BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23936_g3_i2 len=2181 path=[9703:0-1179 3306:1180-1205
3332:1206-1334 3461:1335-1686 3813:1687-1756 3883:1757-1802
3929:1803-1907 12465:1908-2180]

Length=2181
                                                                      Score     E

ref|XP_009789503.1|  PREDICTED: sodium/hydrogen exchanger 6-like        814   0.0      
ref|XP_009603482.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    813   0.0      
ref|XP_011095848.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    808   0.0      
ref|XP_011095847.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    807   0.0      
ref|XP_008224672.1|  PREDICTED: sodium/hydrogen exchanger 6-like        804   0.0      
ref|XP_004237373.1|  PREDICTED: sodium/hydrogen exchanger 6             798   0.0      
ref|XP_006350401.1|  PREDICTED: sodium/hydrogen exchanger 6-like        796   0.0      
ref|XP_009374800.1|  PREDICTED: sodium/hydrogen exchanger 6 isofo...    796   0.0      
emb|CAC83608.1|  Na+/H+ antiporter, isoform 2                           794   0.0      Solanum lycopersicum
ref|XP_010913977.1|  PREDICTED: sodium/hydrogen exchanger 6-like        790   0.0      
ref|XP_011086313.1|  PREDICTED: sodium/hydrogen exchanger 6-like        790   0.0      
ref|XP_002271865.1|  PREDICTED: sodium/hydrogen exchanger 6-like        789   0.0      Vitis vinifera
ref|XP_007026451.1|  Na+/H+ antiporter 6 isoform 2                      788   0.0      
ref|XP_006597645.1|  PREDICTED: sodium/hydrogen exchanger 6             787   0.0      
ref|XP_007159285.1|  hypothetical protein PHAVU_002G225100g             785   0.0      
ref|XP_006586810.1|  PREDICTED: sodium/hydrogen exchanger 6-like        785   0.0      
ref|XP_008375081.1|  PREDICTED: sodium/hydrogen exchanger 6 isofo...    785   0.0      
ref|XP_011040073.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    785   0.0      
ref|XP_008798741.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    784   0.0      
ref|XP_008798740.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    784   0.0      
ref|XP_006373541.1|  sodium proton exchanger family protein             784   0.0      
ref|XP_007026452.1|  Na+/H+ antiporter 6 isoform 3                      783   0.0      
ref|NP_001291225.1|  uncharacterized protein LOC105136432               780   0.0      
gb|AAX37333.1|  Na+/H+ antiporter                                       775   0.0      Populus tomentosa [Chinese white poplar]
ref|XP_010244806.1|  PREDICTED: sodium/hydrogen exchanger 6-like        773   0.0      
ref|XP_010058014.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    772   0.0      
ref|XP_010058013.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    771   0.0      
ref|XP_009385527.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    770   0.0      
ref|XP_004293432.1|  PREDICTED: LOW QUALITY PROTEIN: sodium/hydro...    766   0.0      
ref|XP_004159112.1|  PREDICTED: sodium/hydrogen exchanger 6-like        766   0.0      
ref|XP_004486408.1|  PREDICTED: sodium/hydrogen exchanger 6-like        763   0.0      
ref|XP_006389867.1|  hypothetical protein EUTSA_v10018385mg             756   0.0      
gb|KFK42371.1|  hypothetical protein AALP_AA2G247200                    756   0.0      
ref|XP_006467254.1|  PREDICTED: sodium/hydrogen exchanger 6-like        755   0.0      
gb|KFK35523.1|  hypothetical protein AALP_AA4G001900                    753   0.0      
ref|NP_178079.2|  sodium/hydrogen exchanger 6                           753   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006584123.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    753   0.0      
tpg|DAA60892.1|  TPA: hypothetical protein ZEAMMB73_538503              752   0.0      
gb|AAM08407.1|AF490590_1  Na+/H+ exchanger 6                            752   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004956447.1|  PREDICTED: sodium/hydrogen exchanger 6-like        751   0.0      
ref|XP_010472826.1|  PREDICTED: sodium/hydrogen exchanger 6             751   0.0      
ref|XP_003528718.2|  PREDICTED: sodium/hydrogen exchanger 6-like ...    750   0.0      
gb|ACG45634.1|  sodium/hydrogen exchanger family protein                751   0.0      Zea mays [maize]
ref|XP_010429857.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    751   0.0      
ref|XP_002889258.1|  predicted protein                                  750   0.0      
ref|NP_001140895.1|  uncharacterized protein LOC100272972               750   0.0      Zea mays [maize]
dbj|BAD29666.1|  putative Na+/H+ antiporter, isoform 2                  750   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062780.1|  Os09g0286400                                       750   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006392551.1|  hypothetical protein EUTSA_v10011392mg             749   0.0      
ref|XP_009104514.1|  PREDICTED: sodium/hydrogen exchanger 6-like        749   0.0      
gb|AFV60030.1|  Na+/K+-H+ antiporter NHX6                               747   0.0      
ref|XP_006660500.1|  PREDICTED: sodium/hydrogen exchanger 6-like        747   0.0      
gb|KHN14386.1|  Sodium/hydrogen exchanger 6                             745   0.0      
dbj|BAJ96264.1|  predicted protein                                      742   0.0      
ref|NP_175839.2|  sodium hydrogen exchanger 5                           741   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501256.1|  PREDICTED: sodium/hydrogen exchanger 5-like        741   0.0      
gb|AAM08406.1|AF490589_1  Na+/H+ exchanger 5                            740   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106685.1|  PREDICTED: sodium/hydrogen exchanger 6             741   0.0      
emb|CAO01506.1|  Na+/H+ antiporter                                      739   0.0      Mesembryanthemum crystallinum
gb|AFV60029.1|  Na+/K+-H+ antiporter NHX6                               739   0.0      
ref|XP_010539550.1|  PREDICTED: sodium/hydrogen exchanger 6 isofo...    740   0.0      
ref|XP_010539551.1|  PREDICTED: sodium/hydrogen exchanger 6 isofo...    739   0.0      
ref|XP_010480189.1|  PREDICTED: sodium/hydrogen exchanger 5             738   0.0      
ref|XP_003577939.1|  PREDICTED: sodium/hydrogen exchanger 6-like        738   0.0      
gb|ABC42029.2|  Na+,K+/H+ exchanger                                     736   0.0      Hordeum vulgare [barley]
ref|XP_002894567.1|  ATNHX5/NHX5                                        734   0.0      
ref|XP_010688709.1|  PREDICTED: sodium/hydrogen exchanger 6-like        732   0.0      
gb|AES64654.2|  Na+/H+ exchanger 1                                      730   0.0      
gb|EEC84267.1|  hypothetical protein OsI_30726                          726   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010928157.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    724   0.0      
gb|EEE69360.1|  hypothetical protein OsJ_28692                          724   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010928156.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    719   0.0      
ref|XP_010462489.1|  PREDICTED: sodium/hydrogen exchanger 5-like        715   0.0      
ref|XP_009420065.1|  PREDICTED: sodium/hydrogen exchanger 6-like        715   0.0      
ref|XP_008811144.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    713   0.0      
ref|XP_008811145.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    712   0.0      
ref|XP_008811204.1|  PREDICTED: sodium/hydrogen exchanger 6-like        710   0.0      
emb|CDX88553.1|  BnaC06g39970D                                          711   0.0      
ref|XP_010417630.1|  PREDICTED: LOW QUALITY PROTEIN: sodium/hydro...    708   0.0      
emb|CDX79331.1|  BnaC06g19720D                                          708   0.0      
emb|CDX67985.1|  BnaA07g20250D                                          708   0.0      
gb|KDO78604.1|  hypothetical protein CISIN_1g047772mg                   705   0.0      
gb|KHG02521.1|  Sodium/hydrogen exchanger 6 -like protein               702   0.0      
gb|EYU27611.1|  hypothetical protein MIMGU_mgv1a021839mg                703   0.0      
ref|XP_006307310.1|  hypothetical protein CARUB_v10008930mg             697   0.0      
gb|KGN65008.1|  hypothetical protein Csa_1G178240                       696   0.0      
ref|XP_003594403.1|  Sodium/hydrogen exchanger                          697   0.0      
ref|XP_004139605.1|  PREDICTED: sodium/hydrogen exchanger 6-like        698   0.0      
ref|XP_007154089.1|  hypothetical protein PHAVU_003G089800g             685   0.0      
gb|ABK24882.1|  unknown                                                 674   0.0      Picea sitchensis
ref|XP_007154088.1|  hypothetical protein PHAVU_003G089800g             658   0.0      
ref|XP_006661364.1|  PREDICTED: sodium/hydrogen exchanger 6-like        655   0.0      
ref|XP_006449955.1|  hypothetical protein CICLE_v10018215mg             649   0.0      
gb|KDP27356.1|  hypothetical protein JCGZ_20180                         648   0.0      
dbj|BAK05820.1|  predicted protein                                      645   0.0      
ref|XP_003576666.2|  PREDICTED: sodium/hydrogen exchanger 6-like        645   0.0      
ref|XP_008650841.1|  PREDICTED: hypothetical protein isoform X1         645   0.0      
ref|XP_011040074.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    640   0.0      
ref|XP_008650843.1|  PREDICTED: hypothetical protein isoform X2         642   0.0      
ref|XP_006392550.1|  hypothetical protein EUTSA_v10011392mg             615   0.0      
ref|XP_004959564.1|  PREDICTED: sodium/hydrogen exchanger 6-like        607   0.0      
gb|KHN40217.1|  Sodium/hydrogen exchanger 6                             583   0.0      
gb|ADM13397.1|  Na+/K+/H+ antiporter                                    583   0.0      
ref|XP_009385533.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    568   0.0      
gb|KHN40748.1|  Sodium/hydrogen exchanger 6                             558   0.0      
gb|AFK34247.1|  unknown                                                 543   0.0      
ref|XP_002967169.1|  hypothetical protein SELMODRAFT_144857             541   0.0      
gb|KHG23559.1|  Sodium/hydrogen exchanger 6 -like protein               535   0.0      
ref|XP_002960845.1|  hypothetical protein SELMODRAFT_163708             529   1e-177   
emb|CAJ26377.1|  sodium hydrogen sha-1                                  520   3e-174   Brachypodium sylvaticum
ref|XP_007212901.1|  hypothetical protein PRUPE_ppa021856mg             509   3e-168   
gb|AAF68127.1|AC010793_22  F20B17.4                                     498   5e-165   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001131172.1|  hypothetical protein                               475   5e-158   Zea mays [maize]
dbj|BAJ99158.1|  predicted protein                                      473   5e-157   
ref|XP_002460432.1|  hypothetical protein SORBIDRAFT_02g028040          449   9e-147   Sorghum bicolor [broomcorn]
ref|XP_001765719.1|  predicted protein                                  449   1e-146   
ref|XP_009374801.1|  PREDICTED: sodium/hydrogen exchanger 5 isofo...    439   3e-143   
ref|XP_008375080.1|  PREDICTED: sodium/hydrogen exchanger 6 isofo...    434   4e-143   
emb|CDP04566.1|  unnamed protein product                                433   8e-143   
ref|XP_008464323.1|  PREDICTED: sodium/hydrogen exchanger 6-like        420   2e-137   
emb|CBI40031.3|  unnamed protein product                                416   4e-136   
ref|XP_006301785.1|  hypothetical protein CARUB_v10022249mg             417   3e-134   
ref|XP_006878592.1|  hypothetical protein AMTR_s00011p00253150          401   9e-131   
gb|EMT03702.1|  Sodium/hydrogen exchanger 6                             401   1e-128   
ref|XP_007026450.1|  Na+/H+ antiporter 6 isoform 1                      406   5e-128   
gb|EMT17002.1|  Sodium/hydrogen exchanger 6                             393   1e-125   
emb|CDP04565.1|  unnamed protein product                                370   2e-119   
dbj|BAJ34110.1|  unnamed protein product                                362   4e-116   
gb|EPS63714.1|  sodium/hydrogen exchanger                               359   1e-115   
emb|CDX87370.1|  BnaA07g35030D                                          372   6e-115   
gb|AAD25617.1|AC005287_19  similar to Na+/H+-exchanging proteins        362   8e-112   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ09526.1|  hypothetical protein OsI_31802                          355   8e-112   Oryza sativa Indica Group [Indian rice]
emb|CBI40033.3|  unnamed protein product                                350   4e-111   
gb|EMS56409.1|  Sodium/hydrogen exchanger 6                             341   3e-105   
gb|ABD91508.1|  putative Na+/H+ antiporter isoform 2                    331   2e-101   Oryza sativa Indica Group [Indian rice]
gb|KCW75479.1|  hypothetical protein EUGRSUZ_E04240                     307   3e-95    
ref|XP_002961414.1|  hypothetical protein SELMODRAFT_76526              311   2e-93    
ref|XP_006878591.1|  hypothetical protein AMTR_s00011p00253040          300   4e-93    
ref|XP_002980783.1|  hypothetical protein SELMODRAFT_113308             308   3e-92    
gb|KCW75480.1|  hypothetical protein EUGRSUZ_E04241                     298   4e-92    
tpg|DAA60891.1|  TPA: hypothetical protein ZEAMMB73_538503              296   4e-91    
ref|XP_008465529.1|  PREDICTED: sodium/hydrogen exchanger 6-like        266   5e-80    
ref|XP_003058860.1|  monovalent Cation:Proton antiporter-1 family       271   2e-79    
ref|XP_004334873.1|  Na+/H+ antiporter                                  255   8e-72    
ref|XP_002501423.1|  monovalent Cation:Proton antiporter-1 family       257   3e-71    Micromonas commoda
ref|XP_002521167.1|  sodium/hydrogen exchanger 5, 6, putative           239   4e-71    Ricinus communis
gb|ABS72024.1|  putative sodium/hydrogen antiporter                     234   4e-69    Olea europaea
ref|XP_005850506.1|  hypothetical protein CHLNCDRAFT_140336             244   1e-67    
gb|KDO39930.1|  hypothetical protein CISIN_1g037375mg                   228   4e-66    
ref|NP_001184191.1|  uncharacterized protein LOC100216016               239   7e-66    
ref|XP_010616535.1|  PREDICTED: sodium/hydrogen exchanger 8             238   2e-65    
ref|XP_005002871.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    238   2e-65    
ref|XP_005325277.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    238   3e-65    
gb|EMS66231.1|  Sodium/hydrogen exchanger 6                             227   3e-65    
ref|XP_006929730.1|  PREDICTED: LOW QUALITY PROTEIN: sodium/hydro...    238   3e-65    
ref|XP_007078076.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    238   3e-65    
ref|XP_007078075.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    238   3e-65    
ref|XP_004585949.1|  PREDICTED: sodium/hydrogen exchanger 8             238   4e-65    
ref|XP_004636167.1|  PREDICTED: sodium/hydrogen exchanger 8             238   6e-65    
ref|XP_007439823.1|  PREDICTED: sodium/hydrogen exchanger 8-like        237   7e-65    
ref|XP_006048391.1|  PREDICTED: sodium/hydrogen exchanger 8             237   8e-65    
ref|XP_006175048.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    236   8e-65    
ref|XP_010833386.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    236   1e-64    
ref|XP_003583052.2|  PREDICTED: LOW QUALITY PROTEIN: sodium/hydro...    236   1e-64    
ref|XP_005635222.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    236   1e-64    
ref|XP_010020947.1|  PREDICTED: sodium/hydrogen exchanger 8             236   1e-64    
ref|XP_003787736.1|  PREDICTED: sodium/hydrogen exchanger 8             236   1e-64    
ref|NP_001034364.1|  sodium/hydrogen exchanger 8                        236   1e-64    Gallus gallus [bantam]
ref|XP_854123.2|  PREDICTED: sodium/hydrogen exchanger 8 isoform X4     236   1e-64    Canis lupus familiaris [dogs]
ref|NP_056081.1|  sodium/hydrogen exchanger 8 isoform 2                 236   2e-64    Homo sapiens [man]
ref|XP_514716.3|  PREDICTED: sodium/hydrogen exchanger 8 isoform X2     236   2e-64    Pan troglodytes
ref|XP_006018211.1|  PREDICTED: sodium/hydrogen exchanger 8             236   2e-64    
ref|XP_004412579.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    236   2e-64    
ref|XP_006267480.1|  PREDICTED: sodium/hydrogen exchanger 8             236   2e-64    
ref|XP_005635221.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    236   2e-64    
ref|XP_004062389.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    236   2e-64    
ref|XP_003932609.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    236   2e-64    
ref|XP_004412580.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    236   2e-64    
ref|XP_010382151.1|  PREDICTED: sodium/hydrogen exchanger 8             236   2e-64    
ref|XP_007936515.1|  PREDICTED: sodium/hydrogen exchanger 8             236   2e-64    
ref|XP_008994372.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    236   2e-64    
ref|XP_002747709.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    235   2e-64    Callithrix jacchus [common marmoset]
ref|XP_003214267.1|  PREDICTED: sodium/hydrogen exchanger 8             235   2e-64    
dbj|BAA76783.2|  KIAA0939 protein                                       236   2e-64    Homo sapiens [man]
ref|XP_002830455.2|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    235   3e-64    
ref|XP_009810475.1|  PREDICTED: sodium/hydrogen exchanger 8             236   3e-64    
ref|XP_006129521.1|  PREDICTED: sodium/hydrogen exchanger 8             235   3e-64    
ref|XP_010125473.1|  PREDICTED: sodium/hydrogen exchanger 8             235   3e-64    
ref|XP_006881689.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    235   3e-64    
ref|XP_003252969.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    235   3e-64    
ref|XP_005014219.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    235   3e-64    
ref|XP_007059904.1|  PREDICTED: sodium/hydrogen exchanger 8             236   4e-64    
ref|XP_005286277.1|  PREDICTED: sodium/hydrogen exchanger 8             235   4e-64    
ref|XP_006921966.1|  PREDICTED: sodium/hydrogen exchanger 8             235   4e-64    
ref|XP_006839255.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    235   4e-64    
ref|XP_010190306.1|  PREDICTED: sodium/hydrogen exchanger 8             235   4e-64    
ref|XP_008570064.1|  PREDICTED: sodium/hydrogen exchanger 8             234   4e-64    
ref|XP_006141339.1|  PREDICTED: sodium/hydrogen exchanger 8             234   4e-64    
ref|XP_004370312.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    234   4e-64    
ref|XP_005146861.1|  PREDICTED: sodium/hydrogen exchanger 8             235   4e-64    
ref|XP_004014928.1|  PREDICTED: sodium/hydrogen exchanger 8             235   5e-64    
ref|XP_004746278.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    234   5e-64    
ref|XP_005604764.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    234   5e-64    
ref|XP_004746277.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    234   5e-64    
ref|XP_009948945.1|  PREDICTED: sodium/hydrogen exchanger 8             234   6e-64    
ref|XP_008060132.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    234   6e-64    
ref|XP_002913048.1|  PREDICTED: sodium/hydrogen exchanger 8-like        236   6e-64    
ref|XP_010083356.1|  PREDICTED: sodium/hydrogen exchanger 8             234   6e-64    
ref|XP_007185376.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    234   6e-64    
ref|XP_010307884.1|  PREDICTED: sodium/hydrogen exchanger 8             234   6e-64    
ref|XP_009463840.1|  PREDICTED: sodium/hydrogen exchanger 8             234   6e-64    
ref|XP_009503942.1|  PREDICTED: sodium/hydrogen exchanger 8             234   6e-64    
ref|XP_010154421.1|  PREDICTED: sodium/hydrogen exchanger 8             234   6e-64    
ref|XP_009231981.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    233   6e-64    
ref|XP_007185377.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    234   7e-64    
ref|XP_004785747.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    234   7e-64    
ref|XP_010292571.1|  PREDICTED: sodium/hydrogen exchanger 8             234   7e-64    
ref|XP_009997070.1|  PREDICTED: sodium/hydrogen exchanger 8             234   7e-64    
ref|XP_008833079.1|  PREDICTED: sodium/hydrogen exchanger 8             234   7e-64    
ref|XP_008249980.1|  PREDICTED: sodium/hydrogen exchanger 8             234   7e-64    
ref|XP_005362914.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    234   8e-64    
ref|XP_005525026.1|  PREDICTED: sodium/hydrogen exchanger 8             234   8e-64    
ref|XP_005362916.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    234   8e-64    
ref|XP_010160824.1|  PREDICTED: sodium/hydrogen exchanger 8             234   8e-64    
gb|EAW75648.1|  solute carrier family 9 (sodium/hydrogen exchange...    234   8e-64    
ref|XP_010140949.1|  PREDICTED: sodium/hydrogen exchanger 8             234   9e-64    
ref|XP_010567967.1|  PREDICTED: sodium/hydrogen exchanger 8             234   9e-64    
ref|XP_007475815.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    234   9e-64    
ref|XP_010201422.1|  PREDICTED: sodium/hydrogen exchanger 8             234   9e-64    
ref|XP_009488793.1|  PREDICTED: sodium/hydrogen exchanger 8             234   9e-64    
ref|XP_005057545.1|  PREDICTED: sodium/hydrogen exchanger 8             234   1e-63    
ref|XP_009932122.1|  PREDICTED: sodium/hydrogen exchanger 8             233   1e-63    
ref|XP_008935513.1|  PREDICTED: sodium/hydrogen exchanger 8             234   1e-63    
ref|XP_009557060.1|  PREDICTED: sodium/hydrogen exchanger 8             234   1e-63    
ref|XP_009669454.1|  PREDICTED: sodium/hydrogen exchanger 8             234   1e-63    
ref|XP_008139388.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    233   1e-63    
ref|XP_007533248.1|  PREDICTED: sodium/hydrogen exchanger 8             233   1e-63    
ref|XP_009867546.1|  PREDICTED: sodium/hydrogen exchanger 8             234   1e-63    
ref|XP_009280922.1|  PREDICTED: sodium/hydrogen exchanger 8             234   1e-63    
ref|XP_004687526.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    233   1e-63    
ref|XP_004430343.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    233   1e-63    
ref|XP_005502780.1|  PREDICTED: sodium/hydrogen exchanger 8             235   1e-63    
ref|XP_004663927.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    233   1e-63    
ref|XP_009643706.1|  PREDICTED: sodium/hydrogen exchanger 8             234   2e-63    
ref|XP_009989806.1|  PREDICTED: sodium/hydrogen exchanger 8             233   2e-63    
ref|XP_007100362.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    233   2e-63    
ref|XP_009325119.1|  PREDICTED: sodium/hydrogen exchanger 8             234   2e-63    
ref|XP_005983434.1|  PREDICTED: sodium/hydrogen exchanger 8             233   2e-63    
ref|XP_004663928.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    233   2e-63    
ref|XP_004698110.1|  PREDICTED: sodium/hydrogen exchanger 8             233   2e-63    
ref|XP_005236030.1|  PREDICTED: sodium/hydrogen exchanger 8             234   2e-63    
ref|XP_009091547.1|  PREDICTED: sodium/hydrogen exchanger 8             233   2e-63    
ref|XP_009901535.1|  PREDICTED: sodium/hydrogen exchanger 8             233   2e-63    
ref|XP_008920042.1|  PREDICTED: sodium/hydrogen exchanger 8             234   2e-63    
ref|XP_009582209.1|  PREDICTED: sodium/hydrogen exchanger 8             233   2e-63    
ref|XP_010395074.1|  PREDICTED: sodium/hydrogen exchanger 8             233   2e-63    
ref|XP_005435991.1|  PREDICTED: sodium/hydrogen exchanger 8             234   2e-63    
ref|NP_001020452.1|  sodium/hydrogen exchanger 8                        233   2e-63    Rattus norvegicus [brown rat]
ref|XP_009923311.1|  PREDICTED: sodium/hydrogen exchanger 8             233   2e-63    
ref|XP_003431253.2|  PREDICTED: LOW QUALITY PROTEIN: sodium/hydro...    233   2e-63    
gb|EDL96407.1|  solute carrier family 9 (sodium/hydrogen exchange...    232   3e-63    
ref|XP_008634845.1|  PREDICTED: sodium/hydrogen exchanger 8             233   3e-63    
ref|XP_005866290.1|  PREDICTED: sodium/hydrogen exchanger 8             234   3e-63    
ref|XP_005423749.1|  PREDICTED: sodium/hydrogen exchanger 8             233   3e-63    
ref|NP_683731.1|  sodium/hydrogen exchanger 8 isoform a                 232   3e-63    Mus musculus [mouse]
ref|XP_006758877.1|  PREDICTED: sodium/hydrogen exchanger 8             234   3e-63    
ref|XP_007100361.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    232   3e-63    
gb|EFB26684.1|  hypothetical protein PANDA_000803                       232   3e-63    Ailuropoda melanoleuca
ref|XP_002187088.2|  PREDICTED: sodium/hydrogen exchanger 8             233   4e-63    Taeniopygia guttata
ref|XP_005392384.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    231   4e-63    
ref|XP_009082328.1|  PREDICTED: sodium/hydrogen exchanger 8             233   4e-63    
ref|XP_010833388.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    231   5e-63    
ref|XP_007641284.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    232   6e-63    
ref|XP_008959712.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    230   6e-63    
ref|XP_008994373.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    230   7e-63    
ref|XP_005014217.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    232   9e-63    
ref|XP_005014216.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    232   9e-63    
ref|XP_009891784.1|  PREDICTED: sodium/hydrogen exchanger 8             231   9e-63    
ref|XP_006992696.1|  PREDICTED: sodium/hydrogen exchanger 8             233   1e-62    
ref|XP_006881688.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    231   1e-62    
ref|XP_005074481.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    230   1e-62    
ref|XP_004883652.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    230   2e-62    
ref|XP_008504535.1|  PREDICTED: sodium/hydrogen exchanger 8             231   2e-62    
ref|XP_002594162.1|  hypothetical protein BRAFLDRAFT_275513             229   2e-62    
gb|KFO53355.1|  Sodium/hydrogen exchanger 8                             230   2e-62    
ref|XP_005537397.1|  sodium/hydrogen antiporter NHE8                    233   2e-62    
ref|XP_008108337.1|  PREDICTED: sodium/hydrogen exchanger 8             230   2e-62    
gb|KFO74566.1|  Sodium/hydrogen exchanger 8                             229   3e-62    
gb|KFQ10819.1|  Sodium/hydrogen exchanger 8                             229   3e-62    
gb|KFU90437.1|  Sodium/hydrogen exchanger 8                             230   3e-62    
ref|XP_004618815.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    230   3e-62    
ref|XP_010833387.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    229   3e-62    
ref|XP_005492102.1|  PREDICTED: sodium/hydrogen exchanger 8             230   3e-62    
gb|KFV53644.1|  Sodium/hydrogen exchanger 8                             229   4e-62    
ref|XP_007100363.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    228   4e-62    
gb|KFO06200.1|  Sodium/hydrogen exchanger 8                             229   4e-62    
ref|XP_007446450.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    229   4e-62    
gb|KFW09399.1|  Sodium/hydrogen exchanger 8                             229   4e-62    
ref|XP_007446452.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    229   5e-62    
gb|KFQ97330.1|  Sodium/hydrogen exchanger 8                             229   5e-62    
gb|KFM09776.1|  Sodium/hydrogen exchanger 8                             229   5e-62    
ref|XP_009702939.1|  PREDICTED: sodium/hydrogen exchanger 8             227   5e-62    
ref|XP_007078077.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    229   5e-62    
ref|XP_005002872.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    229   5e-62    
dbj|BAE25331.1|  unnamed protein product                                229   5e-62    
gb|KFP95003.1|  Sodium/hydrogen exchanger 8                             229   5e-62    
gb|KFO93792.1|  Sodium/hydrogen exchanger 8                             229   5e-62    
gb|KFQ44770.1|  Sodium/hydrogen exchanger 8                             229   5e-62    
gb|KFW91546.1|  Sodium/hydrogen exchanger 8                             229   6e-62    
ref|XP_004282938.1|  PREDICTED: sodium/hydrogen exchanger 8             228   7e-62    
gb|KFZ53273.1|  Sodium/hydrogen exchanger 8                             228   7e-62    
ref|XP_005102642.1|  PREDICTED: sodium/hydrogen exchanger 8-like        231   7e-62    
gb|KFQ82060.1|  Sodium/hydrogen exchanger 8                             228   7e-62    
ref|XP_005688703.1|  PREDICTED: sodium/hydrogen exchanger 8             228   8e-62    
ref|XP_008862953.1|  sodium/hydrogen exchanger 3                        227   9e-62    
ref|XP_006175049.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    228   1e-61    
gb|KFW10417.1|  Sodium/hydrogen exchanger 8                             228   1e-61    
ref|XP_008696424.1|  PREDICTED: sodium/hydrogen exchanger 8             229   1e-61    
gb|KFQ65743.1|  Sodium/hydrogen exchanger 8                             228   1e-61    
gb|KFP88583.1|  Sodium/hydrogen exchanger 8                             228   2e-61    
ref|XP_004412578.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    228   2e-61    
gb|KFV79330.1|  Sodium/hydrogen exchanger 8                             228   2e-61    
gb|KFR10099.1|  Sodium/hydrogen exchanger 8                             227   2e-61    
ref|XP_005215117.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    228   2e-61    
gb|KFQ26851.1|  Sodium/hydrogen exchanger 8                             227   2e-61    
ref|XP_004370311.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    228   2e-61    
ref|XP_005635223.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    228   2e-61    
ref|NP_001247420.1|  sodium/hydrogen exchanger 8 isoform 1              227   2e-61    
ref|XP_007185375.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    227   3e-61    
gb|KFV69419.1|  Sodium/hydrogen exchanger 8                             227   3e-61    
gb|KFV06071.1|  Sodium/hydrogen exchanger 8                             227   3e-61    
ref|XP_004062390.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    227   3e-61    
ref|XP_006235708.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    225   3e-61    
ref|XP_006500458.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    225   4e-61    
ref|XP_004430342.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    227   4e-61    
ref|XP_004090129.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    227   4e-61    
ref|XP_004858125.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    229   4e-61    
gb|KFW74522.1|  Sodium/hydrogen exchanger 8                             226   4e-61    
ref|XP_007185374.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    227   4e-61    
gb|EHH19606.1|  hypothetical protein EGK_02305                          226   5e-61    
gb|KGL99922.1|  Sodium/hydrogen exchanger 8                             226   5e-61    
ref|XP_005392383.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    223   6e-61    
gb|KFZ57391.1|  Sodium/hydrogen exchanger 8                             226   7e-61    
ref|XP_004785748.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    226   8e-61    
gb|KFV16669.1|  Sodium/hydrogen exchanger 8                             226   8e-61    
ref|XP_004785746.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    226   8e-61    
gb|ELR53608.1|  Sodium/hydrogen exchanger 8                             226   9e-61    
ref|XP_004746276.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    226   9e-61    
ref|XP_005992098.1|  PREDICTED: sodium/hydrogen exchanger 8             227   9e-61    
ref|XP_008139387.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    226   1e-60    
ref|XP_005362915.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    225   1e-60    
ref|XP_006839254.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    225   1e-60    
gb|KFO97912.1|  Sodium/hydrogen exchanger 8                             225   1e-60    
ref|XP_006677766.1|  hypothetical protein BATDEDRAFT_10823              222   2e-60    
ref|XP_001632734.1|  predicted protein                                  224   2e-60    
ref|XP_009821029.1|  sodium/hydrogen exchanger 3                        223   2e-60    
ref|XP_005014218.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    225   2e-60    
gb|KFP32233.1|  Sodium/hydrogen exchanger 8                             224   2e-60    
ref|XP_004687525.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    224   2e-60    
gb|KFP69216.1|  Sodium/hydrogen exchanger 8                             224   3e-60    
ref|XP_004546038.1|  PREDICTED: sodium/hydrogen exchanger 8-like ...    225   6e-60    
gb|EPS57367.1|  hypothetical protein M569_17451                         211   6e-60    
ref|XP_009015529.1|  hypothetical protein HELRODRAFT_64443              224   6e-60    
ref|XP_008860913.1|  sodium/hydrogen exchanger 3                        222   6e-60    
ref|XP_004618814.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    223   7e-60    
ref|XP_005940328.1|  PREDICTED: sodium/hydrogen exchanger 8-like        224   8e-60    
ref|XP_003586871.2|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    222   8e-60    
gb|KDO33451.1|  sodium/hydrogen exchanger 3                             221   8e-60    
ref|XP_006796387.1|  PREDICTED: sodium/hydrogen exchanger 8-like        224   8e-60    
gb|ABU68838.1|  sodium hydrogen exchanger 8                             224   9e-60    
ref|XP_003439075.1|  PREDICTED: sodium/hydrogen exchanger 8-like        224   9e-60    
gb|EPQ07770.1|  Sodium/hydrogen exchanger 8                             221   1e-59    
ref|XP_006639648.1|  PREDICTED: sodium/hydrogen exchanger 8-like        223   1e-59    
dbj|BAD32347.1|  mKIAA0939 protein                                      221   1e-59    
ref|XP_004883651.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    223   1e-59    
dbj|BAE75801.1|  NHE8                                                   224   1e-59    
ref|XP_003693130.1|  PREDICTED: sodium/hydrogen exchanger 8-like        223   1e-59    
ref|XP_008615246.1|  sodium/hydrogen exchanger 3                        220   2e-59    
ref|XP_007185378.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    221   2e-59    
ref|XP_003963383.1|  PREDICTED: sodium/hydrogen exchanger 8-like        224   2e-59    
ref|XP_002160485.2|  PREDICTED: sodium/hydrogen exchanger 8-like        221   2e-59    
gb|AGE32322.1|  Na+/H+ antiporter                                       207   2e-59    
gb|ERG79434.1|  sodium hydrogen exchanger 8                             223   2e-59    
ref|NP_001008586.1|  sodium/hydrogen exchanger 8 precursor              222   3e-59    
ref|XP_004533348.1|  PREDICTED: sodium/hydrogen exchanger 8-like        223   3e-59    
ref|XP_007185379.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    220   3e-59    
ref|XP_008181309.1|  PREDICTED: sodium/hydrogen exchanger 8             222   3e-59    
ref|XP_006616403.1|  PREDICTED: sodium/hydrogen exchanger 8-like ...    223   4e-59    
ref|XP_004342865.1|  solute carrier family 9                            221   4e-59    
ref|XP_010810063.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    220   4e-59    
gb|EOB05336.1|  Sodium/hydrogen exchanger 8                             221   4e-59    
ref|XP_003702148.1|  PREDICTED: sodium/hydrogen exchanger 8-like        223   7e-59    
ref|XP_005825896.1|  hypothetical protein GUITHDRAFT_44283              214   7e-59    
gb|KFP67223.1|  Sodium/hydrogen exchanger 8                             218   7e-59    
ref|XP_008558974.1|  PREDICTED: sodium/hydrogen exchanger 8             223   7e-59    
ref|XP_010750022.1|  PREDICTED: sodium/hydrogen exchanger 8             221   8e-59    
gb|EFN88906.1|  Sodium/hydrogen exchanger 8                             223   8e-59    
ref|XP_001604457.1|  PREDICTED: sodium/hydrogen exchanger 8-like        223   9e-59    
ref|XP_003396514.1|  PREDICTED: sodium/hydrogen exchanger 8-like        222   9e-59    
gb|EFN72570.1|  Sodium/hydrogen exchanger 8                             222   1e-58    
ref|XP_008298618.1|  PREDICTED: sodium/hydrogen exchanger 8             221   1e-58    
ref|XP_007883746.1|  PREDICTED: sodium/hydrogen exchanger 8             222   1e-58    
ref|XP_008613453.1|  sodium/hydrogen exchanger 3                        218   1e-58    
ref|XP_005801751.1|  PREDICTED: sodium/hydrogen exchanger 8-like        221   1e-58    
ref|XP_006616402.1|  PREDICTED: sodium/hydrogen exchanger 8-like ...    222   1e-58    
gb|ELK33986.1|  Sodium/hydrogen exchanger 8                             218   2e-58    
gb|ABX71221.1|  sodium/hydrogen exchanger 8                             220   2e-58    
ref|XP_003487707.1|  PREDICTED: sodium/hydrogen exchanger 8-like        221   2e-58    
ref|XP_006568416.1|  PREDICTED: sodium/hydrogen exchanger 8             221   2e-58    
gb|EZA51996.1|  Sodium/hydrogen exchanger                               221   3e-58    
ref|XP_008412122.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    219   4e-58    
ref|XP_002131470.1|  PREDICTED: sodium/hydrogen exchanger 8-like        219   4e-58    
gb|EKC33650.1|  Sodium/hydrogen exchanger 8                             219   4e-58    
ref|XP_004070550.1|  PREDICTED: sodium/hydrogen exchanger 8-like        219   6e-58    
ref|XP_011063626.1|  PREDICTED: LOW QUALITY PROTEIN: sodium/hydro...    220   6e-58    
ref|XP_006821443.1|  PREDICTED: sodium/hydrogen exchanger 7-like        218   2e-57    
ref|XP_004997093.1|  hypothetical protein PTSG_01123                    218   2e-57    
ref|XP_007557719.1|  PREDICTED: sodium/hydrogen exchanger 8             218   2e-57    
ref|XP_004931477.1|  PREDICTED: sodium/hydrogen exchanger 8-like        218   3e-57    
ref|XP_001807104.1|  PREDICTED: sodium/hydrogen exchanger 8             217   3e-57    
ref|XP_009033252.1|  hypothetical protein AURANDRAFT_19894              214   3e-57    
emb|CCA25725.1|  Monovalent Cation:Proton Antiporter1 (CPA1) Fami...    214   4e-57    
ref|XP_002001558.1|  GI16224                                            217   4e-57    
ref|XP_001745270.1|  hypothetical protein                               209   5e-57    
emb|CCA25724.1|  Monovalent Cation:Proton Antiporter1 (CPA1) Fami...    214   5e-57    
ref|XP_001865206.1|  sodium/hydrogen exchanger 8                        216   5e-57    
gb|KDO28251.1|  sodium/hydrogen exchanger 3                             214   5e-57    
ref|XP_001842806.1|  sodium/hydrogen exchanger 8                        216   5e-57    
gb|EHJ75420.1|  sodium/hydrogen exchanger 8                             216   5e-57    
emb|CCA25723.1|  Monovalent Cation:Proton Antiporter1 (CPA1) Fami...    214   5e-57    
emb|CCA25722.1|  Monovalent Cation:Proton Antiporter1 (CPA1) Fami...    214   6e-57    
ref|XP_009830068.1|  sodium/hydrogen exchanger 3                        213   8e-57    
ref|XP_009051590.1|  hypothetical protein LOTGIDRAFT_152832             213   8e-57    
ref|XP_008317568.1|  PREDICTED: sodium/hydrogen exchanger 8             215   9e-57    
gb|EFZ20298.1|  hypothetical protein SINV_03720                         216   9e-57    
gb|KFB39964.1|  AGAP009446-PA-like protein                              215   1e-56    
gb|ETN59290.1|  sodium/hydrogen exchanger 5, 6, 8 (nhe5, nhe6, nhe8)    216   1e-56    
ref|XP_002059116.1|  GJ16207                                            213   1e-56    
gb|EFX88428.1|  hypothetical protein DAPPUDRAFT_311311                  215   1e-56    
gb|KDR17572.1|  Sodium/hydrogen exchanger 8                             213   1e-56    
gb|KHN71943.1|  Sodium/hydrogen exchanger 8                             216   1e-56    
ref|XP_001989429.1|  GH11719                                            215   1e-56    
ref|XP_003074064.1|  Na+/H+ antiporter, isoform 2 (ISS)                 215   1e-56    
ref|XP_307859.4|  AGAP009446-PA                                         215   2e-56    
gb|EGI59762.1|  Sodium/hydrogen exchanger 8                             216   2e-56    
ref|XP_008619389.1|  sodium/hydrogen exchanger 3                        211   3e-56    
ref|XP_002182769.1|  predicted protein                                  210   3e-56    
ref|XP_010874117.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    214   3e-56    
ref|XP_009830321.1|  sodium/hydrogen exchanger 3                        212   3e-56    
ref|XP_010874116.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    214   3e-56    
ref|XP_009830322.1|  sodium/hydrogen exchanger 3, variant               212   3e-56    
emb|CEF96466.1|  Cation/H+ exchanger                                    215   3e-56    
ref|XP_004385152.1|  PREDICTED: sodium/hydrogen exchanger 9             212   4e-56    
ref|XP_001879705.1|  predicted protein                                  209   4e-56    
ref|XP_005178440.1|  PREDICTED: sodium/hydrogen exchanger 8-like        215   4e-56    
ref|XP_008861133.1|  sodium/hydrogen exchanger 3, variant 2             212   5e-56    
ref|XP_007502157.1|  PREDICTED: sodium/hydrogen exchanger 9             213   7e-56    
ref|XP_003740917.1|  PREDICTED: sodium/hydrogen exchanger 7-like        213   9e-56    
gb|ERL89967.1|  hypothetical protein D910_07326                         213   9e-56    
ref|XP_005806022.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    213   1e-55    
ref|XP_004546037.1|  PREDICTED: sodium/hydrogen exchanger 8-like ...    213   1e-55    
emb|CBY21052.1|  unnamed protein product                                211   1e-55    
gb|EFX79785.1|  hypothetical protein DAPPUDRAFT_304367                  211   1e-55    
ref|XP_005325279.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    210   2e-55    
ref|XP_008412121.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    212   2e-55    
ref|XP_008412123.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    212   2e-55    
ref|XP_003467766.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    209   2e-55    
ref|XP_007890886.1|  PREDICTED: sodium/hydrogen exchanger 6             212   2e-55    
ref|XP_008861123.1|  sodium/hydrogen exchanger 3, variant 3             209   2e-55    
ref|XP_008861129.1|  sodium/hydrogen exchanger 3, variant 9             208   2e-55    
ref|XP_002087373.1|  GE16483                                            211   3e-55    
ref|XP_002406848.1|  sodium/proton exchanger, putative                  211   3e-55    
ref|XP_002427099.1|  sodium/hydrogen exchanger, putative                212   3e-55    
gb|EST08042.1|  hypothetical protein PSEUBRA_SCAF19g03279               213   3e-55    
ref|XP_793792.3|  PREDICTED: sodium/hydrogen exchanger 7-like           209   4e-55    
ref|XP_005080792.1|  PREDICTED: sodium/hydrogen exchanger 9             210   4e-55    
ref|XP_010341414.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    207   4e-55    
ref|XP_003389980.1|  PREDICTED: sodium/hydrogen exchanger 8-like        209   4e-55    
gb|ENN79908.1|  hypothetical protein YQE_03727                          213   4e-55    
ref|XP_010904369.1|  PREDICTED: sodium/hydrogen exchanger 6-like ...    211   4e-55    
ref|XP_009214201.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    207   5e-55    
ref|XP_002077583.1|  GD22991                                            210   5e-55    
ref|XP_002646099.1|  C. briggsae CBR-NHX-8 protein                      211   6e-55    
ref|XP_798978.2|  PREDICTED: sodium/hydrogen exchanger 9-like           211   6e-55    
gb|KDO31286.1|  sodium/hydrogen exchanger 3                             205   7e-55    
ref|NP_608491.3|  Na[+]/H[+] hydrogen exchanger 1                       210   7e-55    
ref|XP_008994374.1|  PREDICTED: sodium/hydrogen exchanger 8 isofo...    207   7e-55    
ref|NP_001021729.1|  Protein NHX-8, isoform b                           210   8e-55    
ref|XP_002041526.1|  GM16702                                            210   8e-55    
gb|EGT31371.1|  hypothetical protein CAEBREN_17701                      210   9e-55    
ref|XP_001415364.1|  CPA1 family transporter: sodium ion/proton         202   1e-54    
ref|XP_010606454.1|  PREDICTED: sodium/hydrogen exchanger 9 isofo...    209   1e-54    
gb|AAL39869.1|  LP02993p                                                209   1e-54    
gb|AAD32689.1|AF142676_1  sodium-hydrogen exchanger NHE1                207   1e-54    
ref|NP_001021728.1|  Protein NHX-8, isoform a                           209   1e-54    
ref|XP_006869924.1|  PREDICTED: sodium/hydrogen exchanger 9             209   1e-54    
ref|XP_003107509.1|  CRE-NHX-8 protein                                  209   1e-54    
gb|EPB88261.1|  sodium/hydrogen exchanger 3                             209   2e-54    
ref|XP_009199838.1|  PREDICTED: sodium/hydrogen exchanger 9 isofo...    207   2e-54    
ref|XP_009237662.1|  PREDICTED: sodium/hydrogen exchanger 9             208   2e-54    



>ref|XP_009789503.1| PREDICTED: sodium/hydrogen exchanger 6-like [Nicotiana sylvestris]
Length=532

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/521 (87%), Positives = 488/521 (94%), Gaps = 10/521 (2%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRRHRFYY+PEASASLLIGLIVGGLANIS+TET
Sbjct  17    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRHRFYYIPEASASLLIGLIVGGLANISNTET  76

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAI+TFAI GTFIAS+VTG+LV
Sbjct  77    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIITFAILGTFIASIVTGILV  136

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GGV  LMYKLPF+ECLMFG+LISA+DPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  137   YLGGVTYLMYKLPFVECLMFGALISASDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  196

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRSN S+GQN+FMITVRF ETF GS+SAGVGVGF+SALLFKYAGLDIDNLQ
Sbjct  197   ISLYRTMSLVRSNMSTGQNYFMITVRFFETFMGSLSAGVGVGFVSALLFKYAGLDIDNLQ  256

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLE CLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMKRYTYSNLS+SSQRFVS+FFHLIS
Sbjct  257   NLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGVVMKRYTYSNLSESSQRFVSAFFHLIS  316

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAME+HSW+HVGFIFFSILFI IARAANVFGCAYLVNLVRP +RKI
Sbjct  317   SLAETFVFIYMGFDIAMEKHSWSHVGFIFFSILFIVIARAANVFGCAYLVNLVRPPHRKI  376

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P  HQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLIIGGSTGTML
Sbjct  377   PANHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLIIGGSTGTML  436

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAP-----SYDEESSSGSRFKMKLKEFHKST  514
             EAL+VVGD +      G+LGE  EG+NGYIAP     SYD ESSSG+RF+MKLKEFHKST
Sbjct  437   EALEVVGDGH-----AGSLGETFEGNNGYIAPSYSDESYDGESSSGNRFRMKLKEFHKST  491

Query  513   SSFTAIDRNYLTPFFTTQNGDEDEQEELISNSRRARYSGHS  391
             +SF+A+D+NYLTPFFTTQ GDEDE E ++ +SRR  Y GH+
Sbjct  492   TSFSALDKNYLTPFFTTQGGDEDEDEPIMHSSRRGVYDGHN  532



>ref|XP_009603482.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603483.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X2 [Nicotiana 
tomentosiformis]
Length=532

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/521 (86%), Positives = 488/521 (94%), Gaps = 10/521 (2%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRRHRFYY+PEASASLLIGLIVGGLAN+S+TET
Sbjct  17    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRHRFYYIPEASASLLIGLIVGGLANVSNTET  76

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAI+TFAI GTFIAS+VTG+LV
Sbjct  77    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIITFAILGTFIASIVTGILV  136

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GGV  LMYKLPF+ECLMFG+LISA+DPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  137   YLGGVTYLMYKLPFVECLMFGALISASDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  196

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRSN S+GQN+FMITVRF ETF GS+SAGVGVGF+SALLFKYAGLDIDNLQ
Sbjct  197   ISLYRTMSLVRSNMSTGQNYFMITVRFFETFMGSLSAGVGVGFVSALLFKYAGLDIDNLQ  256

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLE CLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMKRYTYSNLS+SSQRFVS+FFHLIS
Sbjct  257   NLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGVVMKRYTYSNLSESSQRFVSAFFHLIS  316

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAME+HSW+HVGFIFFSILFI IARAANVFGCAYLVNLVRP +RKI
Sbjct  317   SLAETFVFIYMGFDIAMEKHSWSHVGFIFFSILFIVIARAANVFGCAYLVNLVRPPHRKI  376

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P  HQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLIIGGSTGTML
Sbjct  377   PANHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLIIGGSTGTML  436

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAP-----SYDEESSSGSRFKMKLKEFHKST  514
             EAL+VVGD +      G+LGE  EG+NGYIAP     SYD ESSSG+RF+MKLKEFHKST
Sbjct  437   EALEVVGDGH-----AGSLGETFEGNNGYIAPSYSDESYDGESSSGNRFRMKLKEFHKST  491

Query  513   SSFTAIDRNYLTPFFTTQNGDEDEQEELISNSRRARYSGHS  391
             +SF+A+D+NYLTPFFTTQ GDEDE E ++ +SRR  Y GH+
Sbjct  492   TSFSALDKNYLTPFFTTQGGDEDEDEPIMHSSRRGVYDGHN  532



>ref|XP_011095848.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X2 [Sesamum 
indicum]
Length=522

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/518 (86%), Positives = 479/518 (92%), Gaps = 6/518 (1%)
 Frame = -1

Query  1956  LPPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLAN  1777
             +P     K+Q+AAGVGILLQIMMLVLSF+LGHVLRRHRFYYLPEASASLLIGLIVG LAN
Sbjct  10    VPRGSPAKEQQAAGVGILLQIMMLVLSFVLGHVLRRHRFYYLPEASASLLIGLIVGALAN  69

Query  1776  ISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASM  1597
             IS+TET+IRAWFNFHEEFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTFAIFGTF+AS+
Sbjct  70    ISNTETSIRAWFNFHEEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFAIFGTFVASV  129

Query  1596  VTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESV  1417
             VTG+LVY+ GV  L+YKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESV
Sbjct  130   VTGILVYLAGVTYLIYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESV  189

Query  1416  LNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGL  1237
             LNDAMAISLYRTMSLVRSN SSGQNFFM+ VRF+ETF GSMSAGVGVGF SALLFKYAGL
Sbjct  190   LNDAMAISLYRTMSLVRSNMSSGQNFFMVVVRFLETFVGSMSAGVGVGFTSALLFKYAGL  249

Query  1236  DIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSS  1057
             DIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK Y++SNLSD SQ+FVS+
Sbjct  250   DIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYSFSNLSDKSQKFVSA  309

Query  1056  FFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVR  877
             FFHLISSLAETFVFIYMGFDIAMEQHSW+H+GFIFFSILFIGIARAANVF CAYLVNLVR
Sbjct  310   FFHLISSLAETFVFIYMGFDIAMEQHSWSHIGFIFFSILFIGIARAANVFSCAYLVNLVR  369

Query  876   PANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGG  697
             PA+RKIP KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGG
Sbjct  370   PAHRKIPMKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGG  429

Query  696   STGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKS  517
             STGTMLEAL VVGDD+D      TLGE  + +NGY AP+Y+ ESSSG+RFKMKLKE  KS
Sbjct  430   STGTMLEALQVVGDDHD------TLGESFDTNNGYRAPTYEGESSSGNRFKMKLKELSKS  483

Query  516   TSSFTAIDRNYLTPFFTTQNGDEDEQEELISNSRRARY  403
             T+SFTA D+NYLTPFFT+QNGDEDE +EL  +SR   Y
Sbjct  484   TASFTAFDKNYLTPFFTSQNGDEDEHDELFGDSRGGGY  521



>ref|XP_011095847.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X1 [Sesamum 
indicum]
Length=532

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/522 (84%), Positives = 476/522 (91%), Gaps = 4/522 (1%)
 Frame = -1

Query  1956  LPPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLAN  1777
             +P     K+Q+AAGVGILLQIMMLVLSF+LGHVLRRHRFYYLPEASASLLIGLIVG LAN
Sbjct  10    VPRGSPAKEQQAAGVGILLQIMMLVLSFVLGHVLRRHRFYYLPEASASLLIGLIVGALAN  69

Query  1776  ISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASM  1597
             IS+TET+IRAWFNFHEEFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTFAIFGTF+AS+
Sbjct  70    ISNTETSIRAWFNFHEEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFAIFGTFVASV  129

Query  1596  VTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESV  1417
             VTG+LVY+ GV  L+YKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESV
Sbjct  130   VTGILVYLAGVTYLIYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESV  189

Query  1416  LNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGL  1237
             LNDAMAISLYRTMSLVRSN SSGQNFFM+ VRF+ETF GSMSAGVGVGF SALLFKYAGL
Sbjct  190   LNDAMAISLYRTMSLVRSNMSSGQNFFMVVVRFLETFVGSMSAGVGVGFTSALLFKYAGL  249

Query  1236  DIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSS  1057
             DIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK Y++SNLSD SQ+FVS+
Sbjct  250   DIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYSFSNLSDKSQKFVSA  309

Query  1056  FFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVR  877
             FFHLISSLAETFVFIYMGFDIAMEQHSW+H+GFIFFSILFIGIARAANVF CAYLVNLVR
Sbjct  310   FFHLISSLAETFVFIYMGFDIAMEQHSWSHIGFIFFSILFIGIARAANVFSCAYLVNLVR  369

Query  876   PANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGG  697
             PA+RKIP KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGG
Sbjct  370   PAHRKIPMKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGG  429

Query  696   STGTMLEALDVVGDDYDsslgtgtlge----rlegSNGYIAPSYDEESSSGSRFKMKLKE  529
             STGTMLEAL VVGDD+D+               + +NGY AP+Y+ ESSSG+RFKMKLKE
Sbjct  430   STGTMLEALQVVGDDHDTLGEVSHALSGEELSFDTNNGYRAPTYEGESSSGNRFKMKLKE  489

Query  528   FHKSTSSFTAIDRNYLTPFFTTQNGDEDEQEELISNSRRARY  403
               KST+SFTA D+NYLTPFFT+QNGDEDE +EL  +SR   Y
Sbjct  490   LSKSTASFTAFDKNYLTPFFTSQNGDEDEHDELFGDSRGGGY  531



>ref|XP_008224672.1| PREDICTED: sodium/hydrogen exchanger 6-like [Prunus mume]
Length=538

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/516 (86%), Positives = 484/516 (94%), Gaps = 6/516 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS+TET
Sbjct  23    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANISNTET  82

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             NIR WFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAI GT I+S+VTG+LV
Sbjct  83    NIRTWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAILGTLISSVVTGILV  142

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+I L Y+LPF+ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLNDAMA
Sbjct  143   YLGGLIYLTYRLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAMA  202

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRS+ SSGQNFFM+ VRF+ETF GSMSAGVGVGF SALLFKYAGLDIDNLQ
Sbjct  203   ISLYRTMSLVRSHASSGQNFFMVIVRFLETFVGSMSAGVGVGFTSALLFKYAGLDIDNLQ  262

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YTYSNLS++SQRFVSSFFHLIS
Sbjct  263   NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTYSNLSENSQRFVSSFFHLIS  322

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAMEQHSW+HVGFIFFSI+FIG+ARAANVF CAYLVNLVRPA+R+I
Sbjct  323   SLAETFVFIYMGFDIAMEQHSWSHVGFIFFSIIFIGVARAANVFSCAYLVNLVRPAHRQI  382

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQ+ALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTML
Sbjct  383   PLKHQRALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTML  442

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EAL VVGD  +     GTL E  EG+NGYIAPSY+EE+SSG+R KMKLKEFH+ST+SFTA
Sbjct  443   EALQVVGDGLE-----GTLSESFEGNNGYIAPSYNEEASSGNRIKMKLKEFHQSTASFTA  497

Query  498   IDRNYLTPFFTTQNGDE-DEQEELISNSRRARYSGH  394
             +DRNYLTPFFT+QNGDE +E +E + +S R  + GH
Sbjct  498   LDRNYLTPFFTSQNGDEVEELDEPMPSSARGGFQGH  533



>ref|XP_004237373.1| PREDICTED: sodium/hydrogen exchanger 6 [Solanum lycopersicum]
Length=531

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/520 (85%), Positives = 483/520 (93%), Gaps = 10/520 (2%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAG GILLQIMMLVLSF++GHVLRR  FYY+PEASASLLIGLIVGGLAN+SDTET
Sbjct  17    GKEQQAAGYGILLQIMMLVLSFVIGHVLRRRHFYYIPEASASLLIGLIVGGLANVSDTET  76

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAI+TFAI GTFIAS VTG+LV
Sbjct  77    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIITFAILGTFIASFVTGILV  136

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GGV  LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  137   YLGGVTYLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  196

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRS+ S+ QN+FMIT+RF+ETF GS+SAGVGVGF+SALLFKYAGLDIDNLQ
Sbjct  197   ISLYRTMSLVRSHMSTDQNYFMITIRFVETFMGSLSAGVGVGFVSALLFKYAGLDIDNLQ  256

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLE CLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMKRYTY NLS+SSQRFVS+FFHLIS
Sbjct  257   NLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGVVMKRYTYPNLSESSQRFVSAFFHLIS  316

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAME+HSW+HVGFIFFSILFI IARAANVFGCAYLVNLVRP ++KI
Sbjct  317   SLAETFVFIYMGFDIAMEKHSWSHVGFIFFSILFIVIARAANVFGCAYLVNLVRPPHQKI  376

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLIIGGSTGTML
Sbjct  377   PAKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLIIGGSTGTML  436

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEES-----SSGSRFKMKLKEFHKST  514
             EAL+VVGD       +G++ E  EG+NGYIAPSY +ES     SSG+RF+MKLKEFHKST
Sbjct  437   EALEVVGDG-----QSGSMDETFEGNNGYIAPSYSDESYDGEPSSGNRFRMKLKEFHKST  491

Query  513   SSFTAIDRNYLTPFFTTQNGDEDEQEELISNSRRARYSGH  394
             +SF+A+D+NYLTPFFTTQ GDEDE E ++ +SRRA Y GH
Sbjct  492   TSFSALDKNYLTPFFTTQGGDEDEDEPIMHSSRRAGYDGH  531



>ref|XP_006350401.1| PREDICTED: sodium/hydrogen exchanger 6-like [Solanum tuberosum]
Length=531

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/520 (85%), Positives = 483/520 (93%), Gaps = 10/520 (2%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAG GILLQIMMLVLSF++GHVLRR  FYY+PEASASLLIGLIVGGLAN+S+TET
Sbjct  17    GKEQQAAGYGILLQIMMLVLSFVIGHVLRRRHFYYIPEASASLLIGLIVGGLANVSNTET  76

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAI+TFAI GTFIAS VTG+LV
Sbjct  77    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIITFAIVGTFIASFVTGILV  136

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GGV  LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  137   YLGGVTYLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  196

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRS+ S+ QN+FMIT+RF+ETF GS+SAGVGVGF+SALLFKYAGLDIDNLQ
Sbjct  197   ISLYRTMSLVRSHMSTDQNYFMITIRFVETFLGSLSAGVGVGFVSALLFKYAGLDIDNLQ  256

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLE CLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMKRYTY NLS+SSQRFVS+FFHLIS
Sbjct  257   NLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGVVMKRYTYPNLSESSQRFVSAFFHLIS  316

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAME+HSW+HVGFIFFSILFI IARAANVFGCAYLVNLVRP ++KI
Sbjct  317   SLAETFVFIYMGFDIAMEKHSWSHVGFIFFSILFIVIARAANVFGCAYLVNLVRPPHQKI  376

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLIIGGSTGTML
Sbjct  377   PAKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLIIGGSTGTML  436

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEES-----SSGSRFKMKLKEFHKST  514
             EAL+VVGD       +G++ E  EG+NGYIAPSY +ES     SSG+RF+MKLKEFHKST
Sbjct  437   EALEVVGDG-----QSGSMDETFEGNNGYIAPSYSDESYDGEPSSGNRFRMKLKEFHKST  491

Query  513   SSFTAIDRNYLTPFFTTQNGDEDEQEELISNSRRARYSGH  394
             +SF+A+D+NYLTPFFTTQ GDEDE E ++ +SRRA Y GH
Sbjct  492   TSFSALDKNYLTPFFTTQGGDEDEDEPIMHSSRRAGYDGH  531



>ref|XP_009374800.1| PREDICTED: sodium/hydrogen exchanger 6 isoform X1 [Pyrus x bretschneideri]
Length=539

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/515 (86%), Positives = 483/515 (94%), Gaps = 6/515 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS+TE 
Sbjct  24    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANISNTEN  83

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAI GTFIAS+VTG+LV
Sbjct  84    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAILGTFIASVVTGILV  143

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+I L Y+LPF+ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLNDAMA
Sbjct  144   YLGGLIYLTYRLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAMA  203

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRS+ SSG+NFFM+ VRF+ETF GS+SAGVGVGF SALLFKYAGLDIDNLQ
Sbjct  204   ISLYRTMSLVRSHASSGENFFMVVVRFLETFVGSLSAGVGVGFTSALLFKYAGLDIDNLQ  263

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YTYSNLS++SQRFVSSFFHLIS
Sbjct  264   NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTYSNLSENSQRFVSSFFHLIS  323

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAMEQHSW+HVGFIFFSI+FI +ARAANVF CAYLVNLVRPA+R+I
Sbjct  324   SLAETFVFIYMGFDIAMEQHSWSHVGFIFFSIIFIVVARAANVFSCAYLVNLVRPAHRQI  383

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALWYSGLRGAMAFALALQSVHDLP+GHGQTIFTATTAIVVLTVL+IGGSTGTML
Sbjct  384   PLKHQKALWYSGLRGAMAFALALQSVHDLPDGHGQTIFTATTAIVVLTVLLIGGSTGTML  443

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EAL VVGD  +     GTLGE  EG+NGYIAPS+D+E SSG+R KMKLKEFH+ST+SFTA
Sbjct  444   EALQVVGDGIE-----GTLGENFEGNNGYIAPSFDDEGSSGNRIKMKLKEFHQSTASFTA  498

Query  498   IDRNYLTPFFTTQNGD-EDEQEELISNSRRARYSG  397
             +DRNYLTPFFT+QNGD EDE +E + +S R  + G
Sbjct  499   LDRNYLTPFFTSQNGDEEDELDEPMPSSTRRGFHG  533



>emb|CAC83608.1| Na+/H+ antiporter, isoform 2 [Solanum lycopersicum]
Length=531

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/520 (84%), Positives = 480/520 (92%), Gaps = 10/520 (2%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAG GILLQIMMLVLSF++GHVLRR  FYY+PEASASLLIGLIVGGLAN+SDTET
Sbjct  17    GKEQQAAGYGILLQIMMLVLSFVIGHVLRRRHFYYIPEASASLLIGLIVGGLANVSDTET  76

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAI+TFAI GTFIAS VTG+LV
Sbjct  77    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIITFAILGTFIASFVTGILV  136

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GGV  LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  137   YLGGVTYLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  196

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRS+ S+ QN+FMIT+RF+ETF GS+SAGVGVGF+SALLFKYAGLDIDNLQ
Sbjct  197   ISLYRTMSLVRSHMSTDQNYFMITIRFVETFMGSLSAGVGVGFVSALLFKYAGLDIDNLQ  256

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLE CLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMKRYTY NLS+SSQRFVS+FFHLIS
Sbjct  257   NLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGVVMKRYTYPNLSESSQRFVSAFFHLIS  316

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAME+HSW+HVGFIFFSILFI IARAANVFGCAYLVNLVRP ++KI
Sbjct  317   SLAETFVFIYMGFDIAMEKHSWSHVGFIFFSILFIVIARAANVFGCAYLVNLVRPPHQKI  376

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALWYSGLRGAMAFALALQ VHDLPEGHGQ IFTATTAIVVLTVLIIGGS GTML
Sbjct  377   PAKHQKALWYSGLRGAMAFALALQPVHDLPEGHGQAIFTATTAIVVLTVLIIGGSAGTML  436

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEES-----SSGSRFKMKLKEFHKST  514
             EAL+VVGD       +G++ E  EG+NGYIAPSY +ES     SSG+RF+MKLKEFHKST
Sbjct  437   EALEVVGDG-----QSGSMDETFEGNNGYIAPSYRDESYDGEPSSGNRFRMKLKEFHKST  491

Query  513   SSFTAIDRNYLTPFFTTQNGDEDEQEELISNSRRARYSGH  394
             +SF+A+D+NYLTPFFTTQ GDEDE E ++ +SRRA Y GH
Sbjct  492   TSFSALDKNYLTPFFTTQGGDEDEDEPIMHSSRRAGYDGH  531



>ref|XP_010913977.1| PREDICTED: sodium/hydrogen exchanger 6-like [Elaeis guineensis]
Length=527

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/520 (84%), Positives = 483/520 (93%), Gaps = 7/520 (1%)
 Frame = -1

Query  1953  PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANI  1774
             PPP  GK+Q+AAGVGILLQI MLVLSF+LGHVLRR +FYYLPEASASLLIGLIVG LANI
Sbjct  14    PPP--GKEQQAAGVGILLQISMLVLSFVLGHVLRRKKFYYLPEASASLLIGLIVGVLANI  71

Query  1773  SDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMV  1594
             S+TE +IRAWFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAIVTFAI GTF+AS+V
Sbjct  72    SNTENSIRAWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIVTFAILGTFVASIV  131

Query  1593  TGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVL  1414
             TG+LVY+GG+  LMY+LP +ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVL
Sbjct  132   TGILVYLGGLTFLMYRLPLVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVL  191

Query  1413  NDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLD  1234
             NDAMAISLYRTMS VRS+ SSGQNFFMI VRF+ETF GSMS+GVGVGF SALLFKYAGLD
Sbjct  192   NDAMAISLYRTMSSVRSHASSGQNFFMIVVRFLETFVGSMSSGVGVGFTSALLFKYAGLD  251

Query  1233  IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSF  1054
             IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YT+SNLS++SQRF ++F
Sbjct  252   IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTFSNLSENSQRFATAF  311

Query  1053  FHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRP  874
             FHLISSLAETFVFIYMGFDIAMEQHSW+HVGFIFFSILFIG+ARAANVFGCAYLVNLVRP
Sbjct  312   FHLISSLAETFVFIYMGFDIAMEQHSWSHVGFIFFSILFIGVARAANVFGCAYLVNLVRP  371

Query  873   ANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGS  694
             A+R+IP KHQKALWYSGLRGAMAFALALQS+H+LPEGHGQTIFTATTAIVVLTVL+IGGS
Sbjct  372   AHRQIPLKHQKALWYSGLRGAMAFALALQSIHELPEGHGQTIFTATTAIVVLTVLLIGGS  431

Query  693   TGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKST  514
             TGTMLE+L+VVGD Y+     G +GE  EG+NGY+APSYDE +SSGSR KMKLKEFHKST
Sbjct  432   TGTMLESLEVVGDGYN-----GPIGESYEGNNGYVAPSYDEGTSSGSRLKMKLKEFHKST  486

Query  513   SSFTAIDRNYLTPFFTTQNGDEDEQEELISNSRRARYSGH  394
             +SFTA+D+NYLTPFFT+QN DE++  E I ++RR  + GH
Sbjct  487   TSFTALDKNYLTPFFTSQNDDEEDFGEPIQDARRGGFRGH  526



>ref|XP_011086313.1| PREDICTED: sodium/hydrogen exchanger 6-like [Sesamum indicum]
Length=527

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/531 (85%), Positives = 484/531 (91%), Gaps = 11/531 (2%)
 Frame = -1

Query  1968  MEELLPPP-----RTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLI  1804
             ME+L   P       GK+QRAAGVGILLQIMMLVLSF+LGHVLRRHR YYLPEASASLLI
Sbjct  1     MEQLQISPADSMGSPGKEQRAAGVGILLQIMMLVLSFVLGHVLRRHRIYYLPEASASLLI  60

Query  1803  GLIVGGLANISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFA  1624
             GLIVGGLANIS+TE +IR+WFNFHEEFFFLFLLPPIIFQSGFS+ PKPFFSNFGAIVTFA
Sbjct  61    GLIVGGLANISNTENSIRSWFNFHEEFFFLFLLPPIIFQSGFSMQPKPFFSNFGAIVTFA  120

Query  1623  IFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNL  1444
             IFGTF+AS+VTGVLVY+GGV  LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNL
Sbjct  121   IFGTFVASVVTGVLVYLGGVTYLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNL  180

Query  1443  YALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFIS  1264
             YALVFGESVLNDAMAISLYRTMSLVRSN SSGQNF MI VRF+ETF GSMSAGVGVGF S
Sbjct  181   YALVFGESVLNDAMAISLYRTMSLVRSNMSSGQNFLMIVVRFLETFVGSMSAGVGVGFTS  240

Query  1263  ALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLS  1084
             ALLFKYAGLDIDNL NLECCLFVLFPYFSYMLAEG GLSGIVSILFTGIVMK YT+SNLS
Sbjct  241   ALLFKYAGLDIDNLHNLECCLFVLFPYFSYMLAEGFGLSGIVSILFTGIVMKHYTFSNLS  300

Query  1083  DSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFG  904
             D+SQ+F ++FFHLISSLAETFVFIYMGFDIAME+HSW+H+GF+FFSILFIGIARAANVF 
Sbjct  301   DNSQKFTAAFFHLISSLAETFVFIYMGFDIAMEKHSWSHMGFVFFSILFIGIARAANVFS  360

Query  903   CAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaiv  724
             CAYLVNLVRP++RKIP KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIV
Sbjct  361   CAYLVNLVRPSHRKIPMKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIV  420

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             VLTVL+IGGSTGTMLEAL VVGD +D       LGE  E ++GY APSY+ ESSSGSRFK
Sbjct  421   VLTVLLIGGSTGTMLEALQVVGDGHD-----APLGESFEANSGYRAPSYEGESSSGSRFK  475

Query  543   MKLKEFHKSTSSFTAIDRNYLTPFFTTQNG-DEDEQEELISNSRRARYSGH  394
             MKLKEFHKST+SFTA+DRNYLTPFFTTQNG DEDE +EL+ +SRR    GH
Sbjct  476   MKLKEFHKSTASFTALDRNYLTPFFTTQNGDDEDEHDELLGDSRRGVLRGH  526



>ref|XP_002271865.1| PREDICTED: sodium/hydrogen exchanger 6-like [Vitis vinifera]
 ref|XP_010661189.1| PREDICTED: sodium/hydrogen exchanger 6-like [Vitis vinifera]
Length=529

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/520 (83%), Positives = 480/520 (92%), Gaps = 8/520 (2%)
 Frame = -1

Query  1947  PRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISD  1768
             P  GK+Q+AAGVGILLQIMMLVLSF+LGHVLRR +FYYLPEASASLLIGLIVGGLANISD
Sbjct  15    PSPGKEQQAAGVGILLQIMMLVLSFVLGHVLRRKKFYYLPEASASLLIGLIVGGLANISD  74

Query  1767  TETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTG  1588
             TET+IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAI GTFIAS VTG
Sbjct  75    TETSIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAIVGTFIASTVTG  134

Query  1587  VLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLND  1408
             +LVY+GG+I LMY+LPFLEC+MFG+LISATDPVTVLSIFQELG+D+NLYALVFGESVLND
Sbjct  135   ILVYLGGLIYLMYRLPFLECMMFGALISATDPVTVLSIFQELGSDMNLYALVFGESVLND  194

Query  1407  AMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDID  1228
             AMAISLYRT+SL++S+  S QNFFM+ V+F+ETF GSMS+GVGVGF +ALLFKYAGLDID
Sbjct  195   AMAISLYRTISLIKSHVPSEQNFFMVIVKFLETFVGSMSSGVGVGFTAALLFKYAGLDID  254

Query  1227  NLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFH  1048
             NL NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YT+SNLS++SQRFVS+FFH
Sbjct  255   NLLNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTFSNLSENSQRFVSAFFH  314

Query  1047  LISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPAN  868
             LISSLAETFVFIYMGFDIAMEQHSW+HVGFIFFSILFI +ARAANVF CAY+VNL+RPA+
Sbjct  315   LISSLAETFVFIYMGFDIAMEQHSWSHVGFIFFSILFIIVARAANVFSCAYMVNLIRPAH  374

Query  867   RKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTG  688
             R+IP KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTG
Sbjct  375   RQIPLKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTG  434

Query  687   TMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSS  508
             TMLEAL VVGD +D     G +GE  E +NGYI+P YDEE SSG+R KM+LKEFHK+T++
Sbjct  435   TMLEALQVVGDGHD-----GPIGESFEVNNGYISPPYDEEESSGNRLKMRLKEFHKNTAT  489

Query  507   FTAIDRNYLTPFFTTQNGDEDEQE---ELISNSRRARYSG  397
             F A+D+NYLTPFFTTQ GD++EQE   E  S+SRRA + G
Sbjct  490   FRALDKNYLTPFFTTQTGDDEEQEDFGEAASSSRRASFHG  529



>ref|XP_007026451.1| Na+/H+ antiporter 6 isoform 2 [Theobroma cacao]
 gb|EOY29073.1| Na+/H+ antiporter 6 isoform 2 [Theobroma cacao]
Length=523

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/517 (84%), Positives = 481/517 (93%), Gaps = 6/517 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAG+GILLQIMMLVLSF+LGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET
Sbjct  12    GKEQQAAGLGILLQIMMLVLSFVLGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  71

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAI GT IAS+VTGVLV
Sbjct  72    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAILGTLIASVVTGVLV  131

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG++ LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLNDAMA
Sbjct  132   YLGGLMYLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAMA  191

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRS+ SSGQNFFM+ VRF+ETF GSMSAGVGVGF SALLFKYAGLDIDNLQ
Sbjct  192   ISLYRTMSLVRSHVSSGQNFFMVIVRFLETFVGSMSAGVGVGFTSALLFKYAGLDIDNLQ  251

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS++SQRFVS+FFHLIS
Sbjct  252   NLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSENSQRFVSAFFHLIS  311

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETF FIYMGFDIAME+HSW+HVGFIFFSILFIG+ARAANVF CAYLVN VRP +R+I
Sbjct  312   SLAETFTFIYMGFDIAMEKHSWSHVGFIFFSILFIGVARAANVFSCAYLVNSVRPVHRQI  371

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P  HQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTML
Sbjct  372   PLNHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTML  431

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
              AL VVGD +D     G LGE  +G+NGY+AP+Y+E+ ++G+RFKMKLKEFHKST+SF+A
Sbjct  432   GALQVVGDGHD-----GHLGEIFDGNNGYVAPTYNEDGTTGNRFKMKLKEFHKSTASFSA  486

Query  498   IDRNYLTPFFTTQNG-DEDEQEELISNSRRARYSGHS  391
             +DRNYLTPFFT+QNG DE+E ++ + +SR   +  HS
Sbjct  487   LDRNYLTPFFTSQNGDDEEEHDDPMPSSRNGGFHDHS  523



>ref|XP_006597645.1| PREDICTED: sodium/hydrogen exchanger 6 [Glycine max]
Length=534

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/508 (85%), Positives = 472/508 (93%), Gaps = 1/508 (0%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRR + Y +PEASASLLIGLIVG LANISDTET
Sbjct  17    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRKKVYIIPEASASLLIGLIVGILANISDTET  76

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             NIRAWFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAIVTFAIFGTFIAS+VTG+LV
Sbjct  77    NIRAWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIVTFAIFGTFIASIVTGILV  136

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG++ LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  137   YLGGLLFLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  196

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMS VR++  SGQN FM+ VRF+ETF GSMSAGVGVGFISALLFKYAGLDIDNLQ
Sbjct  197   ISLYRTMSSVRAD-PSGQNLFMVVVRFLETFVGSMSAGVGVGFISALLFKYAGLDIDNLQ  255

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLE CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YTYSNLS SSQRF S+FF LIS
Sbjct  256   NLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTYSNLSQSSQRFASAFFELIS  315

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAMEQHSW+HVGFIFFSI+FIGIARAANVF CAYLVNLVRP +RKI
Sbjct  316   SLAETFVFIYMGFDIAMEQHSWSHVGFIFFSIIFIGIARAANVFSCAYLVNLVRPTHRKI  375

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALWYSGLRGAMAFALALQS+HDLPEGHGQTIFTATTAIVVLTVL+IGGSTG+ML
Sbjct  376   PSKHQKALWYSGLRGAMAFALALQSIHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGSML  435

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EALDVVG D DS L +       +G+NGYIAP Y+EESSSG++ KMKLKEFHK+ +SFTA
Sbjct  436   EALDVVGGDNDSPLASVGTITNFDGNNGYIAPHYNEESSSGNKIKMKLKEFHKTAASFTA  495

Query  498   IDRNYLTPFFTTQNGDEDEQEELISNSR  415
             +D+NYLTPFFT+QNGDED++ E  +++R
Sbjct  496   LDKNYLTPFFTSQNGDEDDEAEPFTSTR  523



>ref|XP_007159285.1| hypothetical protein PHAVU_002G225100g [Phaseolus vulgaris]
 gb|ESW31279.1| hypothetical protein PHAVU_002G225100g [Phaseolus vulgaris]
Length=534

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/516 (84%), Positives = 473/516 (92%), Gaps = 2/516 (0%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GKDQ+AAGVGILLQIMMLVLSF+LGHVLRR + Y +PEASASLLIGLIVG LANISDTET
Sbjct  17    GKDQQAAGVGILLQIMMLVLSFVLGHVLRRKKVYIIPEASASLLIGLIVGILANISDTET  76

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAIVTFAI GTFIAS+VTG+LV
Sbjct  77    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIVTFAILGTFIASIVTGILV  136

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GGV+ LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  137   YLGGVLFLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  196

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMS V+++  SGQN FM+ VRF+ETF GSMSAGVGVGFISALLFKYAGLDIDNLQ
Sbjct  197   ISLYRTMSSVKAD-PSGQNLFMVVVRFLETFVGSMSAGVGVGFISALLFKYAGLDIDNLQ  255

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLE CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK Y YSNLS SSQRF S+FF LIS
Sbjct  256   NLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYAYSNLSQSSQRFASAFFELIS  315

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAMEQHSW+HVGFIFFSI+FIGIARAANVF CAYLVN+VRP++R+I
Sbjct  316   SLAETFVFIYMGFDIAMEQHSWSHVGFIFFSIIFIGIARAANVFSCAYLVNVVRPSHRRI  375

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             PPK+QKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTML
Sbjct  376   PPKYQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTML  435

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EALDVVG D DS L +       +G NGYIAP Y+EESSSG++ KMKLKE HKS +SFTA
Sbjct  436   EALDVVGGDDDSPLASVGTVTNFDGRNGYIAPPYNEESSSGNKIKMKLKELHKSAASFTA  495

Query  498   IDRNYLTPFFTTQNGDEDEQEELISNSRRARYSGHS  391
             ID+NYLTPFFT+QNGDED++ E  + S R+ + G S
Sbjct  496   IDKNYLTPFFTSQNGDEDDEAEPFT-STRSGFHGQS  530



>ref|XP_006586810.1| PREDICTED: sodium/hydrogen exchanger 6-like [Glycine max]
Length=534

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/508 (84%), Positives = 471/508 (93%), Gaps = 1/508 (0%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRR + Y +PEASASLLIGLIVG LANISDTET
Sbjct  17    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRKKVYIIPEASASLLIGLIVGILANISDTET  76

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IR WFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAIVTFAIFGTFIAS+VTG+LV
Sbjct  77    SIRGWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIVTFAIFGTFIASIVTGILV  136

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG++ LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  137   YLGGLLFLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  196

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMS VR++  SGQN FM+ VRF+ETF GSMSAGVGVGFISALLFKYAGLDIDNLQ
Sbjct  197   ISLYRTMSSVRAD-PSGQNLFMVVVRFLETFVGSMSAGVGVGFISALLFKYAGLDIDNLQ  255

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLE CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YTYSNLS SSQRF S+FF LIS
Sbjct  256   NLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTYSNLSQSSQRFASAFFELIS  315

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAMEQHSW+HVGFIFFSI+FIGIARA NVF CAYLVNLVRP +RKI
Sbjct  316   SLAETFVFIYMGFDIAMEQHSWSHVGFIFFSIIFIGIARATNVFSCAYLVNLVRPTHRKI  375

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             PPKHQKALWYSGLRGAMAFALALQS+HDLPEGHGQTIFTATTAIVVLTVL+IGGSTG+ML
Sbjct  376   PPKHQKALWYSGLRGAMAFALALQSIHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGSML  435

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EALDVVG D DS L +       +G+NGYIAP Y+EESSSG++ KMKLKEFHK+ +SFTA
Sbjct  436   EALDVVGGDNDSPLASVGTITNFDGNNGYIAPPYNEESSSGNKIKMKLKEFHKTAASFTA  495

Query  498   IDRNYLTPFFTTQNGDEDEQEELISNSR  415
             +D+NYLTPFFT+QNGDED++ E  +++R
Sbjct  496   LDKNYLTPFFTSQNGDEDDEAEPFTSTR  523



>ref|XP_008375081.1| PREDICTED: sodium/hydrogen exchanger 6 isoform X2 [Malus domestica]
Length=539

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/516 (84%), Positives = 473/516 (92%), Gaps = 6/516 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLA+IS+TE 
Sbjct  25    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLASISNTEN  84

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAI GTFIAS+VTG+LV
Sbjct  85    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAILGTFIASVVTGILV  144

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+I L Y+LPF+ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLND MA
Sbjct  145   YLGGLIYLTYRLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDXMA  204

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRS+ +SG+NFFM+ VRF+ETF GS+SAGVGVGF SALLFKYAGLDIDNLQ
Sbjct  205   ISLYRTMSLVRSHATSGENFFMVVVRFLETFVGSLSAGVGVGFTSALLFKYAGLDIDNLQ  264

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YTYSNLS++SQRF SSFFHLIS
Sbjct  265   NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTYSNLSENSQRFASSFFHLIS  324

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAMEQHSW+HVGFIFF  L   + RAANVF C YLVNLVRPA+R I
Sbjct  325   SLAETFVFIYMGFDIAMEQHSWSHVGFIFFQFLPNDLCRAANVFSCVYLVNLVRPAHRHI  384

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALWY GLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTML
Sbjct  385   PLKHQKALWYGGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTML  444

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EAL VVGD  +     GTLGE  EG+NGYIAPSY++E SSG+R KMKLKEFH+ST+SFTA
Sbjct  445   EALQVVGDGIE-----GTLGESFEGNNGYIAPSYNDEGSSGNRIKMKLKEFHQSTASFTA  499

Query  498   IDRNYLTPFFTTQNGD-EDEQEELISNSRRARYSGH  394
             +DRNYLTPFFT+QNGD EDE +E +  S R  + GH
Sbjct  500   LDRNYLTPFFTSQNGDEEDELDEPMPGSTRGGFHGH  535



>ref|XP_011040073.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X1 [Populus 
euphratica]
Length=539

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/517 (84%), Positives = 483/517 (93%), Gaps = 7/517 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRRHRFYYLPEASASLLIGLIVG LANIS+TET
Sbjct  29    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRHRFYYLPEASASLLIGLIVGALANISNTET  88

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFA+ GTFIAS+VTGVLV
Sbjct  89    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFALLGTFIASVVTGVLV  148

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+I L Y+LPF+ECLMFG+LISATDPVTVLSIFQELG D NLYALVFGESVLNDAMA
Sbjct  149   YLGGLIYLTYRLPFVECLMFGALISATDPVTVLSIFQELGIDTNLYALVFGESVLNDAMA  208

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMS ++S+ + GQNFFM+  RF+ETF GS+SAGVGVGFISALLFKYAGLDIDNLQ
Sbjct  209   ISLYRTMSSLKSH-APGQNFFMVIFRFLETFVGSLSAGVGVGFISALLFKYAGLDIDNLQ  267

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGL+GIVSILFTGIVMK YTYSNLS++SQRFVS+FFHLIS
Sbjct  268   NLECCLFVLFPYFSYMLAEGLGLTGIVSILFTGIVMKHYTYSNLSENSQRFVSAFFHLIS  327

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAMEQHSW+HVGFIFFSI+FIG+ARAANVF CAYLVNLVRPA R+I
Sbjct  328   SLAETFVFIYMGFDIAMEQHSWSHVGFIFFSIIFIGVARAANVFSCAYLVNLVRPAPRQI  387

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGT+L
Sbjct  388   PVKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTVL  447

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EAL VVGDD+D     G L E L+G+NGY+APSY+E+++SG+R KMKLKEFHKST+SFTA
Sbjct  448   EALQVVGDDHD-----GPLSESLDGNNGYVAPSYNEDATSGNRLKMKLKEFHKSTASFTA  502

Query  498   IDRNYLTPFFTTQNG-DEDEQEELISNSRRARYSGHS  391
             +DRNYLTPFFT+QNG DE+E ++ + +SR   + GH+
Sbjct  503   LDRNYLTPFFTSQNGDDEEEHDDPMPSSRGRGFLGHN  539



>ref|XP_008798741.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X2 [Phoenix 
dactylifera]
Length=527

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/514 (84%), Positives = 477/514 (93%), Gaps = 5/514 (1%)
 Frame = -1

Query  1935  KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             K+Q+AAGVGILLQI MLVLSF+LGHVLRR +FYYLPEAS SLLIGLIVG LANIS+TET+
Sbjct  18    KEQQAAGVGILLQISMLVLSFVLGHVLRRKKFYYLPEASGSLLIGLIVGVLANISNTETS  77

Query  1755  IRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVY  1576
             IR WFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAIVTFAI GTF AS+VTG+LVY
Sbjct  78    IRTWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIVTFAILGTFTASIVTGILVY  137

Query  1575  IGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAI  1396
             +GG+  LMY+LP +ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLNDAMAI
Sbjct  138   LGGLTFLMYRLPLVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAMAI  197

Query  1395  SLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQN  1216
             SLYRTMS VRS+ SSGQNFFMI VRF+ETF GS+S+GVGVGF SALLFKYAGLDIDNLQN
Sbjct  198   SLYRTMSSVRSHASSGQNFFMIIVRFLETFVGSLSSGVGVGFTSALLFKYAGLDIDNLQN  257

Query  1215  LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISS  1036
             LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YT+SNLS++SQRF ++FFHLISS
Sbjct  258   LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTFSNLSENSQRFATAFFHLISS  317

Query  1035  LAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIP  856
             LAETFVFIYMGFDIAMEQHSW+HVGFIFFSILFIG+ARAANVFGCAYLVNLVRPA+R+IP
Sbjct  318   LAETFVFIYMGFDIAMEQHSWSHVGFIFFSILFIGVARAANVFGCAYLVNLVRPAHRQIP  377

Query  855   PKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLE  676
             PK+QKALWYSGLRGAMAFALALQS+HDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTMLE
Sbjct  378   PKYQKALWYSGLRGAMAFALALQSIHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTMLE  437

Query  675   ALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAI  496
             AL+VVGDDYD     G +GE  EG+NGY+APSY+E +SSGSR KMKLKEFH+ST+SFTA+
Sbjct  438   ALEVVGDDYD-----GPIGESYEGNNGYVAPSYEEGTSSGSRLKMKLKEFHESTTSFTAL  492

Query  495   DRNYLTPFFTTQNGDEDEQEELISNSRRARYSGH  394
             D+NYLTPFFT+QN DE++  E   + RR  + GH
Sbjct  493   DKNYLTPFFTSQNDDEEDFGEPTQDKRRGCFRGH  526



>ref|XP_008798740.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X1 [Phoenix 
dactylifera]
Length=528

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/514 (83%), Positives = 474/514 (92%), Gaps = 4/514 (1%)
 Frame = -1

Query  1935  KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             K+Q+AAGVGILLQI MLVLSF+LGHVLRR +FYYLPEAS SLLIGLIVG LANIS+TET+
Sbjct  18    KEQQAAGVGILLQISMLVLSFVLGHVLRRKKFYYLPEASGSLLIGLIVGVLANISNTETS  77

Query  1755  IRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVY  1576
             IR WFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAIVTFAI GTF AS+VTG+LVY
Sbjct  78    IRTWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIVTFAILGTFTASIVTGILVY  137

Query  1575  IGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAI  1396
             +GG+  LMY+LP +ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLNDAMAI
Sbjct  138   LGGLTFLMYRLPLVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAMAI  197

Query  1395  SLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQN  1216
             SLYRTMS VRS+ SSGQNFFMI VRF+ETF GS+S+GVGVGF SALLFKYAGLDIDNLQN
Sbjct  198   SLYRTMSSVRSHASSGQNFFMIIVRFLETFVGSLSSGVGVGFTSALLFKYAGLDIDNLQN  257

Query  1215  LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISS  1036
             LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YT+SNLS++SQRF ++FFHLISS
Sbjct  258   LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTFSNLSENSQRFATAFFHLISS  317

Query  1035  LAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIP  856
             LAETFVFIYMGFDIAMEQHSW+HVGFIFFSILFIG+ARAANVFGCAYLVNLVRPA+R+IP
Sbjct  318   LAETFVFIYMGFDIAMEQHSWSHVGFIFFSILFIGVARAANVFGCAYLVNLVRPAHRQIP  377

Query  855   PKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLE  676
             PK+QKALWYSGLRGAMAFALALQS+HDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTMLE
Sbjct  378   PKYQKALWYSGLRGAMAFALALQSIHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTMLE  437

Query  675   ALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAI  496
             AL+VVGDDYD         +  EG+NGY+APSY+E +SSGSR KMKLKEFH+ST+SFTA+
Sbjct  438   ALEVVGDDYD----GPIGEQSYEGNNGYVAPSYEEGTSSGSRLKMKLKEFHESTTSFTAL  493

Query  495   DRNYLTPFFTTQNGDEDEQEELISNSRRARYSGH  394
             D+NYLTPFFT+QN DE++  E   + RR  + GH
Sbjct  494   DKNYLTPFFTSQNDDEEDFGEPTQDKRRGCFRGH  527



>ref|XP_006373541.1| sodium proton exchanger family protein [Populus trichocarpa]
 gb|ERP51338.1| sodium proton exchanger family protein [Populus trichocarpa]
Length=537

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/517 (84%), Positives = 482/517 (93%), Gaps = 7/517 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRRHRFYYLPEASASLLIGLIVG LANIS+TET
Sbjct  27    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRHRFYYLPEASASLLIGLIVGALANISNTET  86

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTF+I GTFIAS+VTGVLV
Sbjct  87    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFSILGTFIASVVTGVLV  146

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+I L Y+LPF+ECLMFG+LISATDPVTVLSIFQELG D NLYALVFGESVLNDAMA
Sbjct  147   YLGGLIYLTYRLPFVECLMFGALISATDPVTVLSIFQELGIDTNLYALVFGESVLNDAMA  206

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMS ++S+ + GQNFFM+  RF+ETF GS+SAGVGVGFISALLFKYAGLDIDNLQ
Sbjct  207   ISLYRTMSSLKSH-APGQNFFMVVFRFLETFVGSLSAGVGVGFISALLFKYAGLDIDNLQ  265

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGL+GIVSILFTGIVMK YTYSNLS++SQRFVS+FFHLIS
Sbjct  266   NLECCLFVLFPYFSYMLAEGLGLTGIVSILFTGIVMKHYTYSNLSENSQRFVSAFFHLIS  325

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAMEQHSW+HVGFIFFSI+FIG+ARAANVF CAYLVNLVRPA R+I
Sbjct  326   SLAETFVFIYMGFDIAMEQHSWSHVGFIFFSIIFIGVARAANVFSCAYLVNLVRPAPRQI  385

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGT+L
Sbjct  386   PVKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTVL  445

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             E L VVGDD+D     G L E L+G+NGY+APSY+E+++SG+R KMKLKEFHKST+SFTA
Sbjct  446   ETLQVVGDDHD-----GPLSESLDGNNGYVAPSYNEDATSGNRLKMKLKEFHKSTASFTA  500

Query  498   IDRNYLTPFFTTQNG-DEDEQEELISNSRRARYSGHS  391
             +DRNYLTPFFT+QNG DE+E ++ + +SR   + GH+
Sbjct  501   LDRNYLTPFFTSQNGDDEEEHDDPMPSSRGRGFLGHN  537



>ref|XP_007026452.1| Na+/H+ antiporter 6 isoform 3 [Theobroma cacao]
 gb|EOY29074.1| Na+/H+ antiporter 6 isoform 3 [Theobroma cacao]
Length=524

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/518 (84%), Positives = 481/518 (93%), Gaps = 7/518 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAG+GILLQIMMLVLSF+LGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET
Sbjct  12    GKEQQAAGLGILLQIMMLVLSFVLGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  71

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAI GT IAS+VTGVLV
Sbjct  72    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAILGTLIASVVTGVLV  131

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQ-ELGTDVNLYALVFGESVLNDAM  1402
             Y+GG++ LMY+LPF+ECLMFG+LISATDPVTVLSIFQ ELGTD+NLYALVFGESVLNDAM
Sbjct  132   YLGGLMYLMYRLPFVECLMFGALISATDPVTVLSIFQQELGTDMNLYALVFGESVLNDAM  191

Query  1401  AISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNL  1222
             AISLYRTMSLVRS+ SSGQNFFM+ VRF+ETF GSMSAGVGVGF SALLFKYAGLDIDNL
Sbjct  192   AISLYRTMSLVRSHVSSGQNFFMVIVRFLETFVGSMSAGVGVGFTSALLFKYAGLDIDNL  251

Query  1221  QNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLI  1042
             QNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS++SQRFVS+FFHLI
Sbjct  252   QNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSENSQRFVSAFFHLI  311

Query  1041  SSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRK  862
             SSLAETF FIYMGFDIAME+HSW+HVGFIFFSILFIG+ARAANVF CAYLVN VRP +R+
Sbjct  312   SSLAETFTFIYMGFDIAMEKHSWSHVGFIFFSILFIGVARAANVFSCAYLVNSVRPVHRQ  371

Query  861   IPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTM  682
             IP  HQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTM
Sbjct  372   IPLNHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTM  431

Query  681   LEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFT  502
             L AL VVGD +D     G LGE  +G+NGY+AP+Y+E+ ++G+RFKMKLKEFHKST+SF+
Sbjct  432   LGALQVVGDGHD-----GHLGEIFDGNNGYVAPTYNEDGTTGNRFKMKLKEFHKSTASFS  486

Query  501   AIDRNYLTPFFTTQNG-DEDEQEELISNSRRARYSGHS  391
             A+DRNYLTPFFT+QNG DE+E ++ + +SR   +  HS
Sbjct  487   ALDRNYLTPFFTSQNGDDEEEHDDPMPSSRNGGFHDHS  524



>ref|NP_001291225.1| uncharacterized protein LOC105136432 [Populus euphratica]
 gb|ACX46912.1| Na+/H+ exchanger 6 [Populus euphratica]
Length=533

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/501 (86%), Positives = 473/501 (94%), Gaps = 6/501 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRRHRFYYLPEASASLLIGLIVG LANIS+TET
Sbjct  29    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRHRFYYLPEASASLLIGLIVGALANISNTET  88

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFA+ G FIAS+VTGVLV
Sbjct  89    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFALLGAFIASVVTGVLV  148

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+I L Y+LPF+ECLMFG+LISATDPVTVLSIFQELG D NLYALVFGESVLNDAMA
Sbjct  149   YLGGLIYLTYRLPFVECLMFGALISATDPVTVLSIFQELGIDTNLYALVFGESVLNDAMA  208

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMS ++S+ + GQNFFM+  RF+ETF GS+SAGVGVGFISALLFKYAGLDIDNLQ
Sbjct  209   ISLYRTMSSLKSH-APGQNFFMVIFRFLETFVGSLSAGVGVGFISALLFKYAGLDIDNLQ  267

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGL+GIVSILFTGIVMK YTYSNLS++SQRFVS+FFHLIS
Sbjct  268   NLECCLFVLFPYFSYMLAEGLGLTGIVSILFTGIVMKHYTYSNLSENSQRFVSAFFHLIS  327

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAMEQHSW+HVGFIFFSI+FIG+ARAANVF CAYLVNLVRPA R+I
Sbjct  328   SLAETFVFIYMGFDIAMEQHSWSHVGFIFFSIIFIGVARAANVFSCAYLVNLVRPAPRQI  387

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGT+L
Sbjct  388   PVKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTVL  447

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EAL VVGDD+D     G L E L+G+NGY+APSY+E+++SG+R KMKLKEFHKST+SFTA
Sbjct  448   EALQVVGDDHD-----GPLSESLDGNNGYVAPSYNEDATSGNRLKMKLKEFHKSTASFTA  502

Query  498   IDRNYLTPFFTTQNGDEDEQE  436
             +DRNYLTPFFT+QNGD++E+ 
Sbjct  503   LDRNYLTPFFTSQNGDDEEEH  523



>gb|AAX37333.1| Na+/H+ antiporter [Populus tomentosa]
Length=526

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/517 (83%), Positives = 480/517 (93%), Gaps = 7/517 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRRHRFYYLPEASASLLIGLIVG L NIS+TET
Sbjct  16    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRHRFYYLPEASASLLIGLIVGALTNISNTET  75

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTF+I GTFIAS+VTGVLV
Sbjct  76    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFSILGTFIASVVTGVLV  135

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+I L Y+LPF+ECLMFG+LISATDPVTVLSIFQELG D NLYALVFGESVLNDAMA
Sbjct  136   YLGGLIYLTYRLPFVECLMFGALISATDPVTVLSIFQELGIDTNLYALVFGESVLNDAMA  195

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMS ++S+ + GQNFFM+  RF+ETF GS+SAGVGVGFISALLFKYAGLDIDNLQ
Sbjct  196   ISLYRTMSSLKSH-APGQNFFMVIFRFLETFVGSLSAGVGVGFISALLFKYAGLDIDNLQ  254

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             +LECCLFVLFPYFSYMLAEGLGL+GIVSILFTGIVMK YTYSNLS++SQRFVS+FFHLIS
Sbjct  255   DLECCLFVLFPYFSYMLAEGLGLTGIVSILFTGIVMKHYTYSNLSENSQRFVSAFFHLIS  314

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAMEQHSW+HVGFIFFSI+FIG+ARAANVF CAYLVNLVRP  R+I
Sbjct  315   SLAETFVFIYMGFDIAMEQHSWSHVGFIFFSIIFIGVARAANVFSCAYLVNLVRPVPRQI  374

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGT+L
Sbjct  375   PVKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTVL  434

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             E L VVGDD+D     G L E L+G+NGY+APSY+E+++SG+R KMKLKEFHKST+SFTA
Sbjct  435   ETLQVVGDDHD-----GPLSESLDGNNGYVAPSYNEDATSGNRLKMKLKEFHKSTASFTA  489

Query  498   IDRNYLTPFFTTQNG-DEDEQEELISNSRRARYSGHS  391
             +DRNYLTPFFT+Q+G DE+E ++ + +SR   + GH+
Sbjct  490   LDRNYLTPFFTSQSGDDEEEHDDPMPSSRGRGFLGHN  526



>ref|XP_010244806.1| PREDICTED: sodium/hydrogen exchanger 6-like [Nelumbo nucifera]
Length=531

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/509 (85%), Positives = 470/509 (92%), Gaps = 10/509 (2%)
 Frame = -1

Query  1968  MEELLPPPRT-----GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLI  1804
             MEEL   P       G +Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLI
Sbjct  6     MEELQISPANPAGSHGTEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLI  65

Query  1803  GLIVGGLANISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFA  1624
             GL VGGLANIS+TET+IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFA
Sbjct  66    GLTVGGLANISNTETSIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFA  125

Query  1623  IFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNL  1444
             I GTFIAS+VTGVLVY+GGV+ LMY LPF+ECLMFG+LISATDPVTVLSIFQELGTD+NL
Sbjct  126   ILGTFIASIVTGVLVYLGGVMFLMYGLPFVECLMFGALISATDPVTVLSIFQELGTDMNL  185

Query  1443  YALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFIS  1264
             YALVFGESVLNDAMAISLYRTMS V+S+ SS QNFF++ +RF+ETF GSMS+GVGVGF S
Sbjct  186   YALVFGESVLNDAMAISLYRTMSSVKSHVSSRQNFFLVILRFLETFVGSMSSGVGVGFTS  245

Query  1263  ALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLS  1084
             ALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YT+SNLS
Sbjct  246   ALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTFSNLS  305

Query  1083  DSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFG  904
             ++SQ+FV++FFHLISSLAETFVFIYMGFDIAMEQHSW+HVGFIFFSILFIG+ARAANVF 
Sbjct  306   ENSQQFVAAFFHLISSLAETFVFIYMGFDIAMEQHSWSHVGFIFFSILFIGVARAANVFS  365

Query  903   CAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaiv  724
             CAYLVNL RPANR+IP +HQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIV
Sbjct  366   CAYLVNLFRPANRQIPLRHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIV  425

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             VLTVL+IGGSTGTMLEAL VVGD +D     G L E  EG+NGYIAPSY+E +SSG+  K
Sbjct  426   VLTVLLIGGSTGTMLEALQVVGDCHD-----GHLSESFEGNNGYIAPSYEEGASSGNGLK  480

Query  543   MKLKEFHKSTSSFTAIDRNYLTPFFTTQN  457
             MKLKEFHKST+SFTA+DRNYLTPFFTTQN
Sbjct  481   MKLKEFHKSTASFTALDRNYLTPFFTTQN  509



>ref|XP_010058014.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X2 [Eucalyptus 
grandis]
Length=541

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/522 (84%), Positives = 477/522 (91%), Gaps = 9/522 (2%)
 Frame = -1

Query  1950  PP---RTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLA  1780
             PP   +TGK+Q+AAGVGILLQIMMLVLSF+LGHVLRR +FYYLPEASASLLIGL+VGGLA
Sbjct  21    PPGGGQTGKEQQAAGVGILLQIMMLVLSFVLGHVLRRRKFYYLPEASASLLIGLLVGGLA  80

Query  1779  NISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIAS  1600
             N+SDTET+IR WFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAIVTFAI GTFI+S
Sbjct  81    NVSDTETSIRTWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIVTFAILGTFISS  140

Query  1599  MVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGES  1420
             +VTGVLVY+GGV+ LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGES
Sbjct  141   VVTGVLVYLGGVMFLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGES  200

Query  1419  VLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAG  1240
             VLNDAMAISLYRTMSLVR N  S +NF M+ VRF+ETF GSMSAGVGVGFISALLFKYAG
Sbjct  201   VLNDAMAISLYRTMSLVRQNAPSTENFLMVIVRFLETFVGSMSAGVGVGFISALLFKYAG  260

Query  1239  LDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVS  1060
             LDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGI+MK Y YSNLS++SQRFVS
Sbjct  261   LDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGILMKHYAYSNLSENSQRFVS  320

Query  1059  SFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLV  880
             +FFHLISSLAETFVFIYMGFDIAMEQHSW+HVGFI FSILFI IARAANVF CAYLVNL 
Sbjct  321   AFFHLISSLAETFVFIYMGFDIAMEQHSWSHVGFICFSILFIVIARAANVFSCAYLVNLA  380

Query  879   RPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIG  700
             RPA RKIP KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IG
Sbjct  381   RPATRKIPAKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIG  440

Query  699   GSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEE--SSSGSRFKMKLKEF  526
             GSTGTMLEAL VVGD +D   G       +  S+GY+APSYDEE  SSSG++FKMKLKEF
Sbjct  441   GSTGTMLEALQVVGDAHD---GPLGENLEVNHSHGYVAPSYDEEEDSSSGNKFKMKLKEF  497

Query  525   HKSTSSFTAIDRNYLTPFFTTQNGDEDEQ-EELISNSRRARY  403
             H+S +SFTA+D+NYLTPFFT+QNGDED+  +E + +SRR  +
Sbjct  498   HRSAASFTALDKNYLTPFFTSQNGDEDDDFDEPMPSSRRGDF  539



>ref|XP_010058013.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X1 [Eucalyptus 
grandis]
Length=545

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/523 (83%), Positives = 476/523 (91%), Gaps = 7/523 (1%)
 Frame = -1

Query  1950  PP---RTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLA  1780
             PP   +TGK+Q+AAGVGILLQIMMLVLSF+LGHVLRR +FYYLPEASASLLIGL+VGGLA
Sbjct  21    PPGGGQTGKEQQAAGVGILLQIMMLVLSFVLGHVLRRRKFYYLPEASASLLIGLLVGGLA  80

Query  1779  NISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIAS  1600
             N+SDTET+IR WFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAIVTFAI GTFI+S
Sbjct  81    NVSDTETSIRTWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIVTFAILGTFISS  140

Query  1599  MVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGES  1420
             +VTGVLVY+GGV+ LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGES
Sbjct  141   VVTGVLVYLGGVMFLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGES  200

Query  1419  VLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAG  1240
             VLNDAMAISLYRTMSLVR N  S +NF M+ VRF+ETF GSMSAGVGVGFISALLFKYAG
Sbjct  201   VLNDAMAISLYRTMSLVRQNAPSTENFLMVIVRFLETFVGSMSAGVGVGFISALLFKYAG  260

Query  1239  LDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVS  1060
             LDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGI+MK Y YSNLS++SQRFVS
Sbjct  261   LDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGILMKHYAYSNLSENSQRFVS  320

Query  1059  SFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLV  880
             +FFHLISSLAETFVFIYMGFDIAMEQHSW+HVGFI FSILFI IARAANVF CAYLVNL 
Sbjct  321   AFFHLISSLAETFVFIYMGFDIAMEQHSWSHVGFICFSILFIVIARAANVFSCAYLVNLA  380

Query  879   RPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIG  700
             RPA RKIP KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IG
Sbjct  381   RPATRKIPAKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIG  440

Query  699   GSTGTMLEALDVVGDDYDs-slgtgtlgerlegSNGYIAPSYDEE--SSSGSRFKMKLKE  529
             GSTGTMLEAL VVGD +D            +  S+GY+APSYDEE  SSSG++FKMKLKE
Sbjct  441   GSTGTMLEALQVVGDAHDGPLGEHNFQNLEVNHSHGYVAPSYDEEEDSSSGNKFKMKLKE  500

Query  528   FHKSTSSFTAIDRNYLTPFFTTQNGDEDEQ-EELISNSRRARY  403
             FH+S +SFTA+D+NYLTPFFT+QNGDED+  +E + +SRR  +
Sbjct  501   FHRSAASFTALDKNYLTPFFTSQNGDEDDDFDEPMPSSRRGDF  543



>ref|XP_009385527.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=526

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/517 (81%), Positives = 468/517 (91%), Gaps = 8/517 (2%)
 Frame = -1

Query  1953  PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANI  1774
             PPP  GK+Q+AAGVGILLQI MLVLSF++GHVLRRH+FYY+PEASASL+IGL+VGGLANI
Sbjct  14    PPP--GKEQQAAGVGILLQISMLVLSFVVGHVLRRHKFYYVPEASASLIIGLLVGGLANI  71

Query  1773  SDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMV  1594
             SDTET+IR WFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAIVTFAI GTFIAS+V
Sbjct  72    SDTETSIRRWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIVTFAILGTFIASVV  131

Query  1593  TGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVL  1414
             TGVLVY+GG+  LMYKLP +ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVL
Sbjct  132   TGVLVYLGGLTFLMYKLPLVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVL  191

Query  1413  NDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLD  1234
             NDAMAISLYRTMS V+S+ SSGQNFF+I VRF+ETF GSMS+GVGVGFISALLFKYAGLD
Sbjct  192   NDAMAISLYRTMSSVQSHASSGQNFFLIVVRFLETFVGSMSSGVGVGFISALLFKYAGLD  251

Query  1233  IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSF  1054
             IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YT+SNLS+ SQ F ++F
Sbjct  252   IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTFSNLSEKSQHFAAAF  311

Query  1053  FHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRP  874
             FHLISSLAETFVFIYMGFDIAMEQH W+H+GFIFFSI+FIG+ARAA+V+ CA LVN+ RP
Sbjct  312   FHLISSLAETFVFIYMGFDIAMEQHRWSHLGFIFFSIIFIGVARAAHVYVCANLVNMARP  371

Query  873   ANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGS  694
              +R+IP KHQKALWYSGLRGAMAFALALQSVHDLPE HG+TIFTATTAI+VLTV+++GGS
Sbjct  372   TSRQIPLKHQKALWYSGLRGAMAFALALQSVHDLPEAHGKTIFTATTAIIVLTVILVGGS  431

Query  693   TGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKST  514
             TGTMLEAL+VVGD  D         E +E +NGYIAPSY E +SSGS  KM+LKEFHKST
Sbjct  432   TGTMLEALEVVGDGQD------GALETIESNNGYIAPSYQEGTSSGSNLKMRLKEFHKST  485

Query  513   SSFTAIDRNYLTPFFTTQNGDEDEQEELISNSRRARY  403
             +SFTA+D+NYLTPFFT+QN +ED  +E +    R R+
Sbjct  486   TSFTALDKNYLTPFFTSQNEEEDVSDESMRTPSRGRF  522



>ref|XP_004293432.1| PREDICTED: LOW QUALITY PROTEIN: sodium/hydrogen exchanger 6-like 
[Fragaria vesca subsp. vesca]
Length=529

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/519 (84%), Positives = 475/519 (92%), Gaps = 10/519 (2%)
 Frame = -1

Query  1935  KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             K+Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANISDTET+
Sbjct  13    KEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANISDTETS  72

Query  1755  IRAWFNFHEEffflfllppiiFQSGFSLSPKPFFS--NFGAIVTFAIFGTFIASMVTGVL  1582
             IRAWFNFH EFF LFLLPPIIFQSGFSLS     S  NFGAIVTFAI GTFIAS+VTGVL
Sbjct  73    IRAWFNFHVEFFILFLLPPIIFQSGFSLSHVINLSSLNFGAIVTFAILGTFIASVVTGVL  132

Query  1581  VYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAM  1402
             VY+GG++ L Y+LPF+ECLMFG+LISATDPVTVLSIFQELGTD NLYALVFGESVLNDAM
Sbjct  133   VYLGGLMYLTYRLPFVECLMFGALISATDPVTVLSIFQELGTDTNLYALVFGESVLNDAM  192

Query  1401  AISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNL  1222
             AISLYRTMSLVRS+ SSG+NFFM+ VRF+ETF GSMSAGVGVGF SALLFKYAGLDIDNL
Sbjct  193   AISLYRTMSLVRSHASSGENFFMVIVRFLETFVGSMSAGVGVGFTSALLFKYAGLDIDNL  252

Query  1221  QNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLI  1042
             QNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YTYSNLS++SQRFVS+FFHLI
Sbjct  253   QNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTYSNLSENSQRFVSAFFHLI  312

Query  1041  SSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRK  862
             SSLAETFVFIYMGFDIAME+HSW+HVGFIFFSI+FIG+ARAANVF CAYLVNL RPA+R+
Sbjct  313   SSLAETFVFIYMGFDIAMEKHSWSHVGFIFFSIIFIGVARAANVFSCAYLVNLSRPAHRQ  372

Query  861   IPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTM  682
             IP KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTM
Sbjct  373   IPVKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTM  432

Query  681   LEALDVVGDDYDsslgtgtlgerlegSNGYIAPSY--DEESSSGSRFKMKLKEFHKSTSS  508
             LEAL VVGD ++      TLGE  +G++GY+APSY  DEE SSG+R KMKLKEFHKS +S
Sbjct  433   LEALQVVGDGHE-----STLGETFDGNHGYMAPSYEDDEEESSGNRIKMKLKEFHKSAAS  487

Query  507   FTAIDRNYLTPFFTTQNGDEDEQ-EELISNSRRARYSGH  394
             FTA DRNYLTPFFT+QNGDE E+ +E +S+S RA  S H
Sbjct  488   FTAFDRNYLTPFFTSQNGDEAEEFDEPMSSSSRAVGSFH  526



>ref|XP_004159112.1| PREDICTED: sodium/hydrogen exchanger 6-like [Cucumis sativus]
Length=580

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/509 (84%), Positives = 464/509 (91%), Gaps = 4/509 (1%)
 Frame = -1

Query  1953  PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANI  1774
             P     KDQ+AAGVGILLQIMMLVLSF+LGHVLRRHR Y+LPEASASLLIGLIVGGLANI
Sbjct  71    PKGSPVKDQQAAGVGILLQIMMLVLSFVLGHVLRRHRLYFLPEASASLLIGLIVGGLANI  130

Query  1773  SDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMV  1594
             S+TETNIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAI GTFIAS+V
Sbjct  131   SNTETNIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAILGTFIASVV  190

Query  1593  TGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVL  1414
             TG LVY+GG+  LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVL
Sbjct  191   TGGLVYLGGLAFLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVL  250

Query  1413  NDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLD  1234
             NDAMAISLYRTMSLVRS+  SG+NFF + VRF+ETF GS+SAGVGVGF SALLFKYAGLD
Sbjct  251   NDAMAISLYRTMSLVRSHAYSGKNFFFVIVRFLETFVGSLSAGVGVGFTSALLFKYAGLD  310

Query  1233  IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSF  1054
             IDNLQNLECCLFVLFPYFSYMLAEG GLSGIVSILFTG+VMK YTYSNLS SSQ+FV+ F
Sbjct  311   IDNLQNLECCLFVLFPYFSYMLAEGFGLSGIVSILFTGMVMKHYTYSNLSQSSQQFVAEF  370

Query  1053  FHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRP  874
             FHLISSLAETF+FIYMG DIAMEQHSW+HVGFIFFSILFIG+ARAANVF CAYLVNLVRP
Sbjct  371   FHLISSLAETFIFIYMGLDIAMEQHSWSHVGFIFFSILFIGVARAANVFSCAYLVNLVRP  430

Query  873   ANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGS  694
             ANRKIP  HQKALWYSGLRGAMAFALALQS+HDLP+GHGQTIFTATTAIVVLTVL+IGGS
Sbjct  431   ANRKIPSNHQKALWYSGLRGAMAFALALQSIHDLPDGHGQTIFTATTAIVVLTVLLIGGS  490

Query  693   TGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKST  514
             TGTMLEAL VVGD  D      +L E  + SNGYIAP Y++E SS SR KMKLKEFH+ST
Sbjct  491   TGTMLEALQVVGDSDD---HEYSLTETTDASNGYIAP-YNDEGSSRSRIKMKLKEFHEST  546

Query  513   SSFTAIDRNYLTPFFTTQNGDEDEQEELI  427
             +SFTA++RNYLTPFF +++GD++E +  I
Sbjct  547   ASFTALNRNYLTPFFKSRSGDDEEDDNSI  575



>ref|XP_004486408.1| PREDICTED: sodium/hydrogen exchanger 6-like [Cicer arietinum]
Length=549

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/507 (86%), Positives = 469/507 (93%), Gaps = 6/507 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRR + Y +PEASASLLIGLIVG LANIS+TET
Sbjct  17    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRKKIYIIPEASASLLIGLIVGVLANISNTET  76

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             NIRAWFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAIVTFAIFGTF+AS+VTGVLV
Sbjct  77    NIRAWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIVTFAIFGTFLASIVTGVLV  136

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG++ LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  137   YLGGLVFLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  196

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRS+  SGQNFFM+ VRF+ETF GS+SAGVGVGFISALLFKYAGLDIDNLQ
Sbjct  197   ISLYRTMSLVRSH-PSGQNFFMVVVRFLETFVGSLSAGVGVGFISALLFKYAGLDIDNLQ  255

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLE CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK Y YSNLS SSQ+FVS+FF LIS
Sbjct  256   NLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYAYSNLSQSSQKFVSAFFELIS  315

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAMEQHSW+HVGFIFFSI+FIGIARAANVF CAYLVNL RP +RKI
Sbjct  316   SLAETFVFIYMGFDIAMEQHSWSHVGFIFFSIMFIGIARAANVFSCAYLVNLARPDHRKI  375

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTML
Sbjct  376   PLKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTML  435

Query  678   EALDVVGDD---YDsslgtgtlgerlegSNGYIAPSY--DEESSSGSRFKMKLKEFHKST  514
             EALDVVG D    DSSL +       EG+NGYIAPSY  +E SSSG++ KMKLKEFHKS 
Sbjct  436   EALDVVGGDDNLNDSSLASLGPTANYEGNNGYIAPSYEEEESSSSGNKIKMKLKEFHKSA  495

Query  513   SSFTAIDRNYLTPFFTTQNGDEDEQEE  433
             +SFTA+DRNYLTPFFT+ NGDED++ E
Sbjct  496   ASFTALDRNYLTPFFTSHNGDEDDEVE  522



>ref|XP_006389867.1| hypothetical protein EUTSA_v10018385mg [Eutrema salsugineum]
 gb|ESQ27153.1| hypothetical protein EUTSA_v10018385mg [Eutrema salsugineum]
Length=534

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/524 (81%), Positives = 464/524 (89%), Gaps = 12/524 (2%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS
Sbjct  13    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANIS  72

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TET+IR WFNFH+EFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTF++ GTF+ASMVT
Sbjct  73    NTETSIRTWFNFHDEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFSVLGTFVASMVT  132

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             GVLVY+GGV+ LMYKLPF+ECLMFGSLISATDPVTVLSIFQELG+DVNLYALVFGESVLN
Sbjct  133   GVLVYLGGVMFLMYKLPFVECLMFGSLISATDPVTVLSIFQELGSDVNLYALVFGESVLN  192

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLVRS+ SSGQN FM+ VRF+ETF GSMSAGVGVGF SALLFKYAGLD+
Sbjct  193   DAMAISLYRTMSLVRSH-SSGQNIFMVVVRFLETFIGSMSAGVGVGFTSALLFKYAGLDV  251

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS +SQRFVS+FF
Sbjct  252   DNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSVNSQRFVSAFF  311

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETFVFIYMGFDIAME+HSW+H+GFIFFSILFI IARAANVFGC YLVNL RPA
Sbjct  312   HLISSLAETFVFIYMGFDIAMEKHSWSHLGFIFFSILFIVIARAANVFGCGYLVNLARPA  371

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             +RKIP  HQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGST
Sbjct  372   HRKIPMTHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGST  431

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTS  511
             GTMLEAL+VVGD +D    T         +N ++    DE+S SGS F+ KL+EFHKS +
Sbjct  432   GTMLEALEVVGDSHD----TSLGDGFEVVNNRFMTSYDDEDSPSGSGFRTKLREFHKSAA  487

Query  510   SFTAIDRNYLTPFFTTQNGDEDEQ-------EELISNSRRARYS  400
             SFT +DRNYLTPFFT+ NGD D++       EE +  +RR  ++
Sbjct  488   SFTELDRNYLTPFFTSNNGDYDDEDNTEQDHEERMPFTRRGNFN  531



>gb|KFK42371.1| hypothetical protein AALP_AA2G247200 [Arabis alpina]
Length=531

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/522 (81%), Positives = 460/522 (88%), Gaps = 12/522 (2%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS
Sbjct  10    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANIS  69

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TET+IR WFNFH+EFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTF++ GTF+AS+VT
Sbjct  70    NTETSIRTWFNFHDEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFSVLGTFVASIVT  129

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             GVLVY+GGV+ LMY+LPF+ECLMFGSLISATDPVTVLSIFQELG+DVNLYALVFGESVLN
Sbjct  130   GVLVYLGGVMFLMYRLPFVECLMFGSLISATDPVTVLSIFQELGSDVNLYALVFGESVLN  189

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLVRS+ SSGQNFFM+ VRF+ETF GSMSAGVGVGF SALLFKYAGLD+
Sbjct  190   DAMAISLYRTMSLVRSH-SSGQNFFMVIVRFLETFVGSMSAGVGVGFTSALLFKYAGLDV  248

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS +SQRFVS+FF
Sbjct  249   DNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSGNSQRFVSAFF  308

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETFVFIYMGFDIAME+HSW+HVGFI FSILFI IARAANVFGC YLVNL RPA
Sbjct  309   HLISSLAETFVFIYMGFDIAMEKHSWSHVGFICFSILFIVIARAANVFGCGYLVNLARPA  368

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             +RKIP  HQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGST
Sbjct  369   HRKIPMTHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGST  428

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTS  511
             GTMLEAL+VVGD  D    T         +N Y+    DE+S SGS F+ KL+EFHKS +
Sbjct  429   GTMLEALEVVGDSRD----TALGDGFEVVNNRYMTSFDDEDSPSGSGFRTKLREFHKSAA  484

Query  510   SFTAIDRNYLTPFFTTQNGDEDE-------QEELISNSRRAR  406
             SFT +DRNYLTPFFT+ NG+ D+        EE I  +RR  
Sbjct  485   SFTELDRNYLTPFFTSHNGEYDDDVNNEISHEERIPFARRGN  526



>ref|XP_006467254.1| PREDICTED: sodium/hydrogen exchanger 6-like [Citrus sinensis]
Length=531

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/522 (82%), Positives = 476/522 (91%), Gaps = 9/522 (2%)
 Frame = -1

Query  1953  PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANI  1774
             P     K+Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVG LANI
Sbjct  14    PRGSPAKEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGALANI  73

Query  1773  SDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMV  1594
             S+TETNIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAIFGTF+ASMV
Sbjct  74    SNTETNIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAIFGTFLASMV  133

Query  1593  TGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVL  1414
             TG+LVY+GGV+ LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVL
Sbjct  134   TGILVYLGGVMFLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVL  193

Query  1413  NDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLD  1234
             NDAMAISLYRTMSLVRS+ SSGQNFFM+ VRF+ETF GSMSAGVGVGFIS +L K    D
Sbjct  194   NDAMAISLYRTMSLVRSHASSGQNFFMVIVRFLETFVGSMSAGVGVGFISKILIKTFCCD  253

Query  1233  -IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSS  1057
              + +LQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYT+SNLS++SQRFVS+
Sbjct  254   SLFSLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTFSNLSENSQRFVSA  313

Query  1056  FFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVR  877
             FFHLISSLAETFVFIYMGFDIAME+HSW+H+GFIFFSILFI +ARAANVF CAYLVNL R
Sbjct  314   FFHLISSLAETFVFIYMGFDIAMEKHSWSHLGFIFFSILFIIVARAANVFSCAYLVNLAR  373

Query  876   PANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGG  697
             PA+R+IP KHQ+ALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGG
Sbjct  374   PAHRQIPLKHQQALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGG  433

Query  696   STGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKS  517
             STGTMLEAL VVGD +D     G LGE  EG+NGY AP YDE S+SG++ KMKLKEF KS
Sbjct  434   STGTMLEALQVVGDAHD-----GHLGENFEGNNGYAAP-YDEGSTSGNKLKMKLKEFRKS  487

Query  516   TSSFTAIDRNYLTPFFTTQNG--DEDEQEELISNSRRARYSG  397
              +SFTA+D+NYLTPFFT+ NG  +++E E+L+ +SRR  + G
Sbjct  488   AASFTALDKNYLTPFFTSHNGDEEDEEDEDLLPSSRRLSFHG  529



>gb|KFK35523.1| hypothetical protein AALP_AA4G001900 [Arabis alpina]
Length=510

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/512 (81%), Positives = 455/512 (89%), Gaps = 11/512 (2%)
 Frame = -1

Query  1953  PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANI  1774
             PPP   + Q+AAGVGILLQIMMLVLSF+LGHVLRRHRF+YLPEAS SLLIGLIVG LANI
Sbjct  3     PPPGHDQQQQAAGVGILLQIMMLVLSFVLGHVLRRHRFHYLPEASGSLLIGLIVGILANI  62

Query  1773  SDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMV  1594
             SDTET+IR WFNFHEEFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTFAIFGT +AS+V
Sbjct  63    SDTETSIRTWFNFHEEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFAIFGTLVASLV  122

Query  1593  TGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVL  1414
             TG LVY+GG + LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVL
Sbjct  123   TGALVYLGGSMYLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVL  182

Query  1413  NDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLD  1234
             NDAMAISLYRTMSLV   +SSG++F M+ +RF+ETF GSMSAGVGVGF SALLFKYAGLD
Sbjct  183   NDAMAISLYRTMSLVNRQSSSGESFLMVVIRFLETFAGSMSAGVGVGFTSALLFKYAGLD  242

Query  1233  IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSF  1054
              +NLQNLECCLFVLFPYFSYMLAEG+GLSGIVSILFTGIVMKRYT+SNLS++SQ FVS+F
Sbjct  243   TENLQNLECCLFVLFPYFSYMLAEGVGLSGIVSILFTGIVMKRYTFSNLSEASQSFVSAF  302

Query  1053  FHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRP  874
             FHLISSLAETF FIYMGFDIAME+HSW+HVGFI FSILFIG+ARA NVFGCAYLVNLVR 
Sbjct  303   FHLISSLAETFTFIYMGFDIAMEKHSWSHVGFILFSILFIGVARAVNVFGCAYLVNLVRQ  362

Query  873   ANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGS  694
              ++KIP KHQKALWYSGLRGAMAFALALQS+HDLPEGHGQ IFTATT IVV+TVL+IGGS
Sbjct  363   EHQKIPMKHQKALWYSGLRGAMAFALALQSLHDLPEGHGQIIFTATTTIVVVTVLLIGGS  422

Query  693   TGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAP------SYDEE-SSSGSRFKMKL  535
             TG MLEALDV+GDD D            E  + YI P      S DE+ SSSGSRFKMKL
Sbjct  423   TGKMLEALDVIGDDLD----DSMSEGFEESDHRYIPPPFSVGASSDEDTSSSGSRFKMKL  478

Query  534   KEFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQ  439
             KEFHKST+SFTA+D+N+LTPFFTT NGD +E+
Sbjct  479   KEFHKSTTSFTALDKNFLTPFFTTNNGDGEEE  510



>ref|NP_178079.2| sodium/hydrogen exchanger 6 [Arabidopsis thaliana]
 sp|Q8RWU6.3|NHX6_ARATH RecName: Full=Sodium/hydrogen exchanger 6; AltName: Full=Na(+)/H(+) 
exchanger 6; Short=NHE-6 [Arabidopsis thaliana]
 gb|AAM14051.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91682.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36272.1| sodium/hydrogen exchanger 6 [Arabidopsis thaliana]
Length=535

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/522 (81%), Positives = 462/522 (89%), Gaps = 12/522 (2%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS
Sbjct  14    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANIS  73

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TET+IR WFNFH+EFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTF++ GTF+ASMVT
Sbjct  74    NTETSIRTWFNFHDEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFSVLGTFVASMVT  133

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G+LVY+GGV+ LMY+LPF+ECLMFGSLISATDPVTVLSIFQELG+DVNLYALVFGESVLN
Sbjct  134   GLLVYLGGVMFLMYRLPFVECLMFGSLISATDPVTVLSIFQELGSDVNLYALVFGESVLN  193

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLVRS+ SSGQNFFM+ VRF+ETF GSMSAGVGVGF SALLFKYAGLD+
Sbjct  194   DAMAISLYRTMSLVRSH-SSGQNFFMVIVRFLETFVGSMSAGVGVGFTSALLFKYAGLDV  252

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS +SQRFVS+FF
Sbjct  253   DNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSANSQRFVSAFF  312

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETFVFIYMGFDIAME+HSW+H+GFIFFSILFI IARAANVFGC YLVNL RPA
Sbjct  313   HLISSLAETFVFIYMGFDIAMEKHSWSHLGFIFFSILFIVIARAANVFGCGYLVNLARPA  372

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             +RKIP  HQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGST
Sbjct  373   HRKIPMTHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGST  432

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTS  511
             GTMLEAL+VVGD +D    T         ++ Y+    DE++  GS F+ KL+EFHKS +
Sbjct  433   GTMLEALEVVGDSHD----TSLGDGFEVVNSRYMTSYDDEDTPPGSGFRTKLREFHKSAA  488

Query  510   SFTAIDRNYLTPFFTTQNGDEDEQ-------EELISNSRRAR  406
             SFT +DRNYLTPFFT+ NGD D++       EE I  +RR  
Sbjct  489   SFTELDRNYLTPFFTSNNGDYDDEGNMEQHHEERIPFTRRGN  530



>ref|XP_006584123.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X2 [Glycine 
max]
Length=527

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/501 (83%), Positives = 464/501 (93%), Gaps = 4/501 (1%)
 Frame = -1

Query  1935  KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             + Q+AAGVGILLQIMMLVLSF+LGHVLRR + Y LPEASASLLIGL+VG LANIS T+T+
Sbjct  10    EQQQAAGVGILLQIMMLVLSFVLGHVLRRKKIYVLPEASASLLIGLLVGTLANISHTQTS  69

Query  1755  IRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVY  1576
             IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFF+NFGAIVTFAIFGTF+AS+VTGVLVY
Sbjct  70    IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFANFGAIVTFAIFGTFLASIVTGVLVY  129

Query  1575  IGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAI  1396
             +GG++ LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAI
Sbjct  130   LGGLMYLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAI  189

Query  1395  SLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQN  1216
             SLYRTMS+V+S+  SGQNFFM+ VRF+ETF GSMS+GVGVGFISALLFKYAGLDIDNLQN
Sbjct  190   SLYRTMSVVKSH-PSGQNFFMVIVRFLETFVGSMSSGVGVGFISALLFKYAGLDIDNLQN  248

Query  1215  LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISS  1036
             LE CLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YTYSNLS SSQRFVS+FF LISS
Sbjct  249   LESCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTYSNLSRSSQRFVSAFFELISS  308

Query  1035  LAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIP  856
             LAETFVFIYMGFDIAME+HSW+HVGFIFFSI+FIGIARAANVF CAYLVNL+RPA R+IP
Sbjct  309   LAETFVFIYMGFDIAMEKHSWSHVGFIFFSIIFIGIARAANVFSCAYLVNLIRPAYRQIP  368

Query  855   PKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLE  676
             PKHQKALWYSGLRGAMAFALALQS+HDLPEGHGQTI TATTAIVVLTVL+IGGSTGTMLE
Sbjct  369   PKHQKALWYSGLRGAMAFALALQSIHDLPEGHGQTILTATTAIVVLTVLLIGGSTGTMLE  428

Query  675   ALDVVGDD--YDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFT  502
             AL+VVG D   +S L + +     EG+N YI+P  DEE SSG++ KMKL+EF +S +SFT
Sbjct  429   ALEVVGSDSPVESPLASVSTRTNFEGNNVYISPD-DEEPSSGNKIKMKLQEFQRSAASFT  487

Query  501   AIDRNYLTPFFTTQNGDEDEQ  439
             AID+NYLTPFFT+QNGDE+++
Sbjct  488   AIDKNYLTPFFTSQNGDEEDE  508



>tpg|DAA60892.1| TPA: hypothetical protein ZEAMMB73_538503 [Zea mays]
Length=524

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/494 (82%), Positives = 455/494 (92%), Gaps = 7/494 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+ AGVGILLQI MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TET
Sbjct  28    GKEQQVAGVGILLQISMLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTET  87

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             N R WFNFHEEFFFLFLLPPIIFQSGFSLSPKPFF+NFGAIVTFAI GTFIAS+VTGVLV
Sbjct  88    NTRTWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFANFGAIVTFAILGTFIASVVTGVLV  147

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+  LMYKLP +ECLMFG+LISATDPVTVLSIFQELG+DVNLYALVFGESVLNDAMA
Sbjct  148   YLGGLTFLMYKLPLVECLMFGALISATDPVTVLSIFQELGSDVNLYALVFGESVLNDAMA  207

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMS VRS+ + G+NFFM+ ++F+ETF GSMS+GVGVGFISALLFKYAGLD+DNLQ
Sbjct  208   ISLYRTMSSVRSHAAGGENFFMMILQFLETFVGSMSSGVGVGFISALLFKYAGLDVDNLQ  267

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YTYSNLSD+SQRFVS+FFHL+S
Sbjct  268   NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTYSNLSDNSQRFVSAFFHLLS  327

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAME+HSW+HVGFIFFSI+FI +ARAANVF CAYLVN+ RP +R+I
Sbjct  328   SLAETFVFIYMGFDIAMEEHSWSHVGFIFFSIIFIVVARAANVFSCAYLVNMSRPEHRRI  387

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALW+SGLRGAMAFALALQSVH+LPEGHG+TIFT TTAIVVLTVL+IGGSTGTML
Sbjct  388   PVKHQKALWFSGLRGAMAFALALQSVHELPEGHGKTIFTTTTAIVVLTVLLIGGSTGTML  447

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             E+LDVVGD+        T  E  E +NGY+ PSY+E +SSG   +MKLK+FHKST+SFTA
Sbjct  448   ESLDVVGDE-------NTSRENYEDNNGYMPPSYEEGTSSGGGLRMKLKQFHKSTTSFTA  500

Query  498   IDRNYLTPFFTTQN  457
             +D+NYLTPFFT+Q 
Sbjct  501   LDKNYLTPFFTSQT  514



>gb|AAM08407.1|AF490590_1 Na+/H+ exchanger 6 [Arabidopsis thaliana]
Length=525

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/505 (83%), Positives = 459/505 (91%), Gaps = 7/505 (1%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS
Sbjct  14    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANIS  73

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TET+IR WFNFH+EFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTF++ GTF+ASMVT
Sbjct  74    NTETSIRTWFNFHDEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFSVLGTFVASMVT  133

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G+LVY+GGV+ LMY+LPF+ECLMFGSLISATDPVTVLSIFQELG+DVNLYALVFGESVLN
Sbjct  134   GLLVYLGGVMFLMYRLPFVECLMFGSLISATDPVTVLSIFQELGSDVNLYALVFGESVLN  193

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLVRS+ SSGQNFFM+ VRF+ETF GSMSAGVGVGF SALLFKYAGLD+
Sbjct  194   DAMAISLYRTMSLVRSH-SSGQNFFMVIVRFLETFVGSMSAGVGVGFTSALLFKYAGLDV  252

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS +SQRFVS+FF
Sbjct  253   DNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSANSQRFVSAFF  312

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETFVFIYMGFDIAME+HSW+H+GFIFFSILFI IARAANVFGC YLVNL RPA
Sbjct  313   HLISSLAETFVFIYMGFDIAMEKHSWSHLGFIFFSILFIVIARAANVFGCGYLVNLARPA  372

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             +RKIP  HQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGST
Sbjct  373   HRKIPMTHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGST  432

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESS-SGSRFKMKLKEFHKST  514
             GTMLEAL+VVGD +D      +LG+  E  N     SYD+E +  GS F+ KL+EFHKS 
Sbjct  433   GTMLEALEVVGDSHD-----TSLGDGFEVVNSRYMTSYDDEDTPPGSGFRTKLREFHKSA  487

Query  513   SSFTAIDRNYLTPFFTTQNGDEDEQ  439
             +SFT +DRNYLTPFFT+ NGD D++
Sbjct  488   ASFTELDRNYLTPFFTSNNGDYDDE  512



>ref|XP_004956447.1| PREDICTED: sodium/hydrogen exchanger 6-like [Setaria italica]
Length=536

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/512 (80%), Positives = 464/512 (91%), Gaps = 7/512 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+ AGVGILLQI MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TET
Sbjct  29    GKEQQVAGVGILLQISMLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTET  88

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             N R WFNFHEEFFFLFLLPPIIFQSGFSLSPKPFF+NFGAIVTFAI GTFIAS+VTGVLV
Sbjct  89    NTRTWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFANFGAIVTFAILGTFIASVVTGVLV  148

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+  LMYKLP +ECLMFG+LISATDPVTVLSIFQELG+DVNLYALVFGESVLNDAMA
Sbjct  149   YLGGLTFLMYKLPLVECLMFGALISATDPVTVLSIFQELGSDVNLYALVFGESVLNDAMA  208

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMS VRS+ ++G+NFFM+ ++F+ETF GSMS+GVGVGFISALLFKYAGLD+DNLQ
Sbjct  209   ISLYRTMSSVRSHAAAGENFFMMILQFLETFVGSMSSGVGVGFISALLFKYAGLDVDNLQ  268

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YT+SNLSD+SQRFVS+FFHL+S
Sbjct  269   NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTFSNLSDNSQRFVSAFFHLLS  328

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAME+HSW+HVGFIFFSI+FI +ARA NVF CAYLVN+ RP +R+I
Sbjct  329   SLAETFVFIYMGFDIAMEEHSWSHVGFIFFSIIFIVVARAVNVFSCAYLVNMSRPEHRRI  388

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALW+SGLRGAMAFALALQSVH+LPEGHG+TIFT TTAIVVLTVL+IGGSTGTML
Sbjct  389   PLKHQKALWFSGLRGAMAFALALQSVHELPEGHGKTIFTTTTAIVVLTVLLIGGSTGTML  448

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EALDVVGD+        T  E  E +NGY+ P+Y+E +SSG   +MKLK+FHKST+SFTA
Sbjct  449   EALDVVGDE-------NTSIENYEDNNGYMPPTYEEGTSSGGGLRMKLKQFHKSTTSFTA  501

Query  498   IDRNYLTPFFTTQNGDEDEQEELISNSRRARY  403
             +D+NYLTPFFT+Q  D+D+       +RR R+
Sbjct  502   LDKNYLTPFFTSQTDDDDDDFSEQPQNRRVRF  533



>ref|XP_010472826.1| PREDICTED: sodium/hydrogen exchanger 6 [Camelina sativa]
Length=535

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/523 (81%), Positives = 465/523 (89%), Gaps = 14/523 (3%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS
Sbjct  14    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANIS  73

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TET+IR WFNFH+EFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTF++ GTF+ASMVT
Sbjct  74    NTETSIRTWFNFHDEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFSVLGTFVASMVT  133

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G+LVY+GG++ LMY+LP +ECLMFGSLISATDPVTVLSIFQELG+DVNLYALVFGESVLN
Sbjct  134   GLLVYLGGLMFLMYRLPLVECLMFGSLISATDPVTVLSIFQELGSDVNLYALVFGESVLN  193

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLVRS+ SSGQNFFM+ VRF+ETF GSMSAGVGVGF SALLFKYAGLD+
Sbjct  194   DAMAISLYRTMSLVRSH-SSGQNFFMVIVRFLETFVGSMSAGVGVGFTSALLFKYAGLDV  252

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS +SQRFVS+FF
Sbjct  253   DNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSANSQRFVSAFF  312

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETFVFIYMGFDIAME+HSW+H+GFIFFSILFI IARAANVFGC YLVNL RPA
Sbjct  313   HLISSLAETFVFIYMGFDIAMEKHSWSHLGFIFFSILFIVIARAANVFGCGYLVNLARPA  372

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             +RKIP  HQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGST
Sbjct  373   HRKIPMTHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGST  432

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESS-SGSRFKMKLKEFHKST  514
             GTMLEAL+VVGD +D      +LG+  E  N     SYD+E + SGS F+ KL+EFHKS 
Sbjct  433   GTMLEALEVVGDSHD-----TSLGDGFEVVNSRYMTSYDDEDTPSGSGFRTKLREFHKSA  487

Query  513   SSFTAIDRNYLTPFFTTQNGDEDEQ-------EELISNSRRAR  406
             +SFT +D+NYLTPFFT+ NGD D++       EE I  +RR  
Sbjct  488   ASFTELDKNYLTPFFTSNNGDYDDEDNIEQHHEERIPFTRRGN  530



>ref|XP_003528718.2| PREDICTED: sodium/hydrogen exchanger 6-like isoform X1 [Glycine 
max]
Length=522

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/499 (84%), Positives = 461/499 (92%), Gaps = 5/499 (1%)
 Frame = -1

Query  1935  KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             + Q+AAGVGILLQIMMLVLSF+LGHVLRR + Y LPEASASLLIGL+VG LANIS T+T+
Sbjct  10    EQQQAAGVGILLQIMMLVLSFVLGHVLRRKKIYVLPEASASLLIGLLVGTLANISHTQTS  69

Query  1755  IRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVY  1576
             IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFF+NFGAIVTFAIFGTF+AS+VTGVLVY
Sbjct  70    IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFANFGAIVTFAIFGTFLASIVTGVLVY  129

Query  1575  IGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAI  1396
             +GG++ LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAI
Sbjct  130   LGGLMYLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAI  189

Query  1395  SLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQN  1216
             SLYRTMS+V+S+  SGQNFFM+ VRF+ETF GSMS+GVGVGFISALLFKYAGLDIDNLQN
Sbjct  190   SLYRTMSVVKSH-PSGQNFFMVIVRFLETFVGSMSSGVGVGFISALLFKYAGLDIDNLQN  248

Query  1215  LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISS  1036
             LE CLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YTYSNLS SSQRFVS+FF LISS
Sbjct  249   LESCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTYSNLSRSSQRFVSAFFELISS  308

Query  1035  LAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIP  856
             LAETFVFIYMGFDIAME+HSW+HVGFIFFSI+FIGIARAANVF CAYLVNL+RPA R+IP
Sbjct  309   LAETFVFIYMGFDIAMEKHSWSHVGFIFFSIIFIGIARAANVFSCAYLVNLIRPAYRQIP  368

Query  855   PKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLE  676
             PKHQKALWYSGLRGAMAFALALQS+HDLPEGHGQTI TATTAIVVLTVL+IGGSTGTMLE
Sbjct  369   PKHQKALWYSGLRGAMAFALALQSIHDLPEGHGQTILTATTAIVVLTVLLIGGSTGTMLE  428

Query  675   ALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAI  496
             AL+VVG D   S     L    EG+N YI+P  DEE SSG++ KMKL+EF +S +SFTAI
Sbjct  429   ALEVVGSD---SPVESPLASNFEGNNVYISPD-DEEPSSGNKIKMKLQEFQRSAASFTAI  484

Query  495   DRNYLTPFFTTQNGDEDEQ  439
             D+NYLTPFFT+QNGDE+++
Sbjct  485   DKNYLTPFFTSQNGDEEDE  503



>gb|ACG45634.1| sodium/hydrogen exchanger family protein [Zea mays]
 gb|ACN36211.1| unknown [Zea mays]
 tpg|DAA60893.1| TPA: sodium/hydrogen exchanger [Zea mays]
Length=536

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/494 (82%), Positives = 455/494 (92%), Gaps = 7/494 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+ AGVGILLQI MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TET
Sbjct  28    GKEQQVAGVGILLQISMLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTET  87

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             N R WFNFHEEFFFLFLLPPIIFQSGFSLSPKPFF+NFGAIVTFAI GTFIAS+VTGVLV
Sbjct  88    NTRTWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFANFGAIVTFAILGTFIASVVTGVLV  147

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+  LMYKLP +ECLMFG+LISATDPVTVLSIFQELG+DVNLYALVFGESVLNDAMA
Sbjct  148   YLGGLTFLMYKLPLVECLMFGALISATDPVTVLSIFQELGSDVNLYALVFGESVLNDAMA  207

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMS VRS+ + G+NFFM+ ++F+ETF GSMS+GVGVGFISALLFKYAGLD+DNLQ
Sbjct  208   ISLYRTMSSVRSHAAGGENFFMMILQFLETFVGSMSSGVGVGFISALLFKYAGLDVDNLQ  267

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YTYSNLSD+SQRFVS+FFHL+S
Sbjct  268   NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTYSNLSDNSQRFVSAFFHLLS  327

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAME+HSW+HVGFIFFSI+FI +ARAANVF CAYLVN+ RP +R+I
Sbjct  328   SLAETFVFIYMGFDIAMEEHSWSHVGFIFFSIIFIVVARAANVFSCAYLVNMSRPEHRRI  387

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALW+SGLRGAMAFALALQSVH+LPEGHG+TIFT TTAIVVLTVL+IGGSTGTML
Sbjct  388   PVKHQKALWFSGLRGAMAFALALQSVHELPEGHGKTIFTTTTAIVVLTVLLIGGSTGTML  447

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             E+LDVVGD+        T  E  E +NGY+ PSY+E +SSG   +MKLK+FHKST+SFTA
Sbjct  448   ESLDVVGDE-------NTSRENYEDNNGYMPPSYEEGTSSGGGLRMKLKQFHKSTTSFTA  500

Query  498   IDRNYLTPFFTTQN  457
             +D+NYLTPFFT+Q 
Sbjct  501   LDKNYLTPFFTSQT  514



>ref|XP_010429857.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X1 [Camelina 
sativa]
 ref|XP_010429858.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X2 [Camelina 
sativa]
Length=536

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/522 (81%), Positives = 463/522 (89%), Gaps = 11/522 (2%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS
Sbjct  14    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANIS  73

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TET+IR WFNFH+EFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTF++ GTF+ASMVT
Sbjct  74    NTETSIRTWFNFHDEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFSVLGTFVASMVT  133

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G+LVY+GG++ LMY+LP +ECLMFGSLISATDPVTVLSIFQELG+DVNLYALVFGESVLN
Sbjct  134   GLLVYLGGLMFLMYRLPLVECLMFGSLISATDPVTVLSIFQELGSDVNLYALVFGESVLN  193

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLVRS+ SSGQNFFM+ VRF+ETF GSMSAGVGVGF SALLFKYAGLD+
Sbjct  194   DAMAISLYRTMSLVRSH-SSGQNFFMVIVRFLETFVGSMSAGVGVGFTSALLFKYAGLDV  252

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS +SQRFVS+FF
Sbjct  253   DNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSANSQRFVSAFF  312

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETFVFIYMGFDIAME+HSW+H+GFIFFSILFI IARAANVFGC YLVNL RPA
Sbjct  313   HLISSLAETFVFIYMGFDIAMEKHSWSHLGFIFFSILFIVIARAANVFGCGYLVNLARPA  372

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             +RKIP  HQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGST
Sbjct  373   HRKIPMTHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGST  432

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTS  511
             GTMLEAL+VVGD +D+SLG G           Y     DE++ SGS F+ KL+EFHKS +
Sbjct  433   GTMLEALEVVGDSHDTSLGDGFEVVNSRYMTSY---DDDEDTPSGSGFRTKLREFHKSAA  489

Query  510   SFTAIDRNYLTPFFTTQNGDEDEQ-------EELISNSRRAR  406
             SFT +D+NYLTPFFT+ NGD D++       EE I  +RR  
Sbjct  490   SFTELDKNYLTPFFTSNNGDYDDEDNIEQHHEERIPFTRRGN  531



>ref|XP_002889258.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65517.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=536

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/522 (81%), Positives = 462/522 (89%), Gaps = 13/522 (2%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS
Sbjct  14    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANIS  73

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TET+IR WFNFH+EFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTF++ GTF+ASMVT
Sbjct  74    NTETSIRTWFNFHDEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFSVLGTFVASMVT  133

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             GVLVY+GGV+ LMY+LPF+ECLMFGSLISATDPVTVLSIFQELG+DVNLYALVFGESVLN
Sbjct  134   GVLVYLGGVMFLMYRLPFVECLMFGSLISATDPVTVLSIFQELGSDVNLYALVFGESVLN  193

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISAL-LFKYAGLD  1234
             DAMAISLYRTMSLVRS+ SSGQNFFM+ VRF+ETF GSMSAGVGVGF SAL LFKYAGLD
Sbjct  194   DAMAISLYRTMSLVRSH-SSGQNFFMVIVRFLETFVGSMSAGVGVGFTSALHLFKYAGLD  252

Query  1233  IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSF  1054
             +DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS +SQRFVS+F
Sbjct  253   VDNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSANSQRFVSAF  312

Query  1053  FHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRP  874
             FHLISSLAETFVFIYMGFDIAME+HSW+H+GFI FSILFI IARAANVFGC YLVNL RP
Sbjct  313   FHLISSLAETFVFIYMGFDIAMEKHSWSHLGFILFSILFIVIARAANVFGCGYLVNLARP  372

Query  873   ANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGS  694
             A+RKIP  HQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGS
Sbjct  373   AHRKIPMTHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGS  432

Query  693   TGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKST  514
             TGTMLEAL+VVGD +D+SLG G         N Y     DE++  GS F+ KL+E HKS 
Sbjct  433   TGTMLEALEVVGDSHDTSLGDGFEVVNSRFMNSYD----DEDTPPGSGFRTKLRELHKSA  488

Query  513   SSFTAIDRNYLTPFFTTQNGDEDEQ-------EELISNSRRA  409
             +SFT +DRNYLTPFFT+ NGD D++       EE I  +RR 
Sbjct  489   ASFTELDRNYLTPFFTSNNGDYDDEGNIEQHHEERIPFTRRG  530



>ref|NP_001140895.1| uncharacterized protein LOC100272972 [Zea mays]
 gb|ACF84902.1| unknown [Zea mays]
Length=536

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/494 (82%), Positives = 454/494 (92%), Gaps = 7/494 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+ AGVGILLQI MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TET
Sbjct  28    GKEQQVAGVGILLQISMLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTET  87

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             N R WFNFHEEFFFLFLLPPIIFQSGFSLSPKPFF+NFGAIVTFAI GTFIAS+VTGVLV
Sbjct  88    NTRTWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFANFGAIVTFAILGTFIASVVTGVLV  147

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+  LMYKLP +ECLMFG+LISATDPVTVLSIFQELG+DVNLYALVFGESVLNDAM 
Sbjct  148   YLGGLTFLMYKLPLVECLMFGALISATDPVTVLSIFQELGSDVNLYALVFGESVLNDAMT  207

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMS VRS+ + G+NFFM+ ++F+ETF GSMS+GVGVGFISALLFKYAGLD+DNLQ
Sbjct  208   ISLYRTMSSVRSHAAGGENFFMMILQFLETFVGSMSSGVGVGFISALLFKYAGLDVDNLQ  267

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YTYSNLSD+SQRFVS+FFHL+S
Sbjct  268   NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTYSNLSDNSQRFVSAFFHLLS  327

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAME+HSW+HVGFIFFSI+FI +ARAANVF CAYLVN+ RP +R+I
Sbjct  328   SLAETFVFIYMGFDIAMEEHSWSHVGFIFFSIIFIVVARAANVFSCAYLVNMSRPEHRRI  387

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALW+SGLRGAMAFALALQSVH+LPEGHG+TIFT TTAIVVLTVL+IGGSTGTML
Sbjct  388   PVKHQKALWFSGLRGAMAFALALQSVHELPEGHGKTIFTTTTAIVVLTVLLIGGSTGTML  447

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             E+LDVVGD+        T  E  E +NGY+ PSY+E +SSG   +MKLK+FHKST+SFTA
Sbjct  448   ESLDVVGDE-------NTSRENYEDNNGYMPPSYEEGTSSGGGLRMKLKQFHKSTTSFTA  500

Query  498   IDRNYLTPFFTTQN  457
             +D+NYLTPFFT+Q 
Sbjct  501   LDKNYLTPFFTSQT  514



>dbj|BAD29666.1| putative Na+/H+ antiporter, isoform 2 [Oryza sativa Japonica 
Group]
Length=535

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/513 (80%), Positives = 460/513 (90%), Gaps = 8/513 (2%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+ AGVGILLQI MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TET
Sbjct  28    GKEQQVAGVGILLQISMLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTET  87

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             N R WFNFH+EFFFLFLLPPII QSGFSLSPKPFF+NFGAIVTFAI GTFIAS+VTGVLV
Sbjct  88    NTRMWFNFHDEFFFLFLLPPIITQSGFSLSPKPFFANFGAIVTFAILGTFIASVVTGVLV  147

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+  LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  148   YLGGLTFLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  207

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRS  ++G+NFFM+  +F+ETF GS+S+GVGVGFISALLFKYAGLDIDNLQ
Sbjct  208   ISLYRTMSLVRSQAAAGENFFMMVFQFLETFVGSLSSGVGVGFISALLFKYAGLDIDNLQ  267

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YT+SNLS++SQRFVS+FFHL+S
Sbjct  268   NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTFSNLSNNSQRFVSAFFHLLS  327

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAME+HSW+HVGFIFFSI+FI IARA NVF CAYLVN+ RP +R+I
Sbjct  328   SLAETFVFIYMGFDIAMEEHSWSHVGFIFFSIIFIIIARAVNVFSCAYLVNMSRPEHRRI  387

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALW+SGLRGAMAFALALQS ++LP GHG+TIFT TTAIVVLTVL+IGGSTGTML
Sbjct  388   PLKHQKALWFSGLRGAMAFALALQSANELPGGHGKTIFTTTTAIVVLTVLLIGGSTGTML  447

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EALDV+GD+           E  + +NGYI P+Y+E SSSG   +MKLKEFHKST+SFTA
Sbjct  448   EALDVIGDE-------NRSIENYDDNNGYIPPTYEEGSSSGGGLRMKLKEFHKSTTSFTA  500

Query  498   IDRNYLTPFFTTQNGDEDEQ-EELISNSRRARY  403
             +DRNYLTPFFT+Q  ++D+   E   N RR  Y
Sbjct  501   LDRNYLTPFFTSQTDEDDDVFGEQPQNQRRGFY  533



>ref|NP_001062780.1| Os09g0286400 [Oryza sativa Japonica Group]
 dbj|BAF24694.1| Os09g0286400 [Oryza sativa Japonica Group]
 dbj|BAG92828.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAJ06108.1| sodium/proton antiporter [Oryza sativa Japonica Group]
Length=535

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/513 (80%), Positives = 461/513 (90%), Gaps = 8/513 (2%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+ AGVGILLQI MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TET
Sbjct  28    GKEQQVAGVGILLQISMLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTET  87

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             N R WFNFH+EFFFLFLLPPIIFQSGFSLSPKPFF+NFGAIVTFAI GTFIAS+VTGVLV
Sbjct  88    NTRMWFNFHDEFFFLFLLPPIIFQSGFSLSPKPFFANFGAIVTFAILGTFIASVVTGVLV  147

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+  LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  148   YLGGLTFLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  207

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRS  ++G+NFFM+  +F+ETF GS+S+GVGVGFISALLFKYAGLDIDNLQ
Sbjct  208   ISLYRTMSLVRSQAAAGENFFMMVFQFLETFVGSLSSGVGVGFISALLFKYAGLDIDNLQ  267

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YT+SNLS++SQRFVS+FFHL+S
Sbjct  268   NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTFSNLSNNSQRFVSAFFHLLS  327

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAME+HSW+HVGFIFFSI+FI IARA NVF CAYLVN+ RP +R+I
Sbjct  328   SLAETFVFIYMGFDIAMEEHSWSHVGFIFFSIIFIIIARAVNVFSCAYLVNMSRPEHRRI  387

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALW+SGLRGAMAFALALQS ++LP GHG+TIFT TTAIVVLTVL+IGGSTGTML
Sbjct  388   PLKHQKALWFSGLRGAMAFALALQSANELPGGHGKTIFTTTTAIVVLTVLLIGGSTGTML  447

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EALDV+GD+           E  + +NGYI P+Y+E SSSG   +MKLKEFHKST+SFTA
Sbjct  448   EALDVIGDE-------NRSIENYDDNNGYIPPTYEEGSSSGGGLRMKLKEFHKSTTSFTA  500

Query  498   IDRNYLTPFFTTQNGDEDEQ-EELISNSRRARY  403
             +DRNYLTPFFT+Q  ++D+   E   N RR  Y
Sbjct  501   LDRNYLTPFFTSQTDEDDDVFGEQPQNQRRGFY  533



>ref|XP_006392551.1| hypothetical protein EUTSA_v10011392mg [Eutrema salsugineum]
 gb|ESQ29837.1| hypothetical protein EUTSA_v10011392mg [Eutrema salsugineum]
Length=519

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/511 (81%), Positives = 455/511 (89%), Gaps = 11/511 (2%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRHRF+YLPEAS SLLIGLIVG LAN+S
Sbjct  13    PQGQVKQQQAAGVGILLQIMMLVLSFVLGHVLRRHRFHYLPEASGSLLIGLIVGVLANVS  72

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             DTET+IR WFNFHEEFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTFAI GTF+AS+VT
Sbjct  73    DTETSIRTWFNFHEEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFAIIGTFVASVVT  132

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G LVY+GG + LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLN
Sbjct  133   GGLVYLGGSMYLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLN  192

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLV   +S+G++F M+ +RF+ETF GSMSAGVGVGF SALLFKYAGLD 
Sbjct  193   DAMAISLYRTMSLVNRQSSTGEHFLMVVIRFLETFAGSMSAGVGVGFTSALLFKYAGLDT  252

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             +NLQNLECCLFVLFPYFSYMLAEG+GLSGIVSILFTGIVMKRYT+SNLS++SQ FVS+FF
Sbjct  253   ENLQNLECCLFVLFPYFSYMLAEGVGLSGIVSILFTGIVMKRYTFSNLSEASQSFVSAFF  312

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETF FIYMGFDIAMEQHSW+HVGFI FSILFIG+ARA NVFGCAYLVNLVR  
Sbjct  313   HLISSLAETFTFIYMGFDIAMEQHSWSHVGFILFSILFIGVARAVNVFGCAYLVNLVRQE  372

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             N+KIP KHQKALWYSGLRGAMAFALALQS+HDLPEGHGQ IFTATT IVV+TVL+IGGST
Sbjct  373   NQKIPMKHQKALWYSGLRGAMAFALALQSLHDLPEGHGQIIFTATTTIVVVTVLLIGGST  432

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAP------SYDEE-SSSGSRFKMKLK  532
             G MLEAL+VVGDD+D S+  G           YI P      S DEE SSSGSRFKMKLK
Sbjct  433   GKMLEALEVVGDDHDDSMSEGFEESNPR----YIPPPFSIGASSDEETSSSGSRFKMKLK  488

Query  531   EFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQ  439
             EFHKST+SFTA+D+N+LTPFFTT NGD +E+
Sbjct  489   EFHKSTTSFTALDKNFLTPFFTTNNGDGEEE  519



>ref|XP_009104514.1| PREDICTED: sodium/hydrogen exchanger 6-like [Brassica rapa]
Length=535

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/496 (84%), Positives = 452/496 (91%), Gaps = 5/496 (1%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLAN+S
Sbjct  13    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANVS  72

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TET+IR WFNFH+EFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTF++ GTF+ASMVT
Sbjct  73    NTETSIRTWFNFHDEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFSVLGTFVASMVT  132

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             GVLVY+GGV+ LMYKLPF+ECLMFGSLISATDPVTVLSIFQELG+DVNLYALVFGESVLN
Sbjct  133   GVLVYLGGVMFLMYKLPFVECLMFGSLISATDPVTVLSIFQELGSDVNLYALVFGESVLN  192

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLVRS  S+GQNFFM+ VRF+ETF GSMSAGVGVGFISALLFKYAGLD+
Sbjct  193   DAMAISLYRTMSLVRSQ-SAGQNFFMVIVRFLETFVGSMSAGVGVGFISALLFKYAGLDV  251

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS +SQRFVSSFF
Sbjct  252   DNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSTNSQRFVSSFF  311

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETFVFIYMGFDIAME HSW+HVGFI FSILFI IARAANVFGC YLVNLVRPA
Sbjct  312   HLISSLAETFVFIYMGFDIAMENHSWSHVGFILFSILFIVIARAANVFGCGYLVNLVRPA  371

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             +RKIP  HQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVV+TVL+IGGST
Sbjct  372   HRKIPMTHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVVTVLLIGGST  431

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTS  511
             GTMLEAL+VVGD +D++LG G         N +     DE+S SGS F+ KL+EFHKS +
Sbjct  432   GTMLEALEVVGDGHDATLGDGFEVVNDLYMNRF----DDEDSPSGSGFRTKLREFHKSAA  487

Query  510   SFTAIDRNYLTPFFTT  463
             SFT +D+NYLTPFFT+
Sbjct  488   SFTELDKNYLTPFFTS  503



>gb|AFV60030.1| Na+/K+-H+ antiporter NHX6, partial [Brassica oleracea]
Length=524

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/525 (80%), Positives = 459/525 (87%), Gaps = 14/525 (3%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLAN+S
Sbjct  5     PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANVS  64

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TET+IR WFNFH+EFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTF++ GTF+AS+VT
Sbjct  65    NTETSIRTWFNFHDEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFSVLGTFVASIVT  124

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             GVLVY+GGV+ LMY+LPF+ECLMFGSLISATDPVTVLSIFQELG+DVNLYALVFGESVLN
Sbjct  125   GVLVYLGGVMFLMYRLPFVECLMFGSLISATDPVTVLSIFQELGSDVNLYALVFGESVLN  184

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLVRS+ S+GQNFFM+ +RF+ETF GSMSAGVGVGF SALLFKYAGLD+
Sbjct  185   DAMAISLYRTMSLVRSH-SAGQNFFMVIIRFLETFVGSMSAGVGVGFTSALLFKYAGLDV  243

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS +SQRFVS+FF
Sbjct  244   DNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSTNSQRFVSAFF  303

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETFVFIYMGFDIAME+HSW+HVGFIFFSILFI IARAANVFGC YLVNL RPA
Sbjct  304   HLISSLAETFVFIYMGFDIAMEKHSWSHVGFIFFSILFIVIARAANVFGCGYLVNLARPA  363

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             +RKIP  HQKALWYSGLRGAMAFALALQSVH+LP+GHGQTIFTATTAIVV+TVL+IGGST
Sbjct  364   HRKIPMTHQKALWYSGLRGAMAFALALQSVHELPDGHGQTIFTATTAIVVVTVLLIGGST  423

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTS  511
             GTMLEAL+VVGD  D    T         +N Y+    DE S S S F+ KL+EFHKS  
Sbjct  424   GTMLEALEVVGDSRD----TSLGDGFEVVNNRYMTRFDDEGSPSESGFRTKLREFHKSAK  479

Query  510   SFTAIDRNYLTPFFTTQNGDEDE---------QEELISNSRRARY  403
             SF+ +DRNYLTPFFT+ NGD DE          EE I  +RR  +
Sbjct  480   SFSELDRNYLTPFFTSNNGDYDEDDDINNDQHHEERIPFTRRGNF  524



>ref|XP_006660500.1| PREDICTED: sodium/hydrogen exchanger 6-like [Oryza brachyantha]
Length=533

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/512 (80%), Positives = 458/512 (89%), Gaps = 7/512 (1%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+ AGVGILLQI MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TET
Sbjct  27    GKEQQVAGVGILLQISMLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTET  86

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             N R WFNFH+EFFFLFLLPPIIFQSGFSLSPKPFF+NFGAIVTFAI GTFIAS+VTGVLV
Sbjct  87    NTRMWFNFHDEFFFLFLLPPIIFQSGFSLSPKPFFANFGAIVTFAILGTFIASVVTGVLV  146

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+ G+  LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  147   YLCGLAFLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  206

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMS VRS  ++G+NFFM+  +F+ETF GSMS+GVGVGFIS LLFKYAGLDIDNLQ
Sbjct  207   ISLYRTMSSVRSQAAAGENFFMMVFQFLETFVGSMSSGVGVGFISLLLFKYAGLDIDNLQ  266

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGLSG VSILFTG+VMK YTYSNLS++SQRFVS+FFHL+S
Sbjct  267   NLECCLFVLFPYFSYMLAEGLGLSGNVSILFTGMVMKHYTYSNLSNNSQRFVSAFFHLLS  326

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAME+HSW+H+GFIFFSI+FI +ARA NVF CAYLVN+ RP NR+I
Sbjct  327   SLAETFVFIYMGFDIAMEEHSWSHLGFIFFSIIFIILARAVNVFSCAYLVNMSRPENRRI  386

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALW+SGLRGAMAFALALQS ++LP GHG+TIFT TTAIVVLTVL+IGGSTGTML
Sbjct  387   PLKHQKALWFSGLRGAMAFALALQSANELPGGHGKTIFTTTTAIVVLTVLLIGGSTGTML  446

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EALDV+GD+        T  E  + +NGYI P+Y+E +SSG   +MKLKEFHKST+SFTA
Sbjct  447   EALDVIGDE-------NTSIENYDDNNGYIPPTYEEGTSSGGGLRMKLKEFHKSTTSFTA  499

Query  498   IDRNYLTPFFTTQNGDEDEQEELISNSRRARY  403
             +D+NYLTPFFT+Q  D+D+  E   N RR  Y
Sbjct  500   LDKNYLTPFFTSQTDDDDDFGEQPQNQRRGFY  531



>gb|KHN14386.1| Sodium/hydrogen exchanger 6 [Glycine soja]
Length=520

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/509 (82%), Positives = 456/509 (90%), Gaps = 17/509 (3%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRR + Y +PEASASLLIGLIVG LANISDTET
Sbjct  17    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRKKVYIIPEASASLLIGLIVGILANISDTET  76

Query  1758  NIRAWFNFHEEffflfllppii-FQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVL  1582
             NIRAWFNFHEEFFFLFLLPPII  QSGFSL+PKPFFSNFGAIVTFAIFGTFIAS+VTG+L
Sbjct  77    NIRAWFNFHEEFFFLFLLPPIIFTQSGFSLAPKPFFSNFGAIVTFAIFGTFIASIVTGIL  136

Query  1581  VYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAM  1402
             VY+GG++ LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAM
Sbjct  137   VYLGGLLFLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAM  196

Query  1401  AISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNL  1222
             AISLYRTMS VR++  SGQN FM+ VRF+ETF GSMSAG               LDIDNL
Sbjct  197   AISLYRTMSSVRAD-PSGQNLFMVVVRFLETFVGSMSAG---------------LDIDNL  240

Query  1221  QNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLI  1042
             QNLE CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YTYSNLS SSQRF S+FF LI
Sbjct  241   QNLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTYSNLSQSSQRFASAFFELI  300

Query  1041  SSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRK  862
             SSLAETFVFIYMGFDIAMEQHSW+HVGFIFFSI+FIGIARAANVF CAYLVNLVRP +RK
Sbjct  301   SSLAETFVFIYMGFDIAMEQHSWSHVGFIFFSIIFIGIARAANVFSCAYLVNLVRPTHRK  360

Query  861   IPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTM  682
             IP KHQKALWYSGLRGAMAFALALQS+HDLPEGHGQTIFTATTAIVVLTVL+IGGSTG+M
Sbjct  361   IPSKHQKALWYSGLRGAMAFALALQSIHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGSM  420

Query  681   LEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFT  502
             LEALDVVG D DS L +       +G+NGYIAP Y+EESSSG++ KMKLKEFHK+ +SFT
Sbjct  421   LEALDVVGGDNDSPLASVGTITNFDGNNGYIAPHYNEESSSGNKIKMKLKEFHKTAASFT  480

Query  501   AIDRNYLTPFFTTQNGDEDEQEELISNSR  415
             A+D+NYLTPFFT+QNGDED++ E  +++R
Sbjct  481   ALDKNYLTPFFTSQNGDEDDEAEPFTSTR  509



>dbj|BAJ96264.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/493 (82%), Positives = 449/493 (91%), Gaps = 7/493 (1%)
 Frame = -1

Query  1935  KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             K+Q+ AGVGILLQI MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TETN
Sbjct  28    KEQQVAGVGILLQISMLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTETN  87

Query  1755  IRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVY  1576
              R WFNFHEEFFFLFLLPPIIFQSGFSLSPKPFF+NFGAIVTFAI GTFIAS+VTG+LVY
Sbjct  88    TRTWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFANFGAIVTFAILGTFIASIVTGMLVY  147

Query  1575  IGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAI  1396
             +GG+  LMYKLP +ECLMFG+LISATDPVTVLSIFQELG+DVNLYALVFGESVLNDAMAI
Sbjct  148   LGGLTFLMYKLPLVECLMFGALISATDPVTVLSIFQELGSDVNLYALVFGESVLNDAMAI  207

Query  1395  SLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQN  1216
             SLYRTMS VRSN + G+N FM+ ++F+E F GSMS+GVGVGFIS+LLFKYAGLDIDNLQN
Sbjct  208   SLYRTMSSVRSNAAGGENIFMMILQFLEIFVGSMSSGVGVGFISSLLFKYAGLDIDNLQN  267

Query  1215  LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISS  1036
             LECCLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YTYSNLSD+SQRFVS+FFHL+SS
Sbjct  268   LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTYSNLSDNSQRFVSAFFHLLSS  327

Query  1035  LAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIP  856
             LAETFVFIYMGFDIAME+HSW+HVGFI FSI+FI +ARAANVF CAYLVN+ RP +R+IP
Sbjct  328   LAETFVFIYMGFDIAMEEHSWSHVGFIIFSIIFIIVARAANVFSCAYLVNISRPEHRRIP  387

Query  855   PKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLE  676
               HQKAL +SGLRGAMAFALALQSVH+LPEGHG+TI TATTAIVVLTVL+IGGSTGTMLE
Sbjct  388   LNHQKALCFSGLRGAMAFALALQSVHELPEGHGKTILTATTAIVVLTVLLIGGSTGTMLE  447

Query  675   ALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAI  496
             ALDV+GD+        T  E  E +NGYI P+Y+E +SSG   +MKLKEFHKST+SFTA+
Sbjct  448   ALDVIGDE-------NTSIETYEDNNGYIPPTYEEGTSSGGGLRMKLKEFHKSTTSFTAL  500

Query  495   DRNYLTPFFTTQN  457
             D+NYLTPFFT+Q 
Sbjct  501   DKNYLTPFFTSQT  513



>ref|NP_175839.2| sodium hydrogen exchanger 5 [Arabidopsis thaliana]
 sp|Q8S396.2|NHX5_ARATH RecName: Full=Sodium/hydrogen exchanger 5; AltName: Full=Na(+)/H(+) 
exchanger 5; Short=NHE-5 [Arabidopsis thaliana]
 dbj|BAE98578.1| Na+/H+ exchanger 5 [Arabidopsis thaliana]
 gb|AEE33089.1| sodium hydrogen exchanger 5 [Arabidopsis thaliana]
Length=521

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/525 (79%), Positives = 456/525 (87%), Gaps = 17/525 (3%)
 Frame = -1

Query  1968  MEELL------PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLL  1807
             MEE++       P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRHRF+YLPEAS SLL
Sbjct  1     MEEVMISPVEHDPQGQVKQQQAAGVGILLQIMMLVLSFVLGHVLRRHRFHYLPEASGSLL  60

Query  1806  IGLIVGGLANISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTF  1627
             IGLIVG LANISDTET+IR WFNFHEEFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTF
Sbjct  61    IGLIVGILANISDTETSIRTWFNFHEEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTF  120

Query  1626  AIFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVN  1447
             AI GTF+AS+VTG LVY+GG + LMYKLPF+ECLMFG+LISATDPVTVLSIFQ++GTDVN
Sbjct  121   AIIGTFVASVVTGGLVYLGGSMYLMYKLPFVECLMFGALISATDPVTVLSIFQDVGTDVN  180

Query  1446  LYALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFI  1267
             LYALVFGESVLNDAMAISLYRTMSLV   +SSG++FFM+ +RF ETF GSMSAGVGVGF 
Sbjct  181   LYALVFGESVLNDAMAISLYRTMSLVNRQSSSGEHFFMVVIRFFETFAGSMSAGVGVGFT  240

Query  1266  SALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNL  1087
             SALLFKYAGLD +NLQNLECCLFVLFPYFSYMLAEG+GLSGIVSILFTGIVMKRYT+SNL
Sbjct  241   SALLFKYAGLDTENLQNLECCLFVLFPYFSYMLAEGVGLSGIVSILFTGIVMKRYTFSNL  300

Query  1086  SDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVF  907
             S++SQ FVSSFFHLISSLAETF FIYMGFDIAMEQHSW+HVGFI FSILFIG+ARA NVF
Sbjct  301   SEASQSFVSSFFHLISSLAETFTFIYMGFDIAMEQHSWSHVGFILFSILFIGVARAVNVF  360

Query  906   GCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattai  727
             GCAYLVNL R  N+KIP KHQKALWYSGLRGAMAFALALQS+HDLPEGHGQ IFTATT I
Sbjct  361   GCAYLVNLFRQENQKIPMKHQKALWYSGLRGAMAFALALQSLHDLPEGHGQIIFTATTTI  420

Query  726   vvltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAP------SYDEE-  568
             VV+TVL+IGGSTG MLEAL+VVGDD D            E  + Y+ P      S DE+ 
Sbjct  421   VVVTVLLIGGSTGKMLEALEVVGDDLD----DSMSEGFEESDHQYVPPPFSIGASSDEDT  476

Query  567   SSSGSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQEE  433
             SSSGSRFKMKLKEFHK+T+SFTA+D+N+LTPFFTT +GD D   E
Sbjct  477   SSSGSRFKMKLKEFHKTTTSFTALDKNFLTPFFTTNSGDGDGDGE  521



>ref|XP_010501256.1| PREDICTED: sodium/hydrogen exchanger 5-like [Camelina sativa]
Length=521

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/513 (81%), Positives = 452/513 (88%), Gaps = 11/513 (2%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRHRF+YLPEAS SLLIGLIVG LANIS
Sbjct  13    PQGQVKQQQAAGVGILLQIMMLVLSFVLGHVLRRHRFHYLPEASGSLLIGLIVGVLANIS  72

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             DTET+IR WFNFHEEFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTFAI GTF+AS+VT
Sbjct  73    DTETSIRTWFNFHEEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFAIIGTFVASVVT  132

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G LVY+GG + LMYKLPF+ECLMFG+LISATDPVTVLSIFQ++GTDVNLYALVFGESVLN
Sbjct  133   GGLVYLGGSMYLMYKLPFVECLMFGALISATDPVTVLSIFQDVGTDVNLYALVFGESVLN  192

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLV   +SSG++F M+ +RF+ETF GSMSAGVGVGF SALLFKYAGLD 
Sbjct  193   DAMAISLYRTMSLVNRQSSSGEHFLMVVIRFLETFAGSMSAGVGVGFTSALLFKYAGLDT  252

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             +NLQNLECCLFVLFPYFSYMLAEG+GLSGIVSILFTGIVMKRYT+SNLS++SQ FVSSFF
Sbjct  253   ENLQNLECCLFVLFPYFSYMLAEGVGLSGIVSILFTGIVMKRYTFSNLSEASQSFVSSFF  312

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETF FIYMGFDIAMEQHSW+HVGFI FSILFIG+ARA NVFGCAYLVNL R  
Sbjct  313   HLISSLAETFTFIYMGFDIAMEQHSWSHVGFILFSILFIGVARAVNVFGCAYLVNLFRQD  372

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             N+KIP KHQKALWYSGLRGAMAFALALQS+HDLPEGHGQ IFTATTAIVV+TVL+IGGST
Sbjct  373   NQKIPMKHQKALWYSGLRGAMAFALALQSLHDLPEGHGQIIFTATTAIVVVTVLLIGGST  432

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAP------SYDEE-SSSGSRFKMKLK  532
             G MLEAL+VVGDD D            E  + Y+ P      S DE+ SSSGSRFKMKLK
Sbjct  433   GKMLEALEVVGDDLD----DSMSEGFEEIDHRYVPPPFSIGASSDEDTSSSGSRFKMKLK  488

Query  531   EFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQEE  433
             EFHK+T+SFTA+D+N+LTPFFTT +GD D   E
Sbjct  489   EFHKTTTSFTALDKNFLTPFFTTNSGDGDGDGE  521



>gb|AAM08406.1|AF490589_1 Na+/H+ exchanger 5 [Arabidopsis thaliana]
Length=517

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/513 (81%), Positives = 451/513 (88%), Gaps = 11/513 (2%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRHRF+YLPEAS SLLIGLIVG LANIS
Sbjct  9     PQGQVKQQQAAGVGILLQIMMLVLSFVLGHVLRRHRFHYLPEASGSLLIGLIVGILANIS  68

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             DTET+IR WFNFHEEFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTFAI GTF+AS+VT
Sbjct  69    DTETSIRTWFNFHEEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFAIIGTFVASVVT  128

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G LVY+GG + LMYKLPF+ECLMFG+LISATDPVTVLSIFQ++GTDVNLYALVFGESVLN
Sbjct  129   GGLVYLGGSMYLMYKLPFVECLMFGALISATDPVTVLSIFQDVGTDVNLYALVFGESVLN  188

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLV   +SSG++FFM+ +RF ETF GSMSAGVGVGF SALLFKYAGLD 
Sbjct  189   DAMAISLYRTMSLVNRQSSSGEHFFMVVIRFFETFAGSMSAGVGVGFTSALLFKYAGLDT  248

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             +NLQNLECCLFVLFPYFSYMLAEG+GLSGIVSILFTGIVMKRYT+SNLS++SQ FVSSFF
Sbjct  249   ENLQNLECCLFVLFPYFSYMLAEGVGLSGIVSILFTGIVMKRYTFSNLSEASQSFVSSFF  308

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETF FIYMGFDIAMEQHSW+HVGFI FSILFIG+ARA NVFGCAYLVNL R  
Sbjct  309   HLISSLAETFTFIYMGFDIAMEQHSWSHVGFILFSILFIGVARAVNVFGCAYLVNLFRQE  368

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             N+KIP KHQKALWYSGLRGAMAFALALQS+HDLPEGHGQ IFTATT IVV+TVL+IGGST
Sbjct  369   NQKIPMKHQKALWYSGLRGAMAFALALQSLHDLPEGHGQIIFTATTTIVVVTVLLIGGST  428

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAP------SYDEE-SSSGSRFKMKLK  532
             G MLEAL+VVGDD D            E  + Y+ P      S DE+ SSSGSRFKMKLK
Sbjct  429   GKMLEALEVVGDDLD----DSMSEGFEESDHQYVPPPFSIGASSDEDTSSSGSRFKMKLK  484

Query  531   EFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQEE  433
             EFHK+T+SFTA+D+N+LTPFFTT +GD D   E
Sbjct  485   EFHKTTTSFTALDKNFLTPFFTTNSGDGDGDGE  517



>ref|XP_009106685.1| PREDICTED: sodium/hydrogen exchanger 6 [Brassica rapa]
Length=541

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/526 (79%), Positives = 459/526 (87%), Gaps = 14/526 (3%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLAN+S
Sbjct  15    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANVS  74

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TET+IR WFNFH+EFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTF++ GTF+AS+VT
Sbjct  75    NTETSIRTWFNFHDEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFSVLGTFVASIVT  134

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             GVLVY+GGV+ LMY+LPF+ECLMFGSLISATDPVTVLSIFQELG+DVNLYALVFGESVLN
Sbjct  135   GVLVYLGGVMFLMYRLPFVECLMFGSLISATDPVTVLSIFQELGSDVNLYALVFGESVLN  194

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLVRS+ S+GQNFFM+ VRF+ETF GSMSAGVGVGF SALLFKYAGLD+
Sbjct  195   DAMAISLYRTMSLVRSH-STGQNFFMVIVRFLETFVGSMSAGVGVGFTSALLFKYAGLDV  253

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS +SQRFVS+FF
Sbjct  254   DNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSTNSQRFVSAFF  313

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETFVFIYMGFDIAME+HSW+HVGFIFFSILFI IARAANVFGC YLVNL RPA
Sbjct  314   HLISSLAETFVFIYMGFDIAMEKHSWSHVGFIFFSILFIVIARAANVFGCGYLVNLARPA  373

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             +RKIP  HQKALWYSGLRGAMAFALALQSVH+LP+GHGQTIFTATTAIVV+TVL+IGGST
Sbjct  374   HRKIPMTHQKALWYSGLRGAMAFALALQSVHELPDGHGQTIFTATTAIVVVTVLLIGGST  433

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTS  511
             GTMLEAL+VVGD  D    T         +N Y+    DE S S S F+ KL+EFHKS  
Sbjct  434   GTMLEALEVVGDSRD----TSLGDGFEVVNNRYMTRFDDEGSPSESGFRTKLREFHKSAK  489

Query  510   SFTAIDRNYLTPFFTTQNG---------DEDEQEELISNSRRARYS  400
             SF+ +DRNYLTPFFT+ NG         D+   EE I  +RR  ++
Sbjct  490   SFSELDRNYLTPFFTSNNGDYDEDDDINDDQHHEERIPFTRRGNFN  535



>emb|CAO01506.1| Na+/H+ antiporter [Mesembryanthemum crystallinum]
Length=526

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/527 (77%), Positives = 463/527 (88%), Gaps = 10/527 (2%)
 Frame = -1

Query  1968  MEELLPPP-----RTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLI  1804
             ME+ L  P        K+Q+AAGVGILLQIMMLVLSFILGHVLRRH+F+Y+PE SASLLI
Sbjct  1     MEDQLISPADSRGSPAKEQQAAGVGILLQIMMLVLSFILGHVLRRHKFFYIPEVSASLLI  60

Query  1803  GLIVGGLANISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFA  1624
             GL+VGGLANIS+TET+IR WFNFHEEFFFLFLLPPIIFQSGF LSPKPFFSNFGAIVTF+
Sbjct  61    GLVVGGLANISNTETSIRGWFNFHEEFFFLFLLPPIIFQSGFILSPKPFFSNFGAIVTFS  120

Query  1623  IFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNL  1444
             I GTFIAS++TG+LVY+GG+  LMYKLP +EC+MFG+LIS+TDPVTVL+IFQELGTDVNL
Sbjct  121   ILGTFIASVLTGLLVYLGGITFLMYKLPLIECMMFGALISSTDPVTVLAIFQELGTDVNL  180

Query  1443  YALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFIS  1264
             YALVFGESVLNDA+AISLYRTMSL+ S+ S+GQN F + V F+ETF GS+S+GVGVGFI 
Sbjct  181   YALVFGESVLNDAVAISLYRTMSLLNSHMSTGQNIFTLVVGFLETFVGSLSSGVGVGFIP  240

Query  1263  ALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLS  1084
             ALLFKYAGLDIDNLQNLE CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YT+SNLS
Sbjct  241   ALLFKYAGLDIDNLQNLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTFSNLS  300

Query  1083  DSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFG  904
             + SQ+FVS FFHLISSLAETF+FIYMG DI ME+HSW+HVGFIFFSI+FI I+RA NVF 
Sbjct  301   EKSQQFVSEFFHLISSLAETFIFIYMGLDIVMEKHSWSHVGFIFFSIIFIVISRAVNVFS  360

Query  903   CAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaiv  724
             C YL+NL RPA+RKIP KHQKA WYSGLRGAMAFALALQSVHDLPEGH QTIFTATTAIV
Sbjct  361   CGYLINLARPAHRKIPMKHQKAPWYSGLRGAMAFALALQSVHDLPEGHSQTIFTATTAIV  420

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             VLTVL+IGGSTGTMLEAL V+GD  +     G +G+    S+GY++PS DEE SS +RFK
Sbjct  421   VLTVLLIGGSTGTMLEALQVIGDSNE-----GHIGDGFNRSDGYVSPSQDEEESSSNRFK  475

Query  543   MKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQEELISNSRRARY  403
             M+LKEFH+S  SF+++D+NYLTPFFTTQ+GDE+E E L+ + RR  Y
Sbjct  476   MRLKEFHRSAPSFSSLDKNYLTPFFTTQSGDEEEHETLMPSPRREVY  522



>gb|AFV60029.1| Na+/K+-H+ antiporter NHX6, partial [Brassica napus]
Length=525

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/525 (79%), Positives = 458/525 (87%), Gaps = 14/525 (3%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLAN+S
Sbjct  6     PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANVS  65

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TET+IR WFNFH+EFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTF++ GTF+AS+VT
Sbjct  66    NTETSIRTWFNFHDEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFSVLGTFVASIVT  125

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             GVLVY+GGV+ LMY+LPF+ECLMFGSLISATDPVTVLSIFQELG+DVNLYALVFGESVLN
Sbjct  126   GVLVYLGGVMFLMYRLPFVECLMFGSLISATDPVTVLSIFQELGSDVNLYALVFGESVLN  185

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLVRS+ S+GQNFFM+ VRF+ETF GSMSAGVGVGF SALLFKYAGLD+
Sbjct  186   DAMAISLYRTMSLVRSH-STGQNFFMVIVRFLETFVGSMSAGVGVGFTSALLFKYAGLDV  244

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS +SQRFVS+FF
Sbjct  245   DNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSTNSQRFVSAFF  304

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETFVFIYMGFDIAME+HSW+HVGFIFFSILFI IARAANVFGC YLVNL RPA
Sbjct  305   HLISSLAETFVFIYMGFDIAMEKHSWSHVGFIFFSILFIVIARAANVFGCGYLVNLARPA  364

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             ++KIP  HQKALWYSGLRGAMAFALALQSVH+LP+GHGQTIFTATTAIVV+TVL+IGGST
Sbjct  365   HKKIPMTHQKALWYSGLRGAMAFALALQSVHELPDGHGQTIFTATTAIVVVTVLLIGGST  424

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTS  511
             GTMLEAL+VVGD  D    T         +N Y+    DE S S S F+ KL+EFHKS  
Sbjct  425   GTMLEALEVVGDSRD----TSLGDGFEVVNNRYMTRFDDEGSPSESGFRTKLREFHKSAK  480

Query  510   SFTAIDRNYLTPFFTTQNG---------DEDEQEELISNSRRARY  403
             SF+ +DRNYLTPFFT+ NG         D+   EE I  +RR  +
Sbjct  481   SFSELDRNYLTPFFTSNNGDYDEDDDINDDQHHEERIPFTRRGNF  525



>ref|XP_010539550.1| PREDICTED: sodium/hydrogen exchanger 6 isoform X1 [Tarenaya hassleriana]
Length=546

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/497 (82%), Positives = 451/497 (91%), Gaps = 6/497 (1%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS
Sbjct  16    PQGQVKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANIS  75

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TET+IRAWFNFHEEFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTFAI GTF+AS+VT
Sbjct  76    NTETSIRAWFNFHEEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFAILGTFVASIVT  135

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G+LVY+GG + L+YKLP +ECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN
Sbjct  136   GLLVYLGGAMYLIYKLPLVECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  195

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLVRS+ S  QNF ++ VRF+ETF GS+SAGVGVGF SALLFKYA LDI
Sbjct  196   DAMAISLYRTMSLVRSH-SYEQNFLIVIVRFLETFIGSLSAGVGVGFTSALLFKYAALDI  254

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLECCLFVLFPYFSYMLAEG+GLSGIVSILFTGIVMK YTYSNLS++SQRFVS+FF
Sbjct  255   DNLQNLECCLFVLFPYFSYMLAEGVGLSGIVSILFTGIVMKHYTYSNLSENSQRFVSAFF  314

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETF FIYMGFDIA+E+HSW+H+GFIFFSILFIG+ARAANVFGCAYLVNLVRP+
Sbjct  315   HLISSLAETFTFIYMGFDIAIERHSWSHLGFIFFSILFIGVARAANVFGCAYLVNLVRPS  374

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             +RKIP KHQKALWYSGLRGAMAFALALQS+HDLPEGHGQTIF+ATT IVVLTVL+IGGST
Sbjct  375   HRKIPIKHQKALWYSGLRGAMAFALALQSIHDLPEGHGQTIFSATTTIVVLTVLLIGGST  434

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEE-SSSGSRFKMKLKEFHKST  514
             GTMLEAL+VVGD++D              +N Y    YD+E SSSG+ F+ KL+EFHKS 
Sbjct  435   GTMLEALEVVGDNHD----AALGEGFEVMNNRYTLTRYDDEVSSSGNGFRTKLREFHKSA  490

Query  513   SSFTAIDRNYLTPFFTT  463
             +SFT +DRNYLTPFFT+
Sbjct  491   ASFTELDRNYLTPFFTS  507



>ref|XP_010539551.1| PREDICTED: sodium/hydrogen exchanger 6 isoform X2 [Tarenaya hassleriana]
Length=541

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/497 (82%), Positives = 451/497 (91%), Gaps = 6/497 (1%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS
Sbjct  16    PQGQVKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANIS  75

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TET+IRAWFNFHEEFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTFAI GTF+AS+VT
Sbjct  76    NTETSIRAWFNFHEEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFAILGTFVASIVT  135

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G+LVY+GG + L+YKLP +ECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN
Sbjct  136   GLLVYLGGAMYLIYKLPLVECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  195

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLVRS+ S  QNF ++ VRF+ETF GS+SAGVGVGF SALLFKYA LDI
Sbjct  196   DAMAISLYRTMSLVRSH-SYEQNFLIVIVRFLETFIGSLSAGVGVGFTSALLFKYAALDI  254

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLECCLFVLFPYFSYMLAEG+GLSGIVSILFTGIVMK YTYSNLS++SQRFVS+FF
Sbjct  255   DNLQNLECCLFVLFPYFSYMLAEGVGLSGIVSILFTGIVMKHYTYSNLSENSQRFVSAFF  314

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETF FIYMGFDIA+E+HSW+H+GFIFFSILFIG+ARAANVFGCAYLVNLVRP+
Sbjct  315   HLISSLAETFTFIYMGFDIAIERHSWSHLGFIFFSILFIGVARAANVFGCAYLVNLVRPS  374

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             +RKIP KHQKALWYSGLRGAMAFALALQS+HDLPEGHGQTIF+ATT IVVLTVL+IGGST
Sbjct  375   HRKIPIKHQKALWYSGLRGAMAFALALQSIHDLPEGHGQTIFSATTTIVVLTVLLIGGST  434

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEE-SSSGSRFKMKLKEFHKST  514
             GTMLEAL+VVGD++D              +N Y    YD+E SSSG+ F+ KL+EFHKS 
Sbjct  435   GTMLEALEVVGDNHD----AALGEGFEVMNNRYTLTRYDDEVSSSGNGFRTKLREFHKSA  490

Query  513   SSFTAIDRNYLTPFFTT  463
             +SFT +DRNYLTPFFT+
Sbjct  491   ASFTELDRNYLTPFFTS  507



>ref|XP_010480189.1| PREDICTED: sodium/hydrogen exchanger 5 [Camelina sativa]
Length=521

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/507 (81%), Positives = 450/507 (89%), Gaps = 11/507 (2%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRHRF+YLPEAS SLLIGLIVG LANIS
Sbjct  13    PQGQVKQQQAAGVGILLQIMMLVLSFVLGHVLRRHRFHYLPEASGSLLIGLIVGVLANIS  72

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             DTET+IR WFNFHEEFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTFAI GTF+AS+VT
Sbjct  73    DTETSIRTWFNFHEEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFAIIGTFVASVVT  132

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G LVY+GG + LMYKLPF+ECLMFG+LISATDPVTVLSIFQ++GTDVNLYALVFGESVLN
Sbjct  133   GGLVYLGGSMYLMYKLPFVECLMFGALISATDPVTVLSIFQDVGTDVNLYALVFGESVLN  192

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLV   +SSG++F M+ +RF+ETF GSMSAGVGVGF SALLFKYAGLD 
Sbjct  193   DAMAISLYRTMSLVNRQSSSGEHFLMVVIRFLETFAGSMSAGVGVGFTSALLFKYAGLDT  252

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             +NLQNLECCLFVLFPYFSYMLAEG+GLSGIVSILFTGIVMKRYT+SNLS++SQ FVSSFF
Sbjct  253   ENLQNLECCLFVLFPYFSYMLAEGVGLSGIVSILFTGIVMKRYTFSNLSEASQSFVSSFF  312

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETF FIYMGFDIAMEQHSW+HVGFI FSILFIG+ARA NVFGCAYLVNL R  
Sbjct  313   HLISSLAETFTFIYMGFDIAMEQHSWSHVGFILFSILFIGVARAVNVFGCAYLVNLFRQD  372

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             N+KIP KHQKALWYSGLRGAMAFALALQS+HDLPEGHGQ IFTATTAIVV+TVL+IGGST
Sbjct  373   NQKIPMKHQKALWYSGLRGAMAFALALQSLHDLPEGHGQIIFTATTAIVVVTVLLIGGST  432

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAP------SYDEE-SSSGSRFKMKLK  532
             G MLEAL+VVGDD D            E  + Y+ P      S DE+ SSSGSRFKMKLK
Sbjct  433   GKMLEALEVVGDDLD----DSMSEGFEESDHRYVPPPFSIGASSDEDTSSSGSRFKMKLK  488

Query  531   EFHKSTSSFTAIDRNYLTPFFTTQNGD  451
             EFHK+T+SFTA+D+N+LTPFFTT +GD
Sbjct  489   EFHKTTTSFTALDKNFLTPFFTTNSGD  515



>ref|XP_003577939.1| PREDICTED: sodium/hydrogen exchanger 6-like [Brachypodium distachyon]
Length=534

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/518 (78%), Positives = 455/518 (88%), Gaps = 20/518 (4%)
 Frame = -1

Query  1935  KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             K+Q+ AGVGILLQI MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TETN
Sbjct  28    KEQQVAGVGILLQISMLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTETN  87

Query  1755  IRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVY  1576
              R WFNFHEEFFFLFLLPPIIFQSGFSLSPKPFF+NFGAIVTFAI GTFIAS+VTG+LVY
Sbjct  88    TRTWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFANFGAIVTFAILGTFIASIVTGMLVY  147

Query  1575  IGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAI  1396
             +GG+  LMYKLP +ECLMFG+LISATDPVTVLSIFQELG+DVNLYALVFGESVLNDAMAI
Sbjct  148   LGGLTFLMYKLPLVECLMFGALISATDPVTVLSIFQELGSDVNLYALVFGESVLNDAMAI  207

Query  1395  SLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQN  1216
             SLYRTMS VRSN +  ++ FM+ ++F+E F GSMS+GVGVGFISALLFKYAGLDIDNLQN
Sbjct  208   SLYRTMSSVRSNAAGSESIFMMVLQFLEIFVGSMSSGVGVGFISALLFKYAGLDIDNLQN  267

Query  1215  LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISS  1036
             LECCLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YTYSNLSD+SQRFVS+FFHL+SS
Sbjct  268   LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTYSNLSDNSQRFVSAFFHLLSS  327

Query  1035  LAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIP  856
             LAETFVFIYMGFDIAME+HSW+HVGFI FSI+FI +ARAANVF CAYLVN+ RP +R+IP
Sbjct  328   LAETFVFIYMGFDIAMEEHSWSHVGFILFSIIFIIVARAANVFSCAYLVNISRPEHRRIP  387

Query  855   PKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLE  676
              KHQKAL +SGLRGAMAFALALQSVH+LPEGHG+ I T TTAIVVLTVL+IGGSTGTMLE
Sbjct  388   LKHQKALCFSGLRGAMAFALALQSVHELPEGHGKAILTTTTAIVVLTVLLIGGSTGTMLE  447

Query  675   ALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAI  496
             ALDVVGD+        T  E  E ++GYI P+Y+E +SSG   +MKLKEFHKST+SFTA+
Sbjct  448   ALDVVGDE-------NTSIENYEDNSGYIPPTYEEGTSSGGGLRMKLKEFHKSTTSFTAL  500

Query  495   DRNYLTPFFTTQN-------GDEDEQEELISNSRRARY  403
             D+NYLTPFFT+Q        GD+ +      N RR  Y
Sbjct  501   DKNYLTPFFTSQTDDDTDDFGDQPQ------NLRRGFY  532



>gb|ABC42029.2| Na+,K+/H+ exchanger [Hordeum vulgare]
Length=510

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/489 (82%), Positives = 446/489 (91%), Gaps = 7/489 (1%)
 Frame = -1

Query  1926  RAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETNIRA  1747
             + AGVGILLQI MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TETN R 
Sbjct  7     QVAGVGILLQISMLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTETNTRT  66

Query  1746  WFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYIGG  1567
             WFNFHEEFFFLFLLPPIIFQSGFSLSPKPFF+NFGAIVTFAI GTFIAS+VTG+LVY+GG
Sbjct  67    WFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFANFGAIVTFAILGTFIASIVTGMLVYLGG  126

Query  1566  VILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLY  1387
             +  LMYKLP +ECLMFG+LISATDPVTVLSIFQELG+DVNLYALVFGESVLNDAMAISLY
Sbjct  127   LTFLMYKLPLVECLMFGALISATDPVTVLSIFQELGSDVNLYALVFGESVLNDAMAISLY  186

Query  1386  RTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNLEC  1207
             RTMS VRSN + G+N FM+ ++F+E F GSMS+GVGVGFIS+LLFKYAGLDIDNLQNLEC
Sbjct  187   RTMSSVRSNAAGGENIFMMILQFLEIFVGSMSSGVGVGFISSLLFKYAGLDIDNLQNLEC  246

Query  1206  CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAE  1027
             CLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YTYSNLSD+SQRFVS+FFHL+SSLAE
Sbjct  247   CLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTYSNLSDNSQRFVSAFFHLLSSLAE  306

Query  1026  TFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKH  847
             TFVFIYMGFDIAME+HSW+HVGFI FSI+FI +ARAANVF CAYLVN+ RP +R+IP  H
Sbjct  307   TFVFIYMGFDIAMEEHSWSHVGFIIFSIIFIIVARAANVFSCAYLVNISRPEHRRIPLNH  366

Query  846   QKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALD  667
             QKAL +SGLRGAMAFALALQSVH+LPEGHG+TI TATTAIVVLTVL+IGGSTGTMLEALD
Sbjct  367   QKALCFSGLRGAMAFALALQSVHELPEGHGKTILTATTAIVVLTVLLIGGSTGTMLEALD  426

Query  666   VVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAIDRN  487
             V+GD+        T  E  E +NGYI P+Y+E +SSG   +MKLKEFHKST+SFTA+D+N
Sbjct  427   VIGDE-------NTSIETYEDNNGYIPPTYEEGTSSGGGLRMKLKEFHKSTTSFTALDKN  479

Query  486   YLTPFFTTQ  460
             YLTPFFT+Q
Sbjct  480   YLTPFFTSQ  488



>ref|XP_002894567.1| ATNHX5/NHX5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70826.1| ATNHX5/NHX5 [Arabidopsis lyrata subsp. lyrata]
Length=523

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/517 (80%), Positives = 452/517 (87%), Gaps = 17/517 (3%)
 Frame = -1

Query  1968  MEELL------PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLL  1807
             MEEL+       P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRHRF+YLPEAS SLL
Sbjct  1     MEELVISPVDHDPQGQVKQQQAAGVGILLQIMMLVLSFVLGHVLRRHRFHYLPEASGSLL  60

Query  1806  IGLIVGGLANISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTF  1627
             IGLIVG LANISDTET+IR WFNFHEEFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTF
Sbjct  61    IGLIVGVLANISDTETSIRTWFNFHEEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTF  120

Query  1626  AIFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVN  1447
             AI GTF+AS+VTG LVY+GG + LMYKLPF+ECLMFG+LISATDPVTVLSIFQ++GTDVN
Sbjct  121   AIIGTFVASVVTGGLVYLGGSMYLMYKLPFVECLMFGALISATDPVTVLSIFQDVGTDVN  180

Query  1446  LYALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFI  1267
             LYALVFGESVLNDAMAISLYRTMSLV   +SSG++F M+ +RF+ETF GSMSAGVGVGF 
Sbjct  181   LYALVFGESVLNDAMAISLYRTMSLVNRQSSSGEHFLMVVIRFLETFAGSMSAGVGVGFT  240

Query  1266  SALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNL  1087
             SALLFKYAGLD +NLQNLECCLFVLFPYFSYMLAEG+GLSGIVSILFTGIVMKRYT+SNL
Sbjct  241   SALLFKYAGLDTENLQNLECCLFVLFPYFSYMLAEGVGLSGIVSILFTGIVMKRYTFSNL  300

Query  1086  SDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVF  907
             S++SQ FVSSFFHLISSLAETF FIYMGFDIAMEQHSW+HVGFI FSILFIG+ARA NVF
Sbjct  301   SEASQSFVSSFFHLISSLAETFTFIYMGFDIAMEQHSWSHVGFILFSILFIGVARAVNVF  360

Query  906   GCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattai  727
             GCAYLVNL R  N+KIP KHQKALWYSGLRGAMAFALALQS+HDLPEGHGQ IFTATT I
Sbjct  361   GCAYLVNLFRQENQKIPMKHQKALWYSGLRGAMAFALALQSLHDLPEGHGQIIFTATTTI  420

Query  726   vvltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAP------SYDEE-  568
             VV+TVL+IGGSTG MLEAL+VVGDD D            E  + Y+ P      S DE+ 
Sbjct  421   VVVTVLLIGGSTGKMLEALEVVGDDLD----DSMSEGFEESDHRYVPPPFSIGASSDEDT  476

Query  567   SSSGSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQN  457
             SSSGSRFKMKLKEFHK+T+SFTA+D+N+LTPFFTT +
Sbjct  477   SSSGSRFKMKLKEFHKTTTSFTALDKNFLTPFFTTNS  513



>ref|XP_010688709.1| PREDICTED: sodium/hydrogen exchanger 6-like [Beta vulgaris subsp. 
vulgaris]
Length=527

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/512 (77%), Positives = 456/512 (89%), Gaps = 7/512 (1%)
 Frame = -1

Query  1935  KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             K+Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGL+VGGLANIS+TET+
Sbjct  20    KEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLVVGGLANISNTETS  79

Query  1755  IRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVY  1576
             IR WFNFHEEFFFLFLLPPIIFQSGF L+PKPFFSNFGAIVTF++ GTFI+S++TG+LVY
Sbjct  80    IREWFNFHEEFFFLFLLPPIIFQSGFILAPKPFFSNFGAIVTFSVVGTFISSILTGLLVY  139

Query  1575  IGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAI  1396
             +GGV  L+YKLPF+EC+MFG+LIS+TDP+TVL+IFQELGTDVNLYALVFGESVLNDA+AI
Sbjct  140   LGGVTYLIYKLPFVECMMFGALISSTDPITVLAIFQELGTDVNLYALVFGESVLNDAVAI  199

Query  1395  SLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQN  1216
             SLYR+MSL+R  +SS QN F   + F+ETF GS+S+GVGVGFISALLFKYAGLDI+NLQN
Sbjct  200   SLYRSMSLLRGQSSS-QNIFKFILGFLETFVGSLSSGVGVGFISALLFKYAGLDIENLQN  258

Query  1215  LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISS  1036
             LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YTYSNLS+ SQ+FVS FFHLISS
Sbjct  259   LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTYSNLSEKSQQFVSEFFHLISS  318

Query  1035  LAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIP  856
             LAETF+FIYMG DI ME+HSW+H+GFIFFSI+ I IAR  NVF C YLVNL RPANRKIP
Sbjct  319   LAETFIFIYMGLDIVMERHSWSHIGFIFFSIVIIVIARGVNVFSCGYLVNLARPANRKIP  378

Query  855   PKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLE  676
               HQKALWY+GLRGAMAFALALQSVHDLP+G+GQTIFTATTAIVVLTVL+IGGSTGTMLE
Sbjct  379   MTHQKALWYNGLRGAMAFALALQSVHDLPDGNGQTIFTATTAIVVLTVLLIGGSTGTMLE  438

Query  675   ALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAI  496
             +L V+GD  +         +    ++GY++P  +EE SS +RFK++LKEFH+S  SF+A+
Sbjct  439   SLQVIGDTPE------GHLDGFNRNDGYVSPGQEEEGSSSNRFKLRLKEFHRSAPSFSAL  492

Query  495   DRNYLTPFFTTQNGDEDEQEELISNSRRARYS  400
             D+NYLTPFFTTQ+GDEDEQE L+   RR  YS
Sbjct  493   DKNYLTPFFTTQSGDEDEQENLMPTPRREVYS  524



>gb|AES64654.2| Na+/H+ exchanger 1 [Medicago truncatula]
Length=530

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/528 (80%), Positives = 463/528 (88%), Gaps = 26/528 (5%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             PP  GK+Q+AAGVGILLQIMMLVLSF+LGHVLRR + Y +PEASASLLIGLIVG LANIS
Sbjct  16    PP--GKEQQAAGVGILLQIMMLVLSFVLGHVLRRKKIYIIPEASASLLIGLIVGILANIS  73

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             DTETNIRAWFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAIVTFAIFGTF+AS VT
Sbjct  74    DTETNIRAWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIVTFAIFGTFLASFVT  133

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G LVY+GG++ LMY+LPF+EC+MFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLN
Sbjct  134   GALVYLGGLVFLMYRLPFVECMMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLN  193

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMS+V++N  SGQNFFM+ VRF+ETF GS+S               AGLDI
Sbjct  194   DAMAISLYRTMSVVKNN-PSGQNFFMVVVRFLETFVGSLS---------------AGLDI  237

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLE CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK Y YSNLS SSQRFVS+FF
Sbjct  238   DNLQNLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYAYSNLSQSSQRFVSAFF  297

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
              LISSLAETF+FIYMGFDIAMEQHSW+HVGFIFFS++FI IARAANVF CAYLVNLVRPA
Sbjct  298   ELISSLAETFIFIYMGFDIAMEQHSWSHVGFIFFSVIFIVIARAANVFSCAYLVNLVRPA  357

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             +RKIPPK+QKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGST
Sbjct  358   HRKIPPKYQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGST  417

Query  690   GTMLEALDVVGDDY--DsslgtgtlgerlegSNGYIAP-SYDEESSSGSRFKMKLKEFHK  520
             GTMLEALDV+G D   DSSL +        G+NGYIAP   +E SSSG++ KMKLKEFHK
Sbjct  418   GTMLEALDVIGGDTHSDSSLASVGPITDYGGNNGYIAPSYEEESSSSGNKIKMKLKEFHK  477

Query  519   STSSFTAIDRNYLTPFFTTQNGDEDEQEELISNSR-----RARYSGHS  391
             ST+SFTA+DRNYLTPFFT+ NGDEDE+ E  +++R     R+ + G S
Sbjct  478   STASFTALDRNYLTPFFTSHNGDEDEEAEPFTSARSFTSSRSGFHGQS  525



>gb|EEC84267.1| hypothetical protein OsI_30726 [Oryza sativa Indica Group]
Length=515

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/513 (76%), Positives = 441/513 (86%), Gaps = 28/513 (5%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+ AGVGILLQI MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TET
Sbjct  28    GKEQQVAGVGILLQISMLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTET  87

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             N                      QSGFSLSPKPFF+NFGAIVTFAI GTF+AS+VTGVLV
Sbjct  88    NTS--------------------QSGFSLSPKPFFANFGAIVTFAILGTFVASVVTGVLV  127

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+  LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  128   YLGGLTFLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  187

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRS  ++G+NFFM+  +F+ETF GS+S+GVGVGFISALLFKYAGLDIDNLQ
Sbjct  188   ISLYRTMSLVRSQAAAGENFFMMVFQFLETFVGSLSSGVGVGFISALLFKYAGLDIDNLQ  247

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YT+SNLS++SQRFVS+FFHL+S
Sbjct  248   NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTFSNLSNNSQRFVSAFFHLLS  307

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAME+HSW+HVGFIFFSI+FI IARA NVF CAYLVN+ RP +R+I
Sbjct  308   SLAETFVFIYMGFDIAMEEHSWSHVGFIFFSIIFIIIARAVNVFSCAYLVNMSRPEHRRI  367

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALW+SGLRGAMAFALALQS ++LP GHG+TIFT TTAIVVLTVL+IGGSTGTML
Sbjct  368   PLKHQKALWFSGLRGAMAFALALQSANELPGGHGKTIFTTTTAIVVLTVLLIGGSTGTML  427

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EALDV+GD+           E  + +NGYI P+Y+E SSSG   +MKLKEFHKST+SFTA
Sbjct  428   EALDVIGDE-------NRSIENYDDNNGYIPPTYEEGSSSGGGLRMKLKEFHKSTTSFTA  480

Query  498   IDRNYLTPFFTTQNGDEDEQ-EELISNSRRARY  403
             +DRNYLTPFFT+Q  ++D+   E   N RR  Y
Sbjct  481   LDRNYLTPFFTSQTDEDDDVFGEQPQNQRRGFY  513



>ref|XP_010928157.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X2 [Elaeis 
guineensis]
Length=534

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/510 (79%), Positives = 454/510 (89%), Gaps = 6/510 (1%)
 Frame = -1

Query  1935  KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             K+Q+AAGVGILLQI MLVL+F+LGHVLRR + YYLPEASASLLIGLIVGG+ANIS+TET+
Sbjct  25    KEQQAAGVGILLQISMLVLAFVLGHVLRRRKIYYLPEASASLLIGLIVGGVANISNTETS  84

Query  1755  IRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVY  1576
             IR WFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAI+ FA+ GTFIAS+VTGVLVY
Sbjct  85    IRGWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIIAFALLGTFIASIVTGVLVY  144

Query  1575  IGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAI  1396
             +GG+  LMY+LP  E LMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLNDA+AI
Sbjct  145   LGGLTYLMYRLPLGESLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAVAI  204

Query  1395  SLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQN  1216
             SLYRTMS VRSN SSGQN F++ + F+ETF GSMSAGVGVGFISALLFKYAGL+++NL N
Sbjct  205   SLYRTMSSVRSNDSSGQNLFLVILSFLETFVGSMSAGVGVGFISALLFKYAGLNVENLHN  264

Query  1215  LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISS  1036
             LE CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YT+SNLS+ SQ F ++FFHL+SS
Sbjct  265   LESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTFSNLSEKSQHFAAAFFHLLSS  324

Query  1035  LAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIP  856
             LAE FVFIYMGFDIAMEQ SW+H+GFIFFSILFI +ARAANVF CAYLVNLVRPANR+IP
Sbjct  325   LAEAFVFIYMGFDIAMEQQSWSHIGFIFFSILFIAVARAANVFSCAYLVNLVRPANRQIP  384

Query  855   PKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLE  676
              +HQKALWYSGLRGAMAFALALQSVHDLP+GHGQTIFTATTAIVVLTVL+IGGSTGTMLE
Sbjct  385   MQHQKALWYSGLRGAMAFALALQSVHDLPDGHGQTIFTATTAIVVLTVLLIGGSTGTMLE  444

Query  675   ALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAI  496
             AL VVGD ++  LG         G+     PSYDE +SSGS+ +MKLKEFH ST+SFTA+
Sbjct  445   ALKVVGDGHNGRLGEEGFEGPDIGT----GPSYDEATSSGSKLQMKLKEFH-STASFTAL  499

Query  495   DRNYLTPFFTTQNGDEDEQEELISNSRRAR  406
             DR+YLTPFFT+QN DE+  +E+  NS R R
Sbjct  500   DRHYLTPFFTSQNDDENP-DEVTQNSGRTR  528



>gb|EEE69360.1| hypothetical protein OsJ_28692 [Oryza sativa Japonica Group]
Length=631

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/499 (78%), Positives = 437/499 (88%), Gaps = 26/499 (5%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+ AGVGILLQI MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TET
Sbjct  28    GKEQQVAGVGILLQISMLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTET  87

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             N R                    QSGFSLSPKPFF+NFGAIVTFAI GTFIAS+VTGVLV
Sbjct  88    NTRT-------------------QSGFSLSPKPFFANFGAIVTFAILGTFIASVVTGVLV  128

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+  LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  129   YLGGLTFLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  188

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRS  ++G+NFFM+  +F+ETF GS+S+GVGVGFISALLFKYAGLDIDNLQ
Sbjct  189   ISLYRTMSLVRSQAAAGENFFMMVFQFLETFVGSLSSGVGVGFISALLFKYAGLDIDNLQ  248

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YT+SNLS++SQRFVS+FFHL+S
Sbjct  249   NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTFSNLSNNSQRFVSAFFHLLS  308

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAME+HSW+HVGFIFFSI+FI IARA NVF CAYLVN+ RP +R+I
Sbjct  309   SLAETFVFIYMGFDIAMEEHSWSHVGFIFFSIIFIIIARAVNVFSCAYLVNMSRPEHRRI  368

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P KHQKALW+SGLRGAMAFALALQS ++LP GHG+TIFT TTAIVVLTVL+IGGSTGTML
Sbjct  369   PLKHQKALWFSGLRGAMAFALALQSANELPGGHGKTIFTTTTAIVVLTVLLIGGSTGTML  428

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EALDV+GD+           E  + +NGYI P+Y+E SSSG   +MKLKEFHKST+SFTA
Sbjct  429   EALDVIGDE-------NRSIENYDDNNGYIPPTYEEGSSSGGGLRMKLKEFHKSTTSFTA  481

Query  498   IDRNYLTPFFTTQNGDEDE  442
             +DRNYLTPFFT+Q  ++D+
Sbjct  482   LDRNYLTPFFTSQTDEDDD  500



>ref|XP_010928156.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X1 [Elaeis 
guineensis]
Length=535

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/511 (79%), Positives = 454/511 (89%), Gaps = 7/511 (1%)
 Frame = -1

Query  1935  KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             K+Q+AAGVGILLQI MLVL+F+LGHVLRR + YYLPEASASLLIGLIVGG+ANIS+TET+
Sbjct  25    KEQQAAGVGILLQISMLVLAFVLGHVLRRRKIYYLPEASASLLIGLIVGGVANISNTETS  84

Query  1755  IRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVY  1576
             IR WFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAI+ FA+ GTFIAS+VTGVLVY
Sbjct  85    IRGWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIIAFALLGTFIASIVTGVLVY  144

Query  1575  IGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAI  1396
             +GG+  LMY+LP  E LMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLNDA+AI
Sbjct  145   LGGLTYLMYRLPLGESLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAVAI  204

Query  1395  SLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQN  1216
             SLYRTMS VRSN SSGQN F++ + F+ETF GSMSAGVGVGFISALLFKYAGL+++NL N
Sbjct  205   SLYRTMSSVRSNDSSGQNLFLVILSFLETFVGSMSAGVGVGFISALLFKYAGLNVENLHN  264

Query  1215  LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGI-VMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             LE CLFVLFPYFSYMLAEGLGLSGIVSILFTGI VMK YT+SNLS+ SQ F ++FFHL+S
Sbjct  265   LESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIQVMKHYTFSNLSEKSQHFAAAFFHLLS  324

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAE FVFIYMGFDIAMEQ SW+H+GFIFFSILFI +ARAANVF CAYLVNLVRPANR+I
Sbjct  325   SLAEAFVFIYMGFDIAMEQQSWSHIGFIFFSILFIAVARAANVFSCAYLVNLVRPANRQI  384

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             P +HQKALWYSGLRGAMAFALALQSVHDLP+GHGQTIFTATTAIVVLTVL+IGGSTGTML
Sbjct  385   PMQHQKALWYSGLRGAMAFALALQSVHDLPDGHGQTIFTATTAIVVLTVLLIGGSTGTML  444

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EAL VVGD ++  LG         G+     PSYDE +SSGS+ +MKLKEFH ST+SFTA
Sbjct  445   EALKVVGDGHNGRLGEEGFEGPDIGT----GPSYDEATSSGSKLQMKLKEFH-STASFTA  499

Query  498   IDRNYLTPFFTTQNGDEDEQEELISNSRRAR  406
             +DR+YLTPFFT+QN DE+  +E+  NS R R
Sbjct  500   LDRHYLTPFFTSQNDDENP-DEVTQNSGRTR  529



>ref|XP_010462489.1| PREDICTED: sodium/hydrogen exchanger 5-like [Camelina sativa]
Length=520

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/513 (79%), Positives = 446/513 (87%), Gaps = 12/513 (2%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRHRF+YLPEAS SLLIGLIVG LANIS
Sbjct  13    PQGKVKQQQAAGVGILLQIMMLVLSFVLGHVLRRHRFHYLPEASGSLLIGLIVGVLANIS  72

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             DTE +IR WFNFHEEFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTFAI GTF+AS VT
Sbjct  73    DTEISIRTWFNFHEEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFAIIGTFVASFVT  132

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G LVY+GG + LMYKLPF+ECLMFG+LISATDPVTVLSIFQ++GTDVNLYALVFGESVLN
Sbjct  133   GGLVYLGGSMYLMYKLPFVECLMFGALISATDPVTVLSIFQDVGTDVNLYALVFGESVLN  192

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLV   +SSG++F M+ +RF+E F GSMSAGVGVGF SALLFKYAGLD 
Sbjct  193   DAMAISLYRTMSLVNRQSSSGEHFLMVVIRFLEIFAGSMSAGVGVGFTSALLFKYAGLDT  252

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             +NLQNLECCLFVLFPYFSYMLAEG+GLSGIVSILFTGIVMKRYT+SNLS++SQ FVSSFF
Sbjct  253   ENLQNLECCLFVLFPYFSYMLAEGVGLSGIVSILFTGIVMKRYTFSNLSEASQSFVSSFF  312

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETF FIYMGFDIAMEQHSW+HVGFI FSILFIG+ARA NVFGCAYLVNL R  
Sbjct  313   HLISSLAETFTFIYMGFDIAMEQHSWSHVGFILFSILFIGVARAVNVFGCAYLVNLFRQD  372

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             N+K+P KHQKALWYSGLRGAMAFALALQS+HDLPEGHGQ IFTATTAIVV+TVL+IGGST
Sbjct  373   NQKLPMKHQKALWYSGLRGAMAFALALQSLHDLPEGHGQIIFTATTAIVVVTVLLIGGST  432

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYD-------EESSSGSRFKMKLK  532
             G MLEAL+VVGDD D            E  + Y+ P +        + SSSGSRFKMKLK
Sbjct  433   GKMLEALEVVGDDLD----DSMSEGFEESDHRYVPPPFSIGTSSDEDTSSSGSRFKMKLK  488

Query  531   EFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQEE  433
             EFHK T++FTA+D+N+LTPFFTT +GD D   E
Sbjct  489   EFHK-TTTFTALDKNFLTPFFTTNSGDGDGDGE  520



>ref|XP_009420065.1| PREDICTED: sodium/hydrogen exchanger 6-like [Musa acuminata subsp. 
malaccensis]
Length=527

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/520 (75%), Positives = 453/520 (87%), Gaps = 8/520 (2%)
 Frame = -1

Query  1953  PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANI  1774
             P    G+DQ+AAGVGILLQI MLVLSF++GHVLRRH+FYYLPEAS SLLIGL+VGG+ANI
Sbjct  15    PSEEPGEDQQAAGVGILLQISMLVLSFVVGHVLRRHKFYYLPEASVSLLIGLVVGGIANI  74

Query  1773  SDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMV  1594
             S TE NIR WFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAI+T AI GTFIAS+V
Sbjct  75    SHTEANIRGWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIITLAILGTFIASVV  134

Query  1593  TGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVL  1414
             TG+LVY+GG+  LMYKLP +ECLMFG+L+SATDPVTVLSIFQELGTDVN+YALVFGESVL
Sbjct  135   TGILVYLGGLAYLMYKLPLVECLMFGALVSATDPVTVLSIFQELGTDVNIYALVFGESVL  194

Query  1413  NDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLD  1234
             NDAMAISLYRTMS VR + SSGQ+  +  ++F+ETFFGSMS+GVGVGFISALLFKYAGLD
Sbjct  195   NDAMAISLYRTMSSVRHSKSSGQSLALAVLKFLETFFGSMSSGVGVGFISALLFKYAGLD  254

Query  1233  IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSF  1054
             +DNL NLE CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK+YT+SNLS +SQ F  +F
Sbjct  255   VDNLHNLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKQYTFSNLSKNSQHFAPAF  314

Query  1053  FHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRP  874
             FHL+SSLAETFVFIYMGFDIAMEQHSW+H+GFIFFSILFIG+ARAA+VF CA+L+N+VRP
Sbjct  315   FHLLSSLAETFVFIYMGFDIAMEQHSWSHIGFIFFSILFIGVARAAHVFSCAWLINMVRP  374

Query  873   ANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGS  694
             A+ +IP +HQKALWYSGLRGAMAFALAL+SVHDLP+GHG+ I TATTAIVV+TVL+IGGS
Sbjct  375   ASSQIPMRHQKALWYSGLRGAMAFALALKSVHDLPDGHGKIILTATTAIVVITVLLIGGS  434

Query  693   TGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKST  514
             TG MLEAL+V+GD Y          E L  ++ Y+ PS+DE +SSG++ +MKLK+  +ST
Sbjct  435   TGKMLEALEVIGDAYS----GPYGEENLGDNHDYVGPSFDEGTSSGNKIRMKLKKI-QST  489

Query  513   SSFTAIDRNYLTPFFTTQNGDEDEQEELISNSRRARYSGH  394
             +SFTA+DRNYLTP FT++N   DE  E   NSR   +  H
Sbjct  490   ASFTALDRNYLTPIFTSKNDVPDEAPE---NSRTKEFQVH  526



>ref|XP_008811144.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X1 [Phoenix 
dactylifera]
Length=534

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/513 (77%), Positives = 448/513 (87%), Gaps = 5/513 (1%)
 Frame = -1

Query  1932  DQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETNI  1753
             +Q+A G GILLQI MLVL+F+LGHVLRRH+ YYLPEASASLLIGLIVGGLANIS+ ET+I
Sbjct  26    EQQAEGAGILLQISMLVLAFVLGHVLRRHKIYYLPEASASLLIGLIVGGLANISNKETSI  85

Query  1752  RAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYI  1573
             R WFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAI+TFA+ GT IAS+VTGVLVY+
Sbjct  86    RGWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIITFALLGTLIASVVTGVLVYL  145

Query  1572  GGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAIS  1393
             GG+  LMY+LP  E LMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLNDA+AIS
Sbjct  146   GGLTYLMYRLPLGESLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAVAIS  205

Query  1392  LYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNL  1213
             LYRTM+ VRSN SSGQN  ++ + F+ETF GS+S+GVGVGFISALLFKYAGL+++NL NL
Sbjct  206   LYRTMASVRSNDSSGQNLLLVILSFLETFVGSLSSGVGVGFISALLFKYAGLNVENLHNL  265

Query  1212  ECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSL  1033
             E CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYT+SNLS+ SQ F S+FFHL+SSL
Sbjct  266   ESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTFSNLSEKSQHFASAFFHLLSSL  325

Query  1032  AETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPP  853
             AE FVFIYMGFDIAMEQ SW+H+GFIFFSILFIG+ARA NVF CAYLVNLVRPANR+IP 
Sbjct  326   AEAFVFIYMGFDIAMEQQSWSHIGFIFFSILFIGVARATNVFSCAYLVNLVRPANRQIPM  385

Query  852   KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEA  673
             +HQKALWYSGLRGAMAFALALQ+VHDLP+GHGQTIFTATTAIVVLTVL+IGGSTGTMLEA
Sbjct  386   QHQKALWYSGLRGAMAFALALQAVHDLPDGHGQTIFTATTAIVVLTVLLIGGSTGTMLEA  445

Query  672   LDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAID  493
             L VVGD ++             G++G   PSYDE +SSGS+ +M LKEFH +T+S TA+D
Sbjct  446   LKVVGDGHN----GRLGDHMSLGTDGSTGPSYDEGTSSGSKLQMTLKEFH-NTASLTALD  500

Query  492   RNYLTPFFTTQNGDEDEQEELISNSRRARYSGH  394
             R+YLTPFFT+QN DE+  E   ++ R     GH
Sbjct  501   RHYLTPFFTSQNDDENPDEATQNSRRITELEGH  533



>ref|XP_008811145.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X2 [Phoenix 
dactylifera]
Length=534

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/513 (77%), Positives = 448/513 (87%), Gaps = 5/513 (1%)
 Frame = -1

Query  1932  DQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETNI  1753
             +Q+A G GILLQI MLVL+F+LGHVLRRH+ YYLPEASASLLIGLIVGGLANIS+ ET+I
Sbjct  26    EQQAEGAGILLQISMLVLAFVLGHVLRRHKIYYLPEASASLLIGLIVGGLANISNKETSI  85

Query  1752  RAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYI  1573
             R WFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAI+TFA+ GT IAS+VTGVLVY+
Sbjct  86    RGWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIITFALLGTLIASVVTGVLVYL  145

Query  1572  GGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAIS  1393
             GG+  LMY+LP  E LMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLNDA+AIS
Sbjct  146   GGLTYLMYRLPLGESLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAVAIS  205

Query  1392  LYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNL  1213
             LYRTM+ VRSN SSGQN  ++ + F+ETF GS+S+GVGVGFISALLFKYAGL+++NL NL
Sbjct  206   LYRTMASVRSNDSSGQNLLLVILSFLETFVGSLSSGVGVGFISALLFKYAGLNVENLHNL  265

Query  1212  ECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSL  1033
             E CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYT+SNLS+ SQ F S+FFHL+SSL
Sbjct  266   ESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTFSNLSEKSQHFASAFFHLLSSL  325

Query  1032  AETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPP  853
             AE FVFIYMGFDIAMEQ SW+H+GFIFFSILFIG+ARA NVF CAYLVNLVRPANR+IP 
Sbjct  326   AEAFVFIYMGFDIAMEQQSWSHIGFIFFSILFIGVARATNVFSCAYLVNLVRPANRQIPM  385

Query  852   KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEA  673
             +HQKALWYSGLRGAMAFALALQ+VHDLP+GHGQTIFTATTAIVVLTVL+IGGSTGTMLEA
Sbjct  386   QHQKALWYSGLRGAMAFALALQAVHDLPDGHGQTIFTATTAIVVLTVLLIGGSTGTMLEA  445

Query  672   LDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAID  493
             L VVGD ++             G++G   PSYDE +SSGS+ +M LKEFH +T+S TA+D
Sbjct  446   LKVVGDGHN----GRLGDVSFLGTDGSTGPSYDEGTSSGSKLQMTLKEFH-NTASLTALD  500

Query  492   RNYLTPFFTTQNGDEDEQEELISNSRRARYSGH  394
             R+YLTPFFT+QN DE+  E   ++ R     GH
Sbjct  501   RHYLTPFFTSQNDDENPDEATQNSRRITELEGH  533



>ref|XP_008811204.1| PREDICTED: sodium/hydrogen exchanger 6-like [Phoenix dactylifera]
Length=544

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/492 (81%), Positives = 444/492 (90%), Gaps = 6/492 (1%)
 Frame = -1

Query  1935  KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             K+++AAGVGILLQI MLVL+F+LGHVLRRH+  YLPEASASLLIGLIVGGLANIS+TETN
Sbjct  24    KEEQAAGVGILLQISMLVLAFVLGHVLRRHKISYLPEASASLLIGLIVGGLANISNTETN  83

Query  1755  IRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVY  1576
             IR WFNFHEEFFFLFLLPPIIF+SGFSL+PKPFFSNFGAIVTFAI GTF+AS+VTGVLVY
Sbjct  84    IRGWFNFHEEFFFLFLLPPIIFRSGFSLAPKPFFSNFGAIVTFAILGTFVASIVTGVLVY  143

Query  1575  IGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAI  1396
             +GG+  LMY+LP +ECLMFG+LISATDPVTVLSIFQELGTD NLYALVFGESVLNDAMAI
Sbjct  144   LGGLTYLMYRLPLVECLMFGALISATDPVTVLSIFQELGTDENLYALVFGESVLNDAMAI  203

Query  1395  SLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQN  1216
             +LYRTMS V+SN SSGQN F + + F+ETFFGSMS+GVGVG +SALLFKYAGL+++NL N
Sbjct  204   ALYRTMSSVKSNDSSGQNLFFVVLNFLETFFGSMSSGVGVGLLSALLFKYAGLNVENLHN  263

Query  1215  LECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISS  1036
             LE CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYT+SNLS++SQ F ++FFHL+SS
Sbjct  264   LESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTFSNLSENSQHFSAAFFHLLSS  323

Query  1035  LAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIP  856
             LAETFVFIYMGFDI MEQHSW+HVGFIFFSILFIG+ARAANVF CAYLVNLVRPANR+IP
Sbjct  324   LAETFVFIYMGFDIGMEQHSWSHVGFIFFSILFIGVARAANVFSCAYLVNLVRPANRQIP  383

Query  855   PKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLE  676
              +HQKALWYSGLRGAMAFALALQSVHDLP+GHGQTIFTATTAIVVLTVL+IGGST TML 
Sbjct  384   LQHQKALWYSGLRGAMAFALALQSVHDLPDGHGQTIFTATTAIVVLTVLLIGGSTSTMLR  443

Query  675   ALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAI  496
             AL VVGD ++     G L E  EG N  I  SYDE +SSG + KMKLKEFH S +SFT +
Sbjct  444   ALKVVGDGHN-----GPLEESFEGKNCNIGSSYDEGTSSGGKLKMKLKEFH-SNASFTTL  497

Query  495   DRNYLTPFFTTQ  460
             DR+YLTPFFT+ 
Sbjct  498   DRHYLTPFFTSH  509



>emb|CDX88553.1| BnaC06g39970D [Brassica napus]
Length=583

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/588 (70%), Positives = 457/588 (78%), Gaps = 64/588 (11%)
 Frame = -1

Query  1968  MEELLP----PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIG  1801
             M E+ P    P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIG
Sbjct  1     MPEISPAIHDPQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIG  60

Query  1800  LIVGGLANISDTETNIRAWFNFHEEffflfll-ppiiFQSGFSLSPKPFFSNFGAIVTFA  1624
             LIVGGLAN+S+TET+IR WFNFH+EFFFLF L   +  QSGFSL PKPFFSNFGAIVTF+
Sbjct  61    LIVGGLANVSNTETSIRTWFNFHDEFFFLFFLDVLVCTQSGFSLQPKPFFSNFGAIVTFS  120

Query  1623  IFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNL  1444
             + GTF+AS+VTGVLVY+GGV+ LMY+LPF+ECLMFGSLISATDPVTVLSIFQELG+DVNL
Sbjct  121   VLGTFVASIVTGVLVYLGGVMFLMYRLPFVECLMFGSLISATDPVTVLSIFQELGSDVNL  180

Query  1443  YALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGV------  1282
             YALVFGESVLNDAMAISLYRTMSLVRS+ S+GQNFFM+ +RF+ETF GSMSAG+      
Sbjct  181   YALVFGESVLNDAMAISLYRTMSLVRSH-SAGQNFFMVIIRFLETFVGSMSAGLLLLSAS  239

Query  1281  ------------------------------GVGFISAL----LFKYAGLDIDNLQNLECC  1204
                                              F + L    LFKYAGLD+DNLQNLECC
Sbjct  240   SFFVYIFHLCFSNLRKAIYKYQTKYYLKHLNTCFTNVLNAKHLFKYAGLDVDNLQNLECC  299

Query  1203  LFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAET  1024
             LFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS +SQRFVS+FFHLISSLAET
Sbjct  300   LFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSTNSQRFVSAFFHLISSLAET  359

Query  1023  FVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQ  844
             FVFIYMGFDIAME+HSW+HVGFIFFSILFI IARAANVFGC YLVNL RPA+RKIP  HQ
Sbjct  360   FVFIYMGFDIAMEKHSWSHVGFIFFSILFIVIARAANVFGCGYLVNLARPAHRKIPMTHQ  419

Query  843   KALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALDV  664
             KALWYSGLRGAMAFALALQSVH+LP+GHGQTIFTATTAIVV+TVL+IGGSTGTMLEAL+V
Sbjct  420   KALWYSGLRGAMAFALALQSVHELPDGHGQTIFTATTAIVVVTVLLIGGSTGTMLEALEV  479

Query  663   VGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAIDRNY  484
             VGD  D    T         +N Y+    DE S S S F+ KL+EFHKS  SF+ +DRNY
Sbjct  480   VGDSRD----TSLGDGFEVVNNRYMTRFDDEGSPSESGFRTKLREFHKSAKSFSELDRNY  535

Query  483   LTPFFTTQNGDEDEQ--------------EELISNSRRARYSGHS*NF  382
             LTPFFT+ NGD DE               EE I  +RR  ++    NF
Sbjct  536   LTPFFTSNNGDYDEDDDINNDQHHYLKRSEERIPFTRRGNFNNRGLNF  583



>ref|XP_010417630.1| PREDICTED: LOW QUALITY PROTEIN: sodium/hydrogen exchanger 6-like 
[Camelina sativa]
Length=538

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/526 (76%), Positives = 446/526 (85%), Gaps = 17/526 (3%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS
Sbjct  14    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANIS  73

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TET+IR WFNFH+EFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTF++ GTF+ASMVT
Sbjct  74    NTETSIRTWFNFHDEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFSVLGTFVASMVT  133

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G+LVY+GGV+ LMY+LP +ECLMFGSLISATDPVTVLSIFQELG+DVNLYALVFGESVLN
Sbjct  134   GLLVYLGGVMFLMYRLPLVECLMFGSLISATDPVTVLSIFQELGSDVNLYALVFGESVLN  193

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMSLVRS+ SSGQNFFM+ VRF+ETF GSMSAGVGVGF SALLFKYAGLD+
Sbjct  194   DAMAISLYRTMSLVRSH-SSGQNFFMVIVRFLETFVGSMSAGVGVGFTSALLFKYAGLDV  252

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS +SQRFVS+FF
Sbjct  253   DNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSANSQRFVSAFF  312

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETFVFIYMGFDIAME+HSW+H+GFIFFSILFI IARAANVFGC YLVNL RPA
Sbjct  313   HLISSLAETFVFIYMGFDIAMEKHSWSHLGFIFFSILFIVIARAANVFGCGYLVNLARPA  372

Query  870   NRKIPPKHQKALWYSGLRGAMAFALA---LQSVHDLPEGHGQtiftattaivvltvliIG  700
             +RKIP  HQKALWYSGLRGAMAFAL     Q  + L         +A   ++ L VL+IG
Sbjct  373   HRKIPMTHQKALWYSGLRGAMAFALXGSIGQRXNILFXFARSFFQSAELGMLPLRVLLIG  432

Query  699   GSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESS-SGSRFKMKLKEFH  523
             GSTGTMLEAL+VVGD +D      +LG+  E  N     SYD+E + SGS F+ KL+EFH
Sbjct  433   GSTGTMLEALEVVGDSHD-----TSLGDGFEVVNSRYMTSYDDEDTPSGSGFRTKLREFH  487

Query  522   KSTSSFTAIDRNYLTPFFTTQNGDEDEQ-------EELISNSRRAR  406
             KS +SFT +D+NYLTPFFT+ NGD D++       EE I  +RR  
Sbjct  488   KSAASFTELDKNYLTPFFTSNNGDYDDEDNIEQHHEERIPFTRRGN  533



>emb|CDX79331.1| BnaC06g19720D [Brassica napus]
Length=557

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/518 (76%), Positives = 433/518 (84%), Gaps = 27/518 (5%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS
Sbjct  13    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANIS  72

Query  1770  DTETNIRAWFNFHEE----------ffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAI  1621
             +TET+IR WFNFH+E            +      +   SGFSL PKPFFSNFGAIVTF++
Sbjct  73    NTETSIRTWFNFHDEFFFLFLLPPIILYPLFEFVLHIYSGFSLQPKPFFSNFGAIVTFSV  132

Query  1620  FGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLY  1441
              GTF+ASMVTGVLVY+GGV+ LMYKLPF+ECLMFGSLISATDPVTVLSIFQELG+DVNLY
Sbjct  133   LGTFVASMVTGVLVYLGGVMFLMYKLPFVECLMFGSLISATDPVTVLSIFQELGSDVNLY  192

Query  1440  ALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSA---------  1288
             ALVFGESVLNDAMAISLYRTMSLVRS  S+GQNFFM+ VRF+ETF GSMSA         
Sbjct  193   ALVFGESVLNDAMAISLYRTMSLVRSQ-SAGQNFFMVIVRFLETFVGSMSAVSYEIILFH  251

Query  1287  ---GVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGI  1117
                   V   +  LFKYAGLD+DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGI
Sbjct  252   FIHKRVVSLNAKHLFKYAGLDVDNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGI  311

Query  1116  VMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilf  937
             VMK YTYSNLS +SQRFVSSFFHLISSLAETFVFIYMGFDIAME HSW+HVGFI FSILF
Sbjct  312   VMKHYTYSNLSTNSQRFVSSFFHLISSLAETFVFIYMGFDIAMENHSWSHVGFILFSILF  371

Query  936   igIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHG  757
             I IARAANVFGC YLVNLVRPA+RKIP  HQKALWYSGLRGAMAFALALQSVHDLPEGHG
Sbjct  372   IVIARAANVFGCGYLVNLVRPAHRKIPMTHQKALWYSGLRGAMAFALALQSVHDLPEGHG  431

Query  756   QtiftattaivvltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSY  577
             QTIFTATTAIVV+TVL+IGGSTGTMLEAL+VVGD +D++LG G         N +     
Sbjct  432   QTIFTATTAIVVVTVLLIGGSTGTMLEALEVVGDGHDATLGDGFEVVNDRYMNRFD----  487

Query  576   DEESSSGSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTT  463
             DE+S SGS F+ KL+EFHKS +SFT +D+NYLTPFFT+
Sbjct  488   DEDSPSGSGFRTKLREFHKSAASFTELDKNYLTPFFTS  525



>emb|CDX67985.1| BnaA07g20250D [Brassica napus]
Length=557

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/518 (76%), Positives = 433/518 (84%), Gaps = 27/518 (5%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLAN+S
Sbjct  13    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANVS  72

Query  1770  DTETNIRAWFNFHEE----------ffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAI  1621
             +TET+IR WFNFH+E            +      +   SGFSL PKPFFSNFGAIVTF++
Sbjct  73    NTETSIRTWFNFHDEFFFLFLLPPIILYPLFEFVLRINSGFSLQPKPFFSNFGAIVTFSV  132

Query  1620  FGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLY  1441
              GTF+ASMVTGVLVY+GGV+ LMYKLPF+ECLMFGSLISATDPVTVLSIFQELG+DVNLY
Sbjct  133   LGTFVASMVTGVLVYLGGVMFLMYKLPFVECLMFGSLISATDPVTVLSIFQELGSDVNLY  192

Query  1440  ALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSA---------  1288
             ALVFGESVLNDAMAISLYRTMSLVRS  S+GQNFFM+ VRF+ETF GSMSA         
Sbjct  193   ALVFGESVLNDAMAISLYRTMSLVRSQ-SAGQNFFMVIVRFLETFVGSMSAVSYEIFLFD  251

Query  1287  ---GVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGI  1117
                   V   +  LFKYAGLD+DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGI
Sbjct  252   FIHKRVVSLNAKHLFKYAGLDVDNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGI  311

Query  1116  VMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilf  937
             VMK YTYSNLS +SQRFVSSFFHLISSLAETFVFIYMGFDIAME HSW+HVGFI FSILF
Sbjct  312   VMKHYTYSNLSTNSQRFVSSFFHLISSLAETFVFIYMGFDIAMENHSWSHVGFILFSILF  371

Query  936   igIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHG  757
             I IARAANVFGC YLVNLVRPA+RKIP  HQKALWYSGLRGAMAFALALQSVHDLPEGHG
Sbjct  372   IVIARAANVFGCGYLVNLVRPAHRKIPMTHQKALWYSGLRGAMAFALALQSVHDLPEGHG  431

Query  756   QtiftattaivvltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSY  577
             QTIFTATTAIVV+TVL+IGGSTGTMLEAL+VVGD +D++LG G         N +     
Sbjct  432   QTIFTATTAIVVVTVLLIGGSTGTMLEALEVVGDGHDATLGDGFEVVNDRYMNRFD----  487

Query  576   DEESSSGSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTT  463
             DE+S SGS F+ KL+EFHKS +SFT +D+NYLTPFFT+
Sbjct  488   DEDSPSGSGFRTKLREFHKSAASFTELDKNYLTPFFTS  525



>gb|KDO78604.1| hypothetical protein CISIN_1g047772mg [Citrus sinensis]
Length=498

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/511 (77%), Positives = 438/511 (86%), Gaps = 34/511 (7%)
 Frame = -1

Query  1953  PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANI  1774
             P     K+Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVG LANI
Sbjct  14    PRGSPAKEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGALANI  73

Query  1773  SDTETNIRAW----FNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFI  1606
             S+TETNI A+    F F+ + F          QSGFSLSPKPFFSNFGAIVTFAIFGTF+
Sbjct  74    SNTETNISAYLLLDFEFYLQHFSFLDSFRHT-QSGFSLSPKPFFSNFGAIVTFAIFGTFL  132

Query  1605  ASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFG  1426
             ASMVTG+LVY+GGV+ LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFG
Sbjct  133   ASMVTGILVYLGGVMFLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFG  192

Query  1425  ESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKY  1246
             ESVLNDAMAISLYRTMSLVRS+ SSGQNFFM+ VRF+ETF GS+                
Sbjct  193   ESVLNDAMAISLYRTMSLVRSHASSGQNFFMVIVRFLETFVGSI----------------  236

Query  1245  AGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRF  1066
                    LQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYT+SNLS++SQRF
Sbjct  237   -------LQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTFSNLSENSQRF  289

Query  1065  VSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVN  886
             VS+FFHLISSLAETFVFIYMGFDIAME+HSW+H+GFIFFSILFI +ARAANVF CAYLVN
Sbjct  290   VSAFFHLISSLAETFVFIYMGFDIAMEKHSWSHLGFIFFSILFIIVARAANVFSCAYLVN  349

Query  885   LVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvli  706
             L RPA+R+IP KHQ+ALWYSGLRGAMAFALALQSVHDLPEGHGQTIF+ATT IVVLTVL+
Sbjct  350   LARPAHRQIPLKHQQALWYSGLRGAMAFALALQSVHDLPEGHGQTIFSATTVIVVLTVLL  409

Query  705   IGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEF  526
             IGGSTGTMLEAL VVGD +D     G LGE  EG+NGY AP YDE S+SG++ KMKLKEF
Sbjct  410   IGGSTGTMLEALQVVGDAHD-----GHLGENFEGNNGYAAP-YDEGSTSGNKLKMKLKEF  463

Query  525   HKSTSSFTAIDRNYLTPFFTTQNGDEDEQEE  433
              KS +SFTA+D+NYLTPFFT+ NGDE+++E+
Sbjct  464   RKSAASFTALDKNYLTPFFTSHNGDEEDEED  494



>gb|KHG02521.1| Sodium/hydrogen exchanger 6 -like protein [Gossypium arboreum]
Length=515

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/544 (72%), Positives = 438/544 (81%), Gaps = 68/544 (13%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             G++Q+AAGVGILLQIMMLVLSF++GHVLRRH+FYYLPEASASLLIG              
Sbjct  12    GQEQQAAGVGILLQIMMLVLSFVVGHVLRRHKFYYLPEASASLLIG--------------  57

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
                                       FSLSPKPFFSNFGAIVTFAIFGTFIAS+VTGVLV
Sbjct  58    --------------------------FSLSPKPFFSNFGAIVTFAIFGTFIASVVTGVLV  91

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG++ LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLNDAMA
Sbjct  92    YLGGLMYLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAMA  151

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISAL-----LFKYAGLD  1234
             ISLYRTMS+VRSN  SGQNFFM+ VRF+ETF GSMSAGVGVGF SAL     LFKYAGLD
Sbjct  152   ISLYRTMSVVRSNDPSGQNFFMVIVRFLETFVGSMSAGVGVGFTSALISFLNLFKYAGLD  211

Query  1233  IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSF  1054
             IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YT+SNLS++SQRFVS F
Sbjct  212   IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTFSNLSENSQRFVSDF  271

Query  1053  FHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRP  874
             FHLISSLAETF+FIYMGFDIAME+HSW+HVGFIFFSILFI IARA NVF CAYL+NLVRP
Sbjct  272   FHLISSLAETFIFIYMGFDIAMEKHSWSHVGFIFFSILFIAIARAVNVFSCAYLINLVRP  331

Query  873   ANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGS  694
             A+R+IP KHQKAL YSGLRGAMAFALALQSVHDL EGHGQ IFTATTAIVVLTVL+IGGS
Sbjct  332   AHRQIPSKHQKALCYSGLRGAMAFALALQSVHDLEEGHGQIIFTATTAIVVLTVLLIGGS  391

Query  693   TGTMLEALDVVGDDYDs----------------------slgtgtlgerlegSNGYIAPS  580
             TGTMLEAL VVGD +D+                      +     +    EG+NGY+  S
Sbjct  392   TGTMLEALQVVGDGHDAHLGEILSEVLVDENRVKMLNKETASAIMMMAGFEGNNGYVPTS  451

Query  579   YDEESSSGSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQNGD-EDEQEELISNSRRARY  403
              +E+ ++G++ +MKLKEFH+S +SF+ IDRNYLTPFFT+QNGD EDE+++ + +SRR  Y
Sbjct  452   REEDETTGNKLRMKLKEFHRSAASFSEIDRNYLTPFFTSQNGDSEDEEDDPMPSSRRGVY  511

Query  402   SGHS  391
              GHS
Sbjct  512   HGHS  515



>gb|EYU27611.1| hypothetical protein MIMGU_mgv1a021839mg [Erythranthe guttata]
Length=554

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/558 (74%), Positives = 453/558 (81%), Gaps = 52/558 (9%)
 Frame = -1

Query  1968  MEELLPPP-----RTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLI  1804
             MEEL   P        K+Q+AAGVGILLQIMMLVLSF+LGHVLRRHRFYYLPEASASLLI
Sbjct  1     MEELRISPADPRGSPAKEQQAAGVGILLQIMMLVLSFVLGHVLRRHRFYYLPEASASLLI  60

Query  1803  GLIVGGLANISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFA  1624
             GLIVG LANIS+TE +IR+WFNFHEEFFFL  +    F    S   KPFFSNFGAIVTFA
Sbjct  61    GLIVGVLANISNTENSIRSWFNFHEEFFFLESISLTCFPCLPSQDSKPFFSNFGAIVTFA  120

Query  1623  IFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNL  1444
             IFGTF+AS+VTGVLVY+ G   L+Y+LPF+ECLMFG+LISATDPVTVLSIFQELGTD NL
Sbjct  121   IFGTFLASVVTGVLVYLAGATYLIYRLPFVECLMFGALISATDPVTVLSIFQELGTDTNL  180

Query  1443  YALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFIS  1264
             YALVFGESVLNDAMAISLYRTMSLVRS++SS QN FM+ +RF+ETF GSMSAGVGVGF S
Sbjct  181   YALVFGESVLNDAMAISLYRTMSLVRSHSSSDQNLFMVVIRFLETFVGSMSAGVGVGFTS  240

Query  1263  ALL-FKY--------AGLD---IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG  1120
             AL+ F Y        A  D   I +LQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG
Sbjct  241   ALISFLYFFIYLPTLALTDFKLITSLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG  300

Query  1119  IVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsil  940
             IVMK Y++SNLSD+SQ+FVS+FFHLISSLAETFVFIYMGFDIAMEQHSW+H+GFIFFSI+
Sbjct  301   IVMKHYSFSNLSDNSQKFVSAFFHLISSLAETFVFIYMGFDIAMEQHSWSHIGFIFFSIV  360

Query  939   figIAR----------------------------AANVFGCAYLVNLVRPANRKIPPKHQ  844
             FI IAR                            AANVF C YLVNLVRPA+RKIP KHQ
Sbjct  361   FICIARYDYLAFCILALVLLFLIYFPFFFCKEMLAANVFCCGYLVNLVRPAHRKIPMKHQ  420

Query  843   KALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALDV  664
             KALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTMLEAL V
Sbjct  421   KALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTMLEALHV  480

Query  663   VGDDYDsslgtgtlgerlegSNGYIAPSY--DEESSSGSRFKMKLKEFHKSTSSFTAIDR  490
             VGD  +      +LGE LE +NGY AP Y  +EESSSG+RFKM+LKE   ST+SFTA+DR
Sbjct  481   VGDSNE-----VSLGESLESNNGYRAPVYEDEEESSSGNRFKMRLKELRNSTASFTALDR  535

Query  489   NYLTPFFTTQNGDEDEQE  436
             NYLTPFFTTQ+G+ED+  
Sbjct  536   NYLTPFFTTQSGEEDDDH  553



>ref|XP_006307310.1| hypothetical protein CARUB_v10008930mg [Capsella rubella]
 gb|EOA40208.1| hypothetical protein CARUB_v10008930mg [Capsella rubella]
Length=500

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/513 (78%), Positives = 433/513 (84%), Gaps = 32/513 (6%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRHRF+Y+PEAS SLLIGLIVG LANIS
Sbjct  13    PQGQVKQQQAAGVGILLQIMMLVLSFVLGHVLRRHRFHYIPEASGSLLIGLIVGVLANIS  72

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             DTE +IR WFNFHEEFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTFAI GTFIAS+VT
Sbjct  73    DTEASIRTWFNFHEEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFAIIGTFIASVVT  132

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G LVY+GG + LMYKLPF+ECLMFG+LISATDPVTVLSIFQ++GTDVNLYALVFGESVLN
Sbjct  133   GGLVYLGGSMYLMYKLPFVECLMFGALISATDPVTVLSIFQDVGTDVNLYALVFGESVLN  192

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYR                     F+ETF GSMSAGVGVGF SALLFKYAGLD 
Sbjct  193   DAMAISLYR---------------------FLETFAGSMSAGVGVGFTSALLFKYAGLDT  231

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             +NLQNLECCLFVLFPYFSYMLAEG+GLSGIVSILFTGIVMKRYT+SNLS++SQ FVSSFF
Sbjct  232   ENLQNLECCLFVLFPYFSYMLAEGVGLSGIVSILFTGIVMKRYTFSNLSEASQSFVSSFF  291

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
             HLISSLAETF FIYMGFDIAMEQHSW+HVGFI FSILFIG+ARA NVFGCAYLVNL R  
Sbjct  292   HLISSLAETFTFIYMGFDIAMEQHSWSHVGFILFSILFIGVARAVNVFGCAYLVNLFRQD  351

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             N+KIP  HQKALWYSGLRGAMAFALALQS+HDLPEGHGQ IFTATT IVV+TVL+IGGST
Sbjct  352   NQKIPMNHQKALWYSGLRGAMAFALALQSLHDLPEGHGQIIFTATTTIVVVTVLLIGGST  411

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAP------SYDEE-SSSGSRFKMKLK  532
             G MLEAL+VVGDD D            E  + Y+ P      S DE+ SSSGSRFKMKLK
Sbjct  412   GKMLEALEVVGDDLD----DSMSEGFEESDHRYVPPPFSIGASSDEDTSSSGSRFKMKLK  467

Query  531   EFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQEE  433
             EFHK+T+SF+A+D+N+LTPFFTT NGD D   E
Sbjct  468   EFHKTTTSFSALDKNFLTPFFTTNNGDGDGDGE  500



>gb|KGN65008.1| hypothetical protein Csa_1G178240 [Cucumis sativus]
Length=524

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/436 (88%), Positives = 409/436 (94%), Gaps = 0/436 (0%)
 Frame = -1

Query  1953  PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANI  1774
             P     KDQ+AAGVGILLQIMMLVLSF+LGHVLRRHR Y+LPEASASLLIGLIVGGLANI
Sbjct  71    PKGSPVKDQQAAGVGILLQIMMLVLSFVLGHVLRRHRLYFLPEASASLLIGLIVGGLANI  130

Query  1773  SDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMV  1594
             S+TETNIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAI GTFIAS+V
Sbjct  131   SNTETNIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAILGTFIASVV  190

Query  1593  TGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVL  1414
             TG LVY+GG+  LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVL
Sbjct  191   TGGLVYLGGLAFLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVL  250

Query  1413  NDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLD  1234
             NDAMAISLYRTMSLVRS+  SG+NFF + VRF+ETF GS+SAGVGVGF SALLFKYAGLD
Sbjct  251   NDAMAISLYRTMSLVRSHAYSGKNFFFVIVRFLETFVGSLSAGVGVGFTSALLFKYAGLD  310

Query  1233  IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSF  1054
             IDNLQNLECCLFVLFPYFSYMLAEG GLSGIVSILFTG+VMK YTYSNLS SSQ+FV+ F
Sbjct  311   IDNLQNLECCLFVLFPYFSYMLAEGFGLSGIVSILFTGMVMKHYTYSNLSQSSQQFVAEF  370

Query  1053  FHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRP  874
             FHLISSLAETF+FIYMG DIAMEQHSW+HVGFIFFSILFIG+ARAANVF CAYLVNLVRP
Sbjct  371   FHLISSLAETFIFIYMGLDIAMEQHSWSHVGFIFFSILFIGVARAANVFSCAYLVNLVRP  430

Query  873   ANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGS  694
             ANRKIP  HQKALWYSGLRGAMAFALALQS+HDLP+GHGQTIFTATTAIVVLTVL+IGGS
Sbjct  431   ANRKIPSNHQKALWYSGLRGAMAFALALQSIHDLPDGHGQTIFTATTAIVVLTVLLIGGS  490

Query  693   TGTMLEALDVVGDDYD  646
             TGTMLEAL VVGD  D
Sbjct  491   TGTMLEALQVVGDSDD  506



>ref|XP_003594403.1| Sodium/hydrogen exchanger [Medicago truncatula]
Length=553

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/507 (78%), Positives = 437/507 (86%), Gaps = 23/507 (5%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             PP  GK+Q+AAGVGILLQIMMLVLSF+LGHVLRR + Y +PEASASLLIGLIVG LANIS
Sbjct  16    PP--GKEQQAAGVGILLQIMMLVLSFVLGHVLRRKKIYIIPEASASLLIGLIVGILANIS  73

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             DTETNI      H  +     L P+  QSGFSL+PKPFFSNFGAIVTFAIFGTF+AS VT
Sbjct  74    DTETNIS--LCAHLFYHVFASLIPMFTQSGFSLAPKPFFSNFGAIVTFAIFGTFLASFVT  131

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G LVY+GG++ LMY+LPF+EC+MFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLN
Sbjct  132   GALVYLGGLVFLMYRLPFVECMMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLN  191

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DAMAISLYRTMS+V++N  SGQNFFM+ VRF+ETF GS+SAG               LDI
Sbjct  192   DAMAISLYRTMSVVKNN-PSGQNFFMVVVRFLETFVGSLSAG---------------LDI  235

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLE CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK Y YSNLS SSQRFVS+FF
Sbjct  236   DNLQNLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYAYSNLSQSSQRFVSAFF  295

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
              LISSLAETF+FIYMGFDIAMEQHSW+HVGFIFFS++FI IARAANVF CAYLVNLVRPA
Sbjct  296   ELISSLAETFIFIYMGFDIAMEQHSWSHVGFIFFSVIFIVIARAANVFSCAYLVNLVRPA  355

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             +RKIPPK+QKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGST
Sbjct  356   HRKIPPKYQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGST  415

Query  690   GTMLEALDVVGDDY--DsslgtgtlgerlegSNGYIAP-SYDEESSSGSRFKMKLKEFHK  520
             GTMLEALDV+G D   DSSL +        G+NGYIAP   +E SSSG++ KMKLKEFHK
Sbjct  416   GTMLEALDVIGGDTHSDSSLASVGPITDYGGNNGYIAPSYEEESSSSGNKIKMKLKEFHK  475

Query  519   STSSFTAIDRNYLTPFFTTQNGDEDEQ  439
             ST+SFTA+DRNYLTPFFT+ NGDEDE+
Sbjct  476   STASFTALDRNYLTPFFTSHNGDEDEE  502



>ref|XP_004139605.1| PREDICTED: sodium/hydrogen exchanger 6-like [Cucumis sativus]
Length=880

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/436 (88%), Positives = 409/436 (94%), Gaps = 0/436 (0%)
 Frame = -1

Query  1953  PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANI  1774
             P     KDQ+AAGVGILLQIMMLVLSF+LGHVLRRHR Y+LPEASASLLIGLIVGGLANI
Sbjct  71    PKGSPVKDQQAAGVGILLQIMMLVLSFVLGHVLRRHRLYFLPEASASLLIGLIVGGLANI  130

Query  1773  SDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMV  1594
             S+TETNIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAI GTFIAS+V
Sbjct  131   SNTETNIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAILGTFIASVV  190

Query  1593  TGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVL  1414
             TG LVY+GG+  LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVL
Sbjct  191   TGGLVYLGGLAFLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVL  250

Query  1413  NDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLD  1234
             NDAMAISLYRTMSLVRS+  SG+NFF + VRF+ETF GS+SAGVGVGF SALLFKYAGLD
Sbjct  251   NDAMAISLYRTMSLVRSHAYSGKNFFFVIVRFLETFVGSLSAGVGVGFTSALLFKYAGLD  310

Query  1233  IDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSF  1054
             IDNLQNLECCLFVLFPYFSYMLAEG GLSGIVSILFTG+VMK YTYSNLS SSQ+FV+ F
Sbjct  311   IDNLQNLECCLFVLFPYFSYMLAEGFGLSGIVSILFTGMVMKHYTYSNLSQSSQQFVAEF  370

Query  1053  FHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRP  874
             FHLISSLAETF+FIYMG DIAMEQHSW+HVGFIFFSILFIG+ARAANVF CAYLVNLVRP
Sbjct  371   FHLISSLAETFIFIYMGLDIAMEQHSWSHVGFIFFSILFIGVARAANVFSCAYLVNLVRP  430

Query  873   ANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGS  694
             ANRKIP  HQKALWYSGLRGAMAFALALQS+HDLP+GHGQTIFTATTAIVVLTVL+IGGS
Sbjct  431   ANRKIPSNHQKALWYSGLRGAMAFALALQSIHDLPDGHGQTIFTATTAIVVLTVLLIGGS  490

Query  693   TGTMLEALDVVGDDYD  646
             TGTMLEAL VVGD  D
Sbjct  491   TGTMLEALQVVGDSDD  506



>ref|XP_007154089.1| hypothetical protein PHAVU_003G089800g [Phaseolus vulgaris]
 gb|ESW26083.1| hypothetical protein PHAVU_003G089800g [Phaseolus vulgaris]
Length=572

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/540 (72%), Positives = 433/540 (80%), Gaps = 51/540 (9%)
 Frame = -1

Query  1935  KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             K+Q+AAGVGILLQIMMLVLSF+LGHVLRR + Y LPEASASLLIGL+VG LANIS T+T+
Sbjct  21    KEQQAAGVGILLQIMMLVLSFVLGHVLRRKKIYVLPEASASLLIGLLVGTLANISHTQTS  80

Query  1755  IR------------------------------------------AWFNFHEEffflfllp  1702
             IR                                          A+ +FH  +  L  L 
Sbjct  81    IRNLTSSLSAKQGVVQLSRGVFLPLPFTSYNIISLTTRILLFLFAFPSFHHNYSLLSFLD  140

Query  1701  piiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYIGGVILLMYKLPFLECLM  1522
                     SL  KPFFSNFGAIVTFAIFGTF+AS+VTGVLVY+GG++ LMY+LPF+ECLM
Sbjct  141   LP-----LSLYSKPFFSNFGAIVTFAIFGTFLASIVTGVLVYLGGLMYLMYRLPFVECLM  195

Query  1521  FGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLVRSNTSSGQN  1342
             FG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTM++++++  SGQN
Sbjct  196   FGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMTVIKTH-PSGQN  254

Query  1341  FFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAE  1162
             FFM+ VRF+ETF GSMSAGVGVGFISALLFKY+GLDIDNLQNLE CLFVLFPYFSYMLAE
Sbjct  255   FFMVVVRFLETFVGSMSAGVGVGFISALLFKYSGLDIDNLQNLESCLFVLFPYFSYMLAE  314

Query  1161  GLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQ  982
             GLGLSGIVSILFTG+VMK YT+SNLS SSQRFVSSFF LISSLAETFVFIYMGFDIAME+
Sbjct  315   GLGLSGIVSILFTGMVMKHYTFSNLSRSSQRFVSSFFELISSLAETFVFIYMGFDIAMEK  374

Query  981   HSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAF  802
             HSW+HVGFIFFSI+FIGIARA NVF CAYLVNLVRPA R+IP KHQKALWYSGLRGAMAF
Sbjct  375   HSWSHVGFIFFSIIFIGIARAVNVFSCAYLVNLVRPAYRQIPRKHQKALWYSGLRGAMAF  434

Query  801   ALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALDVVGDDYDsslgtgtl  622
             ALALQS+HDLP+GHGQTI TATTAIVVLTVL+IGGSTGTMLEAL VVG D          
Sbjct  435   ALALQSIHDLPDGHGQTILTATTAIVVLTVLLIGGSTGTMLEALQVVGSDSPIIESPLAS  494

Query  621   gerlegS--NGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDE  448
               R      NGY +P  DEE SSG++ KMKL+EF +S +SFTA+D+NYLTPFFT+QN DE
Sbjct  495   LTRTNFEGNNGYFSPD-DEEPSSGNKIKMKLQEFQRSAASFTALDKNYLTPFFTSQNEDE  553



>gb|ABK24882.1| unknown [Picea sitchensis]
Length=594

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/500 (76%), Positives = 422/500 (84%), Gaps = 5/500 (1%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P +   + +AAGVGILLQIMMLVL+F+LGHVLRRH+FYYL EASASLLIGLIVGGLANIS
Sbjct  12    PGKAAIETQAAGVGILLQIMMLVLAFVLGHVLRRHKFYYLHEASASLLIGLIVGGLANIS  71

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             +TE NIR WFNFHEEFFFL LLPPIIFQSGFSL PKPFFSNFGAI+TFAI GTFI+SMVT
Sbjct  72    NTEENIRKWFNFHEEFFFLLLLPPIIFQSGFSLQPKPFFSNFGAIITFAILGTFISSMVT  131

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G+LVY+GG+ LLM++LPF E LMFG+LISATDPVT+L+IFQELG D NLYALVFGESVLN
Sbjct  132   GILVYLGGIFLLMFRLPFQESLMFGALISATDPVTILAIFQELGCDTNLYALVFGESVLN  191

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDI  1231
             DA+AISLYRTM  VR + ++  + F    RFIETFFGSMS G  V   SALLFKYAGL I
Sbjct  192   DAVAISLYRTMLSVRQHAATNPSLFTAVWRFIETFFGSMSTGAAVALSSALLFKYAGLGI  251

Query  1230  DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFF  1051
             DNLQNLECCLFVLFPY SYMLAEGLGLSGIV+ILF GIVMK YT+SNLS++SQ F + FF
Sbjct  252   DNLQNLECCLFVLFPYLSYMLAEGLGLSGIVAILFCGIVMKHYTFSNLSENSQTFTAGFF  311

Query  1050  HLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPA  871
              LISSLAETFVFIYMG DIA EQ SW+HVGFIFFSILFIG+ARAANVF CAYL+N VRPA
Sbjct  312   ELISSLAETFVFIYMGLDIATEQQSWSHVGFIFFSILFIGVARAANVFPCAYLINFVRPA  371

Query  870   NRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGST  691
             +RKIP KHQKALWYSGLRGAMAFALALQS+H+LP+GHGQTIFTATTAIVVLTVL+IGGST
Sbjct  372   SRKIPMKHQKALWYSGLRGAMAFALALQSIHELPDGHGQTIFTATTAIVVLTVLLIGGST  431

Query  690   GTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTS  511
              TMLE L+V GD          LGE  E  + Y AP     SSSG   KMKLKE  KST+
Sbjct  432   ATMLETLEVTGDSQG-----VLLGESSEEESDYRAPDETTSSSSGQNLKMKLKELRKSTA  486

Query  510   SFTAIDRNYLTPFFTTQNGD  451
             +FTAID+N+LTPFFT  NGD
Sbjct  487   TFTAIDKNFLTPFFTAHNGD  506



>ref|XP_007154088.1| hypothetical protein PHAVU_003G089800g [Phaseolus vulgaris]
 gb|ESW26082.1| hypothetical protein PHAVU_003G089800g [Phaseolus vulgaris]
Length=562

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/540 (70%), Positives = 423/540 (78%), Gaps = 61/540 (11%)
 Frame = -1

Query  1935  KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             K+Q+AAGVGILLQIMMLVLSF+LGHVLRR + Y LPEASASLLIGL+VG LANIS T+T+
Sbjct  21    KEQQAAGVGILLQIMMLVLSFVLGHVLRRKKIYVLPEASASLLIGLLVGTLANISHTQTS  80

Query  1755  IR------------------------------------------AWFNFHEEffflfllp  1702
             IR                                          A+ +FH  +  L  L 
Sbjct  81    IRNLTSSLSAKQGVVQLSRGVFLPLPFTSYNIISLTTRILLFLFAFPSFHHNYSLLSFLD  140

Query  1701  piiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYIGGVILLMYKLPFLECLM  1522
                     SL  KPFFSNFGAIVTFAIFGTF+AS+VTGVLVY+GG++ LMY+LPF+ECLM
Sbjct  141   LP-----LSLYSKPFFSNFGAIVTFAIFGTFLASIVTGVLVYLGGLMYLMYRLPFVECLM  195

Query  1521  FGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLVRSNTSSGQN  1342
             FG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTM++++++  SGQN
Sbjct  196   FGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMTVIKTH-PSGQN  254

Query  1341  FFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAE  1162
             FFM+ VRF+ETF GSMSAGVG          Y+GLDIDNLQNLE CLFVLFPYFSYMLAE
Sbjct  255   FFMVVVRFLETFVGSMSAGVG----------YSGLDIDNLQNLESCLFVLFPYFSYMLAE  304

Query  1161  GLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQ  982
             GLGLSGIVSILFTG+VMK YT+SNLS SSQRFVSSFF LISSLAETFVFIYMGFDIAME+
Sbjct  305   GLGLSGIVSILFTGMVMKHYTFSNLSRSSQRFVSSFFELISSLAETFVFIYMGFDIAMEK  364

Query  981   HSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAF  802
             HSW+HVGFIFFSI+FIGIARA NVF CAYLVNLVRPA R+IP KHQKALWYSGLRGAMAF
Sbjct  365   HSWSHVGFIFFSIIFIGIARAVNVFSCAYLVNLVRPAYRQIPRKHQKALWYSGLRGAMAF  424

Query  801   ALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALDVVGDDYDsslgtgtl  622
             ALALQS+HDLP+GHGQTI TATTAIVVLTVL+IGGSTGTMLEAL VVG D          
Sbjct  425   ALALQSIHDLPDGHGQTILTATTAIVVLTVLLIGGSTGTMLEALQVVGSDSPIIESPLAS  484

Query  621   gerlegS--NGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDE  448
               R      NGY +P  DEE SSG++ KMKL+EF +S +SFTA+D+NYLTPFFT+QN DE
Sbjct  485   LTRTNFEGNNGYFSPD-DEEPSSGNKIKMKLQEFQRSAASFTALDKNYLTPFFTSQNEDE  543



>ref|XP_006661364.1| PREDICTED: sodium/hydrogen exchanger 6-like [Oryza brachyantha]
Length=536

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/493 (72%), Positives = 428/493 (87%), Gaps = 4/493 (1%)
 Frame = -1

Query  1932  DQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETNI  1753
             +Q+AAGVGILLQI+MLVLSF+LGH+LRR + YY+PEASASLLIG+IVGG+ANIS+T+ +I
Sbjct  28    EQQAAGVGILLQILMLVLSFVLGHLLRRRKVYYIPEASASLLIGMIVGGIANISNTQRSI  87

Query  1752  RAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYI  1573
             R WFNF E+FF LFLLPPIIFQSGF+L+PKPFFSNFGAI+TFAI GTFIAS++TG+LVY 
Sbjct  88    RRWFNFREDFFLLFLLPPIIFQSGFNLAPKPFFSNFGAIITFAILGTFIASIITGLLVYG  147

Query  1572  GGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAIS  1393
             GGVI ++YKLP  E +MFG+L+SATDPVTVLSIFQELGTDVNLYALVFGESVLNDA+AIS
Sbjct  148   GGVIHIIYKLPLAESMMFGALVSATDPVTVLSIFQELGTDVNLYALVFGESVLNDAVAIS  207

Query  1392  LYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNL  1213
             LYR+M+L+R+N S GQN+F++ ++F+E F GSMS+GVGVG ISALLFKYA L ++NL NL
Sbjct  208   LYRSMALMRTN-SFGQNYFLVVIKFLENFVGSMSSGVGVGLISALLFKYAALGVENLYNL  266

Query  1212  ECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSL  1033
             E CLFVLFPYFSYML+EG+GLSGIVSILFTGIVMKRYT+ NLS+ SQRF   FFHL+SSL
Sbjct  267   ESCLFVLFPYFSYMLSEGIGLSGIVSILFTGIVMKRYTFCNLSEDSQRFTGRFFHLLSSL  326

Query  1032  AETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPP  853
             AE FVFIYMGFDIAME+ SW+H+GFIFFS++FI +ARAANVF CAY++NL RP + +IP 
Sbjct  327   AEAFVFIYMGFDIAMERQSWSHIGFIFFSVIFILLARAANVFSCAYILNLARPVHCQIPR  386

Query  852   KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEA  673
             ++Q ALWYSGLRGAMAFALA+QSVHDLPEGHG+TIFTATT+IVVLTVL+IGGSTGTMLE+
Sbjct  387   QYQLALWYSGLRGAMAFALAIQSVHDLPEGHGETIFTATTSIVVLTVLLIGGSTGTMLES  446

Query  672   LDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAID  493
             L VVGD +                 GY    Y+EE+S+ +RFK+KL+E  KSTSSF  +D
Sbjct  447   LQVVGDSHRYHHPYENFDGNNA---GYTGQHYEEETSTSNRFKIKLREIQKSTSSFALLD  503

Query  492   RNYLTPFFTTQNG  454
             ++YLTP FT+QNG
Sbjct  504   KHYLTPIFTSQNG  516



>ref|XP_006449955.1| hypothetical protein CICLE_v10018215mg [Citrus clementina]
 gb|ESR63195.1| hypothetical protein CICLE_v10018215mg [Citrus clementina]
Length=515

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/521 (72%), Positives = 422/521 (81%), Gaps = 66/521 (13%)
 Frame = -1

Query  1953  PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANI  1774
             P     K+Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVG LANI
Sbjct  14    PRGSPAKEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGALANI  73

Query  1773  SDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMV  1594
             S+TETNI                         SLSPKPFFSNFGAIVTFAIFGTF+ASMV
Sbjct  74    SNTETNI-------------------------SLSPKPFFSNFGAIVTFAIFGTFLASMV  108

Query  1593  TGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVL  1414
             TG+LVY+GGV+ LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVL
Sbjct  109   TGILVYLGGVMFLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVL  168

Query  1413  NDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLD  1234
             NDA+ +    TMSLVRS+ SSGQNFFM+ VRF+ETF GSMSA +GV              
Sbjct  169   NDAIIM----TMSLVRSHASSGQNFFMVIVRFLETFVGSMSAVLGV--------------  210

Query  1233  IDNLQNLEC--CLFVLF-PYF-----------SYMLAEGLGLSGIVSILFTGIVMKRYTY  1096
                L  + C  CLF+LF P+F            YMLAEGLGLSGIVSILFTGIVMKRYT+
Sbjct  211   ---LLYIHCVFCLFILFWPFFMLWLVIVVYDKQYMLAEGLGLSGIVSILFTGIVMKRYTF  267

Query  1095  SNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAA  916
             SNLS++SQRFVS+FFHLISSLAETFVFIYMGFDIAME+HSW+H+GFIFFSIL I + RAA
Sbjct  268   SNLSENSQRFVSAFFHLISSLAETFVFIYMGFDIAMEKHSWSHLGFIFFSILCINLCRAA  327

Query  915   NVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftat  736
             NVF CAYLVNL RPA+R+IP KHQ+ALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTAT
Sbjct  328   NVFSCAYLVNLARPAHRQIPLKHQQALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTAT  387

Query  735   taivvltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSG  556
             TAIVVLTVL+IGGSTGTMLEAL VVGD +D     G LGE  EG+NGY AP YDE S+SG
Sbjct  388   TAIVVLTVLLIGGSTGTMLEALQVVGDAHD-----GHLGENFEGNNGYAAP-YDEGSTSG  441

Query  555   SRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQEE  433
             ++ KMKLKEF KS +SFTA+D+NYLTPFFT+ NGDE+++E+
Sbjct  442   NKLKMKLKEFRKSAASFTALDKNYLTPFFTSHNGDEEDEED  482



>gb|KDP27356.1| hypothetical protein JCGZ_20180 [Jatropha curcas]
Length=498

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/457 (79%), Positives = 393/457 (86%), Gaps = 39/457 (9%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS+TE 
Sbjct  20    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANISNTEN  79

Query  1758  NIRAW-FNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVL  1582
             NI     +F+ E             SGFSLSPKPFFSNFGAIVTFAIFGTFIAS+VTGVL
Sbjct  80    NISFLDISFYTE-------------SGFSLSPKPFFSNFGAIVTFAIFGTFIASVVTGVL  126

Query  1581  VYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAM  1402
             VY+GGV+ LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLNDAM
Sbjct  127   VYLGGVMYLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAM  186

Query  1401  AISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFI---------------  1267
             AISLYRTMSLV+S+  SG NFFM+ VRF+ETF GSMSAG+ V  +               
Sbjct  187   AISLYRTMSLVKSHAPSGSNFFMLIVRFLETFVGSMSAGLWVDVVEKSCIVLIILCFNIF  246

Query  1266  ----------SALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGI  1117
                       S  LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTG+
Sbjct  247   ISLAKQYCLNSENLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGM  306

Query  1116  VMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilf  937
             VMK YTYSNLS+ SQRFVS+FFHLISSLAETFVFIYMGFDIAMEQHSW+HVGFIFFSI+F
Sbjct  307   VMKHYTYSNLSEKSQRFVSAFFHLISSLAETFVFIYMGFDIAMEQHSWSHVGFIFFSIIF  366

Query  936   igIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHG  757
             IG+ARAAN+F CAYLVNLVRPA+RKIP  HQKALWYSGLRGAMAFALALQS+HDLPEGHG
Sbjct  367   IGVARAANIFSCAYLVNLVRPAHRKIPLNHQKALWYSGLRGAMAFALALQSIHDLPEGHG  426

Query  756   QtiftattaivvltvliIGGSTGTMLEALDVVGDDYD  646
             QTIFTATTAIVVLTVL+IGGSTGTMLEAL V+GD ++
Sbjct  427   QTIFTATTAIVVLTVLLIGGSTGTMLEALQVIGDGHE  463



>dbj|BAK05820.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=528

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/499 (72%), Positives = 424/499 (85%), Gaps = 25/499 (5%)
 Frame = -1

Query  1932  DQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETNI  1753
             +Q+AAGVGILLQI MLVLSF+LGH+LRR +FYYLPEASASLLIG+IVGG ANIS+T+ + 
Sbjct  25    EQQAAGVGILLQISMLVLSFVLGHLLRRRKFYYLPEASASLLIGMIVGGFANISNTQKST  84

Query  1752  RAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYI  1573
             R WFNF E+FF LFLLPPIIFQSGF+L+PKPFFSNFGAI+TFAI GTFIAS+VTG+LVY+
Sbjct  85    RRWFNFREDFFLLFLLPPIIFQSGFNLAPKPFFSNFGAIITFAILGTFIASIVTGLLVYL  144

Query  1572  GGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAIS  1393
              G+I ++Y+LP +EC+MFG+L+SATDPVTVLSIFQELGTDVNLYALVFGESVLNDA+AIS
Sbjct  145   AGLIFIIYRLPLVECMMFGALVSATDPVTVLSIFQELGTDVNLYALVFGESVLNDAVAIS  204

Query  1392  LYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNL  1213
             LYRTM+ +R+ +SSGQN  ++ +RF+E F GSMS+G+GVG ISALLFKYA L ++NL NL
Sbjct  205   LYRTMASMRT-SSSGQNLLIVILRFLENFVGSMSSGIGVGLISALLFKYAELGVENLHNL  263

Query  1212  ECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSL  1033
             E CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYT+ NLS+ SQRF + FFHL+SSL
Sbjct  264   ESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTFYNLSEDSQRFTARFFHLLSSL  323

Query  1032  AETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPP  853
             AE F+FIYMGFDIAME+ SW+H+GFIFFSI+FI +ARAANVF CAY++NL RP + +IP 
Sbjct  324   AEAFIFIYMGFDIAMERQSWSHIGFIFFSIVFILVARAANVFSCAYILNLARPPHSQIPR  383

Query  852   KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEA  673
             ++Q ALWYSGLRGAMAFALALQSVHDLPEGHG+TIFTATT+IVVLTVL+IGGSTGTMLEA
Sbjct  384   EYQLALWYSGLRGAMAFALALQSVHDLPEGHGETIFTATTSIVVLTVLLIGGSTGTMLEA  443

Query  672   LDVVGDDYDsslgtgtlgerlegSNGYIAP-------SYDEESSSGSRFKMKLKEFHKST  514
             L VVGD                  N Y  P       S +E + S ++F++KL+E  +ST
Sbjct  444   LQVVGDS-----------------NRYRHPYEENFEGSSEEGTPSKNKFQLKLRELRRST  486

Query  513   SSFTAIDRNYLTPFFTTQN  457
             SSF  +DRNYLTP FT+Q+
Sbjct  487   SSFALLDRNYLTPIFTSQH  505



>ref|XP_003576666.2| PREDICTED: sodium/hydrogen exchanger 6-like [Brachypodium distachyon]
Length=528

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/502 (71%), Positives = 425/502 (85%), Gaps = 28/502 (6%)
 Frame = -1

Query  1932  DQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETNI  1753
             +Q+AAGVGILLQI MLVLSF+LGH+LRR +FYYLPEASASLLIG++VG  ANIS+T+ + 
Sbjct  25    EQQAAGVGILLQISMLVLSFVLGHLLRRRKFYYLPEASASLLIGMVVGAFANISNTQKST  84

Query  1752  RAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYI  1573
             R WFNF E+FF LFLLPPIIFQSGF+L+PKPFFSNFGAI+TFAI GTFIAS+VTG+LVY+
Sbjct  85    RRWFNFREDFFLLFLLPPIIFQSGFNLAPKPFFSNFGAIITFAILGTFIASIVTGLLVYL  144

Query  1572  GGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAIS  1393
             GG+I ++Y+LP +EC+MFG+L+SATDPVTVLSIFQELGTDVNLYALVFGESVLNDA+AIS
Sbjct  145   GGLIYIIYRLPLVECMMFGALVSATDPVTVLSIFQELGTDVNLYALVFGESVLNDAVAIS  204

Query  1392  LYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNL  1213
             LYRTM+ +R+N SSGQNF ++ +RF+E F GSMS+G+GVG ISALLFKYA L ++NL N 
Sbjct  205   LYRTMASMRTN-SSGQNFLLVILRFLENFVGSMSSGIGVGLISALLFKYAELGVENLHNH  263

Query  1212  ECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSL  1033
             E CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYT+ NLS+ SQRF + FFHL+SSL
Sbjct  264   ESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTFYNLSEDSQRFTAHFFHLLSSL  323

Query  1032  AETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPP  853
             AE F+FIYMGFDIAME  SW+H+GFIFFS++FI IARAANVF CAY++NL RP + +IP 
Sbjct  324   AEAFIFIYMGFDIAMEPQSWSHIGFIFFSVVFILIARAANVFSCAYILNLARPPHSQIPR  383

Query  852   KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEA  673
             ++Q ALWYSGLRGAMAFALALQSVHDLPEGHG+TIFTATT+IVVLTVL+IGGSTGTMLEA
Sbjct  384   QYQLALWYSGLRGAMAFALALQSVHDLPEGHGETIFTATTSIVVLTVLLIGGSTGTMLEA  443

Query  672   LDVVGDDYDsslgtgtlgerlegSNGYIAP----------SYDEESSSGSRFKMKLKEFH  523
             L VVGD                  N Y  P          +Y+E +S+ S+F++KL++  
Sbjct  444   LQVVGDS-----------------NRYRHPYEENFDGNNAAYEEGTSTPSKFQLKLRDLR  486

Query  522   KSTSSFTAIDRNYLTPFFTTQN  457
             +STSSF  +DRNYLTP FT+Q+
Sbjct  487   RSTSSFALLDRNYLTPIFTSQH  508



>ref|XP_008650841.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=541

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/507 (71%), Positives = 433/507 (85%), Gaps = 7/507 (1%)
 Frame = -1

Query  1932  DQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETNI  1753
             +++AAGVGILLQI MLVLSF+LGH+LRR +FYY+PEAS SLLIG+IVGGLANIS+T+ +I
Sbjct  23    EEQAAGVGILLQISMLVLSFVLGHILRRRKFYYIPEASGSLLIGMIVGGLANISNTQKSI  82

Query  1752  RAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYI  1573
             R WFNF E+FF LFLLPPIIFQSGFSL+PKPFFSNF AI+TFAI GTFIAS+VTG+LVY+
Sbjct  83    RRWFNFREDFFLLFLLPPIIFQSGFSLAPKPFFSNFDAIITFAILGTFIASIVTGLLVYL  142

Query  1572  GGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAIS  1393
             GG++ ++Y+LP +EC+MFG+L+SATDPVTVLSIFQELGTD NLYALVFGESVLNDA+AIS
Sbjct  143   GGLLYIVYRLPLVECMMFGALVSATDPVTVLSIFQELGTDTNLYALVFGESVLNDAVAIS  202

Query  1392  LYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNL  1213
             LYR+M+ +R++  SG+NFF++ +RF+E F GSMS+G+GVG ISALLFKYA L ++NL NL
Sbjct  203   LYRSMASMRTH-HSGKNFFLVILRFLENFVGSMSSGIGVGLISALLFKYAALGVENLHNL  261

Query  1212  ECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSL  1033
             E CLFVLFPYFSYMLAEG+GLSGI+SILFTGIVMKRYT+SNLSD SQRF + FFHL+SSL
Sbjct  262   ESCLFVLFPYFSYMLAEGIGLSGIISILFTGIVMKRYTFSNLSDDSQRFTARFFHLLSSL  321

Query  1032  AETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPP  853
             AE FVFIYMGFDIA+E+ SW+H+GFIFFSI+FI +ARAANVF CAY++NL RP + +IP 
Sbjct  322   AEAFVFIYMGFDIAIERQSWSHIGFIFFSIIFILVARAANVFSCAYILNLARPPHCQIPR  381

Query  852   KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEA  673
             ++Q+ALWYSGLRGAMAFALALQSVHDLP+GHG+TIFTATT+IVVLTVL+IGGSTGTMLEA
Sbjct  382   QYQQALWYSGLRGAMAFALALQSVHDLPDGHGETIFTATTSIVVLTVLLIGGSTGTMLEA  441

Query  672   LDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAID  493
             L VVGD                   GY   +YDE +S+ S+F+ KL++  +STSSF  +D
Sbjct  442   LQVVGDSNRYCQLYELQESSNGNDTGYTGQNYDEGASTSSKFRSKLRDLRRSTSSFALLD  501

Query  492   RNYLTPFFTTQNGD------EDEQEEL  430
             RNYLTP FT+QNGD      E   EEL
Sbjct  502   RNYLTPIFTSQNGDCNDNTTESPNEEL  528



>ref|XP_011040074.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X2 [Populus 
euphratica]
Length=440

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/428 (82%), Positives = 394/428 (92%), Gaps = 7/428 (2%)
 Frame = -1

Query  1671  SPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDP  1492
             S KPFFSNFGAIVTFA+ GTFIAS+VTGVLVY+GG+I L Y+LPF+ECLMFG+LISATDP
Sbjct  19    SLKPFFSNFGAIVTFALLGTFIASVVTGVLVYLGGLIYLTYRLPFVECLMFGALISATDP  78

Query  1491  VTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIE  1312
             VTVLSIFQELG D NLYALVFGESVLNDAMAISLYRTMS ++S+ + GQNFFM+  RF+E
Sbjct  79    VTVLSIFQELGIDTNLYALVFGESVLNDAMAISLYRTMSSLKSH-APGQNFFMVIFRFLE  137

Query  1311  TFFGSMSAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSI  1132
             TF GS+SAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGL+GIVSI
Sbjct  138   TFVGSLSAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLTGIVSI  197

Query  1131  LFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfif  952
             LFTGIVMK YTYSNLS++SQRFVS+FFHLISSLAETFVFIYMGFDIAMEQHSW+HVGFIF
Sbjct  198   LFTGIVMKHYTYSNLSENSQRFVSAFFHLISSLAETFVFIYMGFDIAMEQHSWSHVGFIF  257

Query  951   fsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL  772
             FSI+FIG+ARAANVF CAYLVNLVRPA R+IP KHQKALWYSGLRGAMAFALALQSVHDL
Sbjct  258   FSIIFIGVARAANVFSCAYLVNLVRPAPRQIPVKHQKALWYSGLRGAMAFALALQSVHDL  317

Query  771   PEGHGQtiftattaivvltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGY  592
             PEGHGQTIFTATTAIVVLTVL+IGGSTGT+LEAL VVGDD+D     G L E L+G+NGY
Sbjct  318   PEGHGQTIFTATTAIVVLTVLLIGGSTGTVLEALQVVGDDHD-----GPLSESLDGNNGY  372

Query  591   IAPSYDEESSSGSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQNG-DEDEQEELISNSR  415
             +APSY+E+++SG+R KMKLKEFHKST+SFTA+DRNYLTPFFT+QNG DE+E ++ + +SR
Sbjct  373   VAPSYNEDATSGNRLKMKLKEFHKSTASFTALDRNYLTPFFTSQNGDDEEEHDDPMPSSR  432

Query  414   RARYSGHS  391
                + GH+
Sbjct  433   GRGFLGHN  440



>ref|XP_008650843.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=539

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/507 (71%), Positives = 434/507 (86%), Gaps = 9/507 (2%)
 Frame = -1

Query  1932  DQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETNI  1753
             +++AAGVGILLQI MLVLSF+LGH+LRR +FYY+PEAS SLLIG+IVGGLANIS+T+ +I
Sbjct  23    EEQAAGVGILLQISMLVLSFVLGHILRRRKFYYIPEASGSLLIGMIVGGLANISNTQKSI  82

Query  1752  RAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYI  1573
             R WFNF E+FF LFLLPPIIFQSGFSL+PKPFFSNF AI+TFAI GTFIAS+VTG+LVY+
Sbjct  83    RRWFNFREDFFLLFLLPPIIFQSGFSLAPKPFFSNFDAIITFAILGTFIASIVTGLLVYL  142

Query  1572  GGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAIS  1393
             GG++ ++Y+LP +EC+MFG+L+SATDPVTVLSIFQELGTD NLYALVFGESVLNDA+AIS
Sbjct  143   GGLLYIVYRLPLVECMMFGALVSATDPVTVLSIFQELGTDTNLYALVFGESVLNDAVAIS  202

Query  1392  LYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNL  1213
             LYR+M+ +R++  SG+NFF++ +RF+E F GSMS+G+GVG ISALLFKYA L ++NL NL
Sbjct  203   LYRSMASMRTH-HSGKNFFLVILRFLENFVGSMSSGIGVGLISALLFKYAALGVENLHNL  261

Query  1212  ECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSL  1033
             E CLFVLFPYFSYMLAEG+GLSGI+SILFTGIVMKRYT+SNLSD SQRF + FFHL+SSL
Sbjct  262   ESCLFVLFPYFSYMLAEGIGLSGIISILFTGIVMKRYTFSNLSDDSQRFTARFFHLLSSL  321

Query  1032  AETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPP  853
             AE FVFIYMGFDIA+E+ SW+H+GFIFFSI+FI +ARAANVF CAY++NL RP + +IP 
Sbjct  322   AEAFVFIYMGFDIAIERQSWSHIGFIFFSIIFILVARAANVFSCAYILNLARPPHCQIPR  381

Query  852   KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEA  673
             ++Q+ALWYSGLRGAMAFALALQSVHDLP+GHG+TIFTATT+IVVLTVL+IGGSTGTMLEA
Sbjct  382   QYQQALWYSGLRGAMAFALALQSVHDLPDGHGETIFTATTSIVVLTVLLIGGSTGTMLEA  441

Query  672   LDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAID  493
             L VVGD   +               GY   +YDE +S+ S+F+ KL++  +STSSF  +D
Sbjct  442   LQVVGD--SNRYCQLYEESSNGNDTGYTGQNYDEGASTSSKFRSKLRDLRRSTSSFALLD  499

Query  492   RNYLTPFFTTQNGD------EDEQEEL  430
             RNYLTP FT+QNGD      E   EEL
Sbjct  500   RNYLTPIFTSQNGDCNDNTTESPNEEL  526



>ref|XP_006392550.1| hypothetical protein EUTSA_v10011392mg [Eutrema salsugineum]
 gb|ESQ29836.1| hypothetical protein EUTSA_v10011392mg [Eutrema salsugineum]
Length=425

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/418 (80%), Positives = 370/418 (89%), Gaps = 11/418 (3%)
 Frame = -1

Query  1671  SPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDP  1492
             S KPFFSNFGAIVTFAI GTF+AS+VTG LVY+GG + LMYKLPF+ECLMFG+LISATDP
Sbjct  12    SQKPFFSNFGAIVTFAIIGTFVASVVTGGLVYLGGSMYLMYKLPFVECLMFGALISATDP  71

Query  1491  VTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIE  1312
             VTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLV   +S+G++F M+ +RF+E
Sbjct  72    VTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLVNRQSSTGEHFLMVVIRFLE  131

Query  1311  TFFGSMSAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSI  1132
             TF GSMSAGVGVGF SALLFKYAGLD +NLQNLECCLFVLFPYFSYMLAEG+GLSGIVSI
Sbjct  132   TFAGSMSAGVGVGFTSALLFKYAGLDTENLQNLECCLFVLFPYFSYMLAEGVGLSGIVSI  191

Query  1131  LFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfif  952
             LFTGIVMKRYT+SNLS++SQ FVS+FFHLISSLAETF FIYMGFDIAMEQHSW+HVGFI 
Sbjct  192   LFTGIVMKRYTFSNLSEASQSFVSAFFHLISSLAETFTFIYMGFDIAMEQHSWSHVGFIL  251

Query  951   fsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL  772
             FSILFIG+ARA NVFGCAYLVNLVR  N+KIP KHQKALWYSGLRGAMAFALALQS+HDL
Sbjct  252   FSILFIGVARAVNVFGCAYLVNLVRQENQKIPMKHQKALWYSGLRGAMAFALALQSLHDL  311

Query  771   PEGHGQtiftattaivvltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGY  592
             PEGHGQ IFTATT IVV+TVL+IGGSTG MLEAL+VVGDD+D S+  G           Y
Sbjct  312   PEGHGQIIFTATTTIVVVTVLLIGGSTGKMLEALEVVGDDHDDSMSEGFEESNPR----Y  367

Query  591   IAP------SYDEE-SSSGSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQ  439
             I P      S DEE SSSGSRFKMKLKEFHKST+SFTA+D+N+LTPFFTT NGD +E+
Sbjct  368   IPPPFSIGASSDEETSSSGSRFKMKLKEFHKSTTSFTALDKNFLTPFFTTNNGDGEEE  425



>ref|XP_004959564.1| PREDICTED: sodium/hydrogen exchanger 6-like [Setaria italica]
Length=494

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/476 (72%), Positives = 412/476 (87%), Gaps = 3/476 (1%)
 Frame = -1

Query  1947  PRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISD  1768
             P T ++Q+AAGVGILLQI MLVLSF+LGHVLRR +FYYLPEAS SLLIG+IVGGLANIS+
Sbjct  21    PGTVEEQQAAGVGILLQISMLVLSFVLGHVLRRRKFYYLPEASGSLLIGMIVGGLANISN  80

Query  1767  TETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTG  1588
             T+ + R WFNF E+FF LFLLPPIIFQSGFSL+PKPFFSNFGAI+TFAI GTFIAS+VTG
Sbjct  81    TQKSTRRWFNFREDFFLLFLLPPIIFQSGFSLAPKPFFSNFGAIITFAIIGTFIASIVTG  140

Query  1587  VLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLND  1408
             +LVY+GG++ ++Y+LP +EC+MFG+L+SATDPVTVLSIFQELGTD NLYALVFGESVLND
Sbjct  141   LLVYLGGLLYIIYRLPLVECMMFGALVSATDPVTVLSIFQELGTDTNLYALVFGESVLND  200

Query  1407  AMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDID  1228
             A+AISLYRTM+ +R++  SGQNFF++ +RF+E F GSMS+G+GVG IS+ LFKYA L ++
Sbjct  201   AVAISLYRTMATMRTH-PSGQNFFLVILRFLENFVGSMSSGIGVGLISSNLFKYAALGVE  259

Query  1227  NLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFH  1048
             NL NLE CLFVLFPYFSYMLAEG+GLSGIVSILFTGIVMKRYT+SNLS+ SQRF + FFH
Sbjct  260   NLHNLESCLFVLFPYFSYMLAEGIGLSGIVSILFTGIVMKRYTFSNLSEDSQRFTARFFH  319

Query  1047  LISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPAN  868
             L+SSLAE FVFIYMGFDIAME+ SW+H+GFIFFSI+FI +ARAANVF CAY++NL RP +
Sbjct  320   LLSSLAEAFVFIYMGFDIAMERQSWSHIGFIFFSIIFILLARAANVFSCAYILNLARPPH  379

Query  867   RKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTG  688
              +IP ++Q+ALWYSGLRGAMAFALALQSVHDLP+GHG+TIFTATT+IVVLTVL+IGGSTG
Sbjct  380   CQIPRQYQQALWYSGLRGAMAFALALQSVHDLPDGHGETIFTATTSIVVLTVLLIGGSTG  439

Query  687   TMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHK  520
             TMLEAL VVGD   +               GY+  +YDE  S+ S+FK KL++  +
Sbjct  440   TMLEALKVVGD--SNRYHQLYEENSDGNDPGYMGQNYDEGPSTSSKFKSKLRDLRR  493



>gb|KHN40217.1| Sodium/hydrogen exchanger 6 [Glycine soja]
Length=445

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/501 (66%), Positives = 376/501 (75%), Gaps = 81/501 (16%)
 Frame = -1

Query  1941  TGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTE  1762
             + + Q+AAGVGILLQIMMLVLSF+LGHVLRR + Y LPEASASLLIGL+VG LANIS T+
Sbjct  7     SKEQQQAAGVGILLQIMMLVLSFVLGHVLRRKKIYVLPEASASLLIGLLVGTLANISHTQ  66

Query  1761  TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVL  1582
             T+I   F+                 + F    KPFF+NFGAIVTFAIFGTF+AS+VTGVL
Sbjct  67    TSISPAFSL----------------ASFWSFQKPFFANFGAIVTFAIFGTFLASIVTGVL  110

Query  1581  VYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAM  1402
             VY+GG++ LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAM
Sbjct  111   VYLGGLMYLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAM  170

Query  1401  AISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNL  1222
             AISLYRTMS+V+S+  SGQNFFM+ VRF+ETF GSMS+G                     
Sbjct  171   AISLYRTMSVVKSH-PSGQNFFMVIVRFLETFVGSMSSGW--------------------  209

Query  1221  QNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLI  1042
                            YMLAEGLGLSGIVSILFTG+VMK YTYSNLS SSQRFVS+FF LI
Sbjct  210   ---------------YMLAEGLGLSGIVSILFTGMVMKHYTYSNLSRSSQRFVSAFFELI  254

Query  1041  SSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRK  862
             SSLAETFVFIYMGFDIAME+HSW+HVGFIFFSI+FIGIARAANVF CAYLVNL+RPA R+
Sbjct  255   SSLAETFVFIYMGFDIAMEKHSWSHVGFIFFSIIFIGIARAANVFSCAYLVNLIRPAYRQ  314

Query  861   IPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTM  682
             IPPKHQKALWYSGLRGAMAFALALQS+HDLPEGHGQTI                  T T 
Sbjct  315   IPPKHQKALWYSGLRGAMAFALALQSIHDLPEGHGQTIL-----------------TATT  357

Query  681   LEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFT  502
                +  VG           +    EG+N YI+P  DEE SSG++ KMKL+EF +S +SFT
Sbjct  358   AIVVLTVG-----------MLMNFEGNNVYISPD-DEEPSSGNKIKMKLQEFQRSAASFT  405

Query  501   AIDRNYLTPFFTTQNGDEDEQ  439
             AID+NYLTPFFT+QNGDE+++
Sbjct  406   AIDKNYLTPFFTSQNGDEEDE  426



>gb|ADM13397.1| Na+/K+/H+ antiporter [Physcomitrella patens]
Length=533

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/526 (65%), Positives = 405/526 (77%), Gaps = 16/526 (3%)
 Frame = -1

Query  1956  LPPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLAN  1777
             LP P +   Q+ A   ILLQI+ML L+F+LGHVLRRH+ YY+ EASASLL+GL VG +AN
Sbjct  12    LPQPGSSDQQQIASASILLQIVMLGLAFVLGHVLRRHKIYYINEASASLLLGLFVGFVAN  71

Query  1776  ISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASM  1597
             +S+TE + R WFNFHEEFF LFLLPPIIF+SGFSL PKPFFSNFGAI TFAI GTFI S+
Sbjct  72    VSNTEAHFRQWFNFHEEFFLLFLLPPIIFESGFSLQPKPFFSNFGAICTFAILGTFITSI  131

Query  1596  VTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESV  1417
             VTG+LVY+GG+  LMY+LPF E +M+G+LISATDPV+VL+IFQELGTDVNLYALVFGESV
Sbjct  132   VTGILVYLGGLFFLMYRLPFHESIMYGALISATDPVSVLAIFQELGTDVNLYALVFGESV  191

Query  1416  LNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGL  1237
             LNDA+AISLYRT+  V+++             F+E F GS+S+GVGV  I ALLFKY+GL
Sbjct  192   LNDAVAISLYRTLLAVKNHPLETHGLMSAIWSFLEIFVGSLSSGVGVALICALLFKYSGL  251

Query  1236  DIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSS  1057
              +  LQNLECCL VLFPYFSYMLAEGLGLSGIV+ILF GI+MK YT+ NLS+ +Q F S 
Sbjct  252   AVHGLQNLECCLVVLFPYFSYMLAEGLGLSGIVAILFCGILMKHYTFPNLSEGAQAFTSG  311

Query  1056  FFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVR  877
             FF LISSLAETFVFIYMG DIA++ HSW+HVGFIFFSI+FI IARAANVF CA LVN++R
Sbjct  312   FFQLISSLAETFVFIYMGMDIAIKSHSWSHVGFIFFSIVFIVIARAANVFPCARLVNMLR  371

Query  876   PANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGG  697
             PA+R+IP  HQKALW+SGLRGAMAFALALQ+VHDLP  HG  IFTATTAIVVLTVL+IGG
Sbjct  372   PASRQIPINHQKALWFSGLRGAMAFALALQAVHDLPNNHGGIIFTATTAIVVLTVLVIGG  431

Query  696   STGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM---KLKEF  526
             ST TMLE L+VVGD +          E +EG    +  SYD E  +     +   K +E 
Sbjct  432   STSTMLEKLEVVGDAHGHESLPEGDEEEMEG----LTTSYDNEHGNPDSVDLLTQKFQEL  487

Query  525   HKSTSSFTAIDRNYLTPFFTTQNGDEDE---------QEELISNSR  415
              +ST++FTAID N+L PFFT ++   +          +E LISN R
Sbjct  488   RRSTATFTAIDNNFLKPFFTKEDRRRNSTDQAPNGRLREGLISNPR  533



>ref|XP_009385533.1| PREDICTED: sodium/hydrogen exchanger 6-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=382

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/384 (79%), Positives = 342/384 (89%), Gaps = 6/384 (2%)
 Frame = -1

Query  1554  MYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMS  1375
             MYKLP +ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMS
Sbjct  1     MYKLPLVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMS  60

Query  1374  LVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNLECCLFV  1195
              V+S+ SSGQNFF+I VRF+ETF GSMS+GVGVGFISALLFKYAGLDIDNLQNLECCLFV
Sbjct  61    SVQSHASSGQNFFLIVVRFLETFVGSMSSGVGVGFISALLFKYAGLDIDNLQNLECCLFV  120

Query  1194  LFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVF  1015
             LFPYFSYMLAEGLGLSGIVSILFTGIVMK YT+SNLS+ SQ F ++FFHLISSLAETFVF
Sbjct  121   LFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTFSNLSEKSQHFAAAFFHLISSLAETFVF  180

Query  1014  IYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKAL  835
             IYMGFDIAMEQH W+H+GFIFFSI+FIG+ARAA+V+ CA LVN+ RP +R+IP KHQKAL
Sbjct  181   IYMGFDIAMEQHRWSHLGFIFFSIIFIGVARAAHVYVCANLVNMARPTSRQIPLKHQKAL  240

Query  834   WYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALDVVGD  655
             WYSGLRGAMAFALALQSVHDLPE HG+TIFTATTAI+VLTV+++GGSTGTMLEAL+VVGD
Sbjct  241   WYSGLRGAMAFALALQSVHDLPEAHGKTIFTATTAIIVLTVILVGGSTGTMLEALEVVGD  300

Query  654   DYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAIDRNYLTP  475
               D         E +E +NGYIAPSY E +SSGS  KM+LKEFHKST+SFTA+D+NYLTP
Sbjct  301   GQD------GALETIESNNGYIAPSYQEGTSSGSNLKMRLKEFHKSTTSFTALDKNYLTP  354

Query  474   FFTTQNGDEDEQEELISNSRRARY  403
             FFT+QN +ED  +E +    R R+
Sbjct  355   FFTSQNEEEDVSDESMRTPSRGRF  378



>gb|KHN40748.1| Sodium/hydrogen exchanger 6 [Glycine soja]
Length=459

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/388 (79%), Positives = 339/388 (87%), Gaps = 19/388 (5%)
 Frame = -1

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG++ LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  80    YLGGLLFLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  139

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMS VR++  SGQN FM+ VRF+ETF GSMSAG               LDIDNLQ
Sbjct  140   ISLYRTMSSVRAD-PSGQNLFMVVVRFLETFVGSMSAG---------------LDIDNLQ  183

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLE CLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YTYSNLS SSQRF S+FF LIS
Sbjct  184   NLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTYSNLSQSSQRFASAFFELIS  243

Query  1038  SLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKI  859
             SLAETFVFIYMGFDIAMEQHSW+HVGFIFFSI+FIGIARA NVF CAYLVNLVRP +RKI
Sbjct  244   SLAETFVFIYMGFDIAMEQHSWSHVGFIFFSIIFIGIARATNVFSCAYLVNLVRPTHRKI  303

Query  858   PPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
             PPKHQKALWYSGLRGAMAFALALQS+HDLPEGHGQTIFTATTAIVVLTVL+IGGSTG+ML
Sbjct  304   PPKHQKALWYSGLRGAMAFALALQSIHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGSML  363

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTA  499
             EALDVVG D D         E  +G+NGYIAP Y+EESSSG++ KMKLKEFHK+ +SFTA
Sbjct  364   EALDVVGGDND---SPLASVELDDGNNGYIAPPYNEESSSGNKIKMKLKEFHKTAASFTA  420

Query  498   IDRNYLTPFFTTQNGDEDEQEELISNSR  415
             +D+NYLTPFFT+QNGDED++ E  +++R
Sbjct  421   LDKNYLTPFFTSQNGDEDDEAEPFTSTR  448


 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRR + Y +PEASASLLIGLIVG LANISDTET
Sbjct  17    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRKKVYIIPEASASLLIGLIVGILANISDTET  76

Query  1758  NI  1753
             +I
Sbjct  77    SI  78



>gb|AFK34247.1| unknown [Lotus japonicus]
Length=387

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/371 (83%), Positives = 329/371 (89%), Gaps = 11/371 (3%)
 Frame = -1

Query  1524  MFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLVRSNTSSGQ  1345
             MFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLV+++ S GQ
Sbjct  1     MFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLVKTHPS-GQ  59

Query  1344  NFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLA  1165
             N FM+ VRF+ETF GSMSAGVGVGFIS+LLFKYAGLDID+LQNLE CLFVLFPYFSYMLA
Sbjct  60    NIFMVIVRFLETFVGSMSAGVGVGFISSLLFKYAGLDIDSLQNLESCLFVLFPYFSYMLA  119

Query  1164  EGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAME  985
             EGLGLSGIVSILFTGIVMK Y YSNLS SSQRFVS+FF LISSLAETFVF+YMGFDIAME
Sbjct  120   EGLGLSGIVSILFTGIVMKHYAYSNLSQSSQRFVSAFFELISSLAETFVFVYMGFDIAME  179

Query  984   QHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMA  805
             QHSW+H+GFIFFSI+FIGIARAANVF CAYLVNL RPA+RKIP KHQKALWYSGLRGAMA
Sbjct  180   QHSWSHIGFIFFSIIFIGIARAANVFSCAYLVNLARPAHRKIPVKHQKALWYSGLRGAMA  239

Query  804   FALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALDVVGDD---------  652
             FALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTMLEALDVVG D         
Sbjct  240   FALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTMLEALDVVGGDSPNGSPLAS  299

Query  651   YDsslgtgtlgerlegSNGYIAPSYDEE-SSSGSRFKMKLKEFHKSTSSFTAIDRNYLTP  475
               S   +        G+ GY+APSYDEE SSSG++ KMKLKEFHKS  SFTA+DRNYLTP
Sbjct  300   IGSVPASFATNNVYAGNIGYVAPSYDEESSSSGNKIKMKLKEFHKSAGSFTALDRNYLTP  359

Query  474   FFTTQNGDEDE  442
             FFT+QNGDE E
Sbjct  360   FFTSQNGDEAE  370



>ref|XP_002967169.1| hypothetical protein SELMODRAFT_144857 [Selaginella moellendorffii]
 gb|EFJ31768.1| hypothetical protein SELMODRAFT_144857 [Selaginella moellendorffii]
Length=547

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/511 (64%), Positives = 389/511 (76%), Gaps = 26/511 (5%)
 Frame = -1

Query  1965  EELLPPPRTGKDQ-RAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVG  1789
             EEL        +Q + AG+ +LLQI+ML  +F+LGHVLRRH+FYYL EASASLLIG+IVG
Sbjct  6     EELAMASEAAIEQHQVAGLSLLLQIVMLGFAFVLGHVLRRHKFYYLHEASASLLIGIIVG  65

Query  1788  GLANISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
             G+AN+S+ E + + WFNF+EEFFFLFLLPPIIFQSGF+L  KPFFSNFGAI  FAI GTF
Sbjct  66    GIANVSNKEMSFKRWFNFNEEFFFLFLLPPIIFQSGFNLYAKPFFSNFGAICVFAIVGTF  125

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             +ASMVTG+LV++GG+  LMYKL FLE L+FGSLISATDPVTVL+IFQELGTD+NLYALVF
Sbjct  126   VASMVTGILVFLGGLFFLMYKLSFLESLLFGSLISATDPVTVLAIFQELGTDMNLYALVF  185

Query  1428  GESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFK  1249
             GESVLNDAMAI+LY+T+     + S+  +F +    F++TF GSM  GV V    ALLFK
Sbjct  186   GESVLNDAMAIALYKTLMKFWHDPSANYSFTVAVSSFLQTFVGSMGTGVVVALCCALLFK  245

Query  1248  YAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQR  1069
             YAGL +++L NLECCLFVLFPYFS+MLAEGLGLSGI++ILF GI+MK Y + NLS+ +Q 
Sbjct  246   YAGLSVNSLHNLECCLFVLFPYFSFMLAEGLGLSGIIAILFCGILMKHYAFQNLSEPAQA  305

Query  1068  FVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLV  889
             F   FF LISSLAETF+FIYMG DIA E H+W+HVGFIFFSI+FI  ARAANVF CAYL+
Sbjct  306   FTRGFFQLISSLAETFLFIYMGLDIATESHTWSHVGFIFFSIVFILAARAANVFPCAYLI  365

Query  888   NLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLP-EGHGQtiftattaivvltv  712
             NL+RP  RKIP KHQKALW+SGLRGAMAF LALQS  DLP + +G+TIFT TTAIVV+TV
Sbjct  366   NLIRPVARKIPLKHQKALWFSGLRGAMAFGLALQSKRDLPTKSNGETIFTTTTAIVVVTV  425

Query  711   liIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEE--SSSGSRFKMK  538
             L IGGST TMLE L+VVGDDY                N  I    + E  S + SR+   
Sbjct  426   LFIGGSTSTMLEKLEVVGDDY-------------AALNVEIGNDNNLELHSPTSSRYL--  470

Query  537   LKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
                    TS FTA D+N+L P FT+   DED
Sbjct  471   -------TSPFTAFDKNFLKPIFTSHVDDED  494



>gb|KHG23559.1| Sodium/hydrogen exchanger 6 -like protein [Gossypium arboreum]
Length=407

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/410 (74%), Positives = 337/410 (82%), Gaps = 27/410 (7%)
 Frame = -1

Query  1557  LMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTM  1378
             LMY LPF+ECLMFG+LISATDPVTVLSIFQELGTD NLYALVFGESVLNDAMAISLYRTM
Sbjct  3     LMYGLPFVECLMFGALISATDPVTVLSIFQELGTDTNLYALVFGESVLNDAMAISLYRTM  62

Query  1377  SLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFI------------------SALLF  1252
             S+VR + SS QNFFM+  RF+ETF GSMSA     F+                  S  LF
Sbjct  63    SIVRKHASSAQNFFMVIFRFLETFVGSMSAEKEHCFLMLHHASEYMLLLLPLNLNSKNLF  122

Query  1251  KYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQ  1072
             KYAGLD+DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFT IVMK Y+YSNLS++SQ
Sbjct  123   KYAGLDVDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTAIVMKHYSYSNLSENSQ  182

Query  1071  RFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYL  892
             +FVS FFHLISSLAETF FIYMGFDIAME+HSW+H+GFIFFSI+FI +ARAANVF CAYL
Sbjct  183   QFVSDFFHLISSLAETFTFIYMGFDIAMEKHSWSHLGFIFFSIIFIVVARAANVFSCAYL  242

Query  891   VNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltv  712
             VNLVRP NR+IP KHQKALWYSGLRGAMAFALALQSVHDLPEG GQ IFTATTAIVVL+V
Sbjct  243   VNLVRPVNRQIPLKHQKALWYSGLRGAMAFALALQSVHDLPEGRGQIIFTATTAIVVLSV  302

Query  711   liIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLK  532
             L+IGGSTGTMLEAL VVGD +D       LGE  + +NGY+APS+ E+ +SG+  KMKLK
Sbjct  303   LLIGGSTGTMLEALHVVGDGHD-----SHLGESFDVNNGYVAPSFKEDGTSGNGIKMKLK  357

Query  531   EFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQEEL----ISNSRRARYSGH  394
             EFHK TSSFTA+DRNYLTPFFT QN D++  E L    IS+S+R  + G 
Sbjct  358   EFHKRTSSFTALDRNYLTPFFTGQNEDDEGGEALLDERISSSKRGGFLGQ  407



>ref|XP_002960845.1| hypothetical protein SELMODRAFT_163708 [Selaginella moellendorffii]
 gb|EFJ38384.1| hypothetical protein SELMODRAFT_163708 [Selaginella moellendorffii]
Length=487

 Score =   529 bits (1362),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 308/441 (70%), Positives = 363/441 (82%), Gaps = 2/441 (0%)
 Frame = -1

Query  1965  EELLPPPRTGKDQ-RAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVG  1789
             EEL        +Q + AG+ +LLQI+ML  +F+LGHVLRRH+FYYL EASASLLIG+IVG
Sbjct  6     EELAMASEAAIEQHQVAGLSLLLQIVMLGFAFVLGHVLRRHKFYYLHEASASLLIGIIVG  65

Query  1788  GLANISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
             G+AN+S+ E + + WFNF+EEFFFLFLLPPIIFQSGF+L  KPFFSNFGAI  FAI GTF
Sbjct  66    GIANVSNKEMSFKRWFNFNEEFFFLFLLPPIIFQSGFNLYAKPFFSNFGAICVFAIVGTF  125

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             +ASMVTG+LV++GG+  LMYKL FLE L+FGSLISATDPVTVL+IFQELGTD+NLYALVF
Sbjct  126   VASMVTGILVFLGGLFFLMYKLSFLESLLFGSLISATDPVTVLAIFQELGTDMNLYALVF  185

Query  1428  GESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFK  1249
             GESVLNDAMAI+LY+T+     + S+  +F +    F++TF GSM  GV V    ALLFK
Sbjct  186   GESVLNDAMAIALYKTLMKFWHDPSANYSFTVAVSSFLQTFVGSMGTGVVVALCCALLFK  245

Query  1248  YAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQR  1069
             YAGL +++L NLECCLFVLFPYFS+MLAEGLGLSGI++ILF GI+MK Y + NLS+ +Q 
Sbjct  246   YAGLSVNSLHNLECCLFVLFPYFSFMLAEGLGLSGIIAILFCGILMKHYAFQNLSEPAQA  305

Query  1068  FVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLV  889
             F   FF LISSLAETF+FIYMG DIA E H+W+HVGFIFFSI+FI  ARAANVF CAYL+
Sbjct  306   FTRGFFQLISSLAETFLFIYMGLDIATESHTWSHVGFIFFSIVFILAARAANVFPCAYLI  365

Query  888   NLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLP-EGHGQtiftattaivvltv  712
             NL+RP  RKIP KHQKALW+SGLRGAMAF LALQS  DLP + +G+TIFT TTAIVV+TV
Sbjct  366   NLIRPVARKIPLKHQKALWFSGLRGAMAFGLALQSKRDLPTKSNGETIFTTTTAIVVVTV  425

Query  711   liIGGSTGTMLEALDVVGDDY  649
             L IGGST TMLE L+VVGDDY
Sbjct  426   LFIGGSTSTMLEKLEVVGDDY  446



>emb|CAJ26377.1| sodium hydrogen sha-1 [Brachypodium sylvaticum]
Length=469

 Score =   520 bits (1338),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 301/454 (66%), Positives = 350/454 (77%), Gaps = 64/454 (14%)
 Frame = -1

Query  1932  DQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETNI  1753
             +Q+AAGVGILLQI MLVLSF+LGH+LRR +FYYLPEASASLLIG+IVG  ANIS+T+ + 
Sbjct  25    EQQAAGVGILLQISMLVLSFVLGHLLRRRKFYYLPEASASLLIGMIVGAFANISNTQKST  84

Query  1752  RAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVY-  1576
             R WFNF E+FF LFLLPP      + L  KPFFSNFGAI+TFAI GTFIAS+VTG+LVY 
Sbjct  85    RRWFNFREDFFLLFLLPP---IILYPLR-KPFFSNFGAIITFAILGTFIASIVTGLLVYY  140

Query  1575  IGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQ-------------------ELGTD  1453
             +GG+I ++Y+LP +EC+MFG+L+SATDPVTVLSIFQ                   ELGTD
Sbjct  141   LGGLIYIIYRLPLVECMMFGALVSATDPVTVLSIFQVSAIPLSTIILTFASSIIVELGTD  200

Query  1452  VNLYALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVG  1273
             VNLYALVFGESVLNDA+AISLYRTM+ +R+N SSGQNF ++ +RF+E F GSMS+G+GVG
Sbjct  201   VNLYALVFGESVLNDAVAISLYRTMASMRTN-SSGQNFLLVILRFLENFVGSMSSGIGVG  259

Query  1272  FISAL-------LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIV  1114
              ISAL       LFKYA L ++NL NLE CLFVLFPYFSYMLAEGLGLSGIVSILFTGIV
Sbjct  260   LISALISSTLFFLFKYAELGVENLHNLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGIV  319

Query  1113  MKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfi  934
             MKRYT+ NLS+ SQRF + FFHL+SSLAE F+                            
Sbjct  320   MKRYTFYNLSEDSQRFTARFFHLLSSLAEAFM----------------------------  351

Query  933   gIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQ  754
                 AANVF CAY++NL RP + +IP ++Q ALWYSGLRGAMAFALALQSVHDLPEGHG+
Sbjct  352   ----AANVFSCAYILNLARPPHSQIPRQYQLALWYSGLRGAMAFALALQSVHDLPEGHGE  407

Query  753   tiftattaivvltvliIGGSTGTMLEALDVVGDD  652
             TIFTATT+IVVLTVL+IGGSTGTMLEAL VVGD 
Sbjct  408   TIFTATTSIVVLTVLLIGGSTGTMLEALQVVGDS  441



>ref|XP_007212901.1| hypothetical protein PRUPE_ppa021856mg [Prunus persica]
 gb|EMJ14100.1| hypothetical protein PRUPE_ppa021856mg [Prunus persica]
Length=611

 Score =   509 bits (1312),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 272/341 (80%), Positives = 294/341 (86%), Gaps = 31/341 (9%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS+TET
Sbjct  16    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANISNTET  75

Query  1758  NIRAWFNFHEEffflfllppiiF----QSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             NIR WFNFHEEFFFLFLLPPII      SGFSLSPKPFFSNFGAIVTFAI GT I+S+VT
Sbjct  76    NIRTWFNFHEEFFFLFLLPPIILYPNFPSGFSLSPKPFFSNFGAIVTFAILGTLISSVVT  135

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G+LVY+GG+I L Y+LPF+ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLN
Sbjct  136   GILVYLGGLIYLTYRLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLN  195

Query  1410  DAM------------AISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFI  1267
             DA+                 +TMSLVRS+ SSGQNFFM+ VRF+ETF GSMSAG      
Sbjct  196   DAVNGNFLVQVCRVNCCCTQKTMSLVRSHASSGQNFFMVIVRFLETFVGSMSAG------  249

Query  1266  SALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNL  1087
                      LDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YTYSNL
Sbjct  250   ---------LDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTYSNL  300

Query  1086  SDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHV  964
             S++SQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSW+HV
Sbjct  301   SENSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWSHV  341


 Score =   238 bits (606),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 167/325 (51%), Positives = 208/325 (64%), Gaps = 39/325 (12%)
 Frame = -1

Query  1323  RFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNLECCL-FVLFPYFSYMLA-----E  1162
             RF+ +FF  +S+          +F Y G DI   Q+    + F+ F  F   LA      
Sbjct  306   RFVSSFFHLISS-----LAETFVFIYMGFDIAMEQHSWSHVGFIFFSIFGDTLATETCSH  360

Query  1161  GLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFD-----  997
              L   GI S ++    ++   ++ +S  SQ +              F+ + +GF      
Sbjct  361   SLTRCGIASDIYWSCKVRILLFATMSPLSQAY--------------FIRVNLGFSHKKLS  406

Query  996   ---IAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYS  826
                 +  Q + +           I + RAANVF CAYLVNLVRPA+R+IP KHQ+ALWYS
Sbjct  407   LLLFSKRQKNLSTCKPKTCKFCPITLCRAANVFSCAYLVNLVRPAHRQIPLKHQQALWYS  466

Query  825   GLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALDVVGDDYD  646
             GLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTMLEAL VVGD  +
Sbjct  467   GLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTMLEALQVVGDGLE  526

Query  645   sslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAIDRNYLTPFFT  466
                  GTLGE  EG+NGYIAPSY+EE+SSG+R KMKLKEFH+ST+SFTA+DRNYLTPFFT
Sbjct  527   -----GTLGESFEGNNGYIAPSYNEEASSGNRIKMKLKEFHQSTASFTALDRNYLTPFFT  581

Query  465   TQNGDE-DEQEELISNSRRARYSGH  394
             +QNGDE +E +E + +S R  + GH
Sbjct  582   SQNGDEVEELDEPMPSSARGGFQGH  606



>gb|AAF68127.1|AC010793_22 F20B17.4 [Arabidopsis thaliana]
Length=531

 Score =   498 bits (1283),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 327/561 (58%), Positives = 368/561 (66%), Gaps = 113/561 (20%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS
Sbjct  14    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANIS  73

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIA--SM  1597
             +TET+IR    F E                  L    FF + G+I T +    F    S 
Sbjct  74    NTETSIR----FVE------------------LFLISFFRH-GSISTMSSSFCFCCLPSY  110

Query  1596  VTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESV  1417
                 + Y+GGV+ LMY+LPF+ECLMFGSLISATDPVTVLSIFQELG+DVNLYALVFGESV
Sbjct  111   YILKIEYLGGVMFLMYRLPFVECLMFGSLISATDPVTVLSIFQELGSDVNLYALVFGESV  170

Query  1416  LNDA-------------------MAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSM  1294
             LNDA                   MAISLYRTMSLVRS+ SSGQNFFM+ VRF+ETF GSM
Sbjct  171   LNDADEIVTLLIRSFSFLCCFWQMAISLYRTMSLVRSH-SSGQNFFMVIVRFLETFVGSM  229

Query  1293  SAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEG--LGLSGIVSILFTG  1120
             SA +          KY  L    L ++      +  YF ++      L  +  VSI FT 
Sbjct  230   SAAM----------KYFILMYSLLLSVYRTWSAVSSYFFHISRNKTLLFYTSYVSIYFTL  279

Query  1119  I-----VMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfi  955
             I     VMK YTYSNLS +SQRFVS+FFHLISSLAETFVFIYMGFDIAME+HSW      
Sbjct  280   IEIVQFVMKHYTYSNLSANSQRFVSAFFHLISSLAETFVFIYMGFDIAMEKHSW------  333

Query  954   ffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSG----------------  823
                        AANVFGC YLVNL RPA+RKIP  HQKALWYSG                
Sbjct  334   -----------AANVFGCGYLVNLARPAHRKIPMTHQKALWYSGKILLCVPLSSYCFYSS  382

Query  822   ------------LRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTML  679
                         LRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTML
Sbjct  383   VINTKICGFCIGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTML  442

Query  678   EALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSS-GSRFKMKLKEFHKSTSSFT  502
             EAL+VVGD +D+SLG G         N     SYD+E +  GS F+ KL+EFHKS +SFT
Sbjct  443   EALEVVGDSHDTSLGDGFEVV-----NSRYMTSYDDEDTPPGSGFRTKLREFHKSAASFT  497

Query  501   AIDRNYLTPFFTTQNGDEDEQ  439
              +DRNYLTPFFT+ NGD D++
Sbjct  498   ELDRNYLTPFFTSNNGDYDDE  518



>ref|NP_001131172.1| hypothetical protein [Zea mays]
 gb|ACF79472.1| unknown [Zea mays]
 tpg|DAA61988.1| TPA: hypothetical protein ZEAMMB73_883587 [Zea mays]
Length=384

 Score =   475 bits (1222),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 259/372 (70%), Positives = 309/372 (83%), Gaps = 7/372 (2%)
 Frame = -1

Query  1527  LMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLVRSNTSSG  1348
             +MFG+L+SATDPVTVLSIFQELGTD NLYALVFGESVLNDA+AISLYR+M+ +R++  SG
Sbjct  1     MMFGALVSATDPVTVLSIFQELGTDTNLYALVFGESVLNDAVAISLYRSMASMRTH-HSG  59

Query  1347  QNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYML  1168
             +NFF++ +RF+E F GSMS+G+GVG ISALLFKYA L ++NL NLE CLFVLFPYFSYML
Sbjct  60    KNFFLVILRFLENFVGSMSSGIGVGLISALLFKYAALGVENLHNLESCLFVLFPYFSYML  119

Query  1167  AEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAM  988
             AEG+GLSGI+SILFTGIVMKRYT+SNLSD SQRF + FFHL+SSLAE FVFIYMGFDIA+
Sbjct  120   AEGIGLSGIISILFTGIVMKRYTFSNLSDDSQRFTARFFHLLSSLAEAFVFIYMGFDIAI  179

Query  987   EQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAM  808
             E+ SW+H+GFIFFSI+FI +ARAANVF CAY++NL RP + +IP ++Q+ALWYSGLRGAM
Sbjct  180   ERQSWSHIGFIFFSIIFILVARAANVFSCAYILNLARPPHCQIPRQYQQALWYSGLRGAM  239

Query  807   AFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALDVVGDDYDsslgtg  628
             AFALALQSVHDLP+GHG+TIFTATT+IVVLTVL+IGGSTGTMLEAL VVGD         
Sbjct  240   AFALALQSVHDLPDGHGETIFTATTSIVVLTVLLIGGSTGTMLEALQVVGDSNRYCQLYE  299

Query  627   tlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQNGD-  451
                       GY   +YDE +S+ S+F+ KL++  +STSSF  +DRNYLTP FT+QNGD 
Sbjct  300   LQESSNGNDTGYTGQNYDEGASTSSKFRSKLRDLRRSTSSFALLDRNYLTPIFTSQNGDC  359

Query  450   -----EDEQEEL  430
                  E   EEL
Sbjct  360   NDNTTESPNEEL  371



>dbj|BAJ99158.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=404

 Score =   473 bits (1217),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 244/315 (77%), Positives = 281/315 (89%), Gaps = 1/315 (0%)
 Frame = -1

Query  1908  ILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETNIRAWFNFHE  1729
             ILLQI MLVL+F+L H+LRR R YYLPEASASLLIGLIVGGLA++S+ + + R WFNF E
Sbjct  49    ILLQISMLVLAFVLSHLLRRRRVYYLPEASASLLIGLIVGGLASVSNAQKSTRRWFNFRE  108

Query  1728  EffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYIGGVILLMY  1549
             E FFLFLLPPIIFQSGFSL+PKPFFSNFGAI+TFAI GT IA +VTG LVY+ G+I L+Y
Sbjct  109   ELFFLFLLPPIIFQSGFSLAPKPFFSNFGAIITFAIVGTLIACIVTGALVYLAGLIHLVY  168

Query  1548  KLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLV  1369
             K+P +EC+MFG+L+SATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTM+ +
Sbjct  169   KMPLVECMMFGALVSATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMASL  228

Query  1368  RSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLF  1189
             R+N SS QN F++ +RF+E FFGSMS GVGVGFISALLFKY+ L + NL NLE CLFV+F
Sbjct  229   RTNASS-QNIFVVILRFLENFFGSMSTGVGVGFISALLFKYSTLGVGNLYNLESCLFVVF  287

Query  1188  PYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIY  1009
             PYFSYMLAEG GLSGIVSILFTGIVMKRYT+SNLS+ SQRF ++ FHL+SSLAETFVFIY
Sbjct  288   PYFSYMLAEGFGLSGIVSILFTGIVMKRYTFSNLSEDSQRFTAALFHLLSSLAETFVFIY  347

Query  1008  MGFDIAMEQHSWTHV  964
             MGFDIAME+ SW+H+
Sbjct  348   MGFDIAMERQSWSHI  362



>ref|XP_002460432.1| hypothetical protein SORBIDRAFT_02g028040 [Sorghum bicolor]
 gb|EER96953.1| hypothetical protein SORBIDRAFT_02g028040 [Sorghum bicolor]
Length=476

 Score =   449 bits (1156),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 275/510 (54%), Positives = 328/510 (64%), Gaps = 91/510 (18%)
 Frame = -1

Query  1932  DQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS---DTE  1762
             +++AAGVGILLQI MLVLSF+LGH+LRR +FYY+PEAS SLLI     G+       D +
Sbjct  23    EEQAAGVGILLQISMLVLSFVLGHILRRRKFYYIPEASGSLLIAHSELGILKFKWQGDDK  82

Query  1761  TN----IRAWFNFHEEffflfllppiiFQSGFSLS-----PKPFFSNFGAIVTFAIFGTF  1609
              N    +  W  +   +    L      QS  S S      KPFFSNF AI+TFAI GTF
Sbjct  83    INATGSVGVWGCYESGYDKCKLRRGAFGQSKCSSSIGEHSNKPFFSNFDAIITFAILGTF  142

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             IAS+VTG+LV           LP +EC+MFG+L+SATDPVTVLSIFQELGTD NLYALVF
Sbjct  143   IASIVTGLLV-----------LPLVECMMFGALVSATDPVTVLSIFQELGTDTNLYALVF  191

Query  1428  GESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFK  1249
             GESVLNDA         SL+RSN                                  LFK
Sbjct  192   GESVLNDA---------SLIRSN----------------------------------LFK  208

Query  1248  YAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQR  1069
             YA L ++        L V      YMLAEG+GLSGIVSILFTGIVMKRYT+SNLSD SQR
Sbjct  209   YAALGVEKF------LLVTIICIRYMLAEGIGLSGIVSILFTGIVMKRYTFSNLSDDSQR  262

Query  1068  FVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLV  889
             F + FFHL+SSLAE FVFIYMG DIAME+ SW                 AANVF CAY++
Sbjct  263   FTARFFHLLSSLAEAFVFIYMGVDIAMERQSW-----------------AANVFPCAYIL  305

Query  888   NLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvl  709
             NL RP + +IP ++Q+ALWYSGLRGAMAFALALQSVHDLP+GHG+TIFTATT+IVVLTVL
Sbjct  306   NLARPPHCQIPRQYQQALWYSGLRGAMAFALALQSVHDLPDGHGETIFTATTSIVVLTVL  365

Query  708   iIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKE  529
             +IGGSTGTMLEAL VVGD   +               GY+  +YDE +S+ S+ + KL++
Sbjct  366   LIGGSTGTMLEALQVVGD--SNRYRQLYEENSNGDDTGYMGQNYDEGASASSKIRSKLRD  423

Query  528   FHKSTSSFTAIDRNYLTPFFTTQNGDEDEQ  439
               +STSSF  +D+NYLTP FT++NGD D+ 
Sbjct  424   LRRSTSSFALLDKNYLTPIFTSRNGDCDDD  453



>ref|XP_001765719.1| predicted protein [Physcomitrella patens]
 gb|EDQ69558.1| predicted protein [Physcomitrella patens]
Length=479

 Score =   449 bits (1156),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 264/450 (59%), Positives = 326/450 (72%), Gaps = 18/450 (4%)
 Frame = -1

Query  1941  TGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTE  1762
             T K Q+   + ILLQI ML L+F+ GH+LRRH+FYYL E SASLLIGL+VG LA  +  +
Sbjct  3     TSKRQQIDSLSILLQISMLGLAFVFGHILRRHKFYYLHEGSASLLIGLVVGALARFTYPQ  62

Query  1761  TNIRAWFNFHEEffflfl---lppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
                  WFNFHE FFFLFL   +      + F +   PFFSNFGAI TFAI GT I++MVT
Sbjct  63    DRFSNWFNFHEGFFFLFLLPPIILYPSSNCFRILCGPFFSNFGAICTFAILGTLISAMVT  122

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G  VY+GG + L+YKLP LE  +FGS+ISATDPV+VL++FQELGTDVNLYALV GESVLN
Sbjct  123   GGFVYLGGRLSLVYKLPLLESCIFGSIISATDPVSVLAVFQELGTDVNLYALVLGESVLN  182

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVG----FISALLFKYA  1243
             DA+A+SLYR++  VR N S+  N  +  +RF  TF GS+ +G+        ++  LFK+A
Sbjct  183   DAVAVSLYRSLVSVRQNLSASYNVTIAIIRFFITFLGSLFSGIHNSPEKPKLAMHLFKFA  242

Query  1242  GLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFV  1063
             GL +  LQ+LECCL VLFPYF+YM AEGLGLSGIV+IL  GI+MK YT+ NLS+S+Q F 
Sbjct  243   GLHVHKLQHLECCLIVLFPYFAYMFAEGLGLSGIVAILLCGILMKHYTFPNLSESAQSFT  302

Query  1062  SSFFHLISSLAETFVFIYMGFDIAMEQHS-WTHVgfiffsilfigIA--------RAANV  910
             + FFHLI SLAETFVF+YMG DIA E+HS W H+ FI FS+    +         RA NV
Sbjct  303   AGFFHLIVSLAETFVFMYMGVDIANERHSNWLHISFILFSVKIHHVTLDDVYLIFRAINV  362

Query  909   FGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftatta  730
             +  AY +N +R A+RKIP +HQ ALW+SGLRGAMAFALALQSVH+  + HGQ IFT TT 
Sbjct  363   YPLAYCINKLRSASRKIPIQHQNALWFSGLRGAMAFALALQSVHNFQDSHGQVIFTTTTT  422

Query  729   ivvltvliIGGSTGTMLEALDV--VGDDYD  646
             IV+LTVL+IGGST TMLE L++    D+Y 
Sbjct  423   IVILTVLVIGGSTSTMLENLNLNKEKDEYS  452



>ref|XP_009374801.1| PREDICTED: sodium/hydrogen exchanger 5 isoform X2 [Pyrus x bretschneideri]
Length=454

 Score =   439 bits (1130),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLANIS+TE 
Sbjct  24    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANISNTEN  83

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAI GTFIAS+VTG+LV
Sbjct  84    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAILGTFIASVVTGILV  143

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+I L Y+LPF+ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLNDAMA
Sbjct  144   YLGGLIYLTYRLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAMA  203

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRS+ SSG+NFFM+ VRF+ETF GS+SAGVGVGF SALLFKYAGLDIDNLQ
Sbjct  204   ISLYRTMSLVRSHASSGENFFMVVVRFLETFVGSLSAGVGVGFTSALLFKYAGLDIDNLQ  263

Query  1218  NLECCLFVLFPYFS  1177
             NLECCLFVLFPYFS
Sbjct  264   NLECCLFVLFPYFS  277


 Score =   227 bits (579),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 154/176 (88%), Gaps = 6/176 (3%)
 Frame = -1

Query  921  AANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtift  742
            AANVF CAYLVNLVRPA+R+IP KHQKALWYSGLRGAMAFALALQSVHDLP+GHGQTIFT
Sbjct  278  AANVFSCAYLVNLVRPAHRQIPLKHQKALWYSGLRGAMAFALALQSVHDLPDGHGQTIFT  337

Query  741  attaivvltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESS  562
            ATTAIVVLTVL+IGGSTGTMLEAL VVGD  +     GTLGE  EG+NGYIAPS+D+E S
Sbjct  338  ATTAIVVLTVLLIGGSTGTMLEALQVVGDGIE-----GTLGENFEGNNGYIAPSFDDEGS  392

Query  561  SGSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQNGD-EDEQEELISNSRRARYSG  397
            SG+R KMKLKEFH+ST+SFTA+DRNYLTPFFT+QNGD EDE +E + +S R  + G
Sbjct  393  SGNRIKMKLKEFHQSTASFTALDRNYLTPFFTSQNGDEEDELDEPMPSSTRRGFHG  448



>ref|XP_008375080.1| PREDICTED: sodium/hydrogen exchanger 6 isoform X1 [Malus domestica]
Length=305

 Score =   434 bits (1115),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 224/254 (88%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLA+IS+TE 
Sbjct  25    GKEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLASISNTEN  84

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             +IRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAI GTFIAS+VTG+LV
Sbjct  85    SIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAILGTFIASVVTGILV  144

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+I L Y+LPF+ECLMFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVLND MA
Sbjct  145   YLGGLIYLTYRLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDXMA  204

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             ISLYRTMSLVRS+ +SG+NFFM+ VRF+ETF GS+SAGVGVGF SALLFKYAGLDIDNLQ
Sbjct  205   ISLYRTMSLVRSHATSGENFFMVVVRFLETFVGSLSAGVGVGFTSALLFKYAGLDIDNLQ  264

Query  1218  NLECCLFVLFPYFS  1177
             NLECCLFVLFPYFS
Sbjct  265   NLECCLFVLFPYFS  278



>emb|CDP04566.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   433 bits (1113),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 246/289 (85%), Positives = 266/289 (92%), Gaps = 5/289 (2%)
 Frame = -1

Query  1257  LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDS  1078
             LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YT+SNLSD+
Sbjct  24    LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTFSNLSDN  83

Query  1077  SQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCA  898
             SQRFVS+FF LISSLAETFVFIYMGFDIAMEQHSW+HVGFIFFSILFI IARAANVFGCA
Sbjct  84    SQRFVSAFFDLISSLAETFVFIYMGFDIAMEQHSWSHVGFIFFSILFIVIARAANVFGCA  143

Query  897   YLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvl  718
             YL+NLVRP NRKIP KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVL
Sbjct  144   YLINLVRPTNRKIPLKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVL  203

Query  717   tvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMK  538
             TVL+IGGSTGTMLEAL+VVGD +D      +LGE  EG+NGYIAP YD ESSSG+R KMK
Sbjct  204   TVLLIGGSTGTMLEALEVVGDGHD-----ESLGESFEGNNGYIAPPYDGESSSGNRLKMK  258

Query  537   LKEFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQEELISNSRRARYSGHS  391
             LKEFHKST+SFTA+DRNYLTPFFT+Q+GDED+++E + +SRR  Y GH 
Sbjct  259   LKEFHKSTASFTALDRNYLTPFFTSQSGDEDDEDEPMISSRRGDYRGHD  307



>ref|XP_008464323.1| PREDICTED: sodium/hydrogen exchanger 6-like [Cucumis melo]
Length=342

 Score =   420 bits (1080),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 224/256 (88%), Positives = 239/256 (93%), Gaps = 1/256 (0%)
 Frame = -1

Query  1953  PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANI  1774
             P     KDQ+AAGVGILLQIMMLVLSF+LGHVLRRHR Y+LPEASASLLIGLIVGGLANI
Sbjct  17    PKGSPVKDQQAAGVGILLQIMMLVLSFVLGHVLRRHRLYFLPEASASLLIGLIVGGLANI  76

Query  1773  SDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMV  1594
             S+TETNIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAI GTFIAS+V
Sbjct  77    SNTETNIRAWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFSNFGAIVTFAILGTFIASVV  136

Query  1593  TGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVL  1414
             TG LVY+GG+  LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVL
Sbjct  137   TGGLVYLGGLAFLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVL  196

Query  1413  NDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLD  1234
             NDAMAISLYRTMSLVRS+  SG+NFF + VRF+ETF GS+SAGVGVGF SALLFKYAGLD
Sbjct  197   NDAMAISLYRTMSLVRSHAYSGKNFFFVIVRFLETFVGSLSAGVGVGFTSALLFKYAGLD  256

Query  1233  IDNLQNLECCL-FVLF  1189
             IDNLQNLECCL FVLF
Sbjct  257   IDNLQNLECCLFFVLF  272


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -1

Query  600  NGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQEELI  427
            NGYIAP Y++E SS SR KMKLKEFH+ST+SFTA++RNYLTPFF +++GD++E +  I
Sbjct  281  NGYIAP-YNDEGSSRSRIKMKLKEFHESTASFTALNRNYLTPFFKSRSGDDEEDDNSI  337



>emb|CBI40031.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   416 bits (1069),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 236/290 (81%), Positives = 262/290 (90%), Gaps = 8/290 (3%)
 Frame = -1

Query  1257  LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDS  1078
             LFKYAGLDIDNL NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMK YT+SNLS++
Sbjct  32    LFKYAGLDIDNLLNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKHYTFSNLSEN  91

Query  1077  SQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCA  898
             SQRFVS+FFHLISSLAETFVFIYMGFDIAMEQHSW+HVGFIFFSILFI +ARAANVF CA
Sbjct  92    SQRFVSAFFHLISSLAETFVFIYMGFDIAMEQHSWSHVGFIFFSILFIIVARAANVFSCA  151

Query  897   YLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvl  718
             Y+VNL+RPA+R+IP KHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVL
Sbjct  152   YMVNLIRPAHRQIPLKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVL  211

Query  717   tvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMK  538
             TVL+IGGSTGTMLEAL VVGD +D     G +GE  E +NGYI+P YDEE SSG+R KM+
Sbjct  212   TVLLIGGSTGTMLEALQVVGDGHD-----GPIGESFEVNNGYISPPYDEEESSGNRLKMR  266

Query  537   LKEFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQE---ELISNSRRARYSG  397
             LKEFHK+T++F A+D+NYLTPFFTTQ GD++EQE   E  S+SRRA + G
Sbjct  267   LKEFHKNTATFRALDKNYLTPFFTTQTGDDEEQEDFGEAASSSRRASFHG  316



>ref|XP_006301785.1| hypothetical protein CARUB_v10022249mg [Capsella rubella]
 gb|EOA34683.1| hypothetical protein CARUB_v10022249mg [Capsella rubella]
Length=487

 Score =   417 bits (1073),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 284/570 (50%), Positives = 329/570 (58%), Gaps = 156/570 (27%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLAN--  1777
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGL    L    
Sbjct  14    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLFSRLLLTPL  73

Query  1776  ------------ISDTETNIRA----WFNFHEEffflfllppiiFQSGFSLSPKPFFSNF  1645
                         + D+  N RA    WFNFH+EFFFL           F L P   +   
Sbjct  74    HFDRPSRVPSIVLFDSLWNFRADRWTWFNFHDEFFFL-----------FLLPPIILYPLI  122

Query  1644  GAIVTFA------------IFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISA  1501
               I   A            + GTF+ASMVTG+LVY+GGV+ LMY+LPF+ECLMFGSLISA
Sbjct  123   EFIFAIALAFSLLRLQSATLLGTFVASMVTGLLVYLGGVMFLMYRLPFVECLMFGSLISA  182

Query  1500  TDPVTVLSIFQELGTDVNLYALVFGESVLNDA--MAISLY-----RTMSLVRSNTSSGQN  1342
             TDPVTVLSIFQELG+DVNLYALVFGESVLNDA  + ISL+       ++L++S  SS Q+
Sbjct  183   TDPVTVLSIFQELGSDVNLYALVFGESVLNDAILLNISLHYILIDELLALMQSTYSSMQD  242

Query  1341  FFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAE  1162
             + +         F S S                     +LQNLECCLFVLFPYFS++   
Sbjct  243   WMLTIPMVSNDIFDSDSLAPSF----------------SLQNLECCLFVLFPYFSFI---  283

Query  1161  GLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQ  982
                                                               YMGFDIAME+
Sbjct  284   --------------------------------------------------YMGFDIAMEK  293

Query  981   HSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYS--------  826
             HSW                 AANVFGC YLVNL RPA+RKIP  HQKALWYS        
Sbjct  294   HSW-----------------AANVFGCGYLVNLARPAHRKIPMTHQKALWYSVITKQSHV  336

Query  825   ---GLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALDVVGD  655
                GLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTMLEAL+VVGD
Sbjct  337   DCIGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTMLEALEVVGD  396

Query  654   DYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSSFTAIDRNYLTP  475
              +D              ++ Y+    DE++ SGS F+ KL+EFHKS +SFT +DRNYLTP
Sbjct  397   SHD----PSLGDGFEVVNSRYMTSYDDEDTPSGSGFRTKLREFHKSAASFTELDRNYLTP  452

Query  474   FFTTQNGDEDEQ-------EELISNSRRAR  406
             FFT+ NGD D++       EE I  +RR  
Sbjct  453   FFTSNNGDYDDEGNIQQHHEERIPFTRRGN  482



>ref|XP_006878592.1| hypothetical protein AMTR_s00011p00253150 [Amborella trichopoda]
 gb|ERM94737.1| hypothetical protein AMTR_s00011p00253150 [Amborella trichopoda]
Length=291

 Score =   401 bits (1030),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 234/291 (80%), Positives = 258/291 (89%), Gaps = 4/291 (1%)
 Frame = -1

Query  1257  LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDS  1078
             LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEG GLSGIVSILFTGI+MK YT+SNLS++
Sbjct  4     LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGFGLSGIVSILFTGILMKHYTFSNLSEN  63

Query  1077  SQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCA  898
             SQ+FV++FFHLISSLAETFVFIYMG DIAMEQ SW+HVGFIFFSILFIG+ARAANVF CA
Sbjct  64    SQQFVAAFFHLISSLAETFVFIYMGIDIAMEQQSWSHVGFIFFSILFIGVARAANVFSCA  123

Query  897   YLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvl  718
             YLVNLVRPA+RKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVL
Sbjct  124   YLVNLVRPASRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVL  183

Query  717   tvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMK  538
             TVL+IGGSTGTMLEAL+VVGD +D   GT  LGE  +G NGYIAPSY+E +SSG + KM+
Sbjct  184   TVLLIGGSTGTMLEALEVVGDGHD---GTFGLGETFDGDNGYIAPSYEEGASSGQKLKMR  240

Query  537   LKEFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQEELISNSRRARYSGHS*N  385
             LKEFHKSTSSFTA+D+NYLTPFFT QNG+  +       S R+ +  H  N
Sbjct  241   LKEFHKSTSSFTALDKNYLTPFFTAQNGEVQDGPSPY-QSHRSNFGRHGSN  290



>gb|EMT03702.1| Sodium/hydrogen exchanger 6 [Aegilops tauschii]
Length=448

 Score =   401 bits (1031),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 248/516 (48%), Positives = 314/516 (61%), Gaps = 117/516 (23%)
 Frame = -1

Query  1935  KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             + + AAGVGILLQI MLVL+F+L H+LRR R YYLPEASASLLIGLIVGGLA++S+    
Sbjct  15    EQEEAAGVGILLQISMLVLAFVLSHLLRRRRVYYLPEASASLLIGLIVGGLASVSNA---  71

Query  1755  IRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVY  1576
                                   Q   SL+PKPFFSNFGAI+TFAI GT IAS+VTGVLVY
Sbjct  72    ----------------------QKSTSLAPKPFFSNFGAIITFAIVGTLIASIVTGVLVY  109

Query  1575  IGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLND----  1408
             + G+I L+Y++P +EC+MFG+L+SATDPVTVLSIFQ    ++ L  L+     L      
Sbjct  110   LAGLIHLVYRMPLVECMMFGALVSATDPVTVLSIFQVYVINLVLLLLLILAPFLISICFV  169

Query  1407  --AMAISLY---------RTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISA  1261
                MAISLY         RTM+ +R+N SS QN F++ +RF+E FFGSMS GVG GFISA
Sbjct  170   AMKMAISLYRIRLDSLIFRTMASLRTNASS-QNIFVVILRFLENFFGSMSTGVGAGFISA  228

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L                  +  L P F  +   G  L          +VMKRYT+SNLS+
Sbjct  229   L------------------ISFLHPTFCIV---GRAL----------MVMKRYTFSNLSE  257

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              SQRF ++ FHL+SSLAETFV  ++ F                   +FI +ARAANVF C
Sbjct  258   DSQRFTAALFHLLSSLAETFVIYFVRF-----------------MKIFILVARAANVFSC  300

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             A+LVNLVRP  R+I  ++Q+ALWYSGLRGAMAFALALQSVHDLP+GHGQTI         
Sbjct  301   AFLVNLVRPPQRQISRQYQQALWYSGLRGAMAFALALQSVHDLPDGHGQTIL--------  352

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
                     +T +++   D   ++Y+ +              G I    +E +S+ S+FK+
Sbjct  353   -------SATISIVVLTD--QENYEGNNNA-----------GNIELGSEEGTSTTSKFKL  392

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDEDEQEE  433
             KL+E  K+T S  A+DRNYLTPFFT+QNGD D+ E 
Sbjct  393   KLQEIQKNTPSLAALDRNYLTPFFTSQNGDSDDDEH  428



>ref|XP_007026450.1| Na+/H+ antiporter 6 isoform 1 [Theobroma cacao]
 gb|EOY29072.1| Na+/H+ antiporter 6 isoform 1 [Theobroma cacao]
Length=632

 Score =   406 bits (1044),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 232/290 (80%), Positives = 261/290 (90%), Gaps = 6/290 (2%)
 Frame = -1

Query  1257  LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDS  1078
             LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS++
Sbjct  348   LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSEN  407

Query  1077  SQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCA  898
             SQRFVS+FFHLISSLAETF FIYMGFDIAME+HSW+HVGFIFFSILFIG+ARAANVF CA
Sbjct  408   SQRFVSAFFHLISSLAETFTFIYMGFDIAMEKHSWSHVGFIFFSILFIGVARAANVFSCA  467

Query  897   YLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvl  718
             YLVN VRP +R+IP  HQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVL
Sbjct  468   YLVNSVRPVHRQIPLNHQKALWYSGLRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVL  527

Query  717   tvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMK  538
             TVL+IGGSTGTML AL VVGD +D     G LGE  +G+NGY+AP+Y+E+ ++G+RFKMK
Sbjct  528   TVLLIGGSTGTMLGALQVVGDGHD-----GHLGEIFDGNNGYVAPTYNEDGTTGNRFKMK  582

Query  537   LKEFHKSTSSFTAIDRNYLTPFFTTQNG-DEDEQEELISNSRRARYSGHS  391
             LKEFHKST+SF+A+DRNYLTPFFT+QNG DE+E ++ + +SR   +  HS
Sbjct  583   LKEFHKSTASFSALDRNYLTPFFTSQNGDDEEEHDDPMPSSRNGGFHDHS  632


 Score =   314 bits (804),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 174/239 (73%), Positives = 193/239 (81%), Gaps = 22/239 (9%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+AAG+GILLQIMMLVLSF+LGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET
Sbjct  12    GKEQQAAGLGILLQIMMLVLSFVLGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  71

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFS-------------LSP---KPFFSNFGAIVTF  1627
             +IR+    +   FF F    +   S F               SP   KPFFSNFGAIVTF
Sbjct  72    SIRSSIASYYYIFFSFFALIVFLNSLFRHSIRVQPITFLTLFSPFWQKPFFSNFGAIVTF  131

Query  1626  AIFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVN  1447
             AI GT IAS+VTGVLVY+GG++ LMY+LPF+ECLMFG+LISATDPVTVLSIFQELGTD+N
Sbjct  132   AILGTLIASVVTGVLVYLGGLMYLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDMN  191

Query  1446  LYALVFGESVLNDAMAISLY------RTMSLVRSNTSSGQNFFMITVRFIETFFGSMSA  1288
             LYALVFGESVLNDAMAISLY      RTMSLVRS+ SSGQNFFM+ VRF+ETF GSMSA
Sbjct  192   LYALVFGESVLNDAMAISLYSVASLCRTMSLVRSHVSSGQNFFMVIVRFLETFVGSMSA  250



>gb|EMT17002.1| Sodium/hydrogen exchanger 6 [Aegilops tauschii]
Length=421

 Score =   393 bits (1009),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 252/451 (56%), Positives = 296/451 (66%), Gaps = 94/451 (21%)
 Frame = -1

Query  1932  DQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIG--------------LI  1795
             +Q+AAGVGILLQI MLVLSF+LGH+LRR +FYYLPEASASLLIG              +I
Sbjct  10    EQQAAGVGILLQISMLVLSFVLGHLLRRRKFYYLPEASASLLIGTYIPIRTPSPEVPGMI  69

Query  1794  VGGLANISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFG  1615
             VGG ANIS+T+ + R WFNF E+FF LFLLPPII                          
Sbjct  70    VGGFANISNTQKSTRRWFNFREDFFLLFLLPPIILYP-----------------------  106

Query  1614  TFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYAL  1435
                       L+Y+ G+I ++Y+LP +EC+MFG+L+SATDPVTVLSIFQELGTDVNLYAL
Sbjct  107   ----------LIYLAGLIFIIYRLPLVECMMFGALVSATDPVTVLSIFQELGTDVNLYAL  156

Query  1434  VFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALL  1255
             VFGESVLNDA+     R + L  S  +S  N  + ++   +              I + L
Sbjct  157   VFGESVLNDAV-----RVLFLRFSLCASFLNLALKSLFVQDHGINEDKHACLYSLILSNL  211

Query  1254  FKYAGLDIDNLQNLECCLFVLFPYFS----------YMLAEGLGLSGIVSILFTGIVMKR  1105
             FKYA L ++NL NLE CLFVLFPYFS          YMLAEGLGLSGIVSILFTGIVMKR
Sbjct  212   FKYAELGVENLHNLESCLFVLFPYFSLLSVTAVCVRYMLAEGLGLSGIVSILFTGIVMKR  271

Query  1104  YTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIA  925
             YT+ NLS+ SQRF + FFHL+SSLAE F+                               
Sbjct  272   YTFYNLSEDSQRFTARFFHLLSSLAEAFM-------------------------------  300

Query  924   RAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtif  745
              AANVF CAY++NL RP N +IP ++Q ALWYSGLRGAMAFALALQSVHDLP+GHG+TIF
Sbjct  301   -AANVFSCAYILNLARPPNSQIPREYQLALWYSGLRGAMAFALALQSVHDLPDGHGETIF  359

Query  744   tattaivvltvliIGGSTGTMLEALDVVGDD  652
             TATT+IVVLTVL+IGGSTGTMLEAL VVGD 
Sbjct  360   TATTSIVVLTVLLIGGSTGTMLEALQVVGDS  390



>emb|CDP04565.1| unnamed protein product [Coffea canephora]
Length=248

 Score =   370 bits (950),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 201/243 (83%), Positives = 219/243 (90%), Gaps = 5/243 (2%)
 Frame = -1

Query  1968  MEELLPPP-----RTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLI  1804
             M+EL   P       GK+Q+AAGVGILLQIMMLVLSF+LGHVLRRHRFYYLPEASASLLI
Sbjct  1     MDELQISPVDSRESPGKEQQAAGVGILLQIMMLVLSFVLGHVLRRHRFYYLPEASASLLI  60

Query  1803  GLIVGGLANISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFA  1624
             GLIVGGLAN+SDTET+IRAWFNFHEEFFFLFLLPPII    F L PKPFFSNFGAIVTFA
Sbjct  61    GLIVGGLANVSDTETSIRAWFNFHEEFFFLFLLPPIILYPFFGLQPKPFFSNFGAIVTFA  120

Query  1623  IFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNL  1444
             I GTFIAS+VTG+LVY+GG++ L YKLPF+ECLMFG+LISATDPVTVLSIFQELGTD NL
Sbjct  121   IGGTFIASVVTGILVYLGGLMYLTYKLPFVECLMFGALISATDPVTVLSIFQELGTDTNL  180

Query  1443  YALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFIS  1264
             YALVFGESVLNDAMAISLYRTMSLVRS++SS QNFFMI VRF+ETF GSMS+GVGVGF S
Sbjct  181   YALVFGESVLNDAMAISLYRTMSLVRSHSSSEQNFFMIIVRFLETFVGSMSSGVGVGFTS  240

Query  1263  ALL  1255
             AL+
Sbjct  241   ALI  243



>dbj|BAJ34110.1| unnamed protein product [Thellungiella halophila]
Length=253

 Score =   362 bits (929),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 193/232 (83%), Positives = 212/232 (91%), Gaps = 0/232 (0%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRHRF+YLPEAS SLLIGLIVG LAN+S
Sbjct  13    PQGQVKQQQAAGVGILLQIMMLVLSFVLGHVLRRHRFHYLPEASGSLLIGLIVGVLANVS  72

Query  1770  DTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVT  1591
             DTET+IR WFNFHEEFFFLFLLPPIIFQSGFSL PKPFFSNFGAIVTFAI GTF+AS+VT
Sbjct  73    DTETSIRTWFNFHEEFFFLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFAIIGTFVASVVT  132

Query  1590  GVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLN  1411
             G LVY+GG + LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLN
Sbjct  133   GGLVYLGGSMYLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLN  192

Query  1410  DAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALL  1255
             DAMAISLYRTMSLV   +S+G++F M+ +RF+ETF GSMSAGVGVGF SAL+
Sbjct  193   DAMAISLYRTMSLVNRQSSTGEHFLMVVIRFLETFAGSMSAGVGVGFTSALI  244



>gb|EPS63714.1| sodium/hydrogen exchanger, partial [Genlisea aurea]
Length=224

 Score =   359 bits (922),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 191/224 (85%), Positives = 210/224 (94%), Gaps = 0/224 (0%)
 Frame = -1

Query  1929  QRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETNIR  1750
             Q+AAGVGILLQIMMLVLSF+LGHVLRR RFYYLPEASASLLIGL+VG LAN+S+TET+IR
Sbjct  1     QQAAGVGILLQIMMLVLSFVLGHVLRRRRFYYLPEASASLLIGLVVGMLANVSNTETSIR  60

Query  1749  AWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYIG  1570
             +WFNFHEEFF LFLLPPIIFQSGFSL PKPFFSNFGAIVTFAIFGTFIAS+VTG+LVY+ 
Sbjct  61    SWFNFHEEFFLLFLLPPIIFQSGFSLQPKPFFSNFGAIVTFAIFGTFIASVVTGILVYLA  120

Query  1569  GVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISL  1390
             G   L+Y+LPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDA+AISL
Sbjct  121   GATFLIYRLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAIAISL  180

Query  1389  YRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISAL  1258
             YRTMS+VRS+ SS QNFF+I  RF+ETF GSMSAGVGVGF SAL
Sbjct  181   YRTMSMVRSHMSSDQNFFVIVFRFLETFVGSMSAGVGVGFTSAL  224



>emb|CDX87370.1| BnaA07g35030D [Brassica napus]
Length=644

 Score =   372 bits (956),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 218/295 (74%), Positives = 241/295 (82%), Gaps = 13/295 (4%)
 Frame = -1

Query  1257  LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDS  1078
             LFKYAGLD+DNLQNLECCLFVLFPYFSYMLAEGL LSGIVSILFTGIVMK YTYSNLS +
Sbjct  348   LFKYAGLDVDNLQNLECCLFVLFPYFSYMLAEGLSLSGIVSILFTGIVMKHYTYSNLSTN  407

Query  1077  SQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCA  898
             SQRFVS+FFHLISSLAETFVFIYMGFDIAME+HSW+HVGFIFFSILFI IARAANVFGC 
Sbjct  408   SQRFVSAFFHLISSLAETFVFIYMGFDIAMEKHSWSHVGFIFFSILFIVIARAANVFGCG  467

Query  897   YLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvl  718
             YLVNL RPA++KIP  HQKALWYSGLRGAMAFALALQSVH+LP+GHGQTIFTATTAIVV+
Sbjct  468   YLVNLARPAHKKIPMTHQKALWYSGLRGAMAFALALQSVHELPDGHGQTIFTATTAIVVV  527

Query  717   tvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMK  538
             TVL+IGGSTGTMLEAL+VVGD  D    T         +N Y+    DE S S S F+ K
Sbjct  528   TVLLIGGSTGTMLEALEVVGDSRD----TSLGDGFEVVNNRYMTRFDDEGSPSESGFRTK  583

Query  537   LKEFHKSTSSFTAIDRNYLTPFFTTQNG---------DEDEQEELISNSRRARYS  400
             L+EFHKS  SF+ +DRNYLTPFFT+ NG         D+   EE I  +RR  ++
Sbjct  584   LREFHKSAKSFSELDRNYLTPFFTSNNGDYDEDDDINDDQHHEERIPFTRRGNFN  638


 Score =   348 bits (892),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 180/245 (73%), Positives = 202/245 (82%), Gaps = 23/245 (9%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIGLIVGGLAN+S
Sbjct  15    PQGQEKQQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGGLANVS  74

Query  1770  DTETNIRAWFNFHEE----------------------ffflfllppiiFQSGFSLSPKPF  1657
             +TET+IR WFNFH+E                          FL   +  QSGFSL PKPF
Sbjct  75    NTETSIRTWFNFHDEFFFLFLLPPIILYPLIEFASATSLCCFLDVLVCTQSGFSLQPKPF  134

Query  1656  FSNFGAIVTFAIFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLS  1477
             FSNFGAIVTF++ GTF+AS+VTGVLVY+GGV+ LMY+LPF+ECLMFGSLISATDPVTVLS
Sbjct  135   FSNFGAIVTFSVLGTFVASIVTGVLVYLGGVMFLMYRLPFVECLMFGSLISATDPVTVLS  194

Query  1476  IFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGS  1297
             IFQELG+DVNLYALVFGESVLNDAMAISLYRTMSLVRS+ S+GQNFFM+ VRF+ETF GS
Sbjct  195   IFQELGSDVNLYALVFGESVLNDAMAISLYRTMSLVRSH-STGQNFFMVIVRFLETFVGS  253

Query  1296  MSAGV  1282
             MSAG+
Sbjct  254   MSAGL  258



>gb|AAD25617.1|AC005287_19 similar to Na+/H+-exchanging proteins [Arabidopsis thaliana]
Length=575

 Score =   362 bits (929),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 220/391 (56%), Positives = 259/391 (66%), Gaps = 48/391 (12%)
 Frame = -1

Query  1587  VLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQ------------------EL  1462
             V+ Y+GG + LMYKLPF+ECLMFG+LISATDPVTVLSIFQ                  ++
Sbjct  191   VVCYLGGSMYLMYKLPFVECLMFGALISATDPVTVLSIFQVLLLFLLLSVSTGYKYSHDV  250

Query  1461  GTDVNLYALVFGESVLNDAMAISL--------YRTMSLVRSNTSSGQNFFMITVRFIETF  1306
             GTDVNLYALVFGESVLNDA++           ++TMSLV   +SSG++FFM+ +RF ETF
Sbjct  251   GTDVNLYALVFGESVLNDAVSFYYLLRYWALPFKTMSLVNRQSSSGEHFFMVVIRFFETF  310

Query  1305  FGSMSAGVGVGFISALLFKYAGLDI--DNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSI  1132
              GSMSAG+ + F+++       L I  +++ N+   LF LF    +       L      
Sbjct  311   AGSMSAGLAISFLNSFYTVVFTLLILSEHIVNVMS-LFSLFSTSIHACRRCWSLRHCFYT  369

Query  1131  LFTGI---VMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVg  961
             L       VMKRYT+SNLS++SQ FVSSFFHLISSLAETF FIYMGFDIAMEQHSW+HVG
Sbjct  370   LHRNCNRRVMKRYTFSNLSEASQSFVSSFFHLISSLAETFTFIYMGFDIAMEQHSWSHVG  429

Query  960   fiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSV  781
                          A NVFGCAYLVNL R  N+KIP KHQKALWYSGLRGAMAFALALQS+
Sbjct  430   -------------AVNVFGCAYLVNLFRQENQKIPMKHQKALWYSGLRGAMAFALALQSL  476

Query  780   HDLPEGHGQti---ftattaivvltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerl  610
             HDLPEGHGQ I    T    + V  VL+IGGSTG MLEAL+VVGDD D S+         
Sbjct  477   HDLPEGHGQIIFTATTTIVVVTVTFVLLIGGSTGKMLEALEVVGDDLDDSMSEVNSRRST  536

Query  609   egSNGYIAPSYDEESSSGSRFKMKLKEFHKS  517
               S    A S ++ SSSGSRFKMKLKEFHK+
Sbjct  537   LISLNIGASSDEDTSSSGSRFKMKLKEFHKT  567


 Score =   113 bits (282),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  1950  PPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANIS  1771
             P    K Q+AAGVGILLQIMMLVLSF+LGHVLRRHRF+YLPEAS SLLIGLIVG LANIS
Sbjct  9     PQGQVKQQQAAGVGILLQIMMLVLSFVLGHVLRRHRFHYLPEASGSLLIGLIVGILANIS  68

Query  1770  DTETNIR  1750
             DTET+IR
Sbjct  69    DTETSIR  75



>gb|EAZ09526.1| hypothetical protein OsI_31802 [Oryza sativa Indica Group]
Length=383

 Score =   355 bits (912),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 194/327 (59%), Positives = 227/327 (69%), Gaps = 76/327 (23%)
 Frame = -1

Query  1941  TGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTE  1762
             T  +Q+AAGVGILLQI MLV+SF+LGHVLRR + YY+PEASASLLIG+IVGGLA IS+T+
Sbjct  33    TVDEQKAAGVGILLQISMLVVSFVLGHVLRRRKVYYIPEASASLLIGMIVGGLAKISNTQ  92

Query  1761  TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVL  1582
              +I                         SL+PKPFFSNFGAI+TFAI GTFIAS+VTG+L
Sbjct  93    RSI-------------------------SLAPKPFFSNFGAIITFAILGTFIASIVTGLL  127

Query  1581  VYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAM  1402
             VY+GG+I ++YKLP +EC+MFG+L+SATDPVTVLSIFQELGTDVNLYALVFGESVLNDA 
Sbjct  128   VYVGGLIYIVYKLPLVECMMFGALVSATDPVTVLSIFQELGTDVNLYALVFGESVLNDA-  186

Query  1401  AISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNL  1222
                     SL+ SN                                  LFKYA L ++NL
Sbjct  187   --------SLILSN----------------------------------LFKYAALGVENL  204

Query  1221  QNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLI  1042
              NLE CLFVLFPYFSYMLAEG GLSGIVSILFTGIVMKRYT+ NLS+ SQRF + FFHL+
Sbjct  205   HNLESCLFVLFPYFSYMLAEGFGLSGIVSILFTGIVMKRYTFYNLSEDSQRFTARFFHLL  264

Query  1041  SSLAETFVFIY--------MGFDIAME  985
             SSLAE FV +Y        M F +A++
Sbjct  265   SSLAEAFVSLYYLQGLRGAMAFALALQ  291


 Score = 84.0 bits (206),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 77/112 (69%), Gaps = 16/112 (14%)
 Frame = -1

Query  840  ALWY-SGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALDV  664
            +L+Y  GLRGAMAFALALQS+HDLPEGHG+TIFTATT+IVVLTVL+IGGSTGTMLE+L  
Sbjct  273  SLYYLQGLRGAMAFALALQSIHDLPEGHGETIFTATTSIVVLTVLLIGGSTGTMLESLQ-  331

Query  663  VGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKMKLKEFHKSTSS  508
               ++D +               Y    Y EE+S+ S F MKLKE  +  SS
Sbjct  332  --HNFDGNNA------------AYPGQRYGEETSTSSNFTMKLKELQRRYSS  369



>emb|CBI40033.3| unnamed protein product [Vitis vinifera]
Length=290

 Score =   350 bits (898),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 187/251 (75%), Positives = 211/251 (84%), Gaps = 18/251 (7%)
 Frame = -1

Query  1947  PRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISD  1768
             P  GK+Q+AAGVGILLQIMMLVLSF+LGHVLRR +FYYLPEASASLLIGLIVGGLANISD
Sbjct  15    PSPGKEQQAAGVGILLQIMMLVLSFVLGHVLRRKKFYYLPEASASLLIGLIVGGLANISD  74

Query  1767  TETNIRAWFNFHEEfff-----------------lfllppiiFQSGFSLSPKPFFSNFGA  1639
             TET+IRAWFNFHEEFFF                 L LL      SGFSLSPKPFFSNFGA
Sbjct  75    TETSIRAWFNFHEEFFFLFLLPPIILYPYLGCCNLLLLSLFDLLSGFSLSPKPFFSNFGA  134

Query  1638  IVTFAIFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELG  1459
             IVTFAI GTFIAS VTG+LVY+GG+I LMY+LPFLEC+MFG+LISATDPVTVLSIFQELG
Sbjct  135   IVTFAIVGTFIASTVTGILVYLGGLIYLMYRLPFLECMMFGALISATDPVTVLSIFQELG  194

Query  1458  TDVNLYALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVG  1279
             +D+NLYALVFGESVLNDAMAISLYRT+SL++S+  S QNFFM+ V+F+ETF GSMS+ VG
Sbjct  195   SDMNLYALVFGESVLNDAMAISLYRTISLIKSHVPSEQNFFMVIVKFLETFVGSMSSEVG  254

Query  1278  VGFISALLFKY  1246
             + F   +LF+Y
Sbjct  255   ISFF-GVLFRY  264



>gb|EMS56409.1| Sodium/hydrogen exchanger 6 [Triticum urartu]
Length=458

 Score =   341 bits (874),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 242/521 (46%), Positives = 302/521 (58%), Gaps = 132/521 (25%)
 Frame = -1

Query  1932  DQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETNI  1753
             +Q+AAGVGILLQI MLVLSF+LGH+LRR +FYYLPEASASLL    +G   ++S  + +I
Sbjct  10    EQQAAGVGILLQISMLVLSFVLGHLLRRRKFYYLPEASASLL----IGTYPSMSIHQPSI  65

Query  1752  RAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYI  1573
                                         P+      G+   + +    I+ M+ G    I
Sbjct  66    ----------------------------PR------GSSYLYFL----ISGMIVGGFANI  87

Query  1572  GGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAIS  1393
                     +LP +EC+MFG+L+SATDPVTVLSIFQELGTDVNLYALVFGESVLNDA+ + 
Sbjct  88    SNT-QKSTRLPLVECMMFGALVSATDPVTVLSIFQELGTDVNLYALVFGESVLNDAVRVL  146

Query  1392  LYR--------TMSL----VRSNTSSGQNFF----------------MITVRFIETFFGS  1297
               R         ++L    V+ +  +   FF                + +V  ++     
Sbjct  147   FLRFSLCAFFLNLALKSLFVQDHGINEDKFFRPEYFPSYLETCMFVLLNSVEPLQVCRTW  206

Query  1296  MSAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGI  1117
                 +    ++ L+F Y+      L NLE CLFVLFPYFSYMLAEGLGLSGIVSILFTGI
Sbjct  207   RRESISYEQLNFLIFIYS------LHNLESCLFVLFPYFSYMLAEGLGLSGIVSILFTGI  260

Query  1116  VMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilf  937
             VMKRYT+ NLS+ SQRF + FFHL+SSLAE F+                           
Sbjct  261   VMKRYTFYNLSEDSQRFTARFFHLLSSLAEAFM---------------------------  293

Query  936   igIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHG  757
                  AANVF CAY++NL RP N +IP ++Q ALWYSGLRGAMAFALALQSVHDLP+GHG
Sbjct  294   -----AANVFSCAYILNLARPPNSQIPREYQLALWYSGLRGAMAFALALQSVHDLPDGHG  348

Query  756   QtiftattaivvltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSY  577
             +TIFTATT+IVVLTVL+IGGSTGTMLEAL VVGD                  N Y  PS 
Sbjct  349   ETIFTATTSIVVLTVLLIGGSTGTMLEALQVVGDS-----------------NRYRHPSL  391

Query  576   DEESSSGSRFKMKLKEFH-KSTSSFTAIDRNYLTPFFTTQN  457
              E        +  +++ H + + SF  + RNYLTP FT+Q+
Sbjct  392   AE---CRRILREAVRKGHLQGSRSF--LIRNYLTPIFTSQH  427



>gb|ABD91508.1| putative Na+/H+ antiporter isoform 2 [Oryza sativa Indica Group]
Length=456

 Score =   331 bits (848),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 167/218 (77%), Positives = 187/218 (86%), Gaps = 19/218 (9%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+ AGVGILLQI MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TET
Sbjct  28    GKEQQVAGVGILLQISMLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTET  87

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             N R                    QSGFSLSPKPFF+NFGAIVTFAI GTF+AS+VTGVLV
Sbjct  88    NTRT-------------------QSGFSLSPKPFFANFGAIVTFAILGTFVASVVTGVLV  128

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+  LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA
Sbjct  129   YLGGLTFLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  188

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAG  1285
             ISLYRTMSLVRS  ++G+NFFM+  +F+ETF GS+S+G
Sbjct  189   ISLYRTMSLVRSQAAAGENFFMMVFQFLETFVGSLSSG  226


 Score =   145 bits (366),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 91/148 (61%), Gaps = 48/148 (32%)
 Frame = -1

Query  1266  SALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNL  1087
             S  LFKYAGLDID                 YMLAEGLGLSGIVSILFTG+VMK YT+SNL
Sbjct  314   SVYLFKYAGLDIDK----------------YMLAEGLGLSGIVSILFTGMVMKHYTFSNL  357

Query  1086  SDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVF  907
             S++SQRFVS+FFHL+SSLAETFV                                A NVF
Sbjct  358   SNNSQRFVSAFFHLLSSLAETFV--------------------------------AVNVF  385

Query  906   GCAYLVNLVRPANRKIPPKHQKALWYSG  823
              CAYLVN+ RP +R+IP KHQKALW+SG
Sbjct  386   SCAYLVNMSRPEHRRIPLKHQKALWFSG  413



>gb|KCW75479.1| hypothetical protein EUGRSUZ_E04240 [Eucalyptus grandis]
Length=253

 Score =   307 bits (787),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 187/264 (71%), Positives = 212/264 (80%), Gaps = 20/264 (8%)
 Frame = -1

Query  1173  MLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVF---IYMG  1003
             MLAEGLGLSGIVSILFTGI+MK Y YSNLS++SQRFVS+FFHLISSLAETFV+   +Y  
Sbjct  1     MLAEGLGLSGIVSILFTGILMKHYAYSNLSENSQRFVSAFFHLISSLAETFVWFPIVYPE  60

Query  1002  FDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSG  823
              +  + Q             LFI IARAANVF CAYLVNL RPA RKIP KHQKALWYSG
Sbjct  61    LNPLLRQ-------------LFIVIARAANVFSCAYLVNLARPATRKIPAKHQKALWYSG  107

Query  822   LRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALDVVGDDYDs  643
             LRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTGTMLEAL VVGD +D 
Sbjct  108   LRGAMAFALALQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTGTMLEALQVVGDAHDG  167

Query  642   slgtgt-lgerlegSNGYIAPSYDEE--SSSGSRFKMKLKEFHKSTSSFTAIDRNYLTPF  472
              LG        +  S+GY+APSYDEE  SSSG++FKMKLKEFH+S +SFTA+D+NYLTPF
Sbjct  168   PLGEHNFQNLEVNHSHGYVAPSYDEEEDSSSGNKFKMKLKEFHRSAASFTALDKNYLTPF  227

Query  471   FTTQNGDEDEQ-EELISNSRRARY  403
             FT+QNGDED+  +E + +SRR  +
Sbjct  228   FTSQNGDEDDDFDEPMPSSRRGDF  251



>ref|XP_002961414.1| hypothetical protein SELMODRAFT_76526, partial [Selaginella moellendorffii]
 gb|EFJ36674.1| hypothetical protein SELMODRAFT_76526, partial [Selaginella moellendorffii]
Length=499

 Score =   311 bits (798),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 196/441 (44%), Positives = 258/441 (59%), Gaps = 63/441 (14%)
 Frame = -1

Query  1956  LPPP--------RTGKD-QRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLI  1804
             +PPP         TG++   AA V I++QI+ML +SF++GH+LRR++   + EA  +L +
Sbjct  4     VPPPVNATSGSEETGEEATHAAAVSIMVQIIMLGISFLVGHMLRRNKIMVIHEAGTALGL  63

Query  1803  GLIVGGLANISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSP--------------  1666
             G ++           +IR+W NF+E+FFF            F L P              
Sbjct  64    GTLL---------FNSIRSWINFNEKFFFY-----------FLLPPIILYPFISSLRHDL  103

Query  1665  -KPFFSNFGAIVTFAIFGTFIASMVTGVLV---------YIGGVILLMYKLPFLECLMFG  1516
              KPFF NFGAI  FA  GT I++   G+L+         YI G +   Y +PFL CL +G
Sbjct  104   CKPFFHNFGAICVFAFLGTAISTFGVGILMQVFEISTIFYIFGTLNWTYSMPFLACLAYG  163

Query  1515  SLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLY----RT-MSLVRSNTSS  1351
             +LISATDPVTVL+IF  LG D NLYA VFGESVLNDA+ IS +    RT +S ++   S+
Sbjct  164   ALISATDPVTVLAIFHALGADANLYAYVFGESVLNDAV-ISYFLICGRTVLSFIKHPEST  222

Query  1350  GQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYM  1171
             G   F     FI  F GS S GV    +SA++F++ GL    L  LE CL  LFPY +Y 
Sbjct  223   G--IFSAFWFFIAIFIGSFSIGVLTSMLSAVMFRHCGLQEKGLAILESCLMALFPYLAYN  280

Query  1170  LAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIA  991
             +A+ L LSGIV+ILF GI MK YT  NLS  +Q+  +SFF ++S L+ETFVFIYMG  + 
Sbjct  281   MADALELSGIVAILFAGITMKYYTAPNLSSEAQQITTSFFGMLSKLSETFVFIYMGVALF  340

Query  990   MEQHSWTH--VgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLR  817
             +E+ SW +            +   +A NV+ CA LVN  R   R+IP   Q ALWY GLR
Sbjct  341   LEEQSWNNFGFTVFTIVSFLMKFEQAWNVYPCAALVNNFREPARQIPMNQQHALWYGGLR  400

Query  816   GAMAFALALQSVHDLPEGHGQ  754
             GAMAFALALQSV D+P+ HG+
Sbjct  401   GAMAFALALQSVQDIPDHHGR  421



>ref|XP_006878591.1| hypothetical protein AMTR_s00011p00253040 [Amborella trichopoda]
 gb|ERM94736.1| hypothetical protein AMTR_s00011p00253040 [Amborella trichopoda]
Length=211

 Score =   300 bits (769),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 182/229 (79%), Gaps = 24/229 (10%)
 Frame = -1

Query  1953  PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANI  1774
             P    GK+Q+AAG+GILLQIMMLVLSF+LGHVLRRH+FYYLPEASASLLIG+IVG LANI
Sbjct  6     PAGAPGKEQQAAGLGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGMIVGVLANI  65

Query  1773  SDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMV  1594
             S+TETNIR                         L PKPFFSNFGAIVTFAI GTFIAS V
Sbjct  66    SNTETNIRT-----------------------CLPPKPFFSNFGAIVTFAILGTFIASFV  102

Query  1593  TGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVL  1414
             TG+LVY+GG++ LMY+LPF+E +MFG+LISATDPVTVLSIFQELGTD+NLYALVFGESVL
Sbjct  103   TGILVYLGGLMFLMYRLPFVESIMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVL  162

Query  1413  NDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFI  1267
             NDAMAISLYRTMS   S+ SS Q+FF + VRF+ETF GSMS+   +G I
Sbjct  163   NDAMAISLYRTMSSFNSH-SSKQSFFWLIVRFLETFVGSMSSENRIGSI  210



>ref|XP_002980783.1| hypothetical protein SELMODRAFT_113308, partial [Selaginella 
moellendorffii]
 gb|EFJ17968.1| hypothetical protein SELMODRAFT_113308, partial [Selaginella 
moellendorffii]
Length=499

 Score =   308 bits (790),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 194/441 (44%), Positives = 257/441 (58%), Gaps = 63/441 (14%)
 Frame = -1

Query  1956  LPPP---RTGKDQ------RAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLI  1804
             +PPP    +G ++       AA V I++QI+ML +SF++GH+LRR++   + EA  +L +
Sbjct  4     VPPPVNATSGSEENGEEATHAAAVSIMVQIIMLGISFLVGHMLRRNKIMVIHEAGTALGL  63

Query  1803  GLIVGGLANISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSP--------------  1666
             G ++           +IR+W NF+E FFF            F L P              
Sbjct  64    GTLL---------FNSIRSWINFNESFFFY-----------FLLPPIILYPFISSLRHDL  103

Query  1665  -KPFFSNFGAIVTFAIFGTFIASMVTGVLV---------YIGGVILLMYKLPFLECLMFG  1516
              KPFF NFGAI  FA  GT I++   G+L+         YI G +   Y +PFL CL +G
Sbjct  104   CKPFFHNFGAICVFAFLGTAISTFGVGILMQVFEISTIFYIFGTLNWTYSMPFLACLAYG  163

Query  1515  SLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLY----RT-MSLVRSNTSS  1351
             +LISATDPVTVL+IF  LG D NLYA VFGESVLNDA+ IS +    RT +S ++   S+
Sbjct  164   ALISATDPVTVLAIFHALGADANLYAYVFGESVLNDAV-ISYFLICGRTVLSFIKHPEST  222

Query  1350  GQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYM  1171
             G   F     FI  F GS S GV    +SA++F++ GL    L  LE CL  LFPY +Y 
Sbjct  223   G--IFSAFWFFIAIFIGSFSIGVLTSMLSAVMFRHCGLQEKGLAILESCLMALFPYLAYN  280

Query  1170  LAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIA  991
             +A+ L LSGIV+ILF GI MK YT  NLS  +Q+  +SFF ++S L+ETFVFIYMG  + 
Sbjct  281   MADALELSGIVAILFAGITMKYYTAPNLSSEAQQITTSFFGMLSKLSETFVFIYMGVALF  340

Query  990   MEQHSWTH--VgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLR  817
             +E+ SW +            +   +A NV+ CA L+N  R   R+IP   Q ALWY GLR
Sbjct  341   LEEQSWNNFGFTVFTIVSFLMKFEQAWNVYPCAALLNNFREPARQIPMNQQHALWYGGLR  400

Query  816   GAMAFALALQSVHDLPEGHGQ  754
             GAMAFALALQSV D+P+ HG+
Sbjct  401   GAMAFALALQSVQDIPDHHGR  421



>gb|KCW75480.1| hypothetical protein EUGRSUZ_E04241 [Eucalyptus grandis]
Length=236

 Score =   298 bits (764),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 180/235 (77%), Positives = 196/235 (83%), Gaps = 34/235 (14%)
 Frame = -1

Query  1950  PP---RTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLA  1780
             PP   +TGK+Q+AAGVGILLQIMMLVLSF+LGHVLRR +FYYLPEASASLLIGL+VGGLA
Sbjct  21    PPGGGQTGKEQQAAGVGILLQIMMLVLSFVLGHVLRRRKFYYLPEASASLLIGLLVGGLA  80

Query  1779  NISDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIAS  1600
             N+SDTET+IR WFNFHEEFFFLFLLPPIIFQSGFSL+PKPFFSNFGAIVTFAI GTFI+S
Sbjct  81    NVSDTETSIRTWFNFHEEFFFLFLLPPIIFQSGFSLAPKPFFSNFGAIVTFAILGTFISS  140

Query  1599  MVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGES  1420
             +VTGVLVY+GGV+ LMYKLPF+ECLMFG+LISATDPVTVLSIFQELGTDVNLYALVFGES
Sbjct  141   VVTGVLVYLGGVMFLMYKLPFVECLMFGALISATDPVTVLSIFQELGTDVNLYALVFGES  200

Query  1419  VLNDAMAISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALL  1255
             VLNDA                               TF GSMSAGVGVGFISAL+
Sbjct  201   VLNDA-------------------------------TFVGSMSAGVGVGFISALI  224



>tpg|DAA60891.1| TPA: hypothetical protein ZEAMMB73_538503 [Zea mays]
Length=256

 Score =   296 bits (759),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             GK+Q+ AGVGILLQI MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TET
Sbjct  28    GKEQQVAGVGILLQISMLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTET  87

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
             N R WFNFHEEFFFLFLLPPIIFQSGFSLSPKPFF+NFGAIVTFAI GTFIAS+VTGVLV
Sbjct  88    NTRTWFNFHEEFFFLFLLPPIIFQSGFSLSPKPFFANFGAIVTFAILGTFIASVVTGVLV  147

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+  LMYKLP +ECLMFG+LISATDPVTVLSIFQELG+DVNLYALVFGESVLNDA  
Sbjct  148   YLGGLTFLMYKLPLVECLMFGALISATDPVTVLSIFQELGSDVNLYALVFGESVLNDADN  207

Query  1398  ISLYRTMSLVR  1366
             +   ++ S  R
Sbjct  208   VISQKSCSRRR  218


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -3

Query  1384  DNVISEKQYLVWTELFYDHCPIYRDIFWINVSRCWCWIHFSFAFQICWIG  1235
             DNVIS+K      ELFYD  PI R++ W NV RC  WI+   + QICWIG
Sbjct  206   DNVISQKSCSRRRELFYDDSPISRNLCWFNVIRCGSWIYLCSSIQICWIG  255



>ref|XP_008465529.1| PREDICTED: sodium/hydrogen exchanger 6-like [Cucumis melo]
Length=221

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  1185  YFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYM  1006
             Y  YMLAEG GLSGIVSILFTG+VMK YTYSNLS SSQ+FV+ FFHLISSLAETF+FIYM
Sbjct  10    YCRYMLAEGFGLSGIVSILFTGMVMKHYTYSNLSQSSQQFVAEFFHLISSLAETFIFIYM  69

Query  1005  GFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYS  826
             G DIAMEQHSW+HVGFIFFSILFIG+ARAANVF CAYLVNLVRPA+RKIP  HQKALWYS
Sbjct  70    GLDIAMEQHSWSHVGFIFFSILFIGVARAANVFSCAYLVNLVRPAHRKIPSNHQKALWYS  129

Query  825   GLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALDVVGDDYD  646
             GLRGAMAFALALQS+HDLP+GHGQTIFTATTAIVVLTVL+IGGSTGTMLEAL VVGD  D
Sbjct  130   GLRGAMAFALALQSIHDLPDGHGQTIFTATTAIVVLTVLLIGGSTGTMLEALQVVGDSDD  189



>ref|XP_003058860.1| monovalent Cation:Proton antiporter-1 family, partial [Micromonas 
pusilla CCMP1545]
 gb|EEH57315.1| monovalent Cation:Proton antiporter-1 family, partial [Micromonas 
pusilla CCMP1545]
Length=416

 Score =   271 bits (694),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 178/405 (44%), Positives = 249/405 (61%), Gaps = 1/405 (0%)
 Frame = -1

Query  1875  FILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETNIRAWFNFHEEffflfllppi  1696
             F+LG V++  +  +L EA A+LL+G+ VG     ++T  ++  W +F+EE FF  LLPPI
Sbjct  12    FVLGLVIKHFKITFLHEAGAALLMGMGVGLALWAANTSGSVTEWVDFNEEIFFFLLLPPI  71

Query  1695  iFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFG  1516
             IF+SGFSLS + FF+NFG I   A  GT I++ V G+ V+I G I L+  LPFL  L+FG
Sbjct  72    IFESGFSLSTRDFFNNFGGICALAFGGTLISTAVIGLCVWIFGAIGLITYLPFLHSLVFG  131

Query  1515  SLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLVRSNTSSGQNFF  1336
             +L+SATDPVTVL++FQELG +++LY+LVFGESVLNDA+AI  YR +     +  S  +  
Sbjct  132   ALVSATDPVTVLALFQELGVNIDLYSLVFGESVLNDAVAIVTYRALINFHQDGVSFVSLI  191

Query  1335  MITVRFIETFFGSMSAGVGVGFISALLFKYAGLD-IDNLQNLECCLFVLFPYFSYMLAEG  1159
                  F   F GS+  G      + + FK  G   + +  ++E  L ++ PY +Y  AE 
Sbjct  192   TAIAFFGYIFVGSVLVGTFFAVATTIFFKLIGGPLLASHTHIEASLVMIAPYCAYTAAES  251

Query  1158  LGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQH  979
             + LSGIV+ILF GIVM  YT  NLS  SQ+     F  +++LAETFVFIYMG  + +E  
Sbjct  252   VSLSGIVAILFCGIVMAHYTRPNLSPESQKNTKEIFKTLATLAETFVFIYMGVAMFLENQ  311

Query  978   SWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFA  799
             +W  + F   ++L     RA N+F     +N  R   R+IP  H   LW  GLRGA+AFA
Sbjct  312   AWKSIPFAIVALLACMGGRACNIFPLTKKINAWRSPGRQIPENHVHMLWICGLRGAIAFA  371

Query  798   LALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALDV  664
             LA  ++ DL    G+ I TAT  I++ TVL IGG+   +++ LD+
Sbjct  372   LASSTIRDLGVESGRVIRTATLMIIIFTVLTIGGACSYLVDRLDL  416



>ref|XP_004334873.1| Na+/H+ antiporter [Acanthamoeba castellanii str. Neff]
 gb|ELR12860.1| Na+/H+ antiporter [Acanthamoeba castellanii str. Neff]
Length=553

 Score =   255 bits (652),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 181/408 (44%), Positives = 255/408 (63%), Gaps = 11/408 (3%)
 Frame = -1

Query  1875  FILGHVLRR--HRFYYLPEASASLLIGLIVGGLANISDTETNIRAWFNFHEEffflfllp  1702
             F+  ++LR+   ++  L E  A++L G I+G           +++   F  EFF L LLP
Sbjct  39    FVSAYILRQLQSKWKILHETGAAILFGAIMGAFIRFFAKLERLQSIVQFDSEFFMLILLP  98

Query  1701  piiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYIGGVILLMYKLPFLECLM  1522
             PIIF+SG+++    FF+N G I   A  GT I++ + G L+Y+     L   L  LEC +
Sbjct  99    PIIFESGYNMRRSNFFNNIGRISVMAFVGTLISAGIFGGLLYVVVSWGLTLPLSLLECFI  158

Query  1521  FGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLVRSNTSSGQN  1342
             FGSLISATDPV+VL+IF++LG + NLYA VFGES+LNDA+AI L+R +S   S   S   
Sbjct  159   FGSLISATDPVSVLAIFKDLGVNKNLYASVFGESILNDAIAIVLFRALSTTTSKELSIGT  218

Query  1341  FFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAE  1162
                I + F  +F GS + GV +G +S+LLFKY     D    LE  L VL+ Y SY+LA+
Sbjct  219   LLNIVLEFTVSFAGSFAVGVTIGLLSSLLFKYT--QFDRYHTLELVLLVLYSYSSYLLAD  276

Query  1161  GLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQ  982
             GLGLSGIV+ILF G+VM  YTY NLS  +Q+F +  F +++SL+E FVF Y+G  +    
Sbjct  277   GLGLSGIVAILFCGVVMAHYTYHNLSPQAQKFSTKLFKVMASLSEMFVFAYLGLALFSFD  336

Query  981   HSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPAN--RKIPPKHQKALWYSGLRGAM  808
               +  +G IFFS+LF   +R  N+F  + ++N+ +  N  R+IP K Q  +W++GLRGAM
Sbjct  337   QVY-DIGLIFFSVLFCLASRLFNIFPLSLMINIYQRKNPKRQIPLKEQFVMWFAGLRGAM  395

Query  807   AFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTMLEALDV  664
             AFAL+L    D    H  +I T T  IV+LTV+++GG+TG +L  LDV
Sbjct  396   AFALSL----DTQTEHALSIHTTTLFIVLLTVMVMGGATGPLLILLDV  439



>ref|XP_002501423.1| monovalent Cation:Proton antiporter-1 family [Micromonas sp. 
RCC299]
 gb|ACO62681.1| monovalent Cation:Proton antiporter-1 family [Micromonas sp. 
RCC299]
Length=697

 Score =   257 bits (657),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 184/426 (43%), Positives = 257/426 (60%), Gaps = 15/426 (4%)
 Frame = -1

Query  1905  LLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETNIRAWFNFHEE  1726
             LLQ+  L  +F+LG  ++  + +++ EA A++L+G++VG + + S     I  W +F E 
Sbjct  82    LLQLFTLATAFVLGLGIKHLKIHWIHEAGATILLGVLVGLMISGSSVSDEITDWLDFDES  141

Query  1725  ffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLVYIGGVILLMYK  1546
              FF  LLPPIIF+ G+SL  + FF+NFGAI + A  GT I++   G  V+I G + L Y 
Sbjct  142   VFFFLLLPPIIFEGGYSLRSREFFANFGAICSLAFAGTTISTFAVGFFVWICGGVGLCYG  201

Query  1545  LPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLVR  1366
             LP L  L+FG+LISATDPVTVL+IFQELG +  LY+LVFGESVLNDA+AI LYRT  LV 
Sbjct  202   LPLLHALVFGALISATDPVTVLAIFQELGVNTELYSLVFGESVLNDAVAIVLYRT--LVN  259

Query  1365  SNTSSGQNFFMITVR---FIETFFGSMSAGVGVGFISALLFKYAGLD---------IDNL  1222
              N + G  F  +      F+  F GS++ GV     + L FK              +   
Sbjct  260   FN-NKGVTFISLMESAGFFLVIFVGSLAVGVLFAVSATLFFKVLNKHGAHEGHVTLLQRN  318

Query  1221  QNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLI  1042
              ++E  L ++ PY +Y  AE + LSGIV+ILF G+VM  YT  NLS  +       F ++
Sbjct  319   NHIEMALVMIAPYAAYAAAESMSLSGIVAILFCGMVMAHYTVPNLSPETAVNSKVVFKVL  378

Query  1041  SSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCAYLVNLVRPANRK  862
             ++LAETFVFIYMG  + +E+  W+ V F+  +++     RA NVF     VN  R   R+
Sbjct  379   ATLAETFVFIYMGVAMFLEEEKWSMVPFVLVAMVGCAGGRALNVFPVIRWVNEKRRPARR  438

Query  861   IPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivvltvliIGGSTGTM  682
             +P  H K L+ SGLRGA+AFALA  ++ DL E  G+ I TAT  IV+ TVL++GGS   +
Sbjct  439   VPDSHTKMLFVSGLRGAIAFALASTTIRDLGEASGKVIRTATLCIVIFTVLVVGGSCNYL  498

Query  681   LEALDV  664
             +   D+
Sbjct  499   VARWDL  504



>ref|XP_002521167.1| sodium/hydrogen exchanger 5, 6, putative [Ricinus communis]
 gb|EEF41217.1| sodium/hydrogen exchanger 5, 6, putative [Ricinus communis]
Length=139

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 130/155 (84%), Gaps = 17/155 (11%)
 Frame = -1

Query  1257  LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDS  1078
             LFKYAGL+IDNLQNLECCLFVLFPYFSYMLAEGLGL GIVSILF GIVMK Y+YSN S++
Sbjct  2     LFKYAGLEIDNLQNLECCLFVLFPYFSYMLAEGLGLFGIVSILFIGIVMKHYSYSNFSEN  61

Query  1077  SQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCA  898
             SQRFVS+FFHLISSLAETFVFIYMGFDIA+EQHSW                 AANVF CA
Sbjct  62    SQRFVSAFFHLISSLAETFVFIYMGFDIAIEQHSW-----------------AANVFSCA  104

Query  897   YLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALA  793
             YL+NLV+PA+R+ P KHQKAL YSGLRGA+AFALA
Sbjct  105   YLLNLVQPAHRQTPLKHQKALRYSGLRGALAFALA  139



>gb|ABS72024.1| putative sodium/hydrogen antiporter, partial [Olea europaea]
Length=155

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -1

Query  1152  LSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSW  973
             LSGIVSILFTGIVMK Y+YSNLSDSSQ+FVS+FFHLISSLAETFVFIYMGFDIAMEQHSW
Sbjct  1     LSGIVSILFTGIVMKHYSYSNLSDSSQKFVSAFFHLISSLAETFVFIYMGFDIAMEQHSW  60

Query  972   THVgfiffsilfigIARAANVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALA  793
             +HVGFIFFSILFIGIARAANVF C YLVN+ RP +R+IPPKHQKALWYSGLRGAMAFALA
Sbjct  61    SHVGFIFFSILFIGIARAANVFSCGYLVNMFRPVHRQIPPKHQKALWYSGLRGAMAFALA  120

Query  792   LQSVHDLPEGHGQtiftattaivvltvliIGGSTG  688
             LQSVHDLPEGHGQTIFTATTAIVVLTVL+IGGSTG
Sbjct  121   LQSVHDLPEGHGQTIFTATTAIVVLTVLLIGGSTG  155



>ref|XP_005850506.1| hypothetical protein CHLNCDRAFT_140336 [Chlorella variabilis]
 gb|EFN58404.1| hypothetical protein CHLNCDRAFT_140336 [Chlorella variabilis]
Length=584

 Score =   244 bits (624),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 157/390 (40%), Positives = 230/390 (59%), Gaps = 17/390 (4%)
 Frame = -1

Query  1938  GKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTET  1759
             G + +AA + +  QIM+++ +  LGH   R    ++ EA  +LL+G+++G +        
Sbjct  19    GSENQAA-LAVFSQIMLVIATLTLGHAASRRGINWIGEAGIALLLGVMIGLI--------  69

Query  1758  NIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMVTGVLV  1579
                 +  F ++ F L +LPPI+F++GF L    F +N   I T A  GT I++   G +V
Sbjct  70    ----FIGFKKDIFMLAILPPIMFEAGFRLDMDRFMANIDGIATLAFLGTLISTFAMGGVV  125

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             +  G + L      L  L+FGS++SATDPVTVL++FQ LG   +LY+LVFGESVLNDA+A
Sbjct  126   WGAGALGLCPPFSPLPALLFGSVVSATDPVTVLAVFQRLGAHPDLYSLVFGESVLNDAVA  185

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             + LYR++S   +   +          F+  F GSM  G G+  ++A + K       ++ 
Sbjct  186   MVLYRSLSTFLATPVTPAALAAAAASFVGVFVGSMLVGCGLALLAAAVVKTKHFRSRHMP  245

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
              LE  L VL  + SYMLA+GL LSGIVS LF GI M  Y   N+  +S+  VSSFF L+S
Sbjct  246   -LESSLVVLLAFASYMLADGLMLSGIVSALFCGIFMAAYAKPNMMPNSRDRVSSFFKLLS  304

Query  1038  SLAETFVFIYMGFDIAMEQHSWTH---VgfiffsilfigIARAANVFGCAYLVNLVRPAN  868
             +LAE FVF+Y+G  + M    + +   + F+    + + ++RA NV+ CA LVNL RP  
Sbjct  305   TLAEVFVFVYIGASVFMSGQGFDNRQLLPFLGVCFVALAVSRALNVWPCAALVNLGRPRE  364

Query  867   RKIPPKHQKALWYSGLRGAMAFALALQSVH  778
              +IP  HQ  LW+SGLRGAMAFA+AL++  
Sbjct  365   LRIPQSHQVMLWWSGLRGAMAFAIALEAAE  394



>gb|KDO39930.1| hypothetical protein CISIN_1g037375mg [Citrus sinensis]
Length=183

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 141/176 (80%), Gaps = 6/176 (3%)
 Frame = -1

Query  1953  PPPRTGKDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANI  1774
             P     K+Q+AAGVGILLQIMMLVLSFILGHVLRRH+FYYLPEASASLLIGLIV  L NI
Sbjct  14    PHGSPAKEQQAAGVGILLQIMMLVLSFILGHVLRRHKFYYLPEASASLLIGLIVSALTNI  73

Query  1773  SDTETNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFIASMV  1594
             S+TETNIR  F+F+E    +     +I  S      KPFFSNFGAIVTFAIFGTF+ASMV
Sbjct  74    SNTETNIRYSFSFNELICSVATCLLMILFSW----QKPFFSNFGAIVTFAIFGTFLASMV  129

Query  1593  TGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFG  1426
             TG+LVY+GGV+ +MY+LPF+ECLMFG+LISATDP+TVLSIFQ  GT   L+ L+ G
Sbjct  130   TGILVYLGGVMFVMYRLPFVECLMFGALISATDPITVLSIFQ--GTCALLFCLLTG  183



>ref|NP_001184191.1| uncharacterized protein LOC100216016 [Xenopus (Silurana) tropicalis]
Length=576

 Score =   239 bits (611),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 184/517 (36%), Positives = 286/517 (55%), Gaps = 18/517 (3%)
 Frame = -1

Query  1965  EELLPPPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGL  1798
             E+ + P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+
Sbjct  34    EKPIIPVQTGVQAQQEEQSSGMSIFFSLLVLGICIILVHLLIKYRLHFLPESVAVVSLGI  93

Query  1797  IVGGLANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFA  1624
             ++G +  I +++   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA
Sbjct  94    LMGAVIKIIESQKLANWKEEEMFRPNTFFLVLLPPIIFESGYSLHKGNFFQNIGSITLFA  153

Query  1623  IFGTFIASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNL  1444
             +FGT I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L
Sbjct  154   VFGTAISAFIVGGGIYFLGQADVIYKLTMTDSFAFGSLISAVDPVATIAIFNALNVDPVL  213

Query  1443  YALVFGESVLNDAMAISLYRTMS-LVRSN---TSSGQNFFMITVRFIETFFGSMSAGVGV  1276
               LVFGES+LNDA++I L  T   L R N    SS Q F      F++ FFGS + G   
Sbjct  214   NMLVFGESILNDAVSIVLTNTAEGLNRGNMADVSSWQTFLQALAYFLKMFFGSAALGTLT  273

Query  1275  GFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTY  1096
             G ISAL+ K+  LD+    +LE  + ++F Y  Y L+EG+ LSGI++ILF+GIVM  YT+
Sbjct  274   GLISALVLKH--LDLRKTPSLEFGMMIIFAYLPYGLSEGISLSGIMAILFSGIVMSHYTH  331

Query  1095  SNLSDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAA  916
              NLS  +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ + + RA 
Sbjct  332   HNLSPVTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLLGRAV  390

Query  915   NVFGCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftat  736
             N+F  +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T
Sbjct  391   NIFPLSYLLNFFR--DHKITPKMMYIMWFSGLRGAIPYALSLHLELE-PIEKRQLIGTTT  447

Query  735   taivvltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSG  556
               IV+ T+LI+GG T  ++  +D+                + E     I   +  E +  
Sbjct  448   IIIVLFTILILGGGTMPLIRLIDIEDSKARRRSKKDVNLSKTEKMGNTIESEHLSELTEE  507

Query  555   SRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
                   +++   +   F  +D  YL PFFT +   ED
Sbjct  508   EYEAQYIRQ--HNLKGFMWLDAKYLNPFFTRRLTRED  542



>ref|XP_010616535.1| PREDICTED: sodium/hydrogen exchanger 8 [Fukomys damarensis]
Length=576

 Score =   238 bits (608),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 193/517 (37%), Positives = 284/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  39    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  99    IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSIALFAVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q FF     F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFFQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  451

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  452   LFTILLLGGSTMPLIRLMDIEDAKVRRRSKKDVNLSKTEKMGNTI------ESEHLSELT  505

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  506   EEEYEAHYIRRQDLKGFMWLDAKYLNPFFTRRLTQED  542



>ref|XP_005002871.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Cavia porcellus]
Length=576

 Score =   238 bits (608),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 193/517 (37%), Positives = 284/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  39    PVQTGEQAQQEEQSSGMTIFFTLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  99    IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R NTS  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRKNTSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  451

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  452   LFTILLLGGSTMPLIRLMDIEDAKARRRSKKDVNLSKTEKMGNTI------ESEHLSELT  505

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  506   EEEYEAHYIRRQDLKGFLWLDAKYLNPFFTRRLTQED  542



>ref|XP_005325277.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Ictidomys 
tridecemlineatus]
Length=580

 Score =   238 bits (607),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 193/517 (37%), Positives = 284/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  43    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  103   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R NTS  SG Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKNTSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  455

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  456   LFTILLLGGSTMPLIRLMDIEDAKARRRSKKDVNLSKTEKMGNTI------ESEHLSELT  509

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  510   EEEYEAHYIRRQDLKGFMWLDAKYLNPFFTRRLTQED  546



>gb|EMS66231.1| Sodium/hydrogen exchanger 6 [Triticum urartu]
Length=219

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 145/187 (78%), Gaps = 15/187 (8%)
 Frame = -1

Query  1578  YIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFGESVLNDAMA  1399
             Y+GG+  LMYKLP +ECLMFG+LISATDPVTVLSIFQELG+DVN +A  + +  L     
Sbjct  48    YLGGLTFLMYKLPLVECLMFGALISATDPVTVLSIFQELGSDVN-FACKYSQYFLVPMTN  106

Query  1398  ISLYRTMSLVRSNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISALLFKYAGLDIDNLQ  1219
             +    TMS VRSN + G+N FM+ ++F+E F GSMS+ + + ++             +LQ
Sbjct  107   L----TMSSVRSNAAGGENIFMMILQFLEIFVGSMSSVLKLRYVYYF----------SLQ  152

Query  1218  NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDSSQRFVSSFFHLIS  1039
             NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG+VMK YTYSNLSD+SQRFVS+FFHL+S
Sbjct  153   NLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGMVMKHYTYSNLSDNSQRFVSAFFHLLS  212

Query  1038  SLAETFV  1018
             SLAETFV
Sbjct  213   SLAETFV  219


 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -1

Query  1890  MLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLANISDTETN  1756
             MLVLSF+LGHVLRRHRFYYLPEASASLLIGL+VGGLANIS+TETN
Sbjct  1     MLVLSFVLGHVLRRHRFYYLPEASASLLIGLVVGGLANISNTETN  45



>ref|XP_006929730.1| PREDICTED: LOW QUALITY PROTEIN: sodium/hydrogen exchanger 8 [Felis 
catus]
Length=596

 Score =   238 bits (608),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  59    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  118

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F     FL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  119   IKIIEFKKLANWKEEEMFRPNMXFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  178

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  179   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  238

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  239   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  298

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  299   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  356

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +  ARA N+F  
Sbjct  357   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFARAVNIFPL  415

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  416   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  471

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  472   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTI------ESEHLSELT  525

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  526   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  562



>ref|XP_007078076.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Panthera tigris 
altaica]
Length=580

 Score =   238 bits (606),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 193/517 (37%), Positives = 284/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  43    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  103   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +  ARA N+F  
Sbjct  341   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFARAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  455

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  456   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTI------ESEHLSELT  509

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  510   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  546



>ref|XP_007078075.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Panthera tigris 
altaica]
Length=596

 Score =   238 bits (607),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 193/517 (37%), Positives = 284/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  59    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  118

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  119   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  178

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  179   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  238

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  239   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  298

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  299   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  356

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +  ARA N+F  
Sbjct  357   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFARAVNIFPL  415

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  416   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  471

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  472   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTI------ESEHLSELT  525

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  526   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  562



>ref|XP_004585949.1| PREDICTED: sodium/hydrogen exchanger 8 [Ochotona princeps]
Length=576

 Score =   238 bits (606),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 189/513 (37%), Positives = 283/513 (55%), Gaps = 20/513 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  39    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  99    IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G+  G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGILTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  451

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I   +  E +      
Sbjct  452   LFTILLLGGSTMPLIRLMDIEDAKARRRSKKDVNLSKTEKMGNTIESEHLSELTEEEYEA  511

Query  543   MKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
               +K   +    F  +D  YL PFFT +   ED
Sbjct  512   HYIKR--QDLKGFLWLDAKYLNPFFTRRLTQED  542



>ref|XP_004636167.1| PREDICTED: sodium/hydrogen exchanger 8 [Octodon degus]
Length=608

 Score =   238 bits (606),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 284/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  71    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  130

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I +++   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  131   IKIIESQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  190

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  191   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  250

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  251   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  310

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  311   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  368

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  369   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  427

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  428   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  483

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  484   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTI------ESEHLSELT  537

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  538   EEEYEAHYIRRQDLKGFMWLDAKYLNPFFTRRLTQED  574



>ref|XP_007439823.1| PREDICTED: sodium/hydrogen exchanger 8-like, partial [Python 
bivittatus]
Length=571

 Score =   237 bits (604),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 184/512 (36%), Positives = 282/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  34    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  93

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I +++   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++ GT 
Sbjct  94    IKIIESQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVIGTA  153

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   L+YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  154   ISAFIVGGGIYFLGQADLIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  213

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R +TS  SG Q F      F++ FFGS + G   G ISA
Sbjct  214   GESILNDAVSIVLTNTAEGLTREHTSDVSGWQTFLQALAYFLKMFFGSAALGTLTGLISA  273

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  274   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  331

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  332   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  390

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  391   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  447

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  448   FTILLLGGGTMPLIRLIDIEDSKARRKNKKDINLSKTEKMGNTIESEHLSELTEEEYEAH  507

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  508   YIKR--QDLKGFMWLDVKYLNPFFTRRLTQED  537



>ref|XP_006048391.1| PREDICTED: sodium/hydrogen exchanger 8 [Bubalus bubalis]
Length=577

 Score =   237 bits (604),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 284/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  39    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  99    IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  451

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+ G              + E     +      ES   S   
Sbjct  452   LFTILLLGGSTMPLIRLVDIEGAKARRRGRKDVNLSKTEKMGNTV------ESEHLSELT  505

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  506   EEEYEAHYIRRQDLKGFLWLDAKYLNPFFTRRLTQED  542



>ref|XP_006175048.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Camelus ferus]
 ref|XP_006206727.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Vicugna pacos]
 ref|XP_010956924.1| PREDICTED: sodium/hydrogen exchanger 8 [Camelus bactrianus]
 ref|XP_010976955.1| PREDICTED: sodium/hydrogen exchanger 8 [Camelus dromedarius]
Length=576

 Score =   236 bits (603),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 189/513 (37%), Positives = 282/513 (55%), Gaps = 20/513 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  39    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  99    IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRKNVSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  451

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I   +  E +      
Sbjct  452   LFTILLLGGSTMPLIRLMDIEDAKARRRSKKDVNLSKTEKMGNTIESEHLSELTEEEYEA  511

Query  543   MKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
               +K   +    F  +D  YL PFFT +   ED
Sbjct  512   HYIKR--QDLKGFLWLDAKYLNPFFTRRLTQED  542



>ref|XP_010833386.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Bison bison 
bison]
Length=577

 Score =   236 bits (603),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 284/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  39    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  99    IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSIALFAVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  451

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+ G              + E     +      ES   S   
Sbjct  452   LFTILLLGGSTMPLIRLVDIEGAKARRRGRKDVNLSKTEKMGNTV------ESEHLSELT  505

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  506   EEEYEAHYIRRQDLKGFLWLDAKYLNPFFTRRLTRED  542



>ref|XP_003583052.2| PREDICTED: LOW QUALITY PROTEIN: sodium/hydrogen exchanger 8 isoform 
X1 [Bos taurus]
 ref|XP_005215118.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Bos taurus]
 ref|XP_005899693.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Bos mutus]
Length=577

 Score =   236 bits (603),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 284/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  39    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  99    IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  451

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+ G              + E     +      ES   S   
Sbjct  452   LFTILLLGGSTMPLIRLVDIEGAKARRRGRKDVNLSKTEKMGNTV------ESEHLSELT  505

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  506   EEEYEAHYIRRQDLKGFLWLDAKYLNPFFTRRLTRED  542



>ref|XP_005635222.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Canis lupus 
familiaris]
Length=580

 Score =   236 bits (602),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  43    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  103   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  455

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  456   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTI------ESEHLSELT  509

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  510   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  546



>ref|XP_010020947.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Nestor notabilis]
Length=590

 Score =   236 bits (603),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 184/512 (36%), Positives = 280/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G  
Sbjct  53    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAF  112

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  113   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  172

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  173   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  232

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  233   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  292

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  293   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  350

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  351   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  409

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  410   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  466

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  467   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  526

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  527   YIKR--QDLKGFMWLDAKYLNPFFTRRLTQED  556



>ref|XP_003787736.1| PREDICTED: sodium/hydrogen exchanger 8 [Otolemur garnettii]
Length=581

 Score =   236 bits (602),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLIDIEDAKARRRNKKDVNLSKTEKMGNTI------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYIRRQDLKGFMWLDAKYLNPFFTRRLTQED  547



>ref|NP_001034364.1| sodium/hydrogen exchanger 8 [Gallus gallus]
 sp|Q5ZJ75.1|SL9A8_CHICK RecName: Full=Sodium/hydrogen exchanger 8; AltName: Full=Na(+)/H(+) 
exchanger 8; Short=NHE-8; AltName: Full=Solute carrier 
family 9 member 8 [Gallus gallus]
 emb|CAG32218.1| hypothetical protein RCJMB04_20d15 [Gallus gallus]
Length=574

 Score =   236 bits (601),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 185/512 (36%), Positives = 280/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+I+G  
Sbjct  37    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGIIMGAF  96

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  97    IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  156

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  157   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  216

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  217   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  276

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  277   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  334

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  335   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  393

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  394   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  450

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              TVL++GG T  ++  + +                + E     I   +  E + G     
Sbjct  451   FTVLLLGGGTMPLIRLIGIEDSKARKRNKKDVNLSKTEKMGNTIESEHLSELTEGEYEAQ  510

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  511   YIKR--QDLKGFMWLDAKYLNPFFTRRLTQED  540



>ref|XP_854123.2| PREDICTED: sodium/hydrogen exchanger 8 isoform X4 [Canis lupus 
familiaris]
Length=581

 Score =   236 bits (602),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTI------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  547



>ref|NP_056081.1| sodium/hydrogen exchanger 8 isoform 2 [Homo sapiens]
 sp|Q9Y2E8.4|SL9A8_HUMAN RecName: Full=Sodium/hydrogen exchanger 8; AltName: Full=Na(+)/H(+) 
exchanger 8; Short=NHE-8; AltName: Full=Solute carrier 
family 9 member 8 [Homo sapiens]
 emb|CAH18432.1| hypothetical protein [Homo sapiens]
 gb|AAI12214.1| Na+/H+ exchanger isoform 8 [Homo sapiens]
 gb|EAW75649.1| solute carrier family 9 (sodium/hydrogen exchanger), member 8, 
isoform CRA_c [Homo sapiens]
 dbj|BAG09907.1| solute carrier family 9, member 8 [synthetic construct]
 gb|AIC56035.1| SLC9A8, partial [synthetic construct]
Length=581

 Score =   236 bits (602),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLMDIEDAKAHRRNKKDVNLSKTEKMGNTV------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  547



>ref|XP_514716.3| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Pan troglodytes]
 ref|XP_003809309.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Pan paniscus]
Length=581

 Score =   236 bits (602),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLMDIEDTKARRRNKKDVNLSKTEKMGNTV------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  547



>ref|XP_006018211.1| PREDICTED: sodium/hydrogen exchanger 8 [Alligator sinensis]
Length=576

 Score =   236 bits (601),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 281/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  39    PVQTGVEAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I +++   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  99    IKIIESQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFIVGGGIYFLGQAEVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRDNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K   +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKQ--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ + + RA N+F  
Sbjct  337   VTQILMQQTLRTVAFMCETCVFAFLGMSIFSFPHKF-EMSFVIWCIVLVLLGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  396   SYLINFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  452

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  453   FTILLLGGGTMPLIRLIDIEDSKARRRNKKDITLSKTEKMGNTIESEHLSELTEEEYEAQ  512

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  513   YIK--RQDLKGFMWLDAKYLNPFFTRRLTQED  542



>ref|XP_004412579.1| PREDICTED: sodium/hydrogen exchanger 8 isoform 2 [Odobenus rosmarus 
divergens]
Length=581

 Score =   236 bits (601),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLVDIEDAKARRRSKKDVNLSKTEKMGNTI------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  547



>ref|XP_006267480.1| PREDICTED: sodium/hydrogen exchanger 8 [Alligator mississippiensis]
Length=576

 Score =   236 bits (601),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 281/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  39    PVQTGVEAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I +++   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  99    IKIIESQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFIVGGGIYFLGQAEVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRDNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K   +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKQ--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ + + RA N+F  
Sbjct  337   VTQILMQQTLRTVAFMCETCVFAFLGMSIFSFPHKF-EMSFVIWCIVLVLLGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  396   SYLINFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  452

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  453   FTILLLGGGTMPLIRLIDIEDSKARRRNKKDITLSKTEKMGNTIESEHLSELTEEEYEAQ  512

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  513   YIK--RQDLKGFMWLDAKYLNPFFTRRLTQED  542



>ref|XP_005635221.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Canis lupus 
familiaris]
Length=596

 Score =   236 bits (602),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  59    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  118

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  119   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  178

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  179   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  238

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  239   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  298

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  299   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  356

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  357   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  415

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  416   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  471

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  472   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTI------ESEHLSELT  525

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  526   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  562



>ref|XP_004062389.1| PREDICTED: sodium/hydrogen exchanger 8 isoform 1 [Gorilla gorilla 
gorilla]
Length=581

 Score =   236 bits (601),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTV------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  547



>ref|XP_003932609.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Saimiri boliviensis 
boliviensis]
Length=576

 Score =   236 bits (601),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  39    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  99    IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  451

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  452   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTV------ESEHLSELT  505

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  506   EEEYEAHYIRRQDLKGFMWLDAKYLNPFFTRRLTQED  542



>ref|XP_004412580.1| PREDICTED: sodium/hydrogen exchanger 8 isoform 3 [Odobenus rosmarus 
divergens]
Length=580

 Score =   236 bits (601),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  43    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  103   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  455

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  456   LFTILLLGGSTMPLIRLVDIEDAKARRRSKKDVNLSKTEKMGNTI------ESEHLSELT  509

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  510   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  546



>ref|XP_010382151.1| PREDICTED: sodium/hydrogen exchanger 8 [Rhinopithecus roxellana]
Length=581

 Score =   236 bits (601),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTV------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYIRRQDLKGFMWLDAKYLNPFFTRRLTQED  547



>ref|XP_007936515.1| PREDICTED: sodium/hydrogen exchanger 8 [Orycteropus afer afer]
Length=581

 Score =   236 bits (601),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLMDIEDAKVRRRNKKDVNLSKTEKMGNTV------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYIRRQDLKGFMWLDAKYLNPFFTRRLTQED  547



>ref|XP_008994372.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Callithrix 
jacchus]
Length=580

 Score =   236 bits (601),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  43    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  103   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  455

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  456   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTV------ESEHLSELT  509

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  510   EEEYEAHYIRRQDLKGFMWLDAKYLNPFFTRRLTQED  546



>ref|XP_002747709.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Callithrix 
jacchus]
Length=581

 Score =   235 bits (600),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTV------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYIRRQDLKGFMWLDAKYLNPFFTRRLTQED  547



>ref|XP_003214267.1| PREDICTED: sodium/hydrogen exchanger 8 [Meleagris gallopavo]
Length=574

 Score =   235 bits (600),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 184/512 (36%), Positives = 280/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  37    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  96

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  97    IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  156

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  157   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  216

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  217   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  276

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  277   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  334

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  335   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  393

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  394   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  450

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              TVL++GG T  ++  +D+                + E     I   +  E +       
Sbjct  451   FTVLLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  510

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  511   YIK--RQDLKGFMWLDAKYLNPFFTRRLTQED  540



>dbj|BAA76783.2| KIAA0939 protein [Homo sapiens]
Length=595

 Score =   236 bits (601),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  58    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  117

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  118   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  177

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  178   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  237

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  238   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISA  297

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  298   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  355

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  356   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  414

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  415   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  470

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  471   LFTILLLGGSTMPLIRLMDIEDAKAHRRNKKDVNLSKTEKMGNTV------ESEHLSELT  524

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  525   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  561



>ref|XP_002830455.2| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Pongo abelii]
 ref|XP_008012605.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_008012622.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Chlorocebus 
sabaeus]
Length=581

 Score =   235 bits (600),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTV------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYIRRQDLKGFMWLDAKYLNPFFTRRLTQED  547



>ref|XP_009810475.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Gavia stellata]
Length=591

 Score =   236 bits (601),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 184/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G  
Sbjct  54    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAF  113

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  114   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  173

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  174   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  233

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  234   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  293

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  294   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  351

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  352   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  410

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  411   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  467

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  468   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  527

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  528   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  557



>ref|XP_006129521.1| PREDICTED: sodium/hydrogen exchanger 8 [Pelodiscus sinensis]
Length=576

 Score =   235 bits (599),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 181/512 (35%), Positives = 280/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  39    PVQTGVEAQQEEQSSGMSIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I +++   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  99    IKIIESQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFIVGGGIYFLGQAEVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVR---SNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R   S+ S  Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRESMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQLLMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  452

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  453   FTILLLGGGTMPLIRLIDIEDSKARRRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAH  512

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  513   YIKR--QDLKGFMWLDAKYLNPFFTRRLTQED  542



>ref|XP_010125473.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Chlamydotis 
macqueenii]
Length=590

 Score =   235 bits (600),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 184/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  53    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  112

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  113   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  172

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  173   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  232

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  233   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  292

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  293   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  350

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  V F+ + I+ +   RA N+F  
Sbjct  351   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EVSFVIWCIVLVLFGRAVNIFPL  409

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  410   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  466

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  467   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  526

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  527   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  556



>ref|XP_006881689.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Elephantulus 
edwardii]
Length=581

 Score =   235 bits (599),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLMDIEDAKARRRSKKDVNLSKTEKMGNTI------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYIRRQDLKGFMWLDVKYLNPFFTRRLTQED  547



>ref|XP_003252969.1| PREDICTED: sodium/hydrogen exchanger 8 isoform 1 [Nomascus leucogenys]
Length=581

 Score =   235 bits (599),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 190/518 (37%), Positives = 287/518 (55%), Gaps = 30/518 (6%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  456

Query  723   vltvliIGGSTGTMLEALDVVG-----DDYDsslgtgtlgerlegSNGYIAPSYDEESSS  559
             + T+L++GGST  ++  +D+        +      + T        + +++   +EE  +
Sbjct  457   LFTILLLGGSTMPLIRLMDIEDARARRRNKKDVNLSKTEKMGNTVESEHLSELTEEEYEA  516

Query  558   GSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
                 +  LK        F  +D  YL PFFT +   ED
Sbjct  517   HYIRRQDLK-------GFMWLDAKYLNPFFTRRLTQED  547



>ref|XP_005014219.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X4 [Anas platyrhynchos]
Length=578

 Score =   235 bits (599),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  41    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  100

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  101   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  160

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  161   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  220

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  221   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  280

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  281   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  338

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +    F+ + I+ +   RA N+F  
Sbjct  339   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-ETSFVIWCIVLVLFGRAVNIFPL  397

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  398   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  454

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  455   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  514

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  515   YIKR--QDLKGFMWLDAKYLNPFFTRRLTQED  544



>ref|XP_007059904.1| PREDICTED: sodium/hydrogen exchanger 8 [Chelonia mydas]
Length=647

 Score =   236 bits (603),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 181/512 (35%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  110   PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  169

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I +++   N +    F    FFL LLPPIIF+SG+SL    FF N G+I+ F++FGT 
Sbjct  170   IKIIESQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSIILFSVFGTA  229

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  230   ISAFIVGGGIYFLGQAEVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  289

Query  1428  GESVLNDAMAISLYRTMS-LVRSN---TSSGQNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N    S  Q F      F++ FFGS + G   G ISA
Sbjct  290   GESILNDAVSIVLTNTAEGLTRENMSEVSEWQTFLQALGYFLKMFFGSAALGTLTGLISA  349

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  350   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  407

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  408   VTQILMQQTLRAVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  466

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  467   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  523

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L +GG T  ++  +D+                + E     I   +  E +       
Sbjct  524   FTILFLGGGTMPLIRLIDIEDSKARRRNKKNINLSKTEKMGNTIESEHLSELTEEEYEAH  583

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  584   YIKR--QDLKGFMWLDARYLNPFFTRRLTQED  613



>ref|XP_005286277.1| PREDICTED: sodium/hydrogen exchanger 8 [Chrysemys picta bellii]
Length=576

 Score =   235 bits (599),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 281/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  39    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I +++   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  99    IKIIESQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFIVGGGIYFLGQAEVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRAVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  452

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  453   FTILLLGGGTMPLIRLIDIEDSKARRRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAH  512

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  513   YIKR--QDLKGFMWLDARYLNPFFTRRLTQED  542



>ref|XP_006921966.1| PREDICTED: sodium/hydrogen exchanger 8 [Pteropus alecto]
Length=580

 Score =   235 bits (599),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 284/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  43    PVQTGEQAQQEEQSSGMTIFFTLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  103   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  455

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D + D          +        G+       ES   S   
Sbjct  456   LFTILLLGGSTMPLIRLVD-IEDAKVHRRNKKDVNLSKTEKMGHTV-----ESEHLSELT  509

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  510   EEEYEAHYIRRQDLKGFLWLDAKYLNPFFTRRLTQED  546



>ref|XP_006839255.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Chrysochloris 
asiatica]
Length=582

 Score =   235 bits (599),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 187/513 (36%), Positives = 282/513 (55%), Gaps = 20/513 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  45    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  104

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  105   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  164

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  165   ISAFIVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  224

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  225   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  284

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  285   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  342

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  343   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  401

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  402   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  457

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I   +  E +      
Sbjct  458   LFTILLLGGSTMPLIRLMDIEDAKARRRSKKDVNLSKTEKMGNTIEAEHLSELTEEEYEA  517

Query  543   MKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
               ++   +    F  +D  YL PFFT +   ED
Sbjct  518   HYIRR--QDLKGFMWLDVKYLNPFFTRRLTQED  548



>ref|XP_010190306.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Mesitornis unicolor]
Length=591

 Score =   235 bits (599),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 280/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  54    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  113

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  114   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  173

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  174   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  233

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  234   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  293

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  294   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  351

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  352   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  410

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  411   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  467

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  468   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  527

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  528   YIKR--QDLKGFMWLDARYLNPFFTRRLTQED  557



>ref|XP_008570064.1| PREDICTED: sodium/hydrogen exchanger 8 [Galeopterus variegatus]
Length=580

 Score =   234 bits (598),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 282/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G  
Sbjct  43    PVQTGEQAQQEEQSSGMTIFFTLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAF  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  103   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  455

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  456   LFTILLLGGSTMPLIRFMDIEDAKARRRNKKDVNLSKTEKMGNTI------ESEHLSELT  509

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  510   EEEYEAHYIRRQDLKGFMWLDAKYLNPFFTRRLTQED  546



>ref|XP_006141339.1| PREDICTED: sodium/hydrogen exchanger 8 [Tupaia chinensis]
Length=581

 Score =   234 bits (598),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLRALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRRTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q + T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLVGTTTIIIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLMDIEDAKARRRSRKDVNLSKTEKMGNTI------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYIRRQDLKGFMWLDAKYLNPFFTRRLTRED  547



>ref|XP_004370312.1| PREDICTED: sodium/hydrogen exchanger 8 isoform 2 [Trichechus 
manatus latirostris]
Length=580

 Score =   234 bits (598),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 284/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  43    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  103   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SGQNFFMITV-RFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG   F+  +  F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWRTFLQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  455

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  456   LFTILLLGGSTMPLIRLMDIEDAKAHRRNKKDVNLSKTEKMGNTI------ESEHLSELT  509

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  510   EEEYEAHYIRRQDLKGFMWLDAKYLNPFFTRRLTQED  546



>ref|XP_005146861.1| PREDICTED: sodium/hydrogen exchanger 8 [Melopsittacus undulatus]
Length=591

 Score =   235 bits (599),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 280/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  54    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  113

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  114   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  173

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  174   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  233

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  234   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  293

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  294   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  351

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  352   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  410

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  411   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  467

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  468   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  527

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  528   YIKR--QDLKGFMWLDAKYLNPFFTRRLTQED  557



>ref|XP_004014928.1| PREDICTED: sodium/hydrogen exchanger 8 [Ovis aries]
Length=605

 Score =   235 bits (600),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  68    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  127

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  128   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  187

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  188   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  247

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  248   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  307

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG  LSGI++ILF+GIVM  YT+ NLS 
Sbjct  308   LVLKH--VDLRKTPSLEFGMMIIFAYLPYGLAEGTSLSGIMAILFSGIVMSHYTHHNLSP  365

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  366   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  424

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  425   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  480

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+ G              + E     +      ES   S   
Sbjct  481   LFTILLLGGSTMPLIRLVDIEGAKARRRGRKDVNLSKTEKMGNTV------ESEHLSELT  534

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  535   EEEYEAHYIRRQDLKGFLWLDAKYLNPFFTRRLTQED  571



>ref|XP_004746278.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X3 [Mustela putorius 
furo]
 ref|XP_004785751.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X6 [Mustela putorius 
furo]
Length=581

 Score =   234 bits (598),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 190/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIQYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  +V
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVLV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLMDIEDAKARRRSKKDVNLSKTEKMGNTI------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  547



>ref|XP_005604764.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Equus caballus]
 ref|XP_005604765.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Equus caballus]
 ref|XP_008532215.1| PREDICTED: sodium/hydrogen exchanger 8 [Equus przewalskii]
 ref|XP_008532216.1| PREDICTED: sodium/hydrogen exchanger 8 [Equus przewalskii]
Length=576

 Score =   234 bits (598),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 190/518 (37%), Positives = 286/518 (55%), Gaps = 30/518 (6%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    +++++ G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  39    PVQTGEQAQQEEQSNGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  99    IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRKNVSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  451

Query  723   vltvliIGGSTGTMLEALDVVG-----DDYDsslgtgtlgerlegSNGYIAPSYDEESSS  559
             + T+L++GGST  ++  +D+        +      + T        + +++   +EE  +
Sbjct  452   LFTILLLGGSTMPLIRLMDIEDAKARRKNKKDVNLSKTEKMGNTVESEHLSELTEEEYEA  511

Query  558   GSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
                 +  LK        F  +D  YL PFFT +   ED
Sbjct  512   HYVRRQDLK-------GFLWLDAKYLNPFFTRRLTQED  542



>ref|XP_004746277.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Mustela putorius 
furo]
 ref|XP_004785750.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X5 [Mustela putorius 
furo]
Length=580

 Score =   234 bits (598),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 190/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G +
Sbjct  43    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIQYRLHFLPESVAVVSLGILMGAV  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  103   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  +V
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVLV  455

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  456   LFTILLLGGSTMPLIRLMDIEDAKARRRSKKDVNLSKTEKMGNTI------ESEHLSELT  509

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  510   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  546



>ref|XP_009948945.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Leptosomus discolor]
Length=591

 Score =   234 bits (598),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 280/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  54    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  113

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  114   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  173

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  174   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  233

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  234   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  293

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  294   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  351

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  352   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  410

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  411   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  467

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  468   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  527

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  528   YIKR--QDLKGFMWLDAKYLNPFFTRRLTQED  557



>ref|XP_008060132.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Tarsius syrichta]
Length=581

 Score =   234 bits (598),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLVDIEDARARRRSRKDVNLSKTEKMGNTV------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYVRRQDLKGFLWLDAKYLNPFFTRRLTQED  547



>ref|XP_002913048.1| PREDICTED: sodium/hydrogen exchanger 8-like [Ailuropoda melanoleuca]
Length=664

 Score =   236 bits (602),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  127   PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  186

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  187   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  246

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  247   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  306

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  307   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  366

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  367   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  424

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  425   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  483

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  484   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  539

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  540   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTI------ESEHLSELT  593

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  594   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  630



>ref|XP_010083356.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Pterocles gutturalis]
Length=581

 Score =   234 bits (597),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  44    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  104   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  457

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  458   FTILLLGGGTMPLIRLIDIEDSKARKKNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  517

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  518   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  547



>ref|XP_007185376.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X3 [Balaenoptera 
acutorostrata scammoni]
Length=583

 Score =   234 bits (597),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  46    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  105

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  106   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  165

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  166   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  225

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  226   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  285

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  286   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  343

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  344   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  402

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q + T T +IV
Sbjct  403   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLVGTTTISIV  458

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++   DV                + E     I      ES   S   
Sbjct  459   LFTILLLGGSTMPLIRFADVEDARARRRSKKDVNLSKTEKMGNTI------ESEHLSELT  512

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  513   EEEYEAHYIRRQDLKGFLWLDAKYLNPFFTRRLTQED  549



>ref|XP_010307884.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Balearica regulorum 
gibbericeps]
Length=581

 Score =   234 bits (597),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  44    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  104   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  457

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  458   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  517

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  518   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  547



>ref|XP_009463840.1| PREDICTED: sodium/hydrogen exchanger 8 [Nipponia nippon]
Length=593

 Score =   234 bits (598),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 280/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  56    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  115

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  116   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  175

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  176   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  235

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  236   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  295

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  296   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  353

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  354   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  412

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  413   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  469

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  470   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  529

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  530   YIKR--QDLKGFMWLDAKYLNPFFTRRLTQED  559



>ref|XP_009503942.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Phalacrocorax 
carbo]
Length=581

 Score =   234 bits (597),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  44    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  104   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  457

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  458   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  517

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  518   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  547



>ref|XP_010154421.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Eurypyga helias]
Length=581

 Score =   234 bits (597),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  44    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  104   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  457

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  458   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  517

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  518   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  547



>ref|XP_009231981.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Pongo abelii]
Length=547

 Score =   233 bits (595),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 190/516 (37%), Positives = 282/516 (55%), Gaps = 28/516 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  457   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTV------ESEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDE  448
              +  E H    +    F  +D  YL PFFT +   E
Sbjct  511   EEEYEAHYIRRQDLKGFMWLDAKYLNPFFTRRLTQE  546



>ref|XP_007185377.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X4 [Balaenoptera 
acutorostrata scammoni]
Length=576

 Score =   234 bits (597),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  39    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  99    IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q + T T +IV
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLVGTTTISIV  451

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++   DV                + E     I      ES   S   
Sbjct  452   LFTILLLGGSTMPLIRFADVEDARARRRSKKDVNLSKTEKMGNTI------ESEHLSELT  505

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  506   EEEYEAHYIRRQDLKGFLWLDAKYLNPFFTRRLTQED  542



>ref|XP_004785747.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Mustela putorius 
furo]
Length=596

 Score =   234 bits (598),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 190/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G +
Sbjct  59    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIQYRLHFLPESVAVVSLGILMGAV  118

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  119   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  178

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  179   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  238

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  239   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  298

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  299   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  356

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  357   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  415

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  +V
Sbjct  416   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVLV  471

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  472   LFTILLLGGSTMPLIRLMDIEDAKARRRSKKDVNLSKTEKMGNTI------ESEHLSELT  525

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  526   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  562



>ref|XP_010292571.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Phaethon lepturus]
Length=581

 Score =   234 bits (597),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  44    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  104   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LMLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  457

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  458   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  517

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  518   YIKR--QDLKGFMWFDARYLNPFFTRRLTQED  547



>ref|XP_009997070.1| PREDICTED: sodium/hydrogen exchanger 8 [Chaetura pelagica]
Length=594

 Score =   234 bits (598),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 280/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  57    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  116

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  117   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  176

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  177   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  236

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  237   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  296

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  297   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  354

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  355   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  413

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  414   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  470

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  471   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  530

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  531   YIKR--QDLKGFMWLDAKYLNPFFTRRLTQED  560



>ref|XP_008833079.1| PREDICTED: sodium/hydrogen exchanger 8 [Nannospalax galili]
Length=578

 Score =   234 bits (597),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 186/512 (36%), Positives = 282/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  39    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  99    IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFVQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PMEKRQLIGTTTIVIVL  452

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GGST  ++  +D+                + E     I   +  E +       
Sbjct  453   FTILLLGGSTMPLIRLVDIEDARARRRSKKDVNLSKTEKMGNTIESEHLSELTEEEYEAH  512

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +++  +    F  +D  YL PFFT +   ED
Sbjct  513   YIRQ--QDLKGFMWLDAKYLNPFFTRRLTQED  542



>ref|XP_008249980.1| PREDICTED: sodium/hydrogen exchanger 8 [Oryctolagus cuniculus]
Length=580

 Score =   234 bits (597),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 282/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  43    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  103   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W SGLRGA+ +AL+L    DL P    Q + T T  IV
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWLSGLRGAIPYALSLHL--DLEPMEKRQLVGTTTIIIV  455

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     I      ES   S   
Sbjct  456   LFTILLLGGSTMPLIRLVDIEDARARRRSKKDVNLSKTEKMGNTI------ESEHLSELT  509

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  510   EEEYEAHYVRRQDLKGFMWLDAKYLNPFFTRRLTQED  546



>ref|XP_005362914.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Microtus ochrogaster]
Length=580

 Score =   234 bits (596),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 184/512 (36%), Positives = 282/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  43    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  103   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   +++KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFVVGGGIYFLGQADVIFKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVR---SNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R   S+ S  Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKHMSDVSGWQTFSQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRRTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PMEKRQLIGTTTIVIVL  456

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GGST  ++  +D+                + E     I   +  E +       
Sbjct  457   FTILLLGGSTMPLIRLVDIEDARARRRNKKDVNLSKTEKMGNAIESEHLSELTEEEYEAH  516

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +++  +    F  +D  YL PFFT +   ED
Sbjct  517   YIRQ--QDLKGFMWLDAKYLNPFFTRRLTQED  546



>ref|XP_005525026.1| PREDICTED: sodium/hydrogen exchanger 8 [Pseudopodoces humilis]
Length=582

 Score =   234 bits (596),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 182/512 (36%), Positives = 281/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   ++++ +  IL H+L  +R ++LPE+ A + +G+++G  
Sbjct  37    PVQTGVQAQQEEQSSGMTIFFSLLVIAICIILVHLLIEYRLHFLPESVAVVSLGILMGAF  96

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I+ F++FGT 
Sbjct  97    IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSIILFSVFGTA  156

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  157   ISAFIVGGGIYFLGRADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  216

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  217   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  276

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  277   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  334

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  335   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  393

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  394   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PMEKRQLIGTTTIIIVL  450

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  451   FTILLLGGGTMPLIRLVDIEDSKPRKRNKKDVNLSKTEKMGNTIESEHLSELTEEEYEAQ  510

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   ++   F  +D  YL PFFT +   ED
Sbjct  511   YIK--RQNLKGFMRLDVEYLNPFFTRRLTQED  540



>ref|XP_005362916.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X3 [Microtus ochrogaster]
Length=581

 Score =   234 bits (596),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 184/512 (36%), Positives = 282/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   +++KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVIFKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVR---SNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R   S+ S  Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKHMSDVSGWQTFSQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRRTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PMEKRQLIGTTTIVIVL  457

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GGST  ++  +D+                + E     I   +  E +       
Sbjct  458   FTILLLGGSTMPLIRLVDIEDARARRRNKKDVNLSKTEKMGNAIESEHLSELTEEEYEAH  517

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +++  +    F  +D  YL PFFT +   ED
Sbjct  518   YIRQ--QDLKGFMWLDAKYLNPFFTRRLTQED  547



>ref|XP_010160824.1| PREDICTED: sodium/hydrogen exchanger 8 [Caprimulgus carolinensis]
Length=599

 Score =   234 bits (597),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  62    PVQTGVEAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  121

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  122   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  181

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  182   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  241

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  242   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  301

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  302   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  359

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  360   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  418

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  419   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  475

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  476   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  535

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  536   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  565



>gb|EAW75648.1| solute carrier family 9 (sodium/hydrogen exchanger), member 8, 
isoform CRA_b [Homo sapiens]
Length=585

 Score =   234 bits (597),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 191/519 (37%), Positives = 282/519 (54%), Gaps = 28/519 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYA--GLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNL  1087
             L+  Y    +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NL
Sbjct  284   LIVIYVLKHIDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNL  343

Query  1086  SDSSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVF  907
             S  +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F
Sbjct  344   SPVTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIF  402

Query  906   GCAYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftatta  730
               +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  
Sbjct  403   PLSYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIV  458

Query  729   ivvltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSR  550
             IV+ T+L++GGST  ++  +D+                + E     +      ES   S 
Sbjct  459   IVLFTILLLGGSTMPLIRLMDIEDAKAHRRNKKDVNLSKTEKMGNTV------ESEHLSE  512

Query  549   FKMKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
                +  E H    +    F  +D  YL PFFT +   ED
Sbjct  513   LTEEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  551



>ref|XP_010140949.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Buceros rhinoceros 
silvestris]
Length=581

 Score =   234 bits (596),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  44    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  104   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  457

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  458   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  517

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  518   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  547



>ref|XP_010567967.1| PREDICTED: sodium/hydrogen exchanger 8 [Haliaeetus leucocephalus]
Length=574

 Score =   234 bits (596),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  37    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  96

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  97    IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  156

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  157   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  216

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  217   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  276

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  277   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  334

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  335   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  393

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  394   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  450

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  451   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  510

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  511   YIK--RQDLKGFMWFDAKYLNPFFTRRLTQED  540



>ref|XP_007475815.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Monodelphis 
domestica]
Length=580

 Score =   234 bits (596),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 185/513 (36%), Positives = 280/513 (55%), Gaps = 20/513 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  43    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I +++   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  103   IKIIESQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFIVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  455

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GG T  ++  +D+                + E     I   +  E +      
Sbjct  456   LFTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEA  515

Query  543   MKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
               +K   +    F   D  YL PF T +   ED
Sbjct  516   HYIKR--QDLKGFMWFDAKYLNPFLTRRLTQED  546



>ref|XP_010201422.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Colius striatus]
Length=592

 Score =   234 bits (597),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 280/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  55    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  114

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  115   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  174

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  175   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  234

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SGQNFFMITV-RFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG   F+  +  F++ FFGS + G   G ISA
Sbjct  235   GESILNDAVSIVLTNTAEGLTRENMSDVSGWETFLQALGYFLKMFFGSAALGTLTGLISA  294

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  295   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  352

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  353   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  411

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  412   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  468

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  469   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  528

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  529   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  558



>ref|XP_009488793.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Pelecanus crispus]
Length=591

 Score =   234 bits (597),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  54    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  113

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  114   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  173

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  174   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  233

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  234   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  293

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  294   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  351

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  352   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  410

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  411   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  467

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  468   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  527

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  528   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  557



>ref|XP_005057545.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Ficedula albicollis]
Length=588

 Score =   234 bits (596),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 182/512 (36%), Positives = 281/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   ++++ +  IL H+L  +R ++LPE+ A + +G+++G  
Sbjct  43    PVQTGVQAQQEEQSSGMTIFFSLLVIAICIILVHLLIEYRLHFLPESVAVVSLGILMGAF  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I+ F++FGT 
Sbjct  103   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSIILFSVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFIVGGGIYFLGRADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PMEKRQLIGTTTIIIVL  456

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  457   FTILLLGGGTMPLIRLVDIEDSKPRKRNKKDVNLSKTEKMGNTIESEHLSELTEEEYEAQ  516

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   ++   F  +D  YL PFFT +   ED
Sbjct  517   YIKR--QNLKGFMRLDVEYLNPFFTRRLTQED  546



>ref|XP_009932122.1| PREDICTED: sodium/hydrogen exchanger 8 [Opisthocomus hoazin]
Length=578

 Score =   233 bits (595),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 181/512 (35%), Positives = 278/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  41    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  100

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  101   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  160

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  161   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  220

Query  1428  GESVLNDAMAISLYRTMS-LVR---SNTSSGQNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R   S+ S  Q F      F++ FFGS + G   G ISA
Sbjct  221   GESILNDAVSIVLTNTAEGLTRESMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  280

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  281   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  338

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  339   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  397

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  398   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  454

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  455   FTILLLGGGTMPLIRLIDIEDSKARKKNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  514

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  515   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  544



>ref|XP_008935513.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Merops nubicus]
Length=589

 Score =   234 bits (596),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  52    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  111

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  112   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  171

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  172   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  231

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  232   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  291

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  292   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  349

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  350   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  408

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  409   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  465

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  466   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  525

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  526   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  555



>ref|XP_009557060.1| PREDICTED: sodium/hydrogen exchanger 8 [Cuculus canorus]
Length=615

 Score =   234 bits (597),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 280/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  78    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  137

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  138   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  197

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  198   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  257

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  258   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  317

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  318   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  375

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  376   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  434

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  435   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  491

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  492   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  551

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F  +D  YL PFFT +   ED
Sbjct  552   YIKR--QDLKGFMWLDAKYLNPFFTRRLTQED  581



>ref|XP_009669454.1| PREDICTED: sodium/hydrogen exchanger 8 [Struthio camelus australis]
Length=613

 Score =   234 bits (597),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  76    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  135

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  136   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  195

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  196   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  255

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  256   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  315

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  316   LMLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  373

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  374   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  432

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  433   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  489

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  490   FTILLLGGGTMPLIRLIDIEDSKARRRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  549

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  550   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  579



>ref|XP_008139388.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Eptesicus 
fuscus]
Length=580

 Score =   233 bits (595),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 190/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  43    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  103   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHIDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVVWCIVLVLFGRAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  455

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  456   LFTILLLGGSTMPLIRLMDIEDAKARRRSKKDVNLSKTEKMGNTV------ESEHLSELT  509

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  510   EEEYEAHYIRRQDLKGFLWLDVKYLNPFFTRRLTQED  546



>ref|XP_007533248.1| PREDICTED: sodium/hydrogen exchanger 8 [Erinaceus europaeus]
Length=576

 Score =   233 bits (595),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 189/517 (37%), Positives = 283/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R++ ++LPE+ A + +G+++G +
Sbjct  39    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYKLHFLPESVAVVSLGILMGAV  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               + + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  99    IKLIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIV  451

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  452   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTV------ESEHLSELT  505

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  506   EEEYEAHYIRRQDLKGFVWLDAKYLNPFFTRRLTQED  542



>ref|XP_009867546.1| PREDICTED: sodium/hydrogen exchanger 8 [Apaloderma vittatum]
Length=604

 Score =   234 bits (596),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  67    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  126

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  127   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  186

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  187   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  246

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  247   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  306

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  307   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  364

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  365   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  423

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  424   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  480

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  481   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  540

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  541   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  570



>ref|XP_009280922.1| PREDICTED: sodium/hydrogen exchanger 8 [Aptenodytes forsteri]
Length=610

 Score =   234 bits (597),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  73    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  132

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  133   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  192

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  193   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  252

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  253   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  312

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  313   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  370

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  371   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  429

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  430   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  486

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  487   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  546

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  547   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  576



>ref|XP_004687526.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Condylura 
cristata]
Length=580

 Score =   233 bits (595),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 189/517 (37%), Positives = 282/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  43    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
                 + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  103   IKFIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFVVGGGIYFLGQADVIAKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q + T T  IV
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLVGTTTIVIV  455

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  456   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGDTV------ESEQLSELT  509

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  510   EEEYEAHYLRRQDLKGFVWLDAKYLNPFFTRRLTQED  546



>ref|XP_004430343.1| PREDICTED: sodium/hydrogen exchanger 8 isoform 2 [Ceratotherium 
simum simum]
Length=580

 Score =   233 bits (595),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 191/517 (37%), Positives = 282/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    +++++ G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  43    PVQTGEQAQQEEQSNGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  102

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  103   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  162

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  163   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  222

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  223   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  282

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  283   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  340

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  341   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRALNIFPL  399

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  400   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIIIV  455

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D+                + E     +      ES   S   
Sbjct  456   LFTILLLGGSTMPLIRLMDIEDAKARRRNKKDVNLSKTEKMGNTV------ESEHLSELT  509

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  510   EEEYEAHYIRRQDLKGFLWLDAKYLNPFFTRRLTQED  546



>ref|XP_005502780.1| PREDICTED: sodium/hydrogen exchanger 8 [Columba livia]
Length=653

 Score =   235 bits (599),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 184/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G  
Sbjct  116   PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAF  175

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  176   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  235

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  236   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  295

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  296   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  355

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  356   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  413

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  414   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  472

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  473   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  529

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  530   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  589

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  590   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  619



>ref|XP_004663927.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X1 [Jaculus jaculus]
Length=576

 Score =   233 bits (594),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 185/512 (36%), Positives = 281/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  39    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  99    IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRRTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PMEKRQLIGTTTIVIVL  452

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  453   FTILLLGGGTMPLIRLVDIEDARVRRRSKKDVNLSKTEKMGNTIESEHLSELTEEEYEAH  512

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +++  +    F  +D  YL PFFT +   ED
Sbjct  513   YIRQ--QDLKGFMWLDAKYLNPFFTRRLTQED  542



>ref|XP_009643706.1| PREDICTED: sodium/hydrogen exchanger 8 [Egretta garzetta]
Length=604

 Score =   234 bits (596),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  67    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  126

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  127   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  186

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  187   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  246

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  247   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  306

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  307   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  364

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  365   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  423

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  424   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  480

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  481   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  540

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  541   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  570



>ref|XP_009989806.1| PREDICTED: sodium/hydrogen exchanger 8, partial [Tauraco erythrolophus]
Length=581

 Score =   233 bits (594),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 278/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  44    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  104   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIILVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  457

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++   D+                + E     I   +  E +       
Sbjct  458   FTILLLGGGTMPLIRLTDIEDSKARKRNKKDVNLSKTEKMGNTIESEHLSELTEEEYEAQ  517

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  518   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  547



>ref|XP_007100362.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Physeter catodon]
Length=576

 Score =   233 bits (594),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 190/518 (37%), Positives = 287/518 (55%), Gaps = 30/518 (6%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  39    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  98

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  99    IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  158

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  159   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  218

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  219   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  278

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  279   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  336

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  337   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  395

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T +IV
Sbjct  396   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTISIV  451

Query  723   vltvliIGGSTGTMLEALDVVG-----DDYDsslgtgtlgerlegSNGYIAPSYDEESSS  559
             + T+L++GGST  ++   D+        +      + T        + +++   +EE  +
Sbjct  452   LFTILLLGGSTMPLIRFADIEDARARRRNKKDVNLSKTEKMGNTVESEHLSELTEEEYEA  511

Query  558   GSRFKMKLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
                 +  LK        F  +D  YL PFFT +   ED
Sbjct  512   HYIRRQDLK-------GFLWLDAKYLNPFFTRRLTQED  542



>ref|XP_009325119.1| PREDICTED: sodium/hydrogen exchanger 8 [Pygoscelis adeliae]
Length=626

 Score =   234 bits (597),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 279/512 (54%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L ++R ++LPE+ A + +G+++G  
Sbjct  89    PVQTGVQAQQEEQSSGMTIFFSLLVLAICIILVHLLIKYRLHFLPESVAVVSLGILMGAF  148

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  F++FGT 
Sbjct  149   IKIIEAQKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFSVFGTA  208

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ + G  +Y  G   ++YKL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  209   ISAFIVGGGIYFLGQADVIYKLNMTDSFAFGSLISAVDPVATIAIFNALNVDPVLNMLVF  268

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  269   GESILNDAVSIVLTNTAEGLTRENMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  328

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  329   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  386

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  387   VTQILMQQTLRTVAFMCETCVFAFLGLSIFSFPHKF-EMSFVIWCIVLVLFGRAVNIFPL  445

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  446   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PIEKRQLIGTTTIIIVL  502

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  503   FTILLLGGGTMPLIRLIDIEDSKARKRNKKDINLSKTEKMGNTIESEHLSELTEEEYEAQ  562

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +K   +    F   D  YL PFFT +   ED
Sbjct  563   YIKR--QDLKGFMWFDAKYLNPFFTRRLTQED  592



>ref|XP_005983434.1| PREDICTED: sodium/hydrogen exchanger 8 [Pantholops hodgsonii]
Length=575

 Score =   233 bits (593),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 193/516 (37%), Positives = 283/516 (55%), Gaps = 27/516 (5%)
 Frame = -1

Query  1950  PPRTGKDQR---AAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGLA  1780
             P +TG+ Q+   ++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G + 
Sbjct  39    PVQTGEQQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAVI  98

Query  1779  NISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTFI  1606
              I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT I
Sbjct  99    KIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTAI  158

Query  1605  ASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVFG  1426
             ++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVFG
Sbjct  159   SAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVFG  218

Query  1425  ESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISAL  1258
             ES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISAL
Sbjct  219   ESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISAL  278

Query  1257  LFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSDS  1078
             + K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS  
Sbjct  279   MLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSPV  336

Query  1077  SQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGCA  898
             +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  +
Sbjct  337   TQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPLS  395

Query  897   YLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaivv  721
             YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV+
Sbjct  396   YLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPMEKRQLIGTTTIVIVL  451

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GGST  ++  +D+ G              + E     +      ES   S    
Sbjct  452   FTILLLGGSTMPLIRLVDIEGAKARRRGRKDVNLSKTEKMGNTV------ESEHLSELTE  505

Query  540   KLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
             +  E H    +    F  +D  YL PFFT +   ED
Sbjct  506   EEYEAHYIRRQDLKGFLWLDAKYLNPFFTRRLTQED  541



>ref|XP_004663928.1| PREDICTED: sodium/hydrogen exchanger 8 isoform X2 [Jaculus jaculus]
Length=581

 Score =   233 bits (594),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 185/512 (36%), Positives = 281/512 (55%), Gaps = 18/512 (4%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRRTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ L ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRTVAFLCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDLPEGHGQtiftattaivv  721
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    + P    Q I T T  IV+
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHLGLE-PMEKRQLIGTTTIVIVL  457

Query  720   ltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFKM  541
              T+L++GG T  ++  +D+                + E     I   +  E +       
Sbjct  458   FTILLLGGGTMPLIRLVDIEDARVRRRSKKDVNLSKTEKMGNTIESEHLSELTEEEYEAH  517

Query  540   KLKEFHKSTSSFTAIDRNYLTPFFTTQNGDED  445
              +++  +    F  +D  YL PFFT +   ED
Sbjct  518   YIRQ--QDLKGFMWLDAKYLNPFFTRRLTQED  547



>ref|XP_004698110.1| PREDICTED: sodium/hydrogen exchanger 8 [Echinops telfairi]
Length=581

 Score =   233 bits (594),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 190/517 (37%), Positives = 284/517 (55%), Gaps = 28/517 (5%)
 Frame = -1

Query  1950  PPRTG----KDQRAAGVGILLQIMMLVLSFILGHVLRRHRFYYLPEASASLLIGLIVGGL  1783
             P +TG    ++++++G+ I   +++L +  IL H+L R+R ++LPE+ A + +G+++G +
Sbjct  44    PVQTGEQAQQEEQSSGMTIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAV  103

Query  1782  ANISDTE--TNIRAWFNFHEEffflfllppiiFQSGFSLSPKPFFSNFGAIVTFAIFGTF  1609
               I + +   N +    F    FFL LLPPIIF+SG+SL    FF N G+I  FA+FGT 
Sbjct  104   IKIIEFKKLANWKEEEMFRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTA  163

Query  1608  IASMVTGVLVYIGGVILLMYKLPFLECLMFGSLISATDPVTVLSIFQELGTDVNLYALVF  1429
             I++ V G  +Y  G   ++ KL   +   FGSLISA DPV  ++IF  L  D  L  LVF
Sbjct  164   ISAFVVGGGIYFLGQADVISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVF  223

Query  1428  GESVLNDAMAISLYRTMS-LVRSNTS--SG-QNFFMITVRFIETFFGSMSAGVGVGFISA  1261
             GES+LNDA++I L  T   L R N S  SG Q F      F++ FFGS + G   G ISA
Sbjct  224   GESILNDAVSIVLTNTAEGLTRKNMSDVSGWQTFLQALGYFLKMFFGSAALGTLTGLISA  283

Query  1260  LLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTYSNLSD  1081
             L+ K+  +D+    +LE  + ++F Y  Y LAEG+ LSGI++ILF+GIVM  YT+ NLS 
Sbjct  284   LVLKH--IDLRKTPSLEFGMMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSP  341

Query  1080  SSQRFVSSFFHLISSLAETFVFIYMGFDIAMEQHSWTHVgfiffsilfigIARAANVFGC  901
              +Q  +      ++ + ET VF ++G  I    H +  + F+ + I+ +   RA N+F  
Sbjct  342   VTQILMQQTLRSVAFMCETCVFAFLGLSIFSFPHKF-EISFVIWCIVLVLFGRAVNIFPL  400

Query  900   AYLVNLVRPANRKIPPKHQKALWYSGLRGAMAFALALQSVHDL-PEGHGQtiftattaiv  724
             +YL+N  R  + KI PK    +W+SGLRGA+ +AL+L    DL P    Q I T T  IV
Sbjct  401   SYLLNFFR--DHKITPKMMFIMWFSGLRGAIPYALSLHL--DLEPLEKRQLIGTTTIVIV  456

Query  723   vltvliIGGSTGTMLEALDVVGDDYDsslgtgtlgerlegSNGYIAPSYDEESSSGSRFK  544
             + T+L++GGST  ++  +D + D          +        G+       E+   S   
Sbjct  457   LFTILLLGGSTMPLIRLVD-IEDTKARRRNKKDVNLSKTEKMGHTV-----EAEHLSELT  510

Query  543   MKLKEFH----KSTSSFTAIDRNYLTPFFTTQNGDED  445
              +  E H    +    F  +D  YL PFFT +   ED
Sbjct  511   EEEYEAHYIRRQDLKGFMWLDVKYLNPFFTRRLTQED  547



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6644713801380