BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23943_g2_i1 len=382 path=[13219:0-1 9709:2-30 1500:31-190
1819:191-381]

Length=382
                                                                      Score     E

ref|XP_002306120.1|  SEC14 cytosolic factor family protein            72.4    5e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011037485.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  72.4    5e-12   
ref|XP_011037488.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  72.4    6e-12   
ref|XP_006384514.1|  hypothetical protein POPTR_0004s16510g           72.0    6e-12   
ref|XP_007042119.1|  Sec14p-like phosphatidylinositol transfer fa...  71.6    9e-12   
ref|XP_007042117.1|  Sec14p-like phosphatidylinositol transfer fa...  70.9    2e-11   
ref|XP_002283681.2|  PREDICTED: phosphatidylinositol/phosphatidyl...  70.9    2e-11   Vitis vinifera
ref|XP_010645229.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  70.9    2e-11   
ref|XP_010690840.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  70.5    2e-11   
ref|XP_008359764.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  70.5    2e-11   
gb|KDO47891.1|  hypothetical protein CISIN_1g006449mg                 70.5    2e-11   
ref|XP_002512943.1|  phosphatidylinositol transporter, putative       70.5    2e-11   Ricinus communis
gb|KDP41761.1|  hypothetical protein JCGZ_26779                       70.5    2e-11   
gb|KDO47892.1|  hypothetical protein CISIN_1g006449mg                 70.5    2e-11   
ref|XP_007042120.1|  Sec14p-like phosphatidylinositol transfer fa...  70.1    2e-11   
gb|KDO47887.1|  hypothetical protein CISIN_1g006449mg                 70.5    2e-11   
gb|KDO47885.1|  hypothetical protein CISIN_1g006449mg                 70.5    2e-11   
ref|XP_006423354.1|  hypothetical protein CICLE_v10028023mg           70.5    2e-11   
ref|XP_006423355.1|  hypothetical protein CICLE_v10028023mg           70.5    2e-11   
ref|XP_006487243.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  70.5    2e-11   
gb|KDO47890.1|  hypothetical protein CISIN_1g006449mg                 70.5    2e-11   
gb|KHN20956.1|  Sec14 cytosolic factor                                70.5    2e-11   
gb|KDO47894.1|  hypothetical protein CISIN_1g006449mg                 70.1    2e-11   
gb|KDO47893.1|  hypothetical protein CISIN_1g006449mg                 70.1    2e-11   
ref|XP_006595925.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  70.5    2e-11   
ref|XP_006423356.1|  hypothetical protein CICLE_v10028023mg           70.1    2e-11   
ref|XP_003550393.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  70.5    2e-11   
ref|XP_006601320.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  70.5    2e-11   
gb|KHN12687.1|  SEC14 cytosolic factor                                70.5    2e-11   
ref|XP_003544359.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  70.5    2e-11   
gb|KDO47895.1|  hypothetical protein CISIN_1g006449mg                 70.1    3e-11   
ref|XP_010263587.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  69.7    5e-11   
ref|XP_010263585.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  69.7    5e-11   
ref|XP_010263586.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  69.7    5e-11   
ref|XP_010263584.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  69.7    5e-11   
ref|XP_004169138.1|  PREDICTED: uncharacterized LOC101208172          69.3    5e-11   
ref|XP_004148831.1|  PREDICTED: uncharacterized protein LOC101208172  69.3    5e-11   
ref|XP_007160727.1|  hypothetical protein PHAVU_001G012100g           69.3    5e-11   
ref|XP_008460966.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  69.3    5e-11   
emb|CDP20068.1|  unnamed protein product                              68.9    7e-11   
ref|XP_011088432.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.9    8e-11   
ref|XP_008236930.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.6    1e-10   
ref|XP_008349908.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.6    1e-10   
ref|XP_008349909.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.6    1e-10   
ref|XP_007199757.1|  hypothetical protein PRUPE_ppa002840mg           68.6    1e-10   
ref|XP_008236932.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.6    1e-10   
ref|XP_009378656.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.6    1e-10   
ref|XP_007199758.1|  hypothetical protein PRUPE_ppa002840mg           68.6    1e-10   
ref|XP_009378657.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.6    1e-10   
ref|XP_008347363.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.6    1e-10   
ref|XP_009378655.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.6    1e-10   
ref|XP_009378654.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.6    1e-10   
ref|XP_008377272.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.2    1e-10   
ref|XP_008377271.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.2    1e-10   
ref|XP_008377274.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.2    1e-10   
ref|XP_008377273.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.2    1e-10   
ref|XP_007135955.1|  hypothetical protein PHAVU_009G006000g           68.2    1e-10   
ref|XP_009365514.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.2    1e-10   
ref|XP_003603969.1|  Sec14 cytosolic factor                           67.8    1e-10   
ref|XP_007135956.1|  hypothetical protein PHAVU_009G006000g           68.2    1e-10   
ref|XP_009353403.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.2    1e-10   
ref|XP_004289639.1|  PREDICTED: uncharacterized protein LOC101312875  68.2    1e-10   
ref|XP_010254739.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.2    1e-10   
ref|XP_010254745.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.2    1e-10   
ref|XP_009335946.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.2    1e-10   
ref|XP_003603968.1|  Sec14 cytosolic factor                           68.2    1e-10   
ref|XP_004500794.1|  PREDICTED: uncharacterized protein LOC101488984  68.2    1e-10   
ref|XP_003603967.1|  Sec14 cytosolic factor                           68.2    1e-10   
dbj|BAF98225.1|  CM0216.430.nc                                        67.8    2e-10   Lotus japonicus
gb|KHG00771.1|  Sec14 cytosolic factor                                67.8    2e-10   
ref|XP_011092815.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  67.4    2e-10   
ref|XP_006847542.1|  hypothetical protein AMTR_s00014p00131390        67.4    2e-10   
ref|XP_011092814.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  67.4    2e-10   
gb|KEH40183.1|  Sec14p-like phosphatidylinositol transfer family ...  67.4    3e-10   
gb|KHN20049.1|  Sec14 cytosolic factor                                67.4    3e-10   
ref|XP_010940114.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  67.4    3e-10   
gb|KEH40180.1|  Sec14p-like phosphatidylinositol transfer family ...  67.4    3e-10   
ref|XP_008795965.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...  67.0    3e-10   
ref|XP_010940115.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  67.0    3e-10   
ref|XP_007131801.1|  hypothetical protein PHAVU_011G042800g           67.0    3e-10   
gb|KEH40182.1|  Sec14p-like phosphatidylinositol transfer family ...  67.0    3e-10   
ref|XP_003537860.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  67.0    3e-10   
ref|XP_008784937.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  67.0    3e-10   
ref|XP_003522898.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  67.0    3e-10   
gb|KHN25399.1|  Sec14 cytosolic factor                                67.0    3e-10   
ref|XP_003541004.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  67.0    4e-10   
ref|XP_007222014.1|  hypothetical protein PRUPE_ppa002936mg           66.6    4e-10   
ref|XP_008220844.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  66.6    5e-10   
ref|XP_004291849.1|  PREDICTED: uncharacterized protein LOC101290835  66.6    5e-10   
ref|XP_010531442.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  66.2    6e-10   
ref|XP_002510428.1|  phosphatidylinositol transporter, putative       66.2    6e-10   Ricinus communis
ref|XP_011047984.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  66.2    6e-10   
ref|XP_011047991.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  65.9    7e-10   
ref|XP_010936679.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  65.9    8e-10   
ref|XP_004499192.1|  PREDICTED: uncharacterized protein LOC101495...  65.9    8e-10   
ref|XP_010936680.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  65.9    8e-10   
ref|XP_004499191.1|  PREDICTED: uncharacterized protein LOC101495...  65.9    8e-10   
ref|XP_009404707.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  65.9    9e-10   
emb|CDX82040.1|  BnaC08g35610D                                        65.5    1e-09   
ref|XP_009117393.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  65.1    2e-09   
emb|CDY13810.1|  BnaA09g43120D                                        65.1    2e-09   
gb|EYU37817.1|  hypothetical protein MIMGU_mgv1a002892mg              65.1    2e-09   
gb|AAK63247.1|AF367433_1  phosphatidylinositol transfer-like prot...  64.7    2e-09   Lotus japonicus
ref|XP_006365129.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  64.7    2e-09   
ref|XP_009781464.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  64.7    2e-09   
ref|XP_009629969.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  64.7    2e-09   
ref|XP_004230868.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  64.7    2e-09   
ref|XP_009629974.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  64.7    2e-09   
ref|XP_003527164.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  64.3    3e-09   
ref|XP_009389342.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  64.3    3e-09   
ref|XP_010536338.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  63.9    4e-09   
ref|XP_010536337.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  63.9    4e-09   
ref|XP_008811091.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  63.9    4e-09   
ref|XP_009418458.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  63.9    4e-09   
ref|NP_179747.4|  Sec14p-like phosphatidylinositol transfer famil...  63.5    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411719.1|  hypothetical protein EUTSA_v10024693mg           63.5    5e-09   
gb|KFK32889.1|  hypothetical protein AALP_AA6G300800                  63.5    5e-09   
gb|KDO84632.1|  hypothetical protein CISIN_1g006989mg                 62.8    7e-09   
ref|XP_006473544.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  62.8    8e-09   
ref|XP_006473545.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  62.8    8e-09   
gb|KDO84631.1|  hypothetical protein CISIN_1g006989mg                 62.8    8e-09   
ref|XP_009765681.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  62.8    9e-09   
ref|XP_009600133.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  62.8    9e-09   
ref|XP_009600157.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  62.8    1e-08   
ref|XP_006365292.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  62.4    1e-08   
ref|XP_006365291.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  62.4    1e-08   
ref|XP_010327434.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  62.4    1e-08   
ref|XP_004248700.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  62.4    1e-08   
gb|ABR17997.1|  unknown                                               62.4    1e-08   Picea sitchensis
ref|XP_010922737.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  62.0    2e-08   
gb|KDP38545.1|  hypothetical protein JCGZ_04470                       62.0    2e-08   
ref|XP_010555281.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  62.0    2e-08   
ref|XP_006296430.1|  hypothetical protein CARUB_v10025610mg           61.6    2e-08   
ref|XP_010446445.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  61.6    2e-08   
ref|XP_010437026.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  61.6    2e-08   
ref|XP_010446446.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  61.2    3e-08   
ref|XP_010437027.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  61.2    3e-08   
emb|CDY29415.1|  BnaA06g13810D                                        60.8    4e-08   
ref|XP_009149448.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  60.8    4e-08   
ref|XP_006283268.1|  hypothetical protein CARUB_v10004299mg           60.8    4e-08   
ref|XP_011048799.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  60.8    4e-08   
ref|XP_002307673.2|  hypothetical protein POPTR_0005s25210g           60.8    4e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006302011.1|  hypothetical protein CARUB_v10019999mg           60.8    4e-08   
ref|XP_011048797.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  60.8    4e-08   
gb|KFK41974.1|  hypothetical protein AALP_AA2G195800                  60.5    6e-08   
ref|XP_002281429.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  60.5    6e-08   Vitis vinifera
ref|NP_177670.2|  Sec14p-like phosphatidylinositol transfer famil...  60.1    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009394504.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  60.1    7e-08   
gb|AAG13072.1|AC023754_10  Unknown protein                            60.1    8e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017606.1|  Sec14p-like phosphatidylinositol transfer fa...  60.1    8e-08   
ref|XP_004961332.1|  PREDICTED: uncharacterized protein LOC101785...  60.1    8e-08   
gb|KHG28545.1|  Bifunctional dihydrofolate reductase-thymidylate ...  60.1    8e-08   
ref|XP_004961331.1|  PREDICTED: uncharacterized protein LOC101785...  60.1    8e-08   
ref|NP_001154472.1|  Sec14p-like phosphatidylinositol transfer fa...  59.7    9e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017604.1|  Sec14p-like phosphatidylinositol transfer fa...  59.7    9e-08   
gb|KFK44097.1|  hypothetical protein AALP_AA1G215500                  59.3    1e-07   
gb|EPS69446.1|  hypothetical protein M569_05317                       59.3    1e-07   
gb|AFW78979.1|  putative CRAL/TRIO domain containing, Sec14p-like...  58.5    1e-07   
gb|EYU42601.1|  hypothetical protein MIMGU_mgv1a003028mg              58.9    2e-07   
ref|XP_006404603.1|  hypothetical protein EUTSA_v10000082mg           58.9    2e-07   
emb|CDY39363.1|  BnaC05g15240D                                        58.5    2e-07   
ref|XP_010105353.1|  Sec14 cytosolic factor                           58.5    2e-07   
ref|XP_008649950.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  58.5    2e-07   
gb|AFW78978.1|  putative CRAL/TRIO domain containing, Sec14p-like...  58.5    3e-07   
gb|AAK59767.1|  AT4g39170/T22F8_70                                    58.5    3e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AFW78976.1|  putative CRAL/TRIO domain containing, Sec14p-like...  58.2    3e-07   
emb|CAB43632.1|  SEC14-like protein                                   58.2    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001056209.1|  Os05g0545000                                     58.2    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654737.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  58.2    4e-07   
ref|NP_568054.1|  Sec14p-like phosphatidylinositol transfer famil...  58.2    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190962.1|  Sec14p-like phosphatidylinositol transfer fa...  57.8    4e-07   
ref|XP_006654736.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  57.8    4e-07   
ref|XP_006654735.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  57.8    4e-07   
ref|XP_010471643.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  57.8    4e-07   
ref|XP_010416414.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  57.4    5e-07   
ref|XP_010428555.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  57.4    5e-07   
ref|XP_010428554.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  57.4    5e-07   
ref|XP_002889021.1|  hypothetical protein ARALYDRAFT_476682           57.4    6e-07   
gb|KFK30497.1|  hypothetical protein AALP_AA7G269400                  57.0    8e-07   
ref|XP_011028880.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  57.0    9e-07   
ref|XP_011028883.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  56.2    1e-06   
ref|XP_011028884.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  56.2    1e-06   
ref|XP_006390313.1|  hypothetical protein EUTSA_v10018296mg           55.8    2e-06   
ref|XP_006390315.1|  hypothetical protein EUTSA_v10018296mg           55.8    2e-06   
ref|XP_009104709.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.8    2e-06   
emb|CDX85889.1|  BnaC06g22450D                                        55.8    2e-06   
gb|KHG12269.1|  SEC14 cytosolic factor                                55.8    2e-06   
ref|XP_009104710.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.8    2e-06   
emb|CDX68133.1|  BnaA07g21730D                                        55.8    2e-06   
ref|XP_009117392.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.5    2e-06   
ref|XP_003573093.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.5    2e-06   
gb|AFW66716.1|  putative CRAL/TRIO domain containing, Sec14p-like...  55.1    3e-06   
ref|XP_008656005.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.1    3e-06   
ref|XP_008679999.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.1    3e-06   
ref|XP_008679998.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.1    4e-06   
ref|XP_008656004.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  54.7    4e-06   
emb|CDY12125.1|  BnaC03g60410D                                        54.7    4e-06   
ref|XP_004952457.1|  PREDICTED: uncharacterized protein LOC101769...  54.7    4e-06   
ref|XP_004952458.1|  PREDICTED: uncharacterized protein LOC101769...  54.7    4e-06   
ref|XP_002866832.1|  hypothetical protein ARALYDRAFT_912374           54.7    4e-06   
ref|XP_002300755.2|  hypothetical protein POPTR_0002s03400g           54.3    6e-06   Populus trichocarpa [western balsam poplar]
ref|XP_006646841.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  54.3    7e-06   
gb|KFK32888.1|  hypothetical protein AALP_AA6G300800                  53.9    7e-06   
ref|XP_010416904.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  53.9    7e-06   
ref|NP_001118356.1|  Sec14p-like phosphatidylinositol transfer fa...  53.9    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429070.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  53.9    7e-06   
ref|XP_010472148.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  53.9    8e-06   
ref|XP_006416483.1|  hypothetical protein EUTSA_v10007470mg           53.5    1e-05   
ref|XP_004951982.1|  PREDICTED: uncharacterized protein LOC101773...  53.1    1e-05   
dbj|BAD07999.1|  putative phosphatidylinositol/ phophatidylcholin...  53.1    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009109488.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  53.1    2e-05   
ref|XP_009380384.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  53.1    2e-05   
ref|XP_009380385.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  53.1    2e-05   
emb|CDX90316.1|  BnaA08g16680D                                        53.1    2e-05   
ref|XP_004951980.1|  PREDICTED: uncharacterized protein LOC101773...  52.8    2e-05   
ref|XP_004951981.1|  PREDICTED: uncharacterized protein LOC101773...  52.4    2e-05   
ref|XP_008681487.1|  PREDICTED: uncharacterized protein LOC100273...  52.0    3e-05   
ref|XP_008681485.1|  PREDICTED: uncharacterized protein LOC100273...  52.0    3e-05   
gb|AFW70031.1|  putative CRAL/TRIO domain containing, Sec14p-like...  51.6    4e-05   
gb|KHG12222.1|  Sec14 cytosolic factor                                51.6    5e-05   
ref|XP_010060978.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  50.8    9e-05   
ref|XP_003574138.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  50.4    1e-04   
gb|KCW67883.1|  hypothetical protein EUGRSUZ_F01595                   50.1    1e-04   
dbj|BAJ87310.1|  predicted protein                                    50.1    1e-04   
ref|XP_010673081.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  49.7    2e-04   
ref|XP_003606975.1|  Sec14 cytosolic factor                           49.3    2e-04   
gb|AES89172.2|  Sec14p-like phosphatidylinositol transfer family ...  49.3    3e-04   
ref|XP_003567967.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  47.4    0.001   
ref|XP_010231072.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  47.4    0.001   



>ref|XP_002306120.1| SEC14 cytosolic factor family protein [Populus trichocarpa]
 gb|EEE86631.1| SEC14 cytosolic factor family protein [Populus trichocarpa]
Length=636

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSGNDERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  33



>ref|XP_011037485.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Populus euphratica]
 ref|XP_011037486.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Populus euphratica]
 ref|XP_011037487.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Populus euphratica]
Length=627

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSGNDERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  33



>ref|XP_011037488.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Populus euphratica]
Length=626

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSGNDERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  33



>ref|XP_006384514.1| hypothetical protein POPTR_0004s16510g [Populus trichocarpa]
 gb|ERP62311.1| hypothetical protein POPTR_0004s16510g [Populus trichocarpa]
Length=625

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSGNDERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  33



>ref|XP_007042119.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
3 [Theobroma cacao]
 gb|EOX97950.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
3 [Theobroma cacao]
Length=641

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>ref|XP_007042117.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007042118.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOX97948.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOX97949.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
Length=626

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>ref|XP_002283681.2| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X2 [Vitis vinifera]
 emb|CBI37683.3| unnamed protein product [Vitis vinifera]
Length=625

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGHDERRERKSDFENSE  33



>ref|XP_010645229.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X1 [Vitis vinifera]
Length=626

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGHDERRERKSDFENSE  33



>ref|XP_010690840.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6 [Beta vulgaris subsp. vulgaris]
Length=626

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGHDERRERKSDFENSE  33



>ref|XP_008359764.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Malus domestica]
Length=632

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGHDERRERKSDFENSE  33



>gb|KDO47891.1| hypothetical protein CISIN_1g006449mg [Citrus sinensis]
Length=605

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>ref|XP_002512943.1| phosphatidylinositol transporter, putative [Ricinus communis]
 gb|EEF49446.1| phosphatidylinositol transporter, putative [Ricinus communis]
Length=624

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>gb|KDP41761.1| hypothetical protein JCGZ_26779 [Jatropha curcas]
Length=626

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>gb|KDO47892.1| hypothetical protein CISIN_1g006449mg [Citrus sinensis]
Length=620

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>ref|XP_007042120.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
4 [Theobroma cacao]
 gb|EOX97951.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
4 [Theobroma cacao]
Length=426

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>gb|KDO47887.1| hypothetical protein CISIN_1g006449mg [Citrus sinensis]
Length=643

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>gb|KDO47885.1| hypothetical protein CISIN_1g006449mg [Citrus sinensis]
Length=644

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>ref|XP_006423354.1| hypothetical protein CICLE_v10028023mg [Citrus clementina]
 gb|ESR36594.1| hypothetical protein CICLE_v10028023mg [Citrus clementina]
 gb|KDO47888.1| hypothetical protein CISIN_1g006449mg [Citrus sinensis]
 gb|KDO47889.1| hypothetical protein CISIN_1g006449mg [Citrus sinensis]
Length=623

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>ref|XP_006423355.1| hypothetical protein CICLE_v10028023mg [Citrus clementina]
 gb|ESR36595.1| hypothetical protein CICLE_v10028023mg [Citrus clementina]
 gb|KDO47886.1| hypothetical protein CISIN_1g006449mg [Citrus sinensis]
Length=624

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>ref|XP_006487243.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Citrus sinensis]
Length=623

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>gb|KDO47890.1| hypothetical protein CISIN_1g006449mg [Citrus sinensis]
Length=613

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>gb|KHN20956.1| Sec14 cytosolic factor [Glycine soja]
Length=630

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGHDERRERKSDFENSE  33



>gb|KDO47894.1| hypothetical protein CISIN_1g006449mg [Citrus sinensis]
Length=483

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>gb|KDO47893.1| hypothetical protein CISIN_1g006449mg [Citrus sinensis]
Length=488

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>ref|XP_006595925.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Glycine max]
Length=618

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGHDERRERKSDFENSE  33



>ref|XP_006423356.1| hypothetical protein CICLE_v10028023mg [Citrus clementina]
 gb|ESR36596.1| hypothetical protein CICLE_v10028023mg [Citrus clementina]
Length=483

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>ref|XP_003550393.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Glycine max]
Length=624

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGHDERRERKSDFENSE  33



>ref|XP_006601320.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Glycine max]
Length=625

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGHDERRERKSDFENSE  33



>gb|KHN12687.1| SEC14 cytosolic factor [Glycine soja]
Length=631

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGHDERRERKSDFENSE  33



>ref|XP_003544359.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Glycine max]
Length=623

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGHDERRERKSDFENSE  33



>gb|KDO47895.1| hypothetical protein CISIN_1g006449mg [Citrus sinensis]
Length=482

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERRERKSDFENSE  33



>ref|XP_010263587.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X4 [Nelumbo nucifera]
Length=623

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF+G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFAGHDERRERKSDFENSE  33



>ref|XP_010263585.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X2 [Nelumbo nucifera]
Length=659

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF+G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFAGHDERRERKSDFENSE  33



>ref|XP_010263586.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X3 [Nelumbo nucifera]
Length=641

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF+G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFAGHDERRERKSDFENSE  33



>ref|XP_010263584.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X1 [Nelumbo nucifera]
Length=677

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF+G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFAGHDERRERKSDFENSE  33



>ref|XP_004169138.1| PREDICTED: uncharacterized LOC101208172 [Cucumis sativus]
Length=623

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DER+ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERKERKSDFENSE  33



>ref|XP_004148831.1| PREDICTED: uncharacterized protein LOC101208172 [Cucumis sativus]
 gb|KGN61819.1| hypothetical protein Csa_2G248760 [Cucumis sativus]
Length=623

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DER+ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERKERKSDFENSE  33



>ref|XP_007160727.1| hypothetical protein PHAVU_001G012100g [Phaseolus vulgaris]
 gb|ESW32721.1| hypothetical protein PHAVU_001G012100g [Phaseolus vulgaris]
Length=626

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DERRER+SDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGHDERRERRSDFENSE  33



>ref|XP_008460966.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Cucumis melo]
Length=624

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DER+ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDERKERKSDFENSE  33



>emb|CDP20068.1| unnamed protein product [Coffea canephora]
Length=621

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG SGNDERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGSSGNDERRERKSDFENSE  33



>ref|XP_011088432.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Sesamum indicum]
 ref|XP_011088433.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Sesamum indicum]
Length=624

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG SGNDERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGSSGNDERRERKSDFENSE  33



>ref|XP_008236930.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X1 [Prunus mume]
 ref|XP_008236931.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X1 [Prunus mume]
Length=628

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_008349908.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Malus domestica]
Length=628

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_008349909.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Malus domestica]
Length=627

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_007199757.1| hypothetical protein PRUPE_ppa002840mg [Prunus persica]
 gb|EMJ00956.1| hypothetical protein PRUPE_ppa002840mg [Prunus persica]
Length=627

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_008236932.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X2 [Prunus mume]
Length=627

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_009378656.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X3 [Pyrus x bretschneideri]
Length=624

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_007199758.1| hypothetical protein PRUPE_ppa002840mg [Prunus persica]
 gb|EMJ00957.1| hypothetical protein PRUPE_ppa002840mg [Prunus persica]
Length=628

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_009378657.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X4 [Pyrus x bretschneideri]
Length=623

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_008347363.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Malus domestica]
Length=631

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERRERKSDFENSE  33



>ref|XP_009378655.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Pyrus x bretschneideri]
Length=627

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_009378654.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Pyrus x bretschneideri]
Length=628

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_008377272.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Malus domestica]
Length=627

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_008377271.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Malus domestica]
Length=628

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_008377274.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X4 [Malus domestica]
Length=623

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_008377273.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X3 [Malus domestica]
Length=624

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_007135955.1| hypothetical protein PHAVU_009G006000g [Phaseolus vulgaris]
 gb|ESW07949.1| hypothetical protein PHAVU_009G006000g [Phaseolus vulgaris]
Length=487

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DE+RER+SDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDEKRERRSDFENSE  33



>ref|XP_009365514.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Pyrus x bretschneideri]
Length=629

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERRERKSDFENSE  33



>ref|XP_003603969.1| Sec14 cytosolic factor [Medicago truncatula]
Length=435

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DE+RER+SDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDEKRERRSDFENSE  33



>ref|XP_007135956.1| hypothetical protein PHAVU_009G006000g [Phaseolus vulgaris]
 gb|ESW07950.1| hypothetical protein PHAVU_009G006000g [Phaseolus vulgaris]
Length=625

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DE+RER+SDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDEKRERRSDFENSE  33



>ref|XP_009353403.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Pyrus x bretschneideri]
Length=626

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_004289639.1| PREDICTED: uncharacterized protein LOC101312875 [Fragaria vesca 
subsp. vesca]
Length=627

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERRERKSDFENSE  33



>ref|XP_010254739.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Nelumbo nucifera]
 ref|XP_010254740.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Nelumbo nucifera]
 ref|XP_010254741.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Nelumbo nucifera]
 ref|XP_010254742.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Nelumbo nucifera]
 ref|XP_010254743.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Nelumbo nucifera]
Length=609

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERRERKSDFENSE  33



>ref|XP_010254745.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Nelumbo nucifera]
Length=608

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERRERKSDFENSE  33



>ref|XP_009335946.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Pyrus x bretschneideri]
Length=632

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERRERKSDFENSE  33



>ref|XP_003603968.1| Sec14 cytosolic factor [Medicago truncatula]
 gb|AES74219.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=623

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DE+RER+SDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDEKRERRSDFENSE  33



>ref|XP_004500794.1| PREDICTED: uncharacterized protein LOC101488984 [Cicer arietinum]
Length=626

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DE+RER+SDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDEKRERRSDFENSE  33



>ref|XP_003603967.1| Sec14 cytosolic factor [Medicago truncatula]
Length=709

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DE+RER+SDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDEKRERRSDFENSE  33



>dbj|BAF98225.1| CM0216.430.nc [Lotus japonicus]
Length=631

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF G+DER+ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYGSDERKERKSDFENSE  33



>gb|KHG00771.1| Sec14 cytosolic factor [Gossypium arboreum]
Length=637

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG SG+DE+RERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGISGSDEKRERKSDFENSE  33



>ref|XP_011092815.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Sesamum indicum]
Length=619

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDR ARPCFEG SGNDERRERKSDFENSE
Sbjct  1   MSGPLDRLARPCFEGSSGNDERRERKSDFENSE  33



>ref|XP_006847542.1| hypothetical protein AMTR_s00014p00131390 [Amborella trichopoda]
 gb|ERN09123.1| hypothetical protein AMTR_s00014p00131390 [Amborella trichopoda]
Length=649

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = -1

Query  118  LWST--AAMSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
            +W      MSGPLDRFARPCFEGFS +DE+RERKSDFENSE
Sbjct  1    MWGVGLITMSGPLDRFARPCFEGFSSHDEKRERKSDFENSE  41



>ref|XP_011092814.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Sesamum indicum]
Length=623

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDR ARPCFEG SGNDERRERKSDFENSE
Sbjct  1   MSGPLDRLARPCFEGSSGNDERRERKSDFENSE  33



>gb|KEH40183.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=622

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 33/34 (97%), Gaps = 1/34 (3%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRE-RKSDFENSE  2
           MSGPLDRFARPCFEGFSGNDERRE RKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGNDERREQRKSDFENSE  34



>gb|KHN20049.1| Sec14 cytosolic factor [Glycine soja]
Length=623

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DE++ER+SDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDEKKERRSDFENSE  33



>ref|XP_010940114.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Elaeis guineensis]
Length=625

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DER+ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERKERKSDFENSE  33



>gb|KEH40180.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=620

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 33/34 (97%), Gaps = 1/34 (3%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRE-RKSDFENSE  2
           MSGPLDRFARPCFEGFSGNDERRE RKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGNDERREQRKSDFENSE  34



>ref|XP_008795965.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol/phosphatidylcholine 
transfer protein SFH6-like [Phoenix dactylifera]
Length=625

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DER+ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERKERKSDFENSE  33



>ref|XP_010940115.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Elaeis guineensis]
Length=619

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DER+ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERKERKSDFENSE  33



>ref|XP_007131801.1| hypothetical protein PHAVU_011G042800g [Phaseolus vulgaris]
 gb|ESW03795.1| hypothetical protein PHAVU_011G042800g [Phaseolus vulgaris]
Length=625

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DE++ER+SDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDEKKERRSDFENSE  33



>gb|KEH40182.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=627

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 33/34 (97%), Gaps = 1/34 (3%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRE-RKSDFENSE  2
           MSGPLDRFARPCFEGFSGNDERRE RKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGNDERREQRKSDFENSE  34



>ref|XP_003537860.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Glycine max]
 gb|KHN39806.1| Sec14 cytosolic factor [Glycine soja]
Length=629

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DE++ER+SDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDEKKERRSDFENSE  33



>ref|XP_008784937.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Phoenix dactylifera]
 ref|XP_008784939.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Phoenix dactylifera]
Length=625

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DER+ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERKERKSDFENSE  33



>ref|XP_003522898.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Glycine max]
 gb|KHN33733.1| Sec14 cytosolic factor [Glycine soja]
Length=624

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DE++ER+SDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDEKKERRSDFENSE  33



>gb|KHN25399.1| Sec14 cytosolic factor [Glycine soja]
Length=692

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DE++ER+SDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDEKKERRSDFENSE  33



>ref|XP_003541004.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Glycine max]
Length=629

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DE++ER+SDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGSDEKKERRSDFENSE  33



>ref|XP_007222014.1| hypothetical protein PRUPE_ppa002936mg [Prunus persica]
 gb|EMJ23213.1| hypothetical protein PRUPE_ppa002936mg [Prunus persica]
Length=620

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DER+ERKSD+ENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERKERKSDYENSE  33



>ref|XP_008220844.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 [Prunus mume]
Length=624

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DER+ERKSD+ENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERKERKSDYENSE  33



>ref|XP_004291849.1| PREDICTED: uncharacterized protein LOC101290835 [Fragaria vesca 
subsp. vesca]
Length=623

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS ++ERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHEERRERKSDFENSE  33



>ref|XP_010531442.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 [Tarenaya hassleriana]
Length=629

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF  NDE++ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFLSNDEKKERKSDFENSE  33



>ref|XP_002510428.1| phosphatidylinositol transporter, putative [Ricinus communis]
 gb|EEF52615.1| phosphatidylinositol transporter, putative [Ricinus communis]
Length=623

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFA PCFEG SGNDERRERKSDFENSE
Sbjct  1   MSGPLDRFAIPCFEGSSGNDERRERKSDFENSE  33



>ref|XP_011047984.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Populus euphratica]
Length=627

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF  +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYSSDERRERKSDFENSE  33



>ref|XP_011047991.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X2 [Populus euphratica]
Length=626

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF  +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFYSSDERRERKSDFENSE  33



>ref|XP_010936679.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X1 [Elaeis guineensis]
Length=636

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DER+ERKSDF+NSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERKERKSDFDNSE  33



>ref|XP_004499192.1| PREDICTED: uncharacterized protein LOC101495235 isoform X5 [Cicer 
arietinum]
Length=627

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 1/34 (3%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSG-NDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGHHDERRERKSDFENSE  34



>ref|XP_010936680.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X2 [Elaeis guineensis]
Length=625

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DER+ERKSDF+NSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERKERKSDFDNSE  33



>ref|XP_004499191.1| PREDICTED: uncharacterized protein LOC101495235 isoform X4 [Cicer 
arietinum]
Length=629

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 1/34 (3%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSG-NDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFSGHHDERRERKSDFENSE  34



>ref|XP_009404707.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Musa acuminata subsp. malaccensis]
 ref|XP_009404715.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Musa acuminata subsp. malaccensis]
Length=626

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DER+ERKSD ENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERKERKSDIENSE  33



>emb|CDX82040.1| BnaC08g35610D [Brassica napus]
Length=603

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF  +DE++ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFLSSDEKKERKSDFENSE  33



>ref|XP_009117393.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X2 [Brassica rapa]
Length=634

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF  +DE++ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFLSSDEKKERKSDFENSE  33



>emb|CDY13810.1| BnaA09g43120D [Brassica napus]
Length=632

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF  +DE++ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFLSSDEKKERKSDFENSE  33



>gb|EYU37817.1| hypothetical protein MIMGU_mgv1a002892mg [Erythranthe guttata]
 gb|EYU37818.1| hypothetical protein MIMGU_mgv1a002892mg [Erythranthe guttata]
Length=628

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG SG++ERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGSSGSEERRERKSDFENSE  33



>gb|AAK63247.1|AF367433_1 phosphatidylinositol transfer-like protein III [Lotus japonicus]
Length=625

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLD FARPCFEGFSG+DE+RER+SDFENSE
Sbjct  1   MSGPLDFFARPCFEGFSGSDEKRERRSDFENSE  33



>ref|XP_006365129.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Solanum tuberosum]
Length=625

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG S +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGSSTHDERRERKSDFENSE  33



>ref|XP_009781464.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Nicotiana sylvestris]
Length=624

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG S +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGSSTHDERRERKSDFENSE  33



>ref|XP_009629969.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Nicotiana tomentosiformis]
Length=625

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG S +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGSSTHDERRERKSDFENSE  33



>ref|XP_004230868.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Solanum lycopersicum]
 ref|XP_010315313.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Solanum lycopersicum]
Length=625

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG S +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGSSTHDERRERKSDFENSE  33



>ref|XP_009629974.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Nicotiana tomentosiformis]
Length=624

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG S +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGSSTHDERRERKSDFENSE  33



>ref|XP_003527164.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Glycine max]
Length=623

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFSG+DE++ER+SDFE SE
Sbjct  1   MSGPLDRFARPCFEGFSGSDEKKERRSDFEYSE  33



>ref|XP_009389342.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Musa acuminata subsp. malaccensis]
Length=626

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DER+ER+SD ENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDERKERRSDIENSE  33



>ref|XP_010536338.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH4-like isoform X2 [Tarenaya hassleriana]
Length=604

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG S NDERRERKSDFE SE
Sbjct  1   MSGPLDRFARPCFEGCSNNDERRERKSDFEASE  33



>ref|XP_010536337.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH4-like isoform X1 [Tarenaya hassleriana]
Length=615

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG S NDERRERKSDFE SE
Sbjct  1   MSGPLDRFARPCFEGCSNNDERRERKSDFEASE  33



>ref|XP_008811091.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Phoenix dactylifera]
Length=625

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG S +DER+ER+SDFENSE
Sbjct  1   MSGPLDRFARPCFEGMSSHDERKERRSDFENSE  33



>ref|XP_009418458.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like [Musa acuminata subsp. malaccensis]
 ref|XP_009418459.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like [Musa acuminata subsp. malaccensis]
Length=631

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGFS +DE++ERKSD ENSE
Sbjct  1   MSGPLDRFARPCFEGFSSHDEKKERKSDVENSE  33



>ref|NP_179747.4| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
 sp|F4IHJ0.1|SFH8_ARATH RecName: Full=Phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8; AltName: Full=Protein SEC FOURTEEN HOMOLOGS 
8; Short=AtSFH8 [Arabidopsis thaliana]
 gb|AEC07189.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
Length=633

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF  +DE++ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGFLSSDEKKERKSDFENSE  33



>ref|XP_006411719.1| hypothetical protein EUTSA_v10024693mg [Eutrema salsugineum]
 gb|ESQ53172.1| hypothetical protein EUTSA_v10024693mg [Eutrema salsugineum]
Length=614

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGP+DRFARPCFEGF  +DE++ERKSDFENSE
Sbjct  1   MSGPVDRFARPCFEGFLSSDEKKERKSDFENSE  33



>gb|KFK32889.1| hypothetical protein AALP_AA6G300800 [Arabis alpina]
Length=639

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  AMSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
            +MSGPLDR+ARPCFEGF  +DE++ERKSDFENSE
Sbjct  2    SMSGPLDRYARPCFEGFLSSDEKKERKSDFENSE  35



>gb|KDO84632.1| hypothetical protein CISIN_1g006989mg [Citrus sinensis]
Length=460

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG   NDERRERKSDF+NSE
Sbjct  1   MSGPLDRFARPCFEGSCSNDERRERKSDFDNSE  33



>ref|XP_006473544.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Citrus sinensis]
Length=623

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG   NDERRERKSDF+NSE
Sbjct  1   MSGPLDRFARPCFEGSCSNDERRERKSDFDNSE  33



>ref|XP_006473545.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Citrus sinensis]
Length=622

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG   NDERRERKSDF+NSE
Sbjct  1   MSGPLDRFARPCFEGSCSNDERRERKSDFDNSE  33



>gb|KDO84631.1| hypothetical protein CISIN_1g006989mg [Citrus sinensis]
Length=622

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG   NDERRERKSDF+NSE
Sbjct  1   MSGPLDRFARPCFEGSCSNDERRERKSDFDNSE  33



>ref|XP_009765681.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Nicotiana sylvestris]
Length=624

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG S  +ERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGSSAREERRERKSDFENSE  33



>ref|XP_009600133.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009600140.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009600149.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Nicotiana tomentosiformis]
Length=625

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG S  +ERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGSSAREERRERKSDFENSE  33



>ref|XP_009600157.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Nicotiana tomentosiformis]
Length=624

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG S  +ERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGSSAREERRERKSDFENSE  33



>ref|XP_006365292.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Solanum tuberosum]
Length=622

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFA PCFEG S +DERRERKSDFENSE
Sbjct  1   MSGPLDRFAMPCFEGSSTHDERRERKSDFENSE  33



>ref|XP_006365291.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Solanum tuberosum]
Length=623

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFA PCFEG S +DERRERKSDFENSE
Sbjct  1   MSGPLDRFAMPCFEGSSTHDERRERKSDFENSE  33



>ref|XP_010327434.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X2 [Solanum lycopersicum]
Length=622

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFA PCFEG S +DERRERKSDFENSE
Sbjct  1   MSGPLDRFAMPCFEGSSTHDERRERKSDFENSE  33



>ref|XP_004248700.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X1 [Solanum lycopersicum]
Length=623

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFA PCFEG S +DERRERKSDFENSE
Sbjct  1   MSGPLDRFAMPCFEGSSTHDERRERKSDFENSE  33



>gb|ABR17997.1| unknown [Picea sitchensis]
Length=621

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG S  DERRERKSD ENSE
Sbjct  1   MSGPLDRFARPCFEGSSAQDERRERKSDVENSE  33



>ref|XP_010922737.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Elaeis guineensis]
 ref|XP_010922744.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Elaeis guineensis]
Length=625

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG S +DER+ERKSDFE SE
Sbjct  1   MSGPLDRFARPCFEGMSNHDERKERKSDFEISE  33



>gb|KDP38545.1| hypothetical protein JCGZ_04470 [Jatropha curcas]
Length=619

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLD FARPCFEG SG+DERRERKSDFE SE
Sbjct  1   MSGPLDLFARPCFEGTSGSDERRERKSDFEISE  33



>ref|XP_010555281.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Tarenaya hassleriana]
Length=633

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG   +DE++ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGLLSSDEKKERKSDFENSE  33



>ref|XP_006296430.1| hypothetical protein CARUB_v10025610mg [Capsella rubella]
 gb|EOA29328.1| hypothetical protein CARUB_v10025610mg [Capsella rubella]
Length=635

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG   +DE++ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEGILSSDEKKERKSDFENSE  33



>ref|XP_010446445.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6 isoform X1 [Camelina sativa]
Length=614

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGP+DRFARPCFEG   +DE++ERKSDFENSE
Sbjct  1   MSGPVDRFARPCFEGIMSSDEKKERKSDFENSE  33



>ref|XP_010437026.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X1 [Camelina sativa]
Length=614

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGP+DRFARPCFEG   +DE++ERKSDFENSE
Sbjct  1   MSGPVDRFARPCFEGIMSSDEKKERKSDFENSE  33



>ref|XP_010446446.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6 isoform X2 [Camelina sativa]
Length=613

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGP+DRFARPCFEG   +DE++ERKSDFENSE
Sbjct  1   MSGPVDRFARPCFEGIMSSDEKKERKSDFENSE  33



>ref|XP_010437027.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X2 [Camelina sativa]
Length=613

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGP+DRFARPCFEG   +DE++ERKSDFENSE
Sbjct  1   MSGPVDRFARPCFEGIMSSDEKKERKSDFENSE  33



>emb|CDY29415.1| BnaA06g13810D [Brassica napus]
Length=615

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRF  PCFEGFS  DERRERKSDFE SE
Sbjct  1   MSGPLDRFTIPCFEGFSSTDERRERKSDFEVSE  33



>ref|XP_009149448.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH4 [Brassica rapa]
Length=615

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRF  PCFEGFS  DERRERKSDFE SE
Sbjct  1   MSGPLDRFTIPCFEGFSSTDERRERKSDFEVSE  33



>ref|XP_006283268.1| hypothetical protein CARUB_v10004299mg [Capsella rubella]
 gb|EOA16166.1| hypothetical protein CARUB_v10004299mg [Capsella rubella]
Length=672

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGP+DRFARPCFEG   +DE++ERKSDFENSE
Sbjct  1   MSGPVDRFARPCFEGVLSSDEKKERKSDFENSE  33



>ref|XP_011048799.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X4 [Populus euphratica]
Length=631

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MS PLD  ARPCFEGFS NDE+RERKSDF+NSE
Sbjct  1   MSSPLDLLARPCFEGFSSNDEKRERKSDFDNSE  33



>ref|XP_002307673.2| hypothetical protein POPTR_0005s25210g [Populus trichocarpa]
 gb|EEE94669.2| hypothetical protein POPTR_0005s25210g [Populus trichocarpa]
Length=622

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MS PLD  ARPCFEGFS NDE+RERKSDF+NSE
Sbjct  1   MSSPLDLLARPCFEGFSSNDEKRERKSDFDNSE  33



>ref|XP_006302011.1| hypothetical protein CARUB_v10019999mg [Capsella rubella]
 gb|EOA34909.1| hypothetical protein CARUB_v10019999mg [Capsella rubella]
Length=612

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDR ARPCFEG S NDERRER+SDFE SE
Sbjct  1   MSGPLDRLARPCFEGCSSNDERRERRSDFEVSE  33



>ref|XP_011048797.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X2 [Populus euphratica]
Length=639

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MS PLD  ARPCFEGFS NDE+RERKSDF+NSE
Sbjct  1   MSSPLDLLARPCFEGFSSNDEKRERKSDFDNSE  33



>gb|KFK41974.1| hypothetical protein AALP_AA2G195800 [Arabis alpina]
Length=610

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFA PCFEG S NDERRER+SDFE SE
Sbjct  1   MSGPLDRFAMPCFEGCSSNDERRERRSDFEVSE  33



>ref|XP_002281429.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 [Vitis vinifera]
 emb|CBI19741.3| unnamed protein product [Vitis vinifera]
Length=623

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 1/33 (3%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG + +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCFEG-ANHDERRERKSDFENSE  32



>ref|NP_177670.2| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
 sp|Q8GXC6.1|SFH5_ARATH RecName: Full=Phosphatidylinositol/phosphatidylcholine transfer 
protein SFH5; AltName: Full=Protein SEC FOURTEEN HOMOLOGS 
5; Short=AtSFH5 [Arabidopsis thaliana]
 dbj|BAC42922.1| putative sec14 cytosolic factor [Arabidopsis thaliana]
 gb|AEE35707.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
Length=612

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDRFARPCFEG S NDERRER+SDFE SE
Sbjct  1   MSGSLDRFARPCFEGVSSNDERRERRSDFEVSE  33



>ref|XP_009394504.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like [Musa acuminata subsp. malaccensis]
 ref|XP_009394505.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like [Musa acuminata subsp. malaccensis]
Length=626

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG S +DE++ERKSD ENSE
Sbjct  1   MSGPLDRFARPCFEGSSNHDEKKERKSDVENSE  33



>gb|AAG13072.1|AC023754_10 Unknown protein [Arabidopsis thaliana]
Length=640

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDRFARPCFEG S NDERRER+SDFE SE
Sbjct  1   MSGSLDRFARPCFEGVSSNDERRERRSDFEVSE  33



>ref|XP_007017606.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
3 [Theobroma cacao]
 ref|XP_007017608.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
3 [Theobroma cacao]
 gb|EOY14831.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
3 [Theobroma cacao]
 gb|EOY14833.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
3 [Theobroma cacao]
Length=620

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG   NDER++RKSDFE SE
Sbjct  1   MSGPLDRFARPCFEGTGSNDERKDRKSDFEISE  33



>ref|XP_004961332.1| PREDICTED: uncharacterized protein LOC101785621 isoform X2 [Setaria 
italica]
Length=616

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF  NDER+E KSD +NSE
Sbjct  1   MSGPLDRFARPCFEGFVHNDERKESKSDADNSE  33



>gb|KHG28545.1| Bifunctional dihydrofolate reductase-thymidylate synthase [Gossypium 
arboreum]
Length=909

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG   NDER++RKSDFE SE
Sbjct  1   MSGPLDRFARPCFEGIVCNDERKDRKSDFEVSE  33



>ref|XP_004961331.1| PREDICTED: uncharacterized protein LOC101785621 isoform X1 [Setaria 
italica]
Length=629

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF  NDER+E KSD +NSE
Sbjct  1   MSGPLDRFARPCFEGFVHNDERKESKSDADNSE  33



>ref|NP_001154472.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
 gb|AEE35708.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
Length=668

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDRFARPCFEG S NDERRER+SDFE SE
Sbjct  1   MSGSLDRFARPCFEGVSSNDERRERRSDFEVSE  33



>ref|XP_007017604.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007017605.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007017607.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY14829.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY14830.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY14832.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
Length=621

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG   NDER++RKSDFE SE
Sbjct  1   MSGPLDRFARPCFEGTGSNDERKDRKSDFEISE  33



>gb|KFK44097.1| hypothetical protein AALP_AA1G215500 [Arabis alpina]
Length=611

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDR  RPCFEG S NDERRERKSD+E SE
Sbjct  1   MSGPLDRLTRPCFEGSSNNDERRERKSDYEVSE  33



>gb|EPS69446.1| hypothetical protein M569_05317 [Genlisea aurea]
Length=618

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDR ARPCFEG S  DE+RERKSD ENSE
Sbjct  1   MSGPLDRLARPCFEGSSAMDEKRERKSDIENSE  33



>gb|AFW78979.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=324

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF  NDER+E +SD +NSE
Sbjct  1   MSGPLDRFARPCFEGFVHNDERKESRSDADNSE  33



>gb|EYU42601.1| hypothetical protein MIMGU_mgv1a003028mg [Erythranthe guttata]
Length=614

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG  +RFA PCFEG SGNDERRERKSDFENSE
Sbjct  1   MSGASERFAMPCFEGSSGNDERRERKSDFENSE  33



>ref|XP_006404603.1| hypothetical protein EUTSA_v10000082mg [Eutrema salsugineum]
 gb|ESQ46056.1| hypothetical protein EUTSA_v10000082mg [Eutrema salsugineum]
Length=639

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 4/37 (11%)
 Frame = -1

Query  100 MSGPLDRFARPCF----EGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCF    EGF  +DER+ERKSDFENSE
Sbjct  1   MSGPLDRFARPCFTTGFEGFLSSDERKERKSDFENSE  37



>emb|CDY39363.1| BnaC05g15240D [Brassica napus]
Length=592

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRF  PCFEGFS  DER+ERKSD E SE
Sbjct  1   MSGPLDRFTIPCFEGFSSTDERKERKSDIEVSE  33



>ref|XP_010105353.1| Sec14 cytosolic factor [Morus notabilis]
 gb|EXC04413.1| Sec14 cytosolic factor [Morus notabilis]
Length=651

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 33/52 (63%), Gaps = 19/52 (37%)
 Frame = -1

Query  100 MSGPLDRFARPC-------------------FEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPC                   FEGFSG+DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPCECSLLFFCFGVWCNACVIGFEGFSGSDERRERKSDFENSE  52



>ref|XP_008649950.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 [Zea mays]
 gb|AFW78977.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=618

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF  NDER+E +SD +NSE
Sbjct  1   MSGPLDRFARPCFEGFVHNDERKESRSDADNSE  33



>gb|AFW78978.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=632

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF  NDER+E +SD +NSE
Sbjct  1   MSGPLDRFARPCFEGFVHNDERKESRSDADNSE  33



>gb|AAK59767.1| AT4g39170/T22F8_70 [Arabidopsis thaliana]
 gb|AAM91428.1| AT4g39170/T22F8_70 [Arabidopsis thaliana]
Length=583

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGP+DRFA PCFEG   +DE++ERKSDFENSE
Sbjct  1   MSGPVDRFAIPCFEGILSSDEKKERKSDFENSE  33



>gb|AFW78976.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=680

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF  NDER+E +SD +NSE
Sbjct  63  MSGPLDRFARPCFEGFVHNDERKESRSDADNSE  95



>emb|CAB43632.1| SEC14-like protein [Arabidopsis thaliana]
 emb|CAB80580.1| SEC14-like protein [Arabidopsis thaliana]
Length=617

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGP+DRFA PCFEG   +DE++ERKSDFENSE
Sbjct  1   MSGPVDRFAIPCFEGILSSDEKKERKSDFENSE  33



>ref|NP_001056209.1| Os05g0545000 [Oryza sativa Japonica Group]
 gb|AAU43984.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18123.1| Os05g0545000 [Oryza sativa Japonica Group]
 dbj|BAG89882.1| unnamed protein product [Oryza sativa Japonica Group]
Length=613

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF+ NDE++E +SD +NSE
Sbjct  1   MSGPLDRFARPCFEGFTHNDEKKEIRSDADNSE  33



>ref|XP_006654737.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X3 [Oryza brachyantha]
Length=614

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF+ NDE++E +SD +NSE
Sbjct  1   MSGPLDRFARPCFEGFAHNDEKKEIRSDADNSE  33



>ref|NP_568054.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
 sp|F4JVA6.1|SFH6_ARATH RecName: Full=Phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6; AltName: Full=Protein SEC FOURTEEN HOMOLOGS 
6; Short=AtSFH6 [Arabidopsis thaliana]
 gb|AEE87031.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
Length=614

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGP+DRFA PCFEG   +DE++ERKSDFENSE
Sbjct  1   MSGPVDRFAIPCFEGILSSDEKKERKSDFENSE  33



>ref|NP_001190962.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
 gb|AEE87032.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
Length=612

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGP+DRFA PCFEG   +DE++ERKSDFENSE
Sbjct  1   MSGPVDRFAIPCFEGILSSDEKKERKSDFENSE  33



>ref|XP_006654736.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Oryza brachyantha]
Length=620

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF+ NDE++E +SD +NSE
Sbjct  1   MSGPLDRFARPCFEGFAHNDEKKEIRSDADNSE  33



>ref|XP_006654735.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Oryza brachyantha]
Length=621

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEGF+ NDE++E +SD +NSE
Sbjct  1   MSGPLDRFARPCFEGFAHNDEKKEIRSDADNSE  33



>ref|XP_010471643.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH5 [Camelina sativa]
Length=612

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDR ARPCFEG S NDERRER+SDFE SE
Sbjct  1   MSGSLDRLARPCFEGCSSNDERRERRSDFEVSE  33



>ref|XP_010416414.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH5-like [Camelina sativa]
Length=612

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDR ARPCFEG S NDERRER+SDFE SE
Sbjct  1   MSGSLDRLARPCFEGCSSNDERRERRSDFEVSE  33



>ref|XP_010428555.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH5-like isoform X2 [Camelina sativa]
Length=610

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDR ARPCFEG S NDERRER+SDFE SE
Sbjct  1   MSGSLDRLARPCFEGCSSNDERRERRSDFEVSE  33



>ref|XP_010428554.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH5-like isoform X1 [Camelina sativa]
Length=612

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDR ARPCFEG S NDERRER+SDFE SE
Sbjct  1   MSGSLDRLARPCFEGCSSNDERRERRSDFEVSE  33



>ref|XP_002889021.1| hypothetical protein ARALYDRAFT_476682 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65280.1| hypothetical protein ARALYDRAFT_476682 [Arabidopsis lyrata subsp. 
lyrata]
Length=612

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDRFARPCFEG S NDERRER+SD E SE
Sbjct  1   MSGSLDRFARPCFEGCSSNDERRERRSDIEVSE  33



>gb|KFK30497.1| hypothetical protein AALP_AA7G269400 [Arabis alpina]
Length=617

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGP+DRFA PCFEG   ++E++ERKSDFENSE
Sbjct  1   MSGPVDRFALPCFEGLLSSEEKKERKSDFENSE  33



>ref|XP_011028880.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X1 [Populus euphratica]
 ref|XP_011028881.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X1 [Populus euphratica]
 ref|XP_011028882.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X1 [Populus euphratica]
Length=618

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MS P DR ARPC EGFS N+E+RERKSDFENSE
Sbjct  1   MSSPSDRLARPCPEGFSSNEEKRERKSDFENSE  33



>ref|XP_011028883.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X2 [Populus euphratica]
Length=607

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MS P DR ARPC EGFS N+E+RERKSDFENSE
Sbjct  1   MSSPSDRLARPCPEGFSSNEEKRERKSDFENSE  33



>ref|XP_011028884.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X3 [Populus euphratica]
Length=585

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MS P DR ARPC EGFS N+E+RERKSDFENSE
Sbjct  1   MSSPSDRLARPCPEGFSSNEEKRERKSDFENSE  33



>ref|XP_006390313.1| hypothetical protein EUTSA_v10018296mg [Eutrema salsugineum]
 ref|XP_006390314.1| hypothetical protein EUTSA_v10018296mg [Eutrema salsugineum]
 gb|ESQ27599.1| hypothetical protein EUTSA_v10018296mg [Eutrema salsugineum]
 gb|ESQ27600.1| hypothetical protein EUTSA_v10018296mg [Eutrema salsugineum]
Length=610

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 1/33 (3%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLD FARPCFEG S NDERRER+SDFE SE
Sbjct  1   MSGPLD-FARPCFEGCSSNDERRERRSDFEVSE  32



>ref|XP_006390315.1| hypothetical protein EUTSA_v10018296mg [Eutrema salsugineum]
 gb|ESQ27601.1| hypothetical protein EUTSA_v10018296mg [Eutrema salsugineum]
Length=612

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 1/33 (3%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLD FARPCFEG S NDERRER+SDFE SE
Sbjct  1   MSGPLD-FARPCFEGCSSNDERRERRSDFEVSE  32



>ref|XP_009104709.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH5 isoform X1 [Brassica rapa]
Length=610

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 1/33 (3%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLD FARPCFEG S NDERRER+SDFE SE
Sbjct  1   MSGPLD-FARPCFEGCSSNDERRERRSDFEVSE  32



>emb|CDX85889.1| BnaC06g22450D [Brassica napus]
Length=607

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 1/33 (3%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLD FARPCFEG S NDERRER+SDFE SE
Sbjct  1   MSGPLD-FARPCFEGCSSNDERRERRSDFEVSE  32



>gb|KHG12269.1| SEC14 cytosolic factor [Gossypium arboreum]
Length=607

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 2/33 (6%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPCFEG   NDER++RKSDFE SE
Sbjct  1   MSGPLDRFARPCFEG--NNDERKDRKSDFEISE  31



>ref|XP_009104710.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH5 isoform X2 [Brassica rapa]
Length=608

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 1/33 (3%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLD FARPCFEG S NDERRER+SDFE SE
Sbjct  1   MSGPLD-FARPCFEGCSSNDERRERRSDFEVSE  32



>emb|CDX68133.1| BnaA07g21730D [Brassica napus]
Length=608

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 1/33 (3%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLD FARPCFEG S NDERRER+SDFE SE
Sbjct  1   MSGPLD-FARPCFEGCSSNDERRERRSDFEVSE  32



>ref|XP_009117392.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 isoform X1 [Brassica rapa]
Length=638

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 4/37 (11%)
 Frame = -1

Query  100 MSGPLDRFARPCF----EGFSGNDERRERKSDFENSE  2
           MSGPLDRFARP F    EGF  +DE++ERKSDFENSE
Sbjct  1   MSGPLDRFARPSFTTGFEGFLSSDEKKERKSDFENSE  37



>ref|XP_003573093.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Brachypodium distachyon]
Length=619

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDRFARPC EG S +DERRERKSD +NS+
Sbjct  1   MSGSLDRFARPCLEGSSSHDERRERKSDVDNSD  33



>gb|AFW66716.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=774

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDRFARPCFEG S +DERR+ KSDFE SE
Sbjct  1   MSGHLDRFARPCFEGCSSHDERRDHKSDFEVSE  33



>ref|XP_008656005.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X2 [Zea mays]
Length=588

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MS PLDR ARPCFEGF  NDER+E +SD +NSE
Sbjct  1   MSAPLDRLARPCFEGFVHNDERKESRSDADNSE  33



>ref|XP_008679999.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Zea mays]
 gb|AFW66715.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=624

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDRFARPCFEG S +DERR+ KSDFE SE
Sbjct  1   MSGHLDRFARPCFEGCSSHDERRDHKSDFEVSE  33



>ref|XP_008679998.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Zea mays]
 gb|AFW66714.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=626

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDRFARPCFEG S +DERR+ KSDFE SE
Sbjct  1   MSGHLDRFARPCFEGCSSHDERRDHKSDFEVSE  33



>ref|XP_008656004.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Zea mays]
 gb|AFW80999.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=618

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MS PLDR ARPCFEGF  NDER+E +SD +NSE
Sbjct  1   MSAPLDRLARPCFEGFVHNDERKESRSDADNSE  33



>emb|CDY12125.1| BnaC03g60410D [Brassica napus]
Length=616

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGP+DRFA PCFEG   +DE++ERKSDFE SE
Sbjct  1   MSGPVDRFAIPCFEGLLSSDEKKERKSDFEISE  33



>ref|XP_004952457.1| PREDICTED: uncharacterized protein LOC101769246 isoform X1 [Setaria 
italica]
Length=633

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MS PLDR ARPCFEG S +DER+ERKSD  NSE
Sbjct  1   MSAPLDRLARPCFEGPSSHDERKERKSDVGNSE  33



>ref|XP_004952458.1| PREDICTED: uncharacterized protein LOC101769246 isoform X2 [Setaria 
italica]
Length=632

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MS PLDR ARPCFEG S +DER+ERKSD  NSE
Sbjct  1   MSAPLDRLARPCFEGPSSHDERKERKSDVGNSE  33



>ref|XP_002866832.1| hypothetical protein ARALYDRAFT_912374 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43091.1| hypothetical protein ARALYDRAFT_912374 [Arabidopsis lyrata subsp. 
lyrata]
Length=614

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG +DRFA PCFEG   +DE++ERKSDFENSE
Sbjct  1   MSGHVDRFAIPCFEGILSSDEKKERKSDFENSE  33



>ref|XP_002300755.2| hypothetical protein POPTR_0002s03400g [Populus trichocarpa]
 gb|EEE80028.2| hypothetical protein POPTR_0002s03400g [Populus trichocarpa]
Length=620

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MS P D   RPC EGFS N+E+RERKSDFENSE
Sbjct  1   MSSPSDSLGRPCLEGFSSNEEKRERKSDFENSE  33



>ref|XP_006646841.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Oryza brachyantha]
Length=624

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDR ARPCFEG S ND+RR+ KSD ENSE
Sbjct  1   MSGHLDRLARPCFEGSSSNDDRRDHKSDVENSE  33



>gb|KFK32888.1| hypothetical protein AALP_AA6G300800 [Arabis alpina]
Length=643

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 4/38 (11%)
 Frame = -1

Query  103  AMSGPLDRFARPCF----EGFSGNDERRERKSDFENSE  2
            +MSGPLDR+ARP F    EGF  +DE++ERKSDFENSE
Sbjct  2    SMSGPLDRYARPSFCTGFEGFLSSDEKKERKSDFENSE  39



>ref|XP_010416904.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Camelina sativa]
Length=645

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 4/37 (11%)
 Frame = -1

Query  100 MSGPLDRFARPCF----EGFSGNDERRERKSDFENSE  2
           MSGPLDRFARP F    EGF  +DE++ERKSDFENSE
Sbjct  1   MSGPLDRFARPSFTTGFEGFLSSDEKKERKSDFENSE  37



>ref|NP_001118356.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
 gb|AEC07190.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
Length=637

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 4/37 (11%)
 Frame = -1

Query  100 MSGPLDRFARPCF----EGFSGNDERRERKSDFENSE  2
           MSGPLDRFARP F    EGF  +DE++ERKSDFENSE
Sbjct  1   MSGPLDRFARPSFTTGFEGFLSSDEKKERKSDFENSE  37



>ref|XP_010429070.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Camelina sativa]
Length=644

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 4/37 (11%)
 Frame = -1

Query  100 MSGPLDRFARPCF----EGFSGNDERRERKSDFENSE  2
           MSGPLDRFARP F    EGF  +DE++ERKSDFENSE
Sbjct  1   MSGPLDRFARPSFTTGFEGFLSSDEKKERKSDFENSE  37



>ref|XP_010472148.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8 [Camelina sativa]
Length=644

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 4/37 (11%)
 Frame = -1

Query  100 MSGPLDRFARPCF----EGFSGNDERRERKSDFENSE  2
           MSGPLDRFARP F    EGF  +DE++ERKSDFENSE
Sbjct  1   MSGPLDRFARPSFTTGFEGFLSSDEKKERKSDFENSE  37



>ref|XP_006416483.1| hypothetical protein EUTSA_v10007470mg [Eutrema salsugineum]
 gb|ESQ34836.1| hypothetical protein EUTSA_v10007470mg [Eutrema salsugineum]
Length=492

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 2/35 (6%)
 Frame = -1

Query  100 MSGPLDRFARP-CFEGFSGNDERRE-RKSDFENSE  2
           MSGPLDRF RP CFEGFS +DERRE RKSDFE SE
Sbjct  1   MSGPLDRFTRPSCFEGFSNSDERREQRKSDFEVSE  35



>ref|XP_004951982.1| PREDICTED: uncharacterized protein LOC101773137 isoform X3 [Setaria 
italica]
Length=653

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDR ARPCFEG S +DERR+ KSDFE SE
Sbjct  1   MSGHLDRLARPCFEGCSSHDERRDHKSDFEISE  33



>dbj|BAD07999.1| putative phosphatidylinositol/ phophatidylcholine transfer protein 
[Oryza sativa Japonica Group]
 gb|EAY84365.1| hypothetical protein OsI_05740 [Oryza sativa Indica Group]
 gb|EAZ21640.1| hypothetical protein OsJ_05269 [Oryza sativa Japonica Group]
Length=624

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDR ARPCFEG S ND++R+ KSD ENSE
Sbjct  1   MSGHLDRLARPCFEGSSSNDDKRDHKSDVENSE  33



>ref|XP_009109488.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6 [Brassica rapa]
Length=618

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGP+DRFA PCFEG   ++E++ERKSDFE SE
Sbjct  1   MSGPVDRFAIPCFEGLLSSEEKKERKSDFEISE  33



>ref|XP_009380384.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=626

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG  DRFA PCFEG S +++ +ERKSDFENSE
Sbjct  1   MSGSFDRFAWPCFEGLSSHEDHKERKSDFENSE  33



>ref|XP_009380385.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=623

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG  DRFA PCFEG S +++ +ERKSDFENSE
Sbjct  1   MSGSFDRFAWPCFEGLSSHEDHKERKSDFENSE  33



>emb|CDX90316.1| BnaA08g16680D [Brassica napus]
Length=618

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGP+DRFA PCFEG   ++E++ERKSDFE SE
Sbjct  1   MSGPVDRFAIPCFEGLLSSEEKKERKSDFEISE  33



>ref|XP_004951980.1| PREDICTED: uncharacterized protein LOC101773137 isoform X1 [Setaria 
italica]
Length=689

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDR ARPCFEG S +DERR+ KSDFE SE
Sbjct  37  MSGHLDRLARPCFEGCSSHDERRDHKSDFEISE  69



>ref|XP_004951981.1| PREDICTED: uncharacterized protein LOC101773137 isoform X2 [Setaria 
italica]
Length=659

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDR ARPCFEG S +DERR+ KSDFE SE
Sbjct  37  MSGHLDRLARPCFEGCSSHDERRDHKSDFEISE  69



>ref|XP_008681487.1| PREDICTED: uncharacterized protein LOC100273833 isoform X2 [Zea 
mays]
 gb|AFW70030.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=624

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDRFARPCFEG S +DE R+ KSDFE SE
Sbjct  1   MSGHLDRFARPCFEGRSSHDECRDHKSDFEVSE  33



>ref|XP_008681485.1| PREDICTED: uncharacterized protein LOC100273833 isoform X1 [Zea 
mays]
 gb|AFW70029.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=626

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDRFARPCFEG S +DE R+ KSDFE SE
Sbjct  1   MSGHLDRFARPCFEGRSSHDECRDHKSDFEVSE  33



>gb|AFW70031.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=418

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDRFARPCFEG S +DE R+ KSDFE SE
Sbjct  1   MSGHLDRFARPCFEGRSSHDECRDHKSDFEVSE  33



>gb|KHG12222.1| Sec14 cytosolic factor [Gossypium arboreum]
Length=589

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 6/33 (18%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDRFARPC      +DERRERKSDFENSE
Sbjct  1   MSGPLDRFARPC------SDERRERKSDFENSE  27



>ref|XP_010060978.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like [Eucalyptus grandis]
 ref|XP_010060979.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like [Eucalyptus grandis]
 gb|KCW67882.1| hypothetical protein EUGRSUZ_F01595 [Eucalyptus grandis]
Length=626

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MS P+D+ AR C EG SG+DERRERKSDFE SE
Sbjct  1   MSHPVDQAARTCSEGPSGHDERRERKSDFETSE  33



>ref|XP_003574138.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like [Brachypodium distachyon]
Length=625

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSG LDR ARPCFEG S +DERR+ KSD E SE
Sbjct  1   MSGHLDRLARPCFEGCSSHDERRDHKSDMEVSE  33



>gb|KCW67883.1| hypothetical protein EUGRSUZ_F01595 [Eucalyptus grandis]
 gb|KCW67884.1| hypothetical protein EUGRSUZ_F01595 [Eucalyptus grandis]
Length=476

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MS P+D+ AR C EG SG+DERRERKSDFE SE
Sbjct  1   MSHPVDQAARTCSEGPSGHDERRERKSDFETSE  33



>dbj|BAJ87310.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=620

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           MSGPLDR ARP FEGF+ ND ++E +SD +NSE
Sbjct  1   MSGPLDRLARPSFEGFTHNDGKKESRSDADNSE  33



>ref|XP_010673081.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like [Beta vulgaris subsp. vulgaris]
Length=459

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = -1

Query  109  TAAMSGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
            +++MSGPLD FARPCFEG S + ER++RKS+FE SE
Sbjct  6    SSSMSGPLDLFARPCFEG-SSSRERKDRKSEFEISE  40



>ref|XP_003606975.1| Sec14 cytosolic factor [Medicago truncatula]
Length=620

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 1/31 (3%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERR-ERKSDFE  11
           MS P+DRFA PCFEG SG+DE+R ERKSDF+
Sbjct  1   MSSPIDRFALPCFEGSSGSDEKRTERKSDFK  31



>gb|AES89172.2| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=616

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 1/31 (3%)
 Frame = -1

Query  100 MSGPLDRFARPCFEGFSGNDERR-ERKSDFE  11
           MS P+DRFA PCFEG SG+DE+R ERKSDF+
Sbjct  1   MSSPIDRFALPCFEGSSGSDEKRTERKSDFK  31



>ref|XP_003567967.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Brachypodium distachyon]
Length=621

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  97  SGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           SGPLDR ARP FEGF+ ND ++E +SD +NSE
Sbjct  3   SGPLDRLARPSFEGFTHNDGKKESRSDADNSE  34



>ref|XP_010231072.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X1 [Brachypodium distachyon]
Length=622

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  97  SGPLDRFARPCFEGFSGNDERRERKSDFENSE  2
           SGPLDR ARP FEGF+ ND ++E +SD +NSE
Sbjct  3   SGPLDRLARPSFEGFTHNDGKKESRSDADNSE  34



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522235234356