+ ++ ++       L G F+ 
Sbjct  197   PEKVLVDMKRWFGDITLNVVFRMIVGKRYE-------DEQDEKGREALRSYFDLAGRFIV  249

Query  986   GDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE--------DQKF  831
              DA FP+   RWLD +G+ + MK+ A+++D ++Q W++  +  R +N+        DQ F
Sbjct  250   SDA-FPI--LRWLDLDGYERMMKKTAQELDRVVQGWLNEHKSRRSTNKRRGDNKDSDQDF  306

Query  830   IDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRV  651
             +DVMLS +D    +   Y  DT IKA  ++++   S+T +  LTW L++LL H E LK+ 
Sbjct  307   MDVMLSTVDAA-EELPGYDADTFIKATCMALVLAGSDTTSVSLTWALSLLLNHREVLKKA  365

Query  650   QDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPK  471
             Q E+DT IG+ER   +SD++NL Y+Q ++KET+R+YP  P   PHE+ EDC VDGYHIPK
Sbjct  366   QHELDTQIGRERLVNESDLENLVYIQAIIKETMRLYPAAPLGVPHESTEDCTVDGYHIPK  425

Query  470   GTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLY  291
             GT+L  N  ++HRD  IW DP++F PERF+T       + + ++ +PFG GRR CPG   
Sbjct  426   GTRLLFNFSKIHRDQHIWSDPQEFRPERFLTTHRNFDVRGQNFELLPFGSGRRMCPGINL  485

Query  290   ATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
             A Q+  +++A L  GF+ +T+ +E +DM E +G+   K TPLEVLVTPRL    +R
Sbjct  486   AMQLISLSLAALLHGFDITTLADEQVDMAEAIGMTNLKATPLEVLVTPRLPEHTYR  541



>ref|XP_006427755.1| hypothetical protein CICLE_v10025349mg [Citrus clementina]
 gb|ESR40995.1| hypothetical protein CICLE_v10025349mg [Citrus clementina]
Length=527

 Score =   426 bits (1096),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 214/503 (43%), Positives = 308/503 (61%), Gaps = 20/503 (4%)
 Frame = -1

Query  1607  KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVR  1428
             KR  PEAGG WP+IGHLH      PL K L + ADKYGP+ TI++G+ R LVVSNWE  +
Sbjct  29    KRGAPEAGGGWPVIGHLHLLGGPEPLHKVLGKIADKYGPILTIKIGVRRTLVVSNWEIAK  88

Query  1427  DCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKH  1248
             +C TT+DK  A RP T AG  L YD ++  F     YWR +RK+  +ELLSS R+E LK+
Sbjct  89    ECLTTSDKVFATRPKTVAGHILCYDSSLLGFVPYGHYWRQIRKIATLELLSSYRLESLKY  148

Query  1247  VWVSELQANINEFYTTIAMDNDKNNNNPSAPK-VNMSRWFGHLTLNLIMQIVAGRRYEYR  1071
             V  SE++  + E Y       DK      AP  V+M +W  ++TLN+I+++V G+R    
Sbjct  149   VRESEVRTCLKELYNLWDAGLDK------APVLVDMKKWCEYVTLNVILRMVVGKRCNIS  202

Query  1070  SDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAI  891
                  +   Q  K   S+     G+ V  DA   L F RWLD  G  + MK+ A+++D I
Sbjct  203   ISQKGTSSDQGWKDELSRFFEFMGKLVVSDA---LPFLRWLDIGGDERLMKKTARELDLI  259

Query  890   LQDWVDARRKERRSNE------DQKFIDVMLSMIDDQFTQGY-SYSRDTVIKAIVLSMLQ  732
             +Q W+D  R++  S +      ++ F+  MLS++DD   Q +     DT+ KA  L+++ 
Sbjct  260   MQRWLDEHRRKGDSGDYQIKGREENFMGAMLSILDDIGAQEFPGRDADTINKATCLALIL  319

Query  731   DASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETL  552
               S+T +  LTW +++LL +  +LK+ Q+E+D  +GKER  ++SD +NL YLQ ++KETL
Sbjct  320   GGSDTTSGTLTWAISLLLNNRHALKKAQEELDQQVGKERAVDESDTENLVYLQAIIKETL  379

Query  551   RMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFMTNL  372
             R+YP GP LAP EA+EDC V GYH+P GT+L +N W++ RDP +W +P  F PERF+   
Sbjct  380   RLYPAGPLLAPREAMEDCTVSGYHVPAGTRLMINAWKIQRDPSVWENPSAFQPERFLPGH  439

Query  371   EGEA---AQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMME  201
                A    + +Q++ +PFG GRRSCPG   A Q+  + +ARL   F  +T  ++P+DM E
Sbjct  440   GAHADVDVRGQQFELIPFGSGRRSCPGASSALQVLHLTLARLLHSFELATPLDQPVDMSE  499

Query  200   DVGIILPKLTPLEVLVTPRLSPT  132
               G+ +PK TPL+VL++PRL P 
Sbjct  500   SPGLTIPKATPLKVLLSPRLLPA  522



>ref|XP_006471151.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=558

 Score =   427 bits (1099),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 221/518 (43%), Positives = 317/518 (61%), Gaps = 21/518 (4%)
 Frame = -1

Query  1637  LLWFSWRKQS---KRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGI  1467
             LLW S R ++   K+  PE GGAWP+IGHLH      P   TL   A+K GP+F I+LG+
Sbjct  47    LLWLSRRHRNSIDKKPVPEPGGAWPLIGHLHLLGGQKPAYVTLGNIAEKCGPIFMIKLGM  106

Query  1466  SRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVV  1287
              R L+VSNWE  ++CFTTNDK  + R    A + LGY+YA+F FS    YWR +RK+  +
Sbjct  107   HRALIVSNWEIAKECFTTNDKVFSNRIKALAPEILGYNYAMFGFSPYGPYWRQIRKIATL  166

Query  1286  ELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLI  1107
             E+LS+ R+E LKHV  SE++ ++ E Y        K+++      V M   F  +TLN+ 
Sbjct  167   EVLSNHRLEMLKHVRESEVRTSMKELYDEWM----KHSDGSGKALVEMKERFNAVTLNVA  222

Query  1106  MQIVAGRRYEYRSDGV-----VSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDY  942
              ++V G+R      G      + EE  R +K   +   L G F   DA+    F RWLD 
Sbjct  223   TRMVVGKRLFVGGTGKTNHQEIDEENDRCRKAIRKFSELTGGFAIADAV---PFLRWLDL  279

Query  941   EGHVKSMKRAAKDVDAILQDWVDARRKERRSNEDQ------KFIDVMLSMIDDQFTQGYS  780
             +G  KSM R AK++D IL+ W+   +++R S++DQ       F+DVM+S++ +   +  S
Sbjct  280   DGCEKSMGRTAKELDQILEGWLKDHKQKRISSDDQVIKDENDFMDVMISVLTEADEEIPS  339

Query  779   YSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDS  600
             +  DT+ KA  L+++   ++T    LTW L ++L H + LK+VQDE+DT+IG+ER   +S
Sbjct  340   FDADTITKATCLALILGGTDTTMVTLTWALTLVLNHGDVLKKVQDELDTHIGRERQVNES  399

Query  599   DVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKI  420
             D K L YLQ VVKETLR+YP  P   PHE++EDC + GYH+P GT+L+VN+ ++ RDP +
Sbjct  400   DTKKLVYLQAVVKETLRLYPATPLSVPHESIEDCTIAGYHVPAGTRLFVNIPKIQRDPNV  459

Query  419   WPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFN  240
             W  P +F PERF+T  +    + + ++ +PFG GRR CPG  +A Q+  + +A L  GF 
Sbjct  460   WEKPNEFRPERFLTTHKDIDVRGQNFELIPFGSGRRGCPGISFALQVLLLTLASLLHGFE  519

Query  239   FSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             F+T  +EPLDM E VG+   K TPL+VL+TPRL   LF
Sbjct  520   FATPGDEPLDMSEGVGLTNLKATPLQVLLTPRLHAPLF  557



>ref|XP_007226343.1| hypothetical protein PRUPE_ppa022174mg [Prunus persica]
 gb|EMJ27542.1| hypothetical protein PRUPE_ppa022174mg [Prunus persica]
Length=522

 Score =   426 bits (1095),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 225/527 (43%), Positives = 327/527 (62%), Gaps = 18/527 (3%)
 Frame = -1

Query  1682  VPCCLSSILGIAALVLLWFSWRKQSK--------RLPPEAGGAWPIIGHLHHFRTSVPLV  1527
             +PC  ++I GI A++L  +   K+S         +LP  AGG WP++GH   FR S    
Sbjct  5     LPCLNTAIAGILAILLFSYFIIKRSSSAAKAKGPKLPKVAGG-WPLLGHFGLFRGSQLPH  63

Query  1526  KTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYA  1347
               L+   DKYGP FTI +GI   LV+S WE  +DCFTTND  +++RP T   K+LGY++A
Sbjct  64    IALASLVDKYGPAFTINIGIHSALVISTWEAAKDCFTTNDIVVSSRPATLGAKHLGYNFA  123

Query  1346  VFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNN  1167
             +F F     YWR +RKL  +ELLS+RR+E LK V VSE++ ++ E YT       K   +
Sbjct  124   MFGFGPYGPYWREMRKLTSLELLSNRRLELLKKVRVSEVEMSLKELYTLWI----KRKES  179

Query  1166  PSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVS  987
                  V M +WFG LTLN+I ++VAG+R     +    +EA+R +K   +  +L G FV 
Sbjct  180   SGERLVEMKQWFGDLTLNVIFRMVAGKRCFMNGNLSEEKEARRWQKAMREFFHLVGLFVL  239

Query  986   GDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNEDQKFIDVMLSMI  807
             GDA+ P  +  WLD  G  K+MK+ AK++D+I+ +W++  +++R   +DQ F+DVMLS I
Sbjct  240   GDAV-P--WLSWLDLGGQQKAMKKTAKELDSIVAEWLEEHKQKRTKGKDQDFMDVMLSAI  296

Query  806   DDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNI  627
             D +   G+    DTVIKA  LS++   S+T    LTW L++LL + + LK+V +E+D  +
Sbjct  297   DGRDVAGFD--ADTVIKATCLSLIAGGSDTTMVTLTWTLSLLLNNRQVLKKVYEELDQYV  354

Query  626   GKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNV  447
             GK R  ++SD+ NL YLQ  VKE +R+ P GP     E  EDC V GYH+PKGT L VN+
Sbjct  355   GKGRLLDESDINNLVYLQATVKEVMRLCPAGPLSGQREFTEDCTVGGYHVPKGTWLLVNL  414

Query  446   WRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVA  267
             W++  DP++W DP +F P+RF+T  +    + +Q++ +PFG GRR+CPG  +  Q+T + 
Sbjct  415   WKIQTDPRVWADPMEFKPDRFLTTHKDVDVRGQQFELMPFGSGRRACPGISFGLQMTLLT  474

Query  266   VARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             +A     F+ +T  N P+DM   +G+   KLTPL+VLV PRLSP L+
Sbjct  475   LASFLHSFDVTTQENAPVDMTGSIGLTNIKLTPLDVLVKPRLSPNLY  521



>ref|XP_010106079.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07349.1| Cytochrome P450 82A3 [Morus notabilis]
Length=528

 Score =   426 bits (1096),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 227/519 (44%), Positives = 331/519 (64%), Gaps = 11/519 (2%)
 Frame = -1

Query  1682  VPCCLSSILGIAALVLLWFSWRKQ-SKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWA  1506
             VP     ++G+  L L    W+++ S+R PPEAGGAWPIIGHLH      P   TL+  A
Sbjct  10    VPATAPILVGL--LFLFHLLWKQRFSRRTPPEAGGAWPIIGHLHLLAGPQPPHITLAHMA  67

Query  1505  DKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTN  1326
             DKYGP+FTI++G+ R LVVS+WE  ++C TTNDK  A RP   A +++ Y+YA+F FS  
Sbjct  68    DKYGPIFTIKMGVHRALVVSSWEMAKECLTTNDKIFANRPKAAAPEHMTYNYAMFGFSPY  127

Query  1325  NSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVN  1146
               YWR VRK+  +ELLS+ R+E L HV VSE+   I E Y  + + N+ + NN +   V 
Sbjct  128   GPYWRQVRKIATLELLSNHRLEMLSHVRVSEVNTAIKEKYE-LWVKNNNSGNNNNGVGVE  186

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPL  966
             M +WFG +TLN+I ++V G+RY   +         R +K       L G FV  DA   L
Sbjct  187   MKKWFGDITLNVIFRMVVGKRYLEATSLSEIGSDDRCRKALRDFFELTGTFVVSDA---L  243

Query  965   WFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDD-Q  798
              + +WLD+ G+ KSMK+ +K++D + Q W++  +++R S E   DQ F+DVMLS++D  +
Sbjct  244   PYLKWLDFGGYEKSMKKTSKELDQLAQRWLEEHKRKRVSGEVNGDQDFMDVMLSILDGAE  303

Query  797   FTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKE  618
                  +Y  DT+ KA  L+++   ++T    +TW LA+LL + E+LK+ + E+D  +GKE
Sbjct  304   LGISSTYDADTINKATSLALILAGTDTTTVTMTWALALLLNNREALKKAEQELDLYVGKE  363

Query  617   RWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRL  438
             R  ++SD+KNL YLQ ++KET+R+YP GP   PHE+ EDC V GYH+P GT+L +N+ +L
Sbjct  364   RQVKESDLKNLVYLQAILKETMRLYPAGPLSLPHESTEDCTVGGYHVPAGTRLLLNLSKL  423

Query  437   HRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVAR  258
             H DPK+W  P +F PERF+T  +    + + ++ +PF  GRR CPG  +A Q+ Q+ +A 
Sbjct  424   HLDPKVWDQPSEFRPERFLTAHKNVDVRGQNFELIPFSSGRRMCPGVSFALQVMQLTLAA  483

Query  257   LFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRL  141
             L  GF  +T  +EP+DM E VG+   K TPL+V++TPRL
Sbjct  484   LLHGFKIATRSDEPVDMRETVGLTNLKATPLDVIITPRL  522



>gb|KDP38422.1| hypothetical protein JCGZ_04347 [Jatropha curcas]
Length=523

 Score =   426 bits (1095),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 226/528 (43%), Positives = 330/528 (63%), Gaps = 26/528 (5%)
 Frame = -1

Query  1670  LSSILGIAALVLL---WFSWRKQSK----RLPPEAGGAWPIIGHLHHFRTSVPLV-KTLS  1515
             LS+I+   + + L   +F   K SK    R  PE  G  P+IGHLH    +  L+ +TL 
Sbjct  7     LSAIVIFFSFIFLCNVYFRGTKSSKGSKGREAPEPAGGLPVIGHLHLLGGADKLLHQTLG  66

Query  1514  EWADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTF  1335
                DKYGPVF IR+G  R LVV++ E  ++CFT NDK +A+RPTT A K++ Y++AVF F
Sbjct  67    TMVDKYGPVFNIRIGSRRALVVASVESAKECFTLNDKILASRPTTAATKHMCYNHAVFGF  126

Query  1334  STNNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAP  1155
             +  + +WR +RK+V++ELLS+R +E +K V  +EL   I + Y   A    KN+  P   
Sbjct  127   APFSPHWREMRKIVMLELLSNRSLEMIKQVQHTELDLGIRKLYGLWA----KNSCLPLLF  182

Query  1154  KVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAI  975
             ++N  RWF  LTLN+I+++VAG++Y   S+    +E++R +K  S+  +L G FV+ DA+
Sbjct  183   ELN--RWFDDLTLNVIVRVVAGKQYAGSSN---DDESKRCRKAISEFYHLMGIFVASDAL  237

Query  974   FPLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRS-----NEDQKFIDVMLSM  810
               LW   WLD +GHVK+MK+ A+D+D IL  W++  R+ R S       ++ FID+MLS+
Sbjct  238   PFLW---WLDLKGHVKAMKKTAEDLDVILSGWLNKHRQRRISVPGEVKSEKDFIDMMLSL  294

Query  809   IDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTN  630
              +     G+ Y  DT IK+  L+++  A +T  T LTW +++LL +  SLK+ Q+E+D +
Sbjct  295   EEKGRMSGFQYDADTSIKSTCLALIAGAGDTITTTLTWAMSLLLNNQPSLKKAQEELDLH  354

Query  629   IGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVN  450
             +G ER   +SD+KNL YLQ +VKETLR+YP  P L P E +EDC + GY +P GT+L VN
Sbjct  355   VGIERQVVESDIKNLVYLQAIVKETLRLYPVAP-LIPREFMEDCSIAGYRVPAGTRLLVN  413

Query  449   VWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQV  270
             V ++ RDPK W +P  F PERF+ N      +   ++ +PFG GRRSCPG  +A     +
Sbjct  414   VGKIQRDPKFWTNPLAFQPERFLENHTNIDVRGHHFELIPFGSGRRSCPGASFALHTLHL  473

Query  269   AVARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
              +ARL   F+  T  ++P+DM E  G   PK TPLEVL++PRL   L+
Sbjct  474   TLARLLHMFDLRTSMDKPVDMTETPGTHTPKATPLEVLLSPRLPEKLY  521



>ref|XP_006471495.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=525

 Score =   426 bits (1095),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 213/508 (42%), Positives = 320/508 (63%), Gaps = 21/508 (4%)
 Frame = -1

Query  1634  LWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRIL  1455
             L   +  + KR  PEAGG+WP+IGHLH      P  + L + AD+YGP+F I++GI+R L
Sbjct  33    LLSKYTSKKKREAPEAGGSWPVIGHLHLLGGPEPPHRVLGKMADEYGPIFKIKMGINRAL  92

Query  1454  VVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLS  1275
             VVSNWE  ++C TT+DK  A+RP T A + LGY++++F FS   SYWR  RK+  +ELLS
Sbjct  93    VVSNWEMAKECLTTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLS  152

Query  1274  SRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIV  1095
             + R+ KL+HV   EL+ ++ + Y       DKN +      V M RWF     N++++++
Sbjct  153   NHRLGKLRHVREYELKTSLKDLYELW----DKNKSTNKMLLVEMKRWFTDTIRNVVLRMI  208

Query  1094  AGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKR  915
              G+      D V  EE   L   FS++    G+FV  DA   L F RWLD  G  +SMK+
Sbjct  209   VGKG----CDSVDGEEWIELLTRFSEMS---GKFVVSDA---LPFLRWLDIGGDERSMKK  258

Query  914   AAKDVDAILQDWVDARRKERRSNE----DQKFIDVMLSMIDDQFTQGYS-YSRDTVIKAI  750
              AK++D ++Q W++  +++R S E    D  F+ VMLS++ D  T+ YS    DT+ KA 
Sbjct  259   IAKELDIVVQGWLEEHKRKRDSQEIKEEDLDFMSVMLSILGD--TKQYSGRDVDTINKAT  316

Query  749   VLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQG  570
              L ++  A++     LTW++++LL H + L + Q+E+D  +G +R   +SD+KNL YLQ 
Sbjct  317   CLGLVLAATDNTKMTLTWVISLLLNHRDILNKAQNELDILVGTKRQVNESDIKNLVYLQA  376

Query  569   VVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPE  390
             ++KE +R+YP  P L PH+++E+C + GY++P  TQL +NVW+L RDP +W +P KF PE
Sbjct  377   ILKEAMRLYPGSPLLIPHKSIEECTISGYNVPTSTQLIINVWKLQRDPHVWEEPCKFQPE  436

Query  389   RFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLD  210
             RF+T  +    + + ++ +PFG GRR+CPG  +A Q+ +  +A L  GF+F+T  NEPLD
Sbjct  437   RFLTRHKDIDVRGQNFELLPFGSGRRTCPGVSFALQVMEFTLASLLHGFDFATPSNEPLD  496

Query  209   MMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             M E +G+ + K  PLEVL+ PRLS +L+
Sbjct  497   MGEGLGLSIQKARPLEVLIAPRLSASLY  524



>ref|XP_010547840.1| PREDICTED: cytochrome P450 82C4-like [Tarenaya hassleriana]
Length=527

 Score =   426 bits (1095),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 221/526 (42%), Positives = 320/526 (61%), Gaps = 16/526 (3%)
 Frame = -1

Query  1682  VPCCLSSILGIAALVLLWFSWRKQSKRLPPEAGGAWPIIGHLHHFRTSVPLV-KTLSEWA  1506
             +P  ++ +   +   +L+   +K   R  PE  G+WPIIGHLH       L+ +TL   A
Sbjct  9     LPILVAFLFISSVSAILFKKTKKPENRKAPEPAGSWPIIGHLHLLGGKNNLLYRTLGALA  68

Query  1505  DKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTN  1326
             D YGP F +RLG  + LVVS+WE  ++C T NDK  A+RP T   K +GY+YA+F F+  
Sbjct  69    DDYGPAFGLRLGSRKALVVSSWEVAKECLTANDKTFASRPNTVGAKLMGYNYALFGFAPY  128

Query  1325  NSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVN  1146
             +SY+R +RK+V  ELLS+RR++ L+HV +SE++  I + Y+   + + K  + P    V+
Sbjct  129   DSYFREMRKIVTFELLSNRRIQMLRHVRISEIEMGIKDIYS---LWSKKGGSGPVL--VD  183

Query  1145  MSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSE--EAQRLKKVFSQVMYLWGEFVSGDAIF  972
             + +W   L LN+I+++VAG+RY +  D    E  EA+R  K  ++   L G FV  DA F
Sbjct  184   VKQWLEDLNLNMIVKLVAGKRYSF-GDATADEADEARRCPKATARFFQLMGLFVIADA-F  241

Query  971   PLWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE---DQKFIDVMLSMIDD  801
             P  F    D +G+ K MK+ A ++D IL+ W+    + R S E   D  FIDVMLS+ D 
Sbjct  242   P--FLGRFDLQGYEKEMKKTAAEIDGILEGWLQEHERRRASGESEGDSDFIDVMLSLADQ  299

Query  800   QFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGK  621
                    +   T IK+  L+M+   S+T    L W  A+L  + E LK+ Q+EID ++GK
Sbjct  300   GKLSDLKHDERTCIKSTCLAMILGGSDTLVGTLIWAFALLANNREILKKAQEEIDFHVGK  359

Query  620   ERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWR  441
             +R   DSD++NL YLQ + KETLRMYP  P L P EA EDC V GYH+  GT+L VNVW+
Sbjct  360   DRKVVDSDIENLVYLQAITKETLRMYPAAPLLGPREATEDCTVAGYHVTAGTRLMVNVWK  419

Query  440   LHRDPKIWPDPEKFLPERFMTNLEGE-AAQNRQYQFVPFGLGRRSCPGNLYATQITQVAV  264
             +HRDP+ WP+PE+F PERF+T    E + + + ++ +PFG GRRSCPG   A Q+  + +
Sbjct  420   IHRDPRFWPNPEEFRPERFLTGPASEYSVRGQSFELLPFGSGRRSCPGISLALQMLHLLL  479

Query  263   ARLFQGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             AR+   F+ +TV    +DM E  G+ +PK  PLEVL++PRL   L+
Sbjct  480   ARVLHSFDLTTVSGLDVDMGESPGLTIPKTKPLEVLLSPRLKKELY  525



>ref|XP_009365841.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=537

 Score =   426 bits (1095),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 217/511 (42%), Positives = 312/511 (61%), Gaps = 22/511 (4%)
 Frame = -1

Query  1607  KRLPPEAGGAWPIIGHLHHF-RTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGV  1431
             K  PPEA G+WP+IGH+    R   P    L   ADKYGP+FTI LG  + L+VS+WE  
Sbjct  33    KSGPPEAPGSWPVIGHIPVIGRGPQPPHVILGNMADKYGPIFTINLGQHKALIVSSWEMA  92

Query  1430  RDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLK  1251
             + CFTTNDK  A RP   AGK LGY+Y++F FS    YWR+VRK+  VELLS+ R+E L+
Sbjct  93    KQCFTTNDKVFATRPKHLAGKLLGYNYSMFGFSPYGPYWRHVRKIATVELLSNHRLELLR  152

Query  1250  HVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYR  1071
             HV  SE+ A   + Y       ++N        V M+RWF  +TLN++ ++V G+R+   
Sbjct  153   HVRESEVNACTKDLYDKW----ERNGGESDWVLVEMNRWFADVTLNIMYRVVVGKRFLGA  208

Query  1070  SDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLDYEGHVKSMKRAAKDVDAI  891
             +     EE +R +K     + L  EFV  D I    F +WLD+ G  K+MK  AKD+D  
Sbjct  209   ATVEEKEENERCRKALRDFLRLSSEFVVSDKIP---FLKWLDFGGIGKAMKATAKDLDVA  265

Query  890   LQDWVDARRKERRS---------NEDQKFIDVMLSMIDDQFTQGYSYSR--DTVIKAIVL  744
             LQ W++  +++R S          +++ F+D MLS++ D   +G+  +   DT IKA  L
Sbjct  266   LQGWLEEHKQKRNSRSELNSGNVKDERDFMDTMLSVLGDVSAEGFPSTTIADTTIKATCL  325

Query  743   SMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVV  564
             + +   ++     LTW+L++LL + E+LK+ Q+E+D  +G+ER  ++SDVKNL YLQ +V
Sbjct  326   AAILGGTDPTTAVLTWVLSLLLNNREALKKAQEELDNQVGRERQVKESDVKNLVYLQAIV  385

Query  563   KETLRMYPQGPYLAPHEAVEDCIVDG---YHIPKGTQLYVNVWRLHRDPKIWPDPEKFLP  393
             KETLR+YP  P   PHE +EDC V     YH+  GT+L VN+W++HR+P +W DP +F P
Sbjct  386   KETLRLYPPSPLSIPHECIEDCNVGNGTNYHVKTGTRLLVNIWKIHRNPNVWLDPFRFQP  445

Query  392   ERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPL  213
             ERF+T  +    + + ++F+PFG GRR CPG     Q+ Q+ +A+L  GF  +T  +EP+
Sbjct  446   ERFLTTHKDFDVRGQNFEFIPFGSGRRMCPGVSLGLQVVQLTLAQLLHGFEIATPSDEPV  505

Query  212   DMMEDVGIILPKLTPLEVLVTPRLSPTLFRL  120
             DM E  G+   K TPLEVL+TPRL   L+ +
Sbjct  506   DMTESTGVTNMKATPLEVLLTPRLPAKLYEI  536



>ref|XP_009801068.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana sylvestris]
Length=468

 Score =   424 bits (1089),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 209/470 (44%), Positives = 305/470 (65%), Gaps = 14/470 (3%)
 Frame = -1

Query  1508  ADKYGPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFST  1329
             AD YGP F +RLG     VVS+WE  ++CFT NDK +A+RPTT A K++GY YAVF F+ 
Sbjct  2     ADNYGPAFNLRLGSRGAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFAP  61

Query  1328  NNSYWRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKV  1149
              +++WR +RK+ + ELLS+RR++ LKHV VSE++  I E Y     +N  ++  P    V
Sbjct  62    YSTFWREMRKIAMYELLSNRRLDTLKHVQVSEVEMGIQELYKLWVNNNSGHSCRPVL--V  119

Query  1148  NMSRWFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFP  969
              +  WF  LTLN+I+++VAG+RY         +EA+R +K  +Q  +L G FV  DA FP
Sbjct  120   ELKGWFEDLTLNVIVRMVAGKRYFGAGATCDDDEARRCQKAINQFFHLIGIFVPSDA-FP  178

Query  968   LWFFRWLDYEGHVKSMKRAAKDVDAILQDWVDA---RRKERRSNED-----QKFIDVMLS  813
             +    W D +GH K+MKR AK++D+IL+ W+     R K R S+E      Q FIDVMLS
Sbjct  179   I--LGWFDIQGHEKAMKRTAKELDSILEGWLQEHRHREKTRFSHEAKNEGAQDFIDVMLS  236

Query  812   MIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDT  633
             +  +     + Y  DT IK+  L+++   S+T A  LTW +++LL +P+ L++ Q EID 
Sbjct  237   LQQEGRLSNFQYDADTSIKSTCLALILGGSDTTAGTLTWAISLLLNNPQILRKAQKEIDL  296

Query  632   NIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYV  453
             ++GK+R  ++SD++NL Y+Q ++KETLR+YP GP L P EA+++C V GY I  GT+L V
Sbjct  297   HVGKDRQVDESDIQNLAYIQAIIKETLRLYPAGPLLGPREAMDECEVGGYKIIPGTRLIV  356

Query  452   NVWRLHRDPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQ  273
             NVW++ RDP+IW DP+ F P+RF  +      + + ++ +PFG GRRSCPG   A Q+  
Sbjct  357   NVWKIQRDPRIWEDPDSFKPDRFFMSNSNVDVKGQDFELIPFGSGRRSCPGASLALQVLH  416

Query  272   VAVARLFQGFNFST-VPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLF  126
             + +AR  Q F FS  V ++ +D+ E  G+ +PK TPL+VL+TPRLS  L+
Sbjct  417   LTLARFLQAFEFSKPVDDQLIDLTESPGLTIPKATPLDVLITPRLSANLY  466



>ref|XP_008382594.1| PREDICTED: cytochrome P450 82G1-like [Malus domestica]
Length=540

 Score =   426 bits (1094),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 205/497 (41%), Positives = 319/497 (64%), Gaps = 11/497 (2%)
 Frame = -1

Query  1595  PEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKYGPVFTIRLGISRILVVSNWEGVRDCFT  1416
             P+  GAWP+IGHL   R+ +P+   L   AD++GP+++++LG   +LV+S WE V++ FT
Sbjct  47    PQPSGAWPLIGHLPLLRSEIPVALILGAMADQHGPIYSLKLGQHELLVLSAWEQVQELFT  106

Query  1415  TNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSYWRNVRKLVVVELLSSRRMEKLKHVWVS  1236
               D+  A RPTT  GKYLGYD A F  S    YWR VRKL  +ELLSS+R++ L HV  S
Sbjct  107   KKDRVFATRPTTAGGKYLGYDNATFALSPYGDYWREVRKLTTMELLSSKRVKTLSHVRAS  166

Query  1235  ELQANINEFYTTIAMDNDKNNNNPSAPKVNMSRWFGHLTLNLIMQIVAGRRYEYRSDGVV  1056
             E+ + I   ++ +   ++ + ++ S+  V+MS    HLT N+ ++++AG+R+        
Sbjct  167   EVDSFIKNLHSLVCTKDNVDPSSTSSSPVHMSELLEHLTFNINVKLIAGKRFTVGQYNEK  226

Query  1055  SEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFFRWLD-YEGHVKSMKRAAKDVDAILQDW  879
             + E  R +K   + ++L+G FV  DA+ P   F WLD + GHV SMK+  K++D +L  W
Sbjct  227   NGEVWRFEKAVKEALHLFGVFVWSDAM-PC--FEWLDGWFGHVSSMKKCFKELDYVLGKW  283

Query  878   VDARRKERRSNEDQK----FIDVMLSMIDDQFTQGYSYSRDTVIKAIVLSMLQDASETFA  711
             ++  R+ R  +++ K     +DVM+S  ++   + Y ++RDTVIKA  L ++   +E+ +
Sbjct  284   LEEHRQRRLESKNNKVESDLMDVMISNFEED--EIYGHNRDTVIKATALVLMATGTESTS  341

Query  710   THLTWILAVLLKHPESLKRVQDEIDTNIGKERWAEDSDVKNLPYLQGVVKETLRMYPQGP  531
               LTW +++LL + + LK  Q+E+D ++GK+RW ++SD+ NL YLQ ++KETLR+YP GP
Sbjct  342   VTLTWAMSLLLNNQKVLKSAQEELDIHVGKDRWVQESDLTNLKYLQAILKETLRLYPPGP  401

Query  530   YLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHRDPKIWPDPEKFLPERFM-TNLEGEAAQ  354
                  EA+EDC + GY +PKGT+L VN+W+L RDP++W +P +F PERFM T+ + +   
Sbjct  402   ITGLREAMEDCHLGGYFVPKGTRLLVNIWKLQRDPRMWANPCEFQPERFMTTHADVDFKG  461

Query  353   NRQYQFVPFGLGRRSCPGNLYATQITQVAVARLFQGFNFSTVPNEPLDMMEDVGIILPKL  174
                ++++PF  GRRSCPG    + + Q+ +ARL QGFN S V +  +DM E +G+ LPK 
Sbjct  462   QSNFEYIPFSAGRRSCPGMTLGSHVVQLVLARLIQGFNMSRVGDGAVDMKEGLGLALPKA  521

Query  173   TPLEVLVTPRLSPTLFR  123
              PLEV + PRL   L++
Sbjct  522   NPLEVFLAPRLPLQLYQ  538



>emb|CBI32505.3| unnamed protein product [Vitis vinifera]
Length=1019

 Score =   440 bits (1131),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 226/523 (43%), Positives = 321/523 (61%), Gaps = 26/523 (5%)
 Frame = -1

Query  1664  SILGIA-ALVLLWFSWRKQSK---RLPPEAGGAWPIIGHLHHFRTSVPLVKTLSEWADKY  1497
             ++ GI  A++ LW    K +K   R PPE  GAWP++GHLH      PL +T    AD+Y
Sbjct  514   TVFGILFAIICLWLVNAKGNKNKGRSPPEPSGAWPVMGHLHLLGADKPLHRTFGAMADEY  573

Query  1496  GPVFTIRLGISRILVVSNWEGVRDCFTTNDKHMAARPTTCAGKYLGYDYAVFTFSTNNSY  1317
             GP+F+IRLG+   LVVS+ E  ++C+TT DK +A RP + A K +GY++A+F F  +  Y
Sbjct  574   GPIFSIRLGLRTALVVSSSEVAKECYTTKDKALANRPRSLAVKLMGYEHAMFAFERHGPY  633

Query  1316  WRNVRKLVVVELLSSRRMEKLKHVWVSELQANINEFYTTIAMDNDKNNNNPSAPKVNMSR  1137
             WR+VR+L +VELLS+R+ E LKHV  SE+   I E Y          +N  S   V+M +
Sbjct  634   WRDVRRLAMVELLSNRQHEMLKHVRDSEVTFFIQELYGQWV------DNGGSPVLVDMKK  687

Query  1136  WFGHLTLNLIMQIVAGRRYEYRSDGVVSEEAQRLKKVFSQVMYLWGEFVSGDAIFPLWFF  957
              F HL  NL+M+ VAG+R              R  +     M L G+F+  DA+ P  F 
Sbjct  688   KFEHLVANLVMRTVAGKR--------CGNGESRWCQALGDFMNLMGQFMVSDAV-P--FL  736

Query  956   RWLD-YEGHVKSMKRAAKDVDAILQDWVDARRKERRSNE----DQKFIDVMLSMIDDQFT  792
              WLD   G+   MK  A+ +D ++  WV+  R++R S      +Q FI  MLS+IDD   
Sbjct  737   GWLDTVRGYTAKMKGTARQLDQVIGRWVEEHRQKRLSGSINEAEQDFIHAMLSVIDDAQF  796

Query  791   QGYSYSRDTVIKAIVLSMLQDASETFATHLTWILAVLLKHPESLKRVQDEIDTNIGKERW  612
              G+ +  DTVIKA  L+++  +++T A  LTW L++L+ +P +LK+ Q+E+D ++G+ + 
Sbjct  797   SGHDHDHDTVIKATCLTVMLASNDTIAITLTWALSLLMNNPHALKKAQEELDFHVGRNQQ  856

Query  611   AEDSDVKNLPYLQGVVKETLRMYPQGPYLAPHEAVEDCIVDGYHIPKGTQLYVNVWRLHR  432
               +SD+K L YLQ ++KETLR+YP GP   PHEA+EDC + G+HI  GT+L VN+W+LHR
Sbjct  857   VYESDIKKLVYLQAIIKETLRLYPAGPLALPHEAMEDCTIAGFHIQAGTRLLVNLWKLHR  916

Query  431   DPKIWPDPEKFLPERFMTNLEGEAAQNRQYQFVPFGLGRRSCPGNLYATQITQVAVARLF  252
             DP IW DP +F PERF+T   G   + + ++ +PFG GRR CPG  +A +I Q+ +ARL 
Sbjct  917   DPTIWSDPLEFQPERFLTKHVGLDVRGQHFELLPFGSGRRMCPGISFALEILQLTLARLL  976

Query  251   QGFNFSTVPNEPLDMMEDVGIILPKLTPLEVLVTPRLSPTLFR  123
              GF    V + PLDM E VG+ LPK TPLEV + PRL   L+ 
Sbjct  977   HGFELGVVADSPLDMTEGVGLALPKATPLEVTLVPRLPSELYH  1019



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5012438777632