BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23932_g3_i1 len=2416 path=[438:0-86 525:87-2415]

Length=2416
                                                                      Score     E

ref|XP_009613585.1|  PREDICTED: uncharacterized protein LOC104106690    348   2e-104   
ref|XP_009804560.1|  PREDICTED: uncharacterized protein LOC104249777    342   4e-102   
ref|XP_006362390.1|  PREDICTED: uncharacterized protein LOC102585...    315   5e-92    
ref|XP_004233042.1|  PREDICTED: uncharacterized protein LOC101247686    314   2e-91    
emb|CDO96807.1|  unnamed protein product                                274   7e-77    
ref|XP_011101394.1|  PREDICTED: uncharacterized protein LOC105179...    238   7e-64    
ref|XP_011101392.1|  PREDICTED: uncharacterized protein LOC105179...    237   8e-64    
gb|KDP21102.1|  hypothetical protein JCGZ_21573                         187   7e-47    
ref|XP_006467641.1|  PREDICTED: uncharacterized protein LOC102610...    182   4e-45    
ref|XP_002266263.1|  PREDICTED: uncharacterized protein LOC100253264    180   2e-44    Vitis vinifera
emb|CBI30693.3|  unnamed protein product                                179   8e-44    
ref|XP_002533963.1|  conserved hypothetical protein                     173   2e-42    Ricinus communis
ref|XP_007025362.1|  Transcription initiation factor TFIID subuni...    171   3e-41    
ref|XP_010274478.1|  PREDICTED: uncharacterized protein LOC104609787    169   9e-41    
gb|KDO77867.1|  hypothetical protein CISIN_1g006045mg                   162   1e-38    
ref|XP_010277001.1|  PREDICTED: uncharacterized protein LOC104611...    163   1e-38    
gb|KDO77870.1|  hypothetical protein CISIN_1g006045mg                   162   2e-38    
ref|XP_010277003.1|  PREDICTED: uncharacterized protein LOC104611...    162   2e-38    
ref|XP_002305742.1|  hypothetical protein POPTR_0004s05650g             155   7e-36    Populus trichocarpa [western balsam poplar]
ref|XP_006449510.1|  hypothetical protein CICLE_v10014532mg             153   2e-35    
gb|KHF99143.1|  hypothetical protein F383_20211                         153   4e-35    
ref|XP_010999739.1|  PREDICTED: uncharacterized protein LOC105107498    151   2e-34    
ref|XP_011085986.1|  PREDICTED: uncharacterized protein LOC105167...    147   2e-33    
ref|XP_011039432.1|  PREDICTED: uncharacterized protein LOC105135997    145   2e-32    
ref|XP_002276750.3|  PREDICTED: uncharacterized protein LOC100245463    143   5e-32    Vitis vinifera
ref|XP_008225296.1|  PREDICTED: uncharacterized protein LOC103324955    142   1e-31    
ref|XP_007212805.1|  hypothetical protein PRUPE_ppa001223mg             140   6e-31    
ref|XP_008341663.1|  PREDICTED: uncharacterized protein LOC103404511    140   8e-31    
ref|XP_010057105.1|  PREDICTED: uncharacterized protein LOC104445013    138   1e-30    
gb|KCW74116.1|  hypothetical protein EUGRSUZ_E02752                     138   1e-30    
emb|CAN81695.1|  hypothetical protein VITISV_042576                     140   1e-30    Vitis vinifera
ref|XP_009352764.1|  PREDICTED: uncharacterized protein LOC103944087    139   1e-30    
emb|CBI21990.3|  unnamed protein product                                137   2e-30    
ref|XP_002528543.1|  conserved hypothetical protein                     136   5e-30    Ricinus communis
ref|XP_004172354.1|  PREDICTED: uncharacterized LOC101207534            137   5e-30    
ref|XP_004150220.1|  PREDICTED: uncharacterized protein LOC101207534    136   8e-30    
ref|XP_008443305.1|  PREDICTED: uncharacterized protein LOC103486924    135   1e-29    
ref|XP_011085987.1|  PREDICTED: uncharacterized protein LOC105167...    134   1e-29    
ref|XP_007148041.1|  hypothetical protein PHAVU_006G175400g             135   2e-29    
gb|KDP36298.1|  hypothetical protein JCGZ_09805                         134   4e-29    
ref|XP_008345909.1|  PREDICTED: uncharacterized protein LOC103408870    134   5e-29    
ref|XP_002890798.1|  hypothetical protein ARALYDRAFT_890443             129   8e-28    
gb|EYU28091.1|  hypothetical protein MIMGU_mgv1a010560mg                124   2e-27    
ref|XP_010104398.1|  hypothetical protein L484_010350                   128   3e-27    
ref|XP_004293955.1|  PREDICTED: uncharacterized protein LOC101297...    127   5e-27    
ref|XP_004293954.1|  PREDICTED: uncharacterized protein LOC101297...    127   6e-27    
ref|XP_010109884.1|  hypothetical protein L484_003815                   127   1e-26    
gb|KHN28614.1|  hypothetical protein glysoja_040482                     126   1e-26    
ref|XP_003547171.1|  PREDICTED: uncharacterized protein LOC100786...    125   2e-26    
ref|XP_006307092.1|  hypothetical protein CARUB_v10008679mg             125   2e-26    
ref|XP_009350271.1|  PREDICTED: uncharacterized protein LOC103941775    124   7e-26    
ref|XP_002317416.2|  hypothetical protein POPTR_0011s07290g             123   1e-25    Populus trichocarpa [western balsam poplar]
ref|XP_008353439.1|  PREDICTED: uncharacterized protein LOC103417008    119   1e-25    
gb|KHG24123.1|  Protein arginine N-methyltransferase 7                  123   1e-25    
ref|XP_003590280.1|  hypothetical protein MTR_1g050940                  121   4e-25    
ref|XP_003636800.1|  hypothetical protein MTR_060s0021                  121   4e-25    
ref|XP_004485899.1|  PREDICTED: uncharacterized protein LOC101504...    120   7e-25    
ref|XP_008229123.1|  PREDICTED: uncharacterized protein LOC103328...    121   7e-25    
ref|XP_008229122.1|  PREDICTED: uncharacterized protein LOC103328...    121   7e-25    
ref|XP_007048701.1|  Uncharacterized protein isoform 1                  120   8e-25    
ref|XP_007048702.1|  Uncharacterized protein isoform 2                  120   1e-24    
ref|XP_011086364.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    119   1e-24    
gb|KHN48001.1|  hypothetical protein glysoja_015471                     119   2e-24    
ref|XP_006585173.1|  PREDICTED: uncharacterized protein LOC102660...    119   3e-24    
ref|XP_008381206.1|  PREDICTED: uncharacterized protein LOC103444...    117   1e-23    
gb|KHN06405.1|  hypothetical protein glysoja_010749                     115   4e-23    
ref|XP_009350316.1|  PREDICTED: uncharacterized protein LOC103941849    115   5e-23    
ref|XP_006580168.1|  PREDICTED: uncharacterized protein LOC102665...    114   5e-23    
ref|XP_006415597.1|  hypothetical protein EUTSA_v10007223mg             112   1e-22    
dbj|BAD94645.1|  hypothetical protein                                   112   2e-22    Arabidopsis thaliana [mouse-ear cress]
ref|NP_174218.2|  uncharacterized protein                               111   4e-22    Arabidopsis thaliana [mouse-ear cress]
gb|KHN08430.1|  hypothetical protein glysoja_014195                     110   2e-21    
ref|XP_011033746.1|  PREDICTED: uncharacterized protein LOC105132...    110   2e-21    
ref|XP_011033749.1|  PREDICTED: uncharacterized protein LOC105132...    108   5e-21    
ref|XP_007159457.1|  hypothetical protein PHAVU_002G239200g             105   5e-20    
ref|XP_006415598.1|  hypothetical protein EUTSA_v10007223mg             104   6e-20    
ref|XP_006852401.1|  hypothetical protein AMTR_s00021p00026070          104   9e-20    
ref|XP_010686211.1|  PREDICTED: uncharacterized protein LOC104900492    102   4e-19    
ref|XP_008368737.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    102   6e-19    
ref|XP_009767174.1|  PREDICTED: uncharacterized protein LOC104218389    100   2e-18    
ref|XP_002320413.2|  hypothetical protein POPTR_0014s13950g           99.0    5e-18    Populus trichocarpa [western balsam poplar]
ref|XP_008381208.1|  PREDICTED: uncharacterized protein LOC103444...  99.0    6e-18    
ref|XP_007216809.1|  hypothetical protein PRUPE_ppa023132mg           98.6    8e-18    
emb|CDX90178.1|  BnaA08g18060D                                        97.8    8e-18    
ref|XP_009370525.1|  PREDICTED: uncharacterized protein LOC103959880  98.6    9e-18    
ref|XP_006348878.1|  PREDICTED: uncharacterized protein LOC102602...  97.8    1e-17    
ref|XP_006348876.1|  PREDICTED: uncharacterized protein LOC102602...  97.4    1e-17    
gb|EYU30775.1|  hypothetical protein MIMGU_mgv1a023439mg              96.7    2e-17    
ref|XP_007132845.1|  hypothetical protein PHAVU_011G129400g           97.1    2e-17    
ref|XP_009109678.1|  PREDICTED: uncharacterized protein LOC103835287  96.3    2e-17    
gb|EPS57778.1|  hypothetical protein M569_17039                       96.7    2e-17    
emb|CDY43328.1|  BnaC03g59000D                                        95.9    3e-17    
ref|XP_010499440.1|  PREDICTED: uncharacterized protein LOC104776958  95.9    4e-17    
ref|XP_010549410.1|  PREDICTED: uncharacterized protein LOC104820601  95.1    8e-17    
ref|XP_008448243.1|  PREDICTED: probable GPI-anchored adhesin-lik...  94.4    2e-16    
ref|XP_004505483.1|  PREDICTED: uncharacterized protein LOC101506...  92.8    4e-16    
ref|XP_010323685.1|  PREDICTED: uncharacterized protein LOC101245...  92.4    4e-16    
ref|XP_004505486.1|  PREDICTED: uncharacterized protein LOC101506...  92.8    5e-16    
ref|XP_004303187.1|  PREDICTED: uncharacterized protein LOC101308888  92.8    5e-16    
gb|KGN46972.1|  hypothetical protein Csa_6G154530                     92.4    6e-16    
ref|XP_004243280.1|  PREDICTED: uncharacterized protein LOC101245...  92.0    7e-16    
gb|EPS64531.1|  hypothetical protein M569_10250                       89.4    7e-16    
ref|XP_009603490.1|  PREDICTED: uncharacterized protein LOC104098459  92.0    8e-16    
ref|XP_011083000.1|  PREDICTED: uncharacterized protein LOC105165626  91.7    1e-15    
ref|XP_004137030.1|  PREDICTED: uncharacterized protein LOC101218044  90.9    2e-15    
ref|XP_004251869.1|  PREDICTED: uncharacterized protein LOC101253258  88.2    1e-14    
gb|KDO37998.1|  hypothetical protein CISIN_1g006533mg                 87.4    2e-14    
ref|XP_010478283.1|  PREDICTED: uncharacterized protein LOC104757253  87.0    3e-14    
ref|XP_010460696.1|  PREDICTED: uncharacterized protein LOC104741512  86.7    3e-14    
ref|XP_006446800.1|  hypothetical protein CICLE_v10014575mg           86.7    3e-14    
emb|CDP15941.1|  unnamed protein product                              86.7    4e-14    
gb|KHN34238.1|  hypothetical protein glysoja_035873                   85.5    1e-13    
ref|XP_009602914.1|  PREDICTED: uncharacterized protein LOC104097983  85.1    1e-13    
ref|XP_010035863.1|  PREDICTED: uncharacterized protein LOC104425004  85.1    1e-13    
ref|XP_006358968.1|  PREDICTED: uncharacterized protein LOC102584213  84.7    1e-13    
ref|XP_009790223.1|  PREDICTED: uncharacterized protein LOC104237722  84.7    1e-13    
ref|XP_008455300.1|  PREDICTED: uncharacterized protein LOC103495498  84.7    1e-13    
ref|XP_010542726.1|  PREDICTED: uncharacterized protein LOC104815844  84.0    2e-13    
ref|XP_008789379.1|  PREDICTED: uncharacterized protein LOC103706890  82.0    1e-12    
ref|XP_003607595.1|  hypothetical protein MTR_4g080050                81.3    2e-12    
ref|XP_006469004.1|  PREDICTED: uncharacterized protein LOC102629...  80.9    2e-12    
ref|XP_006469003.1|  PREDICTED: uncharacterized protein LOC102629...  80.9    2e-12    
gb|KCW89648.1|  hypothetical protein EUGRSUZ_A01920                   80.5    3e-12    
gb|EYU28093.1|  hypothetical protein MIMGU_mgv11b011332mg             75.1    1e-11    
ref|XP_006582277.1|  PREDICTED: dentin sialophosphoprotein-like i...  77.4    3e-11    
ref|XP_010052771.1|  PREDICTED: uncharacterized protein LOC104441341  77.4    3e-11    
ref|XP_010414190.1|  PREDICTED: uncharacterized protein LOC104700373  77.0    4e-11    
ref|XP_009102870.1|  PREDICTED: uncharacterized protein LOC103828...  76.3    4e-11    
ref|XP_010469774.1|  PREDICTED: uncharacterized protein LOC104749776  76.3    6e-11    
ref|XP_006293862.1|  hypothetical protein CARUB_v10022845mg           75.9    7e-11    
ref|XP_009416505.1|  PREDICTED: uncharacterized protein LOC103997090  75.1    1e-10    
ref|XP_010510260.1|  PREDICTED: uncharacterized protein LOC104786530  74.3    2e-10    
ref|XP_010920169.1|  PREDICTED: uncharacterized protein LOC105044068  74.7    2e-10    
ref|XP_002881148.1|  hypothetical protein ARALYDRAFT_482023           73.6    4e-10    
ref|XP_009102868.1|  PREDICTED: uncharacterized protein LOC103828...  73.2    4e-10    
ref|XP_006410215.1|  hypothetical protein EUTSA_v10016438mg           73.6    4e-10    
emb|CDX94655.1|  BnaC07g10030D                                        71.6    1e-09    
gb|AAV63883.1|  hypothetical protein At2g30990                        70.5    2e-09    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH20020.1|  AT2G30990                                            70.1    4e-09    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031451.1|  uncharacterized protein                          69.7    6e-09    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004504294.1|  PREDICTED: uncharacterized protein LOC101497431  68.9    8e-09    
ref|XP_010666069.1|  PREDICTED: uncharacterized protein LOC104883279  69.3    8e-09    
ref|XP_009391420.1|  PREDICTED: uncharacterized protein LOC103977582  68.9    9e-09    
gb|AAR99352.1|  hypothetical protein At2g30990                        68.6    1e-08    Arabidopsis thaliana [mouse-ear cress]
gb|AAC20733.1|  hypothetical protein                                  68.9    1e-08    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004504531.1|  PREDICTED: uncharacterized protein LOC101494821  66.6    2e-08    
dbj|BAH19865.1|  AT2G30990                                            67.0    5e-08    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502167.1|  PREDICTED: uncharacterized protein LOC101494184  64.7    8e-08    
ref|NP_180964.1|  uncharacterized protein                             63.9    4e-07    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406233.1|  PREDICTED: uncharacterized protein LOC103989171  63.5    5e-07    
ref|XP_006592874.1|  PREDICTED: uncharacterized protein LOC102668249  62.4    1e-06    
emb|CDY58982.1|  BnaA04g28680D                                        61.2    2e-06    
ref|XP_009143799.1|  PREDICTED: uncharacterized protein LOC103867...  61.2    2e-06    
ref|XP_009143798.1|  PREDICTED: uncharacterized protein LOC103867...  60.8    3e-06    
ref|XP_009141121.1|  PREDICTED: uncharacterized protein LOC103865095  60.5    5e-06    
emb|CDY63140.1|  BnaCnng41430D                                        60.1    6e-06    
ref|XP_006410559.1|  hypothetical protein EUTSA_v10016475mg           60.1    7e-06    
ref|XP_002879481.1|  hypothetical protein ARALYDRAFT_321137           59.3    1e-05    
gb|KHN27946.1|  hypothetical protein glysoja_007678                   59.3    1e-05    
ref|XP_010469391.1|  PREDICTED: uncharacterized protein LOC104749449  58.5    2e-05    
ref|XP_004513204.1|  PREDICTED: uncharacterized protein LOC101492832  57.0    2e-05    
emb|CDY17227.1|  BnaA05g09610D                                        57.8    3e-05    
gb|AAR99362.1|  hypothetical protein At2g34170                        57.4    4e-05    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509787.1|  PREDICTED: uncharacterized protein LOC104786146  56.6    8e-05    
ref|XP_010413771.1|  PREDICTED: uncharacterized protein LOC104700022  55.1    2e-04    
ref|XP_006296401.1|  hypothetical protein CARUB_v10025577mg           53.9    4e-04    
gb|KHN01240.1|  hypothetical protein glysoja_008142                   52.8    6e-04    



>ref|XP_009613585.1| PREDICTED: uncharacterized protein LOC104106690 [Nicotiana tomentosiformis]
 ref|XP_009613586.1| PREDICTED: uncharacterized protein LOC104106690 [Nicotiana tomentosiformis]
Length=690

 Score =   348 bits (894),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 240/513 (47%), Positives = 300/513 (58%), Gaps = 66/513 (13%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             MEK +L+ + P++SVR+I+S++   E  N+K +E   PNRQQ    L V KSD ELSEVT
Sbjct  1     MEKKQLDFNAPLLSVRKISSSLSPHERANKKIIERAPPNRQQS---LPVKKSDWELSEVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
             KPVAVPF WEQ PG+R+G N  +     + S+ PRLPPGR P++ RFYS ERP  ++ ++
Sbjct  58    KPVAVPFMWEQIPGRRKGNNDARANLRVECSSSPRLPPGRLPETIRFYSGERPRTQNIYK  117

Query  1864  FQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLSLNCSIGDLS  1694
                E L   +HAAL+DSLVES+  +G  D E  D      P+ L   ESLSL+CS+  LS
Sbjct  118   SPAEGLPWIDHAALLDSLVESIYTRG--DRESEDDAYSDAPETLSPTESLSLDCSVSGLS  175

Query  1693  GCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL-------------VTEQ  1571
             G Q         D KPSG       +RDFMMSRFLPAAKA VL              TEQ
Sbjct  176   GHQS-------SDSKPSGTFSIDSQTRDFMMSRFLPAAKAVVLETPQYVQKKQVPVSTEQ  228

Query  1570  PRLV-----KEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRL  1406
             P+ V        K+ E   +SYYS Y  DV      E  D+++ +QHK   K WK FPR+
Sbjct  229   PKPVPVERKPTVKRMESKPVSYYSGYPDDV----GSEIEDDVSENQHKRPSKGWKFFPRI  284

Query  1405  SVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNK----------ARKAYS  1256
              VK SL LLNP PG+K KT  P  SS   VKR++   P  P +           ARKAYS
Sbjct  285   CVKNSLCLLNPLPGLKVKTHVPTPSS-QAVKRVSGLKPKTPQSPTSYAHEVKRLARKAYS  343

Query  1255  GPIEKQSYDAICKQRFRSGALSGELCKADKRGL-----------KADGQYPHGGSRSGAI  1109
             GP+EK S D I KQRF SG LS EL KAD R             K  G  P   SRSGAI
Sbjct  344   GPLEKNSCDTINKQRFHSGVLSRELYKADNRSFSGQLPNPSDSCKLVGISPGRRSRSGAI  403

Query  1108  SPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGE-SDSP  932
             SPYRNV   S F+EGT FLGVP+E E+L  S F SFR+    + D   +    G  SDSP
Sbjct  404   SPYRNVAPPSPFNEGTRFLGVPKEMESLWASRFDSFRKGCYTVKDKVPQQIGTGRFSDSP  463

Query  931   SDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMD  833
             S+VVEKT+Y+DSV+ V+ ++ +  SSKP+GL++
Sbjct  464   SEVVEKTLYIDSVDNVQISARNSASSKPKGLVN  496



>ref|XP_009804560.1| PREDICTED: uncharacterized protein LOC104249777 [Nicotiana sylvestris]
 ref|XP_009804561.1| PREDICTED: uncharacterized protein LOC104249777 [Nicotiana sylvestris]
Length=690

 Score =   342 bits (877),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 235/513 (46%), Positives = 300/513 (58%), Gaps = 66/513 (13%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             MEK +L+ + P++SVR+I+S++   E  N+K +E   PNRQQ    L V KSD ELSEVT
Sbjct  1     MEKKQLDFNAPLLSVRKISSSLSPHERANKKIIERAPPNRQQS---LPVKKSDWELSEVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
             KPVAVPF WEQ PG+R+G+N  +     + S+ PRLPPGR P++ RFYS ERP  ++ ++
Sbjct  58    KPVAVPFMWEQIPGRRKGDNEARANLRVEWSSSPRLPPGRLPETIRFYSGERPRTQNIYK  117

Query  1864  FQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLSLNCSIGDLS  1694
                E L   +HAAL+DSL ES+  +G  D    D      P+ L   ESLSL+CS+  LS
Sbjct  118   SPAEGLPWIDHAALLDSLAESIYTRG--DRASEDDANSDAPETLSPTESLSLDCSVSGLS  175

Query  1693  GCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL-------------VTEQ  1571
             G Q         D KPSG       +RDFMMSRFLPAAKA VL              TEQ
Sbjct  176   GHQS-------SDSKPSGTFSIDSQTRDFMMSRFLPAAKAVVLETPQYVQKKQVPVSTEQ  228

Query  1570  PRLVKE-----AKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRL  1406
             P+ V        K+ E   +SYYS Y  DV +    E  D+++ +QHK   K WK FPR+
Sbjct  229   PKPVPVERKPIVKQMESKPVSYYSGYPDDVGS----EIEDDVSENQHKRPSKGWKFFPRI  284

Query  1405  SVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNK----------ARKAYS  1256
              VK SL LLNP PG+K KT  P + S   VKR++   P  P +           ARKAYS
Sbjct  285   CVKNSLCLLNPLPGLKVKTHVP-TPSAQAVKRVSGMKPKTPQSPTSYAHEVKRLARKAYS  343

Query  1255  GPIEKQSYDAICKQRFRSGALSGELCKADKRGL-----------KADGQYPHGGSRSGAI  1109
             GP+EK + D I KQRF SG LS EL KA+ R             K  G  P   SRSGAI
Sbjct  344   GPLEKNTCDTINKQRFHSGVLSRELYKAENRSFSGQLPNPSDSCKLVGISPGRRSRSGAI  403

Query  1108  SPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGE-SDSP  932
             SPYRNV   S F+EGT FLGVP+E E+L  S F SFR+    + D   +    G  SDSP
Sbjct  404   SPYRNVAPPSPFNEGTRFLGVPKEMESLWASRFDSFRKGCYTVKDKVPQQIGTGRFSDSP  463

Query  931   SDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMD  833
             S+VVEKT+Y+DSV+ V+ ++ +  SSKP+GL++
Sbjct  464   SEVVEKTLYIDSVDNVQISARNSASSKPKGLVN  496



>ref|XP_006362390.1| PREDICTED: uncharacterized protein LOC102585343 isoform X1 [Solanum 
tuberosum]
 ref|XP_006362391.1| PREDICTED: uncharacterized protein LOC102585343 isoform X2 [Solanum 
tuberosum]
Length=694

 Score =   315 bits (808),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 226/516 (44%), Positives = 292/516 (57%), Gaps = 69/516 (13%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M K +L+ + P++SVR+I S++   E  N+K  +   PNRQQ    L V KSD EL+EVT
Sbjct  1     MAKKQLDFNAPLLSVRKIASSLTPNERANKKMADKVPPNRQQS---LPVKKSDWELTEVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
             KPVAVPF WEQ PG+ + +   +     + S+ PRLPPGR P++ RFYS ERP   + +R
Sbjct  58    KPVAVPFVWEQIPGRPKDDIEVRTSLRVERSSSPRLPPGRLPETVRFYSGERPRTHNIYR  117

Query  1864  FQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLSLNCSIGDLS  1694
                E L   +HAAL+DSLVES+  +G  D E  D      P+ +   ESLSLNCS+  LS
Sbjct  118   SPAEGLPWMDHAALLDSLVESIYTRG--DRESEDGAYSDGPETMSPTESLSLNCSVSGLS  175

Query  1693  GCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVT-----------EQPR  1565
             G Q         D++PSG       +RDFMMSRFLPAAKA VL T           EQP 
Sbjct  176   GHQT-------SDLQPSGTFSIDSQTRDFMMSRFLPAAKAVVLETPQYVHKKPVSAEQPM  228

Query  1564  LVKE---------AKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFP  1412
              VK+          K  E   +SYYS +  DV      E  D++  +  K   K W+ FP
Sbjct  229   PVKKLVPVERKPLVKPLESNPVSYYSSHPADV----GSETEDDVPENPDKKPSKGWRFFP  284

Query  1411  RLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAP---SGPLNKA-------RKA  1262
             R+ VK SL LLNP PG+K KT+ P + S   VKR++   P     P + A       RKA
Sbjct  285   RICVKNSLCLLNPLPGLKVKTRAP-TPSPQAVKRVSGTKPKMAQSPTSYAHEVKKLTRKA  343

Query  1261  YSGPIEKQSYDAICKQRFRSGALSGELCKADKRGL-----------KADGQYPHGGSRSG  1115
             YSGP+EK + D I KQRF SG LS EL KAD R +           K  G  P   SRSG
Sbjct  344   YSGPLEKNACDTINKQRFHSGVLSRELYKADNRSMSGQLSNPNDSCKLVGISPGRRSRSG  403

Query  1114  AISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWD--TPIKSSFKGES  941
             AISPYRNV   S F+EGT FLGVP+E E+L  S F SFR+    + D   P +       
Sbjct  404   AISPYRNVAPPSPFNEGTRFLGVPKEMESLWASRFDSFRKGCYTVKDKAVPQRMGTGKFF  463

Query  940   DSPSDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMD  833
             DSPS+VVEKT+Y+DSV+ V+ ++ +  S KP+G+++
Sbjct  464   DSPSEVVEKTLYIDSVDNVQISAPNAASLKPKGIVN  499



>ref|XP_004233042.1| PREDICTED: uncharacterized protein LOC101247686 [Solanum lycopersicum]
Length=695

 Score =   314 bits (804),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 224/516 (43%), Positives = 289/516 (56%), Gaps = 68/516 (13%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M K +L+ + P++SVR+I S++   E    K  E+  P  +QQ   L V KSD ELSEVT
Sbjct  1     MAKKQLDFNAPLLSVRKIASSLAPNERALNKKTEDKVPPNRQQS--LPVKKSDWELSEVT  58

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
             KPVAVPF WE+ PG+ + +N  +     + S+ PRLPPGR P++ RFYS ERP   + +R
Sbjct  59    KPVAVPFVWEKIPGRPKDDNEARTSLRVERSSSPRLPPGRLPETVRFYSGERPRTHNIYR  118

Query  1864  FQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLSLNCSIGDLS  1694
                E +   +HAAL+DSLVES+  +G  D E  D      P+ +   ESLSLNCS+  LS
Sbjct  119   SPAEGIPWMDHAALLDSLVESIYTRG--DRESEDDDYSDGPETMSPTESLSLNCSVSGLS  176

Query  1693  GCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVT-----------EQPR  1565
             G Q         D++PSG       +RDFMM+RFLPAAKA VL T           EQP 
Sbjct  177   GHQT-------SDLQPSGTFSIDSQTRDFMMNRFLPAAKAVVLETPQYVHKKPVSAEQPM  229

Query  1564  LVKE---------AKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFP  1412
              VK+          K  E   +SYYS +  D       E  D++  +  K   K WK FP
Sbjct  230   PVKKLVPVERKPLVKPLESNPVSYYSSHPADA----GSETEDDVPENSDKKPSKGWKFFP  285

Query  1411  RLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAP---SGPLNKA-------RKA  1262
             R+ VK SL LLNP PG+K KT+ P + S   VKR++   P     P + A       RKA
Sbjct  286   RICVKNSLCLLNPLPGLKVKTRAP-TPSPQAVKRVSGTKPKMAQSPTSYAHEVKKLTRKA  344

Query  1261  YSGPIEKQSYDAICKQRFRSGALSGELCKADKRGL-----------KADGQYPHGGSRSG  1115
             YSGP+EK + D I KQRF SG LS EL KAD R L           K  G  P   SRSG
Sbjct  345   YSGPLEKNACDTINKQRFHSGVLSRELYKADNRSLSGQLSNPNDSCKLVGISPGRRSRSG  404

Query  1114  AISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWD--TPIKSSFKGES  941
             AISPYRNV   S F+EGT FLGVP+E E+L  S F SFR+    + D   P +       
Sbjct  405   AISPYRNVAPPSPFNEGTRFLGVPKEMESLWASRFDSFRKGCYTVKDKAVPQRMGTGKFF  464

Query  940   DSPSDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMD  833
             DSPS+VVEKT+Y+DSV  V+ ++ +  S KP+G+++
Sbjct  465   DSPSEVVEKTLYIDSVANVRISAPNAASLKPKGIVN  500



>emb|CDO96807.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   274 bits (700),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 206/515 (40%), Positives = 278/515 (54%), Gaps = 77/515 (15%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRR--INS-----------NVRHLEGVNRKNVEnpqpnrqqqrqPL  2084
             MEK +LNL+ P++SVR+  +NS           N+   +G +RK +    P RQ     L
Sbjct  1     MEKKQLNLNAPLLSVRKPTLNSGSLLSSRNSSANLGSSDGKSRKLLHKSGPIRQHS---L  57

Query  2083  CVPKSDCELSEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRF  1904
              VPKSD EL  +TKP AVPF WEQ PG+ +GE   +    +   + PRLPPGR PDS R 
Sbjct  58    PVPKSDWELGALTKPAAVPFVWEQTPGRAKGEGDEQTETTKRSVSAPRLPPGRLPDSVRR  117

Query  1903  YSCERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESL  1724
             YS ER   ++      E   + +HAAL+DSL ES+ G  E D+E  D       D L++L
Sbjct  118   YSGERCNDQNIHGPHPEVYPVSDHAALIDSLRESIYGNEESDLESTDDYS----DALDAL  173

Query  1723  ------SLNCSIGDLSGCQGLDVEE-GRDDVKPSGDSRDFMMSRFLPAAKAAVLVT----  1577
                   S NCSI  LSG +  +V++ G   V P   ++D MMSRFLPAAKAAV+ T    
Sbjct  174   SPTASFSFNCSISGLSGFEVPNVKQSGTFCVDP--QTKDLMMSRFLPAAKAAVVETPQYI  231

Query  1576  -----------EQPRLVKEAKK------YEPYVMSYYSDYAGDVVTenedeendNMTIDQ  1448
                        +QPR V   ++      Y   ++S+Y+ +A DV +E ED + D      
Sbjct  232   PKKQPAATEPPKQPRKVVSGERKPLLDHYGSNIISFYNQFAEDVQSEGEDSQRDI----P  287

Query  1447  HKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKAR  1268
              K S K W +FPRL VK SL LLNP P MK +T  P S  T +V RLT           R
Sbjct  288   KKRSSKTWGIFPRLCVKKSLCLLNPIPAMKPRTPVPKSPPT-DVGRLT-----------R  335

Query  1267  KAYSGPIEKQSYDAICKQRFRSGALSGELCKADKR----------GLKADGQYPHGGSRS  1118
             KAYSGP++KQ+ DA  K+RF SG LS EL + + +            +A G  P   SRS
Sbjct  336   KAYSGPLDKQASDANNKRRFHSGVLSRELHQVENKPSDSRQFSYTSYRAGGLSPCRPSRS  395

Query  1117  GAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESD  938
             G ISPYRN +  S F +G  FLG+P+E +N+    +SS     ++L D      +K ++ 
Sbjct  396   GGISPYRNASPQSPFGKGARFLGLPKEVDNVTAEKYSSLYRKCSNLLDAAPPRIYKQDTV  455

Query  937   SPSDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMD  833
             SP++VVEKT+Y+DSV  V     D+ SSK E  ++
Sbjct  456   SPTEVVEKTLYIDSVTSVNLKK-DIPSSKSESRVN  489



>ref|XP_011101394.1| PREDICTED: uncharacterized protein LOC105179467 isoform X2 [Sesamum 
indicum]
Length=680

 Score =   238 bits (606),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 195/528 (37%), Positives = 264/528 (50%), Gaps = 93/528 (18%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             MEK +L+ + P++SVRR +S  +  E V RK  E P P+RQQ    L   +SD +  +VT
Sbjct  1     MEKRQLDFNAPLLSVRRYSSPSKSSELVKRKVTEKPLPSRQQS---LPTNRSDLDHEQVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDS----------------  1913
             KP AVPF WEQ PG+ + E   +V   E+PS  PRLPPGR  D+                
Sbjct  58    KPAAVPFHWEQIPGRPKSEVESQVPTPEEPSNTPRLPPGRLSDAIRRSSGEIPKLPPGRL  117

Query  1912  ---RRFYSCERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNP  1742
                 R+ S ER   ++ +R Q E  +  +HA L++ L ES+  K E D E  D       
Sbjct  118   SGPLRYSSGERCNDQNLYRPQVEAFSFSDHAILLERLNESLKCKDESDSESGDDAYSDAL  177

Query  1741  DVL---ESLSLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAA  1589
             D L   ES S+N S+  +SGC          D+KPSG       +RDFMM+RFLPAAKA 
Sbjct  178   DTLSPTESCSMNYSVSGVSGCHS-------SDMKPSGTFCIDKQTRDFMMNRFLPAAKAV  230

Query  1588  VLVTEQ------------PRLVKEA---------KKYEPYVMSYYSDYAGDVVTenedee  1472
             VL T Q            P+ VK+          K+Y    + YYS Y  +  +E+ED+E
Sbjct  231   VLETPQYVVKKSPVIDEPPKQVKKVVSGEIKPSLKQYSSDALPYYSRYIDNAESEDEDQE  290

Query  1471  ndNMTIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAP  1292
                      K S K W++ PR  VK SL LLNP P MKS+ + P   +  +++RLTRNA 
Sbjct  291   YSVPV----KKSGKAWRILPRFCVKNSLCLLNPLPAMKSRPRAPTPPNA-DLRRLTRNA-  344

Query  1291  SGPLNKARKAYSGPIEKQSYDAICKQRFRSGALSGELCK------------ADKRGLKAD  1148
                       +SGP++K +     K++F SG LS +L              A+ R   + 
Sbjct  345   ----------HSGPLDKNACLVPYKKKFHSGLLSRDLPALENKLTDGTNQFANIRDSHSS  394

Query  1147  GQYPHGGSRSGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTP  968
             G  P    RSG+ISPYRN +  S F EG GFLGVP++  N      +S R++   L D  
Sbjct  395   GVSPLRRHRSGSISPYRNESPKSPFREGVGFLGVPKQVANYNADKIASSRKLFKALQDVS  454

Query  967   IKSSFKGESDSPSDVVEKTVYVDSVNYVKTTSLDLCSS---KPEGLMD  833
                  +  S    DVVEKT+YVD   YVK T L +  S   K +GL++
Sbjct  455   RNQINERGSGPTGDVVEKTLYVD---YVKKTDLPISKSSCRKVDGLVN  499



>ref|XP_011101392.1| PREDICTED: uncharacterized protein LOC105179467 isoform X1 [Sesamum 
indicum]
Length=681

 Score =   237 bits (605),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 196/528 (37%), Positives = 262/528 (50%), Gaps = 92/528 (17%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             MEK +L+ + P++SVRR +S  +  E V RK  E P P+RQQ    L   +SD +  +VT
Sbjct  1     MEKRQLDFNAPLLSVRRYSSPSKSSELVKRKVTEKPLPSRQQS---LPTNRSDLDHEQVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDS----------------  1913
             KP AVPF WEQ PG+ + E   +V   E+PS  PRLPPGR  D+                
Sbjct  58    KPAAVPFHWEQIPGRPKSEVESQVPTPEEPSNTPRLPPGRLSDAIRRSSGEIPKLPPGRL  117

Query  1912  ---RRFYSCERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNP  1742
                 R+ S ER   ++ +R Q E  +  +HA L++ L ES+  K E D E  D       
Sbjct  118   SGPLRYSSGERCNDQNLYRPQVEAFSFSDHAILLERLNESLKCKDESDSESGDDAYSDAL  177

Query  1741  DVL---ESLSLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAA  1589
             D L   ES S+N S+  +SGC          D+KPSG       +RDFMM+RFLPAAKA 
Sbjct  178   DTLSPTESCSMNYSVSGVSGCHS-------SDMKPSGTFCIDKQTRDFMMNRFLPAAKAV  230

Query  1588  VLVTEQ------------PRLVKEA---------KKYEPYVMSYYSDYAGDVVTenedee  1472
             VL T Q            P+ VK+          K+Y    + YYS Y  +  +E+ED+E
Sbjct  231   VLETPQYVVKKSPVIDEPPKQVKKVVSGEIKPSLKQYSSDALPYYSRYIDNAESEDEDQE  290

Query  1471  ndNMTIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAP  1292
                      K S K W++ PR  VK SL LLNP P MKS+ + P   +  +++RLTRNA 
Sbjct  291   YSVPV----KKSGKAWRILPRFCVKNSLCLLNPLPAMKSRPRAPTPPNA-DLRRLTRNAH  345

Query  1291  SGPLNKARKAYSGPIEKQSYDAICKQRFRSGALSGELCK------------ADKRGLKAD  1148
             SGPL+K                  K++F SG LS +L              A+ R   + 
Sbjct  346   SGPLDKQNACL----------VPYKKKFHSGLLSRDLPALENKLTDGTNQFANIRDSHSS  395

Query  1147  GQYPHGGSRSGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTP  968
             G  P    RSG+ISPYRN +  S F EG GFLGVP++  N      +S R++   L D  
Sbjct  396   GVSPLRRHRSGSISPYRNESPKSPFREGVGFLGVPKQVANYNADKIASSRKLFKALQDVS  455

Query  967   IKSSFKGESDSPSDVVEKTVYVDSVNYVKTTSLDLCSS---KPEGLMD  833
                  +  S    DVVEKT+YVD   YVK T L +  S   K +GL++
Sbjct  456   RNQINERGSGPTGDVVEKTLYVD---YVKKTDLPISKSSCRKVDGLVN  500



>gb|KDP21102.1| hypothetical protein JCGZ_21573 [Jatropha curcas]
Length=668

 Score =   187 bits (475),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 208/697 (30%), Positives = 307/697 (44%), Gaps = 140/697 (20%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLN + P++SVRR ++  +       K  EN Q  ++     L   KSD  L +VT
Sbjct  1     MEERKLNFNAPLMSVRRSSTATKPSNVTKGKKFENAQLVKRNT---LPSYKSDFNLDQVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYP--CEDPSTMPRLPPGRKPDSRRFYSCERPCHEDS  1871
             +PVAVPF WEQ PG+R+  +G K  P  CE+ S  PR  P R  D  +    ++P  + +
Sbjct  58    EPVAVPFHWEQIPGRRK--DGSKPDPRGCEEASVTPRFTPRRALDVVKHIEDKKPEDQVA  115

Query  1870  FRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGR-------DSRECTNPDVLESLSLNC  1712
             FR Q +  +  + A  +D   E +  K +F+ E         D+R+  +   ++S S++C
Sbjct  116   FRPQIQSNSFNDIANGLDCSKEGVNEKSDFNSENDDDDDLYSDARDTLSG--MDSFSVDC  173

Query  1711  SIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVT---------  1577
             S+  +SG   L        VKPSG       +RDFMMSRFLPAAKA  L           
Sbjct  174   SVSGVSGFDSL-------AVKPSGTFNADPQTRDFMMSRFLPAAKAMTLEAPQYASRKQP  226

Query  1576  ---EQPRLVKEA----------KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWS  1436
                EQPR + +           +K    V SY+ D   +     E E+  +  ++  K  
Sbjct  227   VSGEQPRQIVQVVQRDRTPPVNRKESFNVPSYHQDLVDE-----ESEDECDQYVNYGKIM  281

Query  1435  RKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYS  1256
              K   L P L VK SL L+NP PGMK + Q+P S++  ++KR+T++  S       ++ S
Sbjct  282   TKGCGLLPLLCVKNSLRLVNPVPGMKVRNQSPMSAA-RDIKRMTKSVYS-------RSQS  333

Query  1255  GPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGS-----------RSGAI  1109
               I K + D + K+   +   S  L   D +      ++ +              RSGAI
Sbjct  334   PTINKPAKDPVHKKEPDNEVQSPRLVGVDNKLTGGSNRFTYARDRQMISRTSPFRRSGAI  393

Query  1108  SPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPS  929
             SPYRN    S F  G GFLGVP++ EN K +  + + +  +   +       +  S   S
Sbjct  394   SPYRNEAPQSPFPIG-GFLGVPKDLENFKANKLNLYGKCYSKSQELVPYHGLRHGSRPLS  452

Query  928   DVVEKTVYVDSVNYVKTTSLDLCSSK-PEGLMDPEEFKDLPERTSSNPNQE---------  779
                EKT+YVD+VN       +  SS   +G M P E KD+    SS   QE         
Sbjct  453   PTTEKTLYVDTVNVAGLLCSNAGSSDIKKGGMGPAE-KDIKSLLSSREIQETYTIESTSK  511

Query  778   -------PNQKRGS--------------------------------STSRSSRENFKPDY  716
                    P QK G                                 ST+     N + D 
Sbjct  512   DVTSLNFPEQKSGDADLSLLSDMSTHRDQWDTGEDLSQESLALVCVSTTTEGNLNIENDQ  571

Query  715   RSYSDVTsslspypplp------kspSESWLWRTLPSIPS--------RGGHNDQTNQSP  578
              S  D+ ++ + +          K+PSESWL RTLP++ S        RG +     Q  
Sbjct  572   ISNMDIGNAKTGFAQCSLPPSLPKTPSESWLSRTLPTVSSQNPSSHLYRGTNFRSKRQDS  631

Query  577   RATNTATKREITVSSCSEHHCNSYYTEELIPYGSHVW  467
             + T+T+TK E  V S   H+ +  Y+EEL P+ S  +
Sbjct  632   KTTSTSTKWENIVKSSYLHNDHVRYSEELFPHASQQF  668



>ref|XP_006467641.1| PREDICTED: uncharacterized protein LOC102610214 isoform X1 [Citrus 
sinensis]
 ref|XP_006467642.1| PREDICTED: uncharacterized protein LOC102610214 isoform X2 [Citrus 
sinensis]
Length=657

 Score =   182 bits (461),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 211/673 (31%), Positives = 309/673 (46%), Gaps = 111/673 (16%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSN-VRHLEGVNRKNVEnpqpnrqqqrqPLCVP--KSDCELS  2054
             M++ KLN + P++SVRR ++  V   +G N K VE+   +R+       +P  ++D  L 
Sbjct  1     MDERKLNFNAPLLSVRRYSTTAVASSDGENGKMVESSASSRR-----YSIPFYRTDLNLE  55

Query  2053  EVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHED  1874
             +VT+P AVPF WEQ PG R  + G ++   ED    PRLPP +  D  ++   +    +D
Sbjct  56    QVTEPAAVPFMWEQIPG-RPKDGGPELQHSEDAPVTPRLPPLKALDIIKYPLAKE--FDD  112

Query  1873  SFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLSLNCSIG  1703
             S R ++   +L  +   +DS  E+   K + D +  D       D L   +S S+NCS+ 
Sbjct  113   SPRVESR--SLNENMCTLDSPNEANDWKQQLDTDNDDDVYSDALDTLSSTDSYSINCSLS  170

Query  1702  DLSGCQGLDVEE-GRDDVKPSGDSRDFMMSRFLPAAKAAVL------------VTEQPRL  1562
              LSG  G  V+  G     P   +RDFMM RFLPAAKA  L              EQPR 
Sbjct  171   GLSGSDGQVVKRSGTFSTDP--QTRDFMMRRFLPAAKAMALEPPQYASRKQPVTIEQPRQ  228

Query  1561  VKE--AKKYEPYV-MSYYSDYAGDVVTenedeendNMTIDQH-------KWSRKFWKLFP  1412
             V +  ++   P V  S +  + G+ V E E+EE +  T D+          S K   L P
Sbjct  229   VIKVVSEDRRPLVNKSIFIPHYGEDVEEEEEEEEEEETEDEVDEYDDSDNLSGKACGLLP  288

Query  1411  RLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSY  1232
             RL +  SL LLNP PG+K++T + + SS+++V+ L + A +   N+        ++K   
Sbjct  289   RLCLNKSLCLLNPMPGLKARTHS-SVSSSSDVRNLGKAAYTESRNQT-------VKKHVR  340

Query  1231  DAICKQRFRSGALSGEL--------CKADKRGLKADGQYPHGGS--RSGAISPYRNVTTS  1082
             DA+ K +  SG  S +L        C +++    +D Q     S  R G ISPYRN    
Sbjct  341   DAVYKHQAESGVQSPKLLGIENKMTCGSNRFACLSDQQMAGRSSPYRRG-ISPYRNERPQ  399

Query  1081  SRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYV  902
             S F  G GFLGVP+EAEN++ +  + +    +   +     SFK    S S  VEKT+YV
Sbjct  400   SPF-RGGGFLGVPKEAENVRANKLNPYNRAGSKSQELFPHHSFKKRFGSLSPAVEKTLYV  458

Query  901   DSVNYVK---------------TTSLDLC------------------SSKPEGLMDPEEF  821
             D+VN+ K               T S+D                    SS  E +M P   
Sbjct  459   DTVNFSKISDTMGQMKSEGIERTASVDTVKDESRSETKVSASIEASRSSSFEKIMHPAGQ  518

Query  820   KDLPERTSSNPNQEPNQKRGSSTSRSSRENFKPDYRSYSDV---------Tsslspyppl  668
              D+ +    +    P  K    T+ ++ E      +  S+          +       PL
Sbjct  519   GDMEQCLGLDGELNPECKSLVCTNVTADETLNSSCQHKSEADDLGCINSGSEQSLLPLPL  578

Query  667   pkspSESWLWRTLPSIPSR--------GGHNDQTNQSPRATNTATKREITVSSCSEHHCN  512
             PK P+ESWLWRTLPS+ SR        G   +   Q P+   T TK E  V +   HH +
Sbjct  579   PKKPTESWLWRTLPSVSSRNSFSNPNVGTRFNPKKQDPKTPLTTTKWETIVKTSYAHHDH  638

Query  511   SYYTEELIPYGSH  473
               Y+EEL  + S 
Sbjct  639   IRYSEELTSHFSQ  651



>ref|XP_002266263.1| PREDICTED: uncharacterized protein LOC100253264 [Vitis vinifera]
 ref|XP_010655526.1| PREDICTED: uncharacterized protein LOC100253264 [Vitis vinifera]
 ref|XP_010655527.1| PREDICTED: uncharacterized protein LOC100253264 [Vitis vinifera]
Length=672

 Score =   180 bits (456),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 174/504 (35%), Positives = 239/504 (47%), Gaps = 94/504 (19%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  +LN S P++SVRRI+S +   +G  +K +ENP+P RQ       +P S  +  +VT
Sbjct  1     MEGKQLNFSAPLLSVRRISSTLGSSDGQKKKMIENPRPYRQISIPSY-IPYSSVD--QVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPC---EDPSTMPRLPPGRKPDSRRFYSCERPCHED  1874
             +PVAVPF WEQ PG  R ++G +  P    E+ S+ PR+PPGR      F   ++P   +
Sbjct  58    EPVAVPFRWEQIPG--RAKDGSEPEPQLHDEELSSTPRVPPGRV-----FDVIQKPAEIE  110

Query  1873  S-----FRFQTEPLALKNHAALMDSLVESMLGKGEFD------VEGRDSRECTNPDVLES  1727
             S     FR Q E  +L  +   ++ L E   G  + D       +  DS   TN     S
Sbjct  111   SDNRNIFRPQNETSSLDENFTNLEGLHEE--GDSDNDSGSDAYSDAVDSLSPTN-----S  163

Query  1726  LSLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL------  1583
             LSL+CS+  LSG  G        DVKPSG       +RD MM+RFLPAAKA VL      
Sbjct  164   LSLSCSVSGLSGSDG-------PDVKPSGTFSIDPQTRDLMMNRFLPAAKAMVLETPHYA  216

Query  1582  ------VTEQPRLVKEA---------KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQ  1448
                   V EQPR VK            KY   ++ YY  Y  +   E+EDE       D+
Sbjct  217   SRKQSVVLEQPRQVKRVISEDTKPSLNKYSTDIIPYYGQYEEEEGRESEDEH------DE  270

Query  1447  HKWSRKF--WKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNK  1274
             +  S       L PR  +K SL LL+P PGMK +T+ P SS+   VK+L+++A       
Sbjct  271   YDASGNIPGCGLIPRFCLKNSLCLLDPVPGMKVRTRVPKSSA-RVVKKLSKHA-------  322

Query  1273  ARKAYSGPIEKQSYDAICKQRFRSGALSGEL------------CKADKRGLKADGQYPHG  1130
               + +   + K ++DA  + +      S +L            C         DG  PH 
Sbjct  323   YVRDHDRIVTKNAWDAFRRNQLDYEVQSSKLHEVGNMMTVESNCTYSSDSQATDGSSPHR  382

Query  1129  GSRS-GAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSF  953
              S S G ISPYRN    S F EG GFLGVP E +N K      + +   +  +       
Sbjct  383   HSSSGGGISPYRNEAPHSPFHEGMGFLGVPIEVDNFKADRLIFYSQACKNFSEILSPEEN  442

Query  952   KGESDSPSDVVEKTVYVDSVNYVK  881
             K    S S +VEKT+Y+DSV+  +
Sbjct  443   KQGPGSVSPIVEKTLYIDSVDVAE  466



>emb|CBI30693.3| unnamed protein product [Vitis vinifera]
Length=792

 Score =   179 bits (455),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 172/501 (34%), Positives = 238/501 (48%), Gaps = 88/501 (18%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  +LN S P++SVRRI+S +   +G  +K +ENP+P RQ       +P S  +  +VT
Sbjct  121   MEGKQLNFSAPLLSVRRISSTLGSSDGQKKKMIENPRPYRQISIPSY-IPYSSVD--QVT  177

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPC---EDPSTMPRLPPGRKPDSRRFYSCERPCHED  1874
             +PVAVPF WEQ PG  R ++G +  P    E+ S+ PR+PPGR      F   ++P   +
Sbjct  178   EPVAVPFRWEQIPG--RAKDGSEPEPQLHDEELSSTPRVPPGRV-----FDVIQKPAEIE  230

Query  1873  S-----FRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLSL  1718
             S     FR Q E  +L  +   ++ L E    +G+ D +          D L    SLSL
Sbjct  231   SDNRNIFRPQNETSSLDENFTNLEGLHE----EGDSDNDSGSDAYSDAVDSLSPTNSLSL  286

Query  1717  NCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL---------  1583
             +CS+  LSG  G        DVKPSG       +RD MM+RFLPAAKA VL         
Sbjct  287   SCSVSGLSGSDG-------PDVKPSGTFSIDPQTRDLMMNRFLPAAKAMVLETPHYASRK  339

Query  1582  ---VTEQPRLVKEA---------KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKW  1439
                V EQPR VK            KY   ++ YY  Y  +   E+EDE       D++  
Sbjct  340   QSVVLEQPRQVKRVISEDTKPSLNKYSTDIIPYYGQYEEEEGRESEDEH------DEYDA  393

Query  1438  SRKF--WKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARK  1265
             S       L PR  +K SL LL+P PGMK +T+ P SS+   VK+L+++A         +
Sbjct  394   SGNIPGCGLIPRFCLKNSLCLLDPVPGMKVRTRVPKSSA-RVVKKLSKHA-------YVR  445

Query  1264  AYSGPIEKQSYDAICKQRFRSGALSGEL------------CKADKRGLKADGQYPHGGSR  1121
              +   + K ++DA  + +      S +L            C         DG  PH  S 
Sbjct  446   DHDRIVTKNAWDAFRRNQLDYEVQSSKLHEVGNMMTVESNCTYSSDSQATDGSSPHRHSS  505

Query  1120  S-GAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGE  944
             S G ISPYRN    S F EG GFLGVP E +N K      + +   +  +       K  
Sbjct  506   SGGGISPYRNEAPHSPFHEGMGFLGVPIEVDNFKADRLIFYSQACKNFSEILSPEENKQG  565

Query  943   SDSPSDVVEKTVYVDSVNYVK  881
               S S +VEKT+Y+DSV+  +
Sbjct  566   PGSVSPIVEKTLYIDSVDVAE  586



>ref|XP_002533963.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28419.1| conserved hypothetical protein [Ricinus communis]
Length=612

 Score =   173 bits (438),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 207/650 (32%), Positives = 295/650 (45%), Gaps = 108/650 (17%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrq---qqrqPLCVPKSDCELS  2054
             ME+ KLN ++P++SVRR ++  R        + E  + N      +R+ L   K    L 
Sbjct  1     MEERKLNFNIPLLSVRRSSTPTRSSAPTKSSSGEKGKKNDNFHPDRRRTLPSCKPAYILD  60

Query  2053  EVTKPVAVPFCWEQAPGKRRGENGGKVYP--CEDPSTMPRLPPGRKPDSRRFYSCERPCH  1880
             +VT+PVAVPF WEQ PG  R ++G    P   E+ S  PR+PP R  D  +    ++P  
Sbjct  61    QVTEPVAVPFQWEQIPG--RPKDGAVPDPQGHEEVSVTPRIPPRRVLDVVKHIDNKKPED  118

Query  1879  EDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLS------L  1718
             +D+   Q E  +  N    +D   E +  K    +E  D  +  + D L++LS      +
Sbjct  119   QDALTPQIEAKSFTNIVGRLDCSKEGVDEKAIIILENDDDEDVYS-DALDTLSPTDSFSV  177

Query  1717  NCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL---------  1583
             NCS+  +SG   L V       KPSG       ++DFMMSRFLPAAKA  L         
Sbjct  178   NCSLSGVSGFDNLAV-------KPSGTFSIDQQAQDFMMSRFLPAAKAMTLEPPQYASRK  230

Query  1582  ---VTEQPRLVKEA--KKYEPYVMSYYS----DYAGDVVTenedeendNMTIDQHKWSRK  1430
                  EQPR   +A  +   P V+   S     Y  D   E  ++E D+ + D    + K
Sbjct  231   QPVSGEQPRQTTKAVNRDRTPPVIRNRSCNIPPYHQDKEDEESEDECDDYS-DSGNITAK  289

Query  1429  FWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGP  1250
                  PRL +K SL LLNP PGMK +TQT + SST ++K+LT+   S       ++ S  
Sbjct  290   GCGFLPRLCIKNSLCLLNPVPGMKIRTQT-SMSSTKDIKKLTKAVFS-------RSQSPT  341

Query  1249  IEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSR-----------SGAISP  1103
             ++K + +A+ KQ+  S   S  +   + +      ++ +   R           SG ISP
Sbjct  342   VKKPARNAVSKQKQDSEVPSPRMVGVENKLTGGSNRFTYATDRQMISRTSPFRRSGCISP  401

Query  1102  YRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDV  923
             +RN    S F  G G  G+P++ ENLK + F+SF    +   +    +  +  S   S  
Sbjct  402   HRNEAPQSPF-RGRGSQGIPKQLENLKSNQFNSFNRGYSKSQELVSYNGIRRGSRPASPT  460

Query  922   VEKTVYVDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPER----------TSSNPNQEPN  773
             VEKT+YVD+VN        LCS+        E  +DL +           T  N N E +
Sbjct  461   VEKTLYVDTVNAAGI----LCSNS-------EMTEDLSKESMALVCISAATEGNVNIESD  509

Query  772   Q--KRGSSTSRSSRENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPSIPS-----  614
             Q  KR  + S  +           S V       P LPK+PSESWLWRTLPSI S     
Sbjct  510   QISKRDDTGSEKT-----------SLVLVQPPIPPLLPKTPSESWLWRTLPSISSQNQSS  558

Query  613   ---RGGHNDQTNQSPRATNTATKREITVSSCSEHHCNSYYTEELIPYGSH  473
                R        Q  +  +  TK E  V S   HH +  Y+EEL P+ S 
Sbjct  559   NSYRNNSFLSKRQDTKTFSATTKWENIVKSSYLHHDHVRYSEELFPHASQ  608



>ref|XP_007025362.1| Transcription initiation factor TFIID subunit 11, putative [Theobroma 
cacao]
 gb|EOY27984.1| Transcription initiation factor TFIID subunit 11, putative [Theobroma 
cacao]
Length=710

 Score =   171 bits (433),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 176/539 (33%), Positives = 256/539 (47%), Gaps = 102/539 (19%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLN + P++SVRR ++     +   +K VENP PNR+     L    SD  L +VT
Sbjct  1     MEERKLNFNAPLLSVRRFSATSAFSDRDKQKIVENPCPNRRHT---LPFYNSDVSLDQVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
             +PVAVPF WEQ PGK +G    +  P ++ S  PRLPPGR  D  ++   +   +++  R
Sbjct  58    EPVAVPFVWEQIPGKAKGGIEHESQPNKEASGTPRLPPGRVLDIMKYTVEKEFENQNVVR  117

Query  1864  FQTEPLALKNHAALMDS----LVESMLGKGEFDVEG-RDSRECTNPDVLESLSLNCSIGD  1700
              Q+E  +L ++   +DS    + E  + + E D +   D+ +  +P   +SLS+NCSI  
Sbjct  118   PQSEIYSLNDNVTKLDSSNKGINEKCISESETDDDAYSDALDTLSP--TDSLSMNCSISG  175

Query  1699  LSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVTEQ---------PR  1565
             LS              KPSG       +RDFMMSRFLPAAKA  L   Q         P 
Sbjct  176   LS-------GSSGLVAKPSGTFSSDPQTRDFMMSRFLPAAKAMTLEMPQYASRKQSVAPA  228

Query  1564  LVKEAKK------------YEPYVMSYYS-DYAGDVVTenedeendNMTIDQHKWSRKFW  1424
             L +E KK            YE  ++ +Y+ D  G+   +  D+       D    SRK  
Sbjct  229   LPREDKKVVVGDRKPPVNQYESVIIPHYNQDVDGEETEDEYDDYE-----DSGNLSRKAC  283

Query  1423  KLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIE  1244
              L PRLS K SL LLNP PG+K +T + +  ST EV + ++           K++S  IE
Sbjct  284   GLLPRLSFKNSLCLLNPVPGLKVRTHS-SMPSTREVAKPSKAT-------YMKSHSQIIE  335

Query  1243  KQSYDAICKQRFRSGA-----------------------LSG-----ELCKADKRGLKAD  1148
             K ++DA+ K +  SG                        LSG      L +  K+     
Sbjct  336   KHAWDAVHKNKSDSGVQSPQPQENKSDTGVQSPRLPENKLSGGVQSPRLPEIGKKMTCGS  395

Query  1147  GQYPHGGSR-------------SGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFS  1007
              Q+ + G +             S  ISPYR     S F  G GFLG+P+EAE    +M  
Sbjct  396   NQFTNSGDQQIVNRSPPKRLPGSARISPYRRERPQSPF-RGGGFLGMPKEAEKFNANMLI  454

Query  1006  SFREVDTHLWD-TPIKSSFKGESDSPSDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMD  833
              + + + +  +  P +S+ +G S + S  VEKT+YVD+VN+ +  S +  SS  +  MD
Sbjct  455   KYTKSNNNSQELVPYQSTRQG-SGALSPAVEKTLYVDTVNFAEIASSNSDSSDTKAPMD  512



>ref|XP_010274478.1| PREDICTED: uncharacterized protein LOC104609787 [Nelumbo nucifera]
 ref|XP_010274479.1| PREDICTED: uncharacterized protein LOC104609787 [Nelumbo nucifera]
Length=684

 Score =   169 bits (428),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 162/511 (32%), Positives = 236/511 (46%), Gaps = 76/511 (15%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ +L+ + P++SVRR +S +    G   K +E  Q             KSD +   V 
Sbjct  1     MEEKQLDFNAPLLSVRRFSS-ITASSGEESKRIEKSQRKIPS----FPYHKSDLKSGPVR  55

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
              P AVPF WEQ PG+ R  +  +  P E P    +LPPGR    ++  S + P   ++ R
Sbjct  56    NPGAVPFLWEQIPGRPRDGDALQARPIEPP----KLPPGRAFGVKQQSSNKEPEDPNAIR  111

Query  1864  FQTEPL-------ALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLS-----  1721
              Q   +       +L  +   +D+L ES+  K + D E       T  D LE+LS     
Sbjct  112   PQANDIHPSYKISSLDENVTALDNLKESLKEKRDADTEEDVDEAFT--DALETLSRTESF  169

Query  1720  -LNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAV--------  1586
              LNCS+  LS   G        +++PSG       +RDFM+ RFLPAAKA          
Sbjct  170   LLNCSVTGLSALDG-------PNMRPSGTFSTDPQTRDFMLGRFLPAAKAMAEETPQHTS  222

Query  1585  ----LVTEQPRLVKEAKK--------YEPYVMSYYSDYAGDVVTenedeendNMTIDQHK  1442
                 L  EQ R VK   +        Y+PY++  +         E+EDE+ ++   D   
Sbjct  223   RKQPLPREQQRQVKVVSEDRRPPQYHYKPYMLPQFP--MDQGEEESEDEDEEDGYDDTGN  280

Query  1441  WSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKA  1262
              S K   LFPR  +K S  LLNP PGMK +   P SS    V+++     +G      + 
Sbjct  281   LSAKACGLFPRFGLKNSFCLLNPIPGMKVRNHVPISS----VRKVGTRVKTG----HSRP  332

Query  1261  YSGPIEKQSYDAICKQRFRS-----GALSGEL---CKADKRGLKADGQYPHGGSRSGAIS  1106
             +    ++ ++DA+ K +  S     G L  E     +++     +D Q P G S    I 
Sbjct  333   HMEINDEHTWDAVYKHKLASRLKPSGVLEDETKLTSESNHLTYSSDSQTPDGSS-PYRIL  391

Query  1105  PYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSD  926
             PYRN    S F EG+GFLG+PRE ++ K +   S+ +    L D     + K E  S S 
Sbjct  392   PYRNEAPRSPFHEGSGFLGIPREVKDRKANGLDSYNKGGNCLRDILFHQNNKQELGSLSP  451

Query  925   VVEKTVYVDSVNYVKTTSLDLCSSKPEGLMD  833
             +VEKT+YVDSV+ V+T +    S+    LMD
Sbjct  452   MVEKTLYVDSVHTVETPNSKSSSANSRTLMD  482



>gb|KDO77867.1| hypothetical protein CISIN_1g006045mg [Citrus sinensis]
 gb|KDO77868.1| hypothetical protein CISIN_1g006045mg [Citrus sinensis]
 gb|KDO77869.1| hypothetical protein CISIN_1g006045mg [Citrus sinensis]
Length=657

 Score =   162 bits (411),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 167/499 (33%), Positives = 248/499 (50%), Gaps = 58/499 (12%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSN-VRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             M++ KLN + P++SVRR ++  V   +G N K VE    +R+     +   ++D  L +V
Sbjct  1     MDERKLNFNAPLLSVRRYSTTAVASSDGENGKMVEISASSRRYS---IPFYRTDLNLEQV  57

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
             T+P AVPF WEQ PG R  + G ++   ED    PRLPP +  D  ++   +    +DS 
Sbjct  58    TEPAAVPFMWEQIPG-RPKDGGPELQHSEDAPVTPRLPPLKALDIIKYPLAKE--FDDSP  114

Query  1867  RFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLSLNCSIGDL  1697
             R ++   +L  +   +DS  E+   K + D +  D       D L   +S S+NCS+  L
Sbjct  115   RVESR--SLNENMCTLDSPNEANDWKQQLDTDNDDDVYSDALDTLSSTDSYSINCSLSGL  172

Query  1696  SGCQGLDVEE-GRDDVKPSGDSRDFMMSRFLPAAKAAVL------------VTEQPRLVK  1556
             SG  G  V+  G     P   +RDFMM RFLPAAKA  L              EQPR V 
Sbjct  173   SGSDGQVVKRSGTFSTDPQ--TRDFMMRRFLPAAKAMALEPPQYASRKQPVTIEQPRQVI  230

Query  1555  E--AKKYEPYV-MSYYSDYAGDVVTenedeendNMTIDQH-------KWSRKFWKLFPRL  1406
             +  ++   P V  S +  + G+ V E E+EE +  T D+          S K   L PRL
Sbjct  231   KVVSEDRRPLVNKSIFIPHYGEDVEEEEEEEEEEETEDEVDEYDDSDNLSGKACGLLPRL  290

Query  1405  SVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYDA  1226
              +  SL LLNP PG+K++T + + SS+++V+ L + A +   N+        ++K   DA
Sbjct  291   CLNKSLCLLNPMPGLKARTHS-SVSSSSDVRNLGKAAYTESRNQT-------VKKHVRDA  342

Query  1225  ICKQRFRSGALSGEL--------CKADKRGLKADGQYPHGGS--RSGAISPYRNVTTSSR  1076
             + K +  SG  S +L        C +++    +D Q     S  R G ISPYRN    S 
Sbjct  343   VYKHQAESGVQSPKLLGIENKMTCGSNRFACLSDQQMAGRSSPYRRG-ISPYRNERPQSP  401

Query  1075  FSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVDS  896
             F  G GFLGVP+EAEN++ +  + +    +   +     SFK    S S  VEKT+YVD+
Sbjct  402   F-RGGGFLGVPKEAENVRANKLNPYNRAGSKSQELFPHHSFKKRFGSLSPAVEKTLYVDT  460

Query  895   VNYVKTTSLDLCSSKPEGL  839
             VN+ K +   +   K EG+
Sbjct  461   VNFSKISDT-MGQMKSEGI  478



>ref|XP_010277001.1| PREDICTED: uncharacterized protein LOC104611577 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010277002.1| PREDICTED: uncharacterized protein LOC104611577 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010277004.1| PREDICTED: uncharacterized protein LOC104611577 isoform X1 [Nelumbo 
nucifera]
Length=689

 Score =   163 bits (412),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 161/507 (32%), Positives = 242/507 (48%), Gaps = 62/507 (12%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +L+ + P++SVRR  S     EG  RK +       Q +   L   KS+ +   V
Sbjct  6     LMEEKQLDFNAPLLSVRRFASASPSSEGDERKRI----VKSQPKIPSLPYYKSELKSGPV  61

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
             + P AVPF WEQ PG+ +   G +    E P   P+LPPGR  D ++  S + P  + + 
Sbjct  62    SNPGAVPFLWEQIPGRPKDGGGAQPRATERPPVAPKLPPGRVLDVKQQSSNKEPEDQSAI  121

Query  1867  RFQTEP-------LALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLS----  1721
             + Q +          L N+   ++   ES+  KG+ D E  D+ E    D LE+LS    
Sbjct  122   KAQMDNDCPDHKISYLDNNLIALEKSKESLKKKGDADTE-EDADEAFT-DALETLSRTES  179

Query  1720  -LNCSIGDLSGCQGLDVEE-GRDDVKPSGDSRDFMMSRFLPAAKAAV------------L  1583
              LNCS+  +S   G +    G     P   +RDFM+ RFLPAAKA              L
Sbjct  180   FLNCSVTGMSAWDGPNTRSSGTFLTDPQ--TRDFMLGRFLPAAKAVAAEMPQYASRKQPL  237

Query  1582  VTEQPRLVKEA---------KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRK  1430
               EQPR  K+           KY P ++  +    G+  +E+EDE++   T      S  
Sbjct  238   PYEQPRETKKVVSGDTRPPQYKYRPNMIQQFPQDEGEEESEDEDEDDYGDT---GNLSAN  294

Query  1429  FWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGP  1250
                LFPR  +K S  LLNP PGMK +T+ P SS    V+++ +   +       +++   
Sbjct  295   ACGLFPRFCLKGSFCLLNPVPGMKVRTRVPVSS----VRKVGKQVKT----TYARSHKES  346

Query  1249  IEKQSYDAICKQRF-----RSGALSGE---LCKADKRGLKADGQYPHGGSRSGAISPYRN  1094
              ++ S+DA+ K +      R+G L  E     ++++    +D Q P   S    ISP R 
Sbjct  347   KDEHSWDAVYKHKLASRIQRTGVLEDESKLTSQSNRLTYWSDSQTPDE-SPPNRISPCRV  405

Query  1093  VTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEK  914
              T  S F EG+GFLG+P E +NLK +   S  +    L +     + + ES S S  VEK
Sbjct  406   GTRQSSFREGSGFLGIPEEVKNLKANGIDSHNKDHKSLREILFHQNSQIESGSVSPTVEK  465

Query  913   TVYVDSVNYVKTTSLDLCSSKPEGLMD  833
             T+YVDSV+ V+T++    S   + LM+
Sbjct  466   TLYVDSVHIVETSNSKSSSPDAKLLMN  492



>gb|KDO77870.1| hypothetical protein CISIN_1g006045mg [Citrus sinensis]
Length=663

 Score =   162 bits (410),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 167/499 (33%), Positives = 248/499 (50%), Gaps = 58/499 (12%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSN-VRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             M++ KLN + P++SVRR ++  V   +G N K VE    +R+     +   ++D  L +V
Sbjct  1     MDERKLNFNAPLLSVRRYSTTAVASSDGENGKMVEISASSRRYS---IPFYRTDLNLEQV  57

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
             T+P AVPF WEQ PG R  + G ++   ED    PRLPP +  D  ++   +    +DS 
Sbjct  58    TEPAAVPFMWEQIPG-RPKDGGPELQHSEDAPVTPRLPPLKALDIIKYPLAKE--FDDSP  114

Query  1867  RFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLSLNCSIGDL  1697
             R ++   +L  +   +DS  E+   K + D +  D       D L   +S S+NCS+  L
Sbjct  115   RVESR--SLNENMCTLDSPNEANDWKQQLDTDNDDDVYSDALDTLSSTDSYSINCSLSGL  172

Query  1696  SGCQGLDVEE-GRDDVKPSGDSRDFMMSRFLPAAKAAVL------------VTEQPRLVK  1556
             SG  G  V+  G     P   +RDFMM RFLPAAKA  L              EQPR V 
Sbjct  173   SGSDGQVVKRSGTFSTDPQ--TRDFMMRRFLPAAKAMALEPPQYASRKQPVTIEQPRQVI  230

Query  1555  E--AKKYEPYV-MSYYSDYAGDVVTenedeendNMTIDQH-------KWSRKFWKLFPRL  1406
             +  ++   P V  S +  + G+ V E E+EE +  T D+          S K   L PRL
Sbjct  231   KVVSEDRRPLVNKSIFIPHYGEDVEEEEEEEEEEETEDEVDEYDDSDNLSGKACGLLPRL  290

Query  1405  SVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYDA  1226
              +  SL LLNP PG+K++T + + SS+++V+ L + A +   N+        ++K   DA
Sbjct  291   CLNKSLCLLNPMPGLKARTHS-SVSSSSDVRNLGKAAYTESRNQT-------VKKHVRDA  342

Query  1225  ICKQRFRSGALSGEL--------CKADKRGLKADGQYPHGGS--RSGAISPYRNVTTSSR  1076
             + K +  SG  S +L        C +++    +D Q     S  R G ISPYRN    S 
Sbjct  343   VYKHQAESGVQSPKLLGIENKMTCGSNRFACLSDQQMAGRSSPYRRG-ISPYRNERPQSP  401

Query  1075  FSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVDS  896
             F  G GFLGVP+EAEN++ +  + +    +   +     SFK    S S  VEKT+YVD+
Sbjct  402   F-RGGGFLGVPKEAENVRANKLNPYNRAGSKSQELFPHHSFKKRFGSLSPAVEKTLYVDT  460

Query  895   VNYVKTTSLDLCSSKPEGL  839
             VN+ K +   +   K EG+
Sbjct  461   VNFSKISDT-MGQMKSEGI  478



>ref|XP_010277003.1| PREDICTED: uncharacterized protein LOC104611577 isoform X2 [Nelumbo 
nucifera]
Length=681

 Score =   162 bits (410),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 161/507 (32%), Positives = 242/507 (48%), Gaps = 62/507 (12%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +L+ + P++SVRR  S     EG  RK +       Q +   L   KS+ +   V
Sbjct  6     LMEEKQLDFNAPLLSVRRFASASPSSEGDERKRI----VKSQPKIPSLPYYKSELKSGPV  61

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
             + P AVPF WEQ PG+ +   G +    E P   P+LPPGR  D ++  S + P  + + 
Sbjct  62    SNPGAVPFLWEQIPGRPKDGGGAQPRATERPPVAPKLPPGRVLDVKQQSSNKEPEDQSAI  121

Query  1867  RFQTEP-------LALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLS----  1721
             + Q +          L N+   ++   ES+  KG+ D E  D+ E    D LE+LS    
Sbjct  122   KAQMDNDCPDHKISYLDNNLIALEKSKESLKKKGDADTE-EDADEAFT-DALETLSRTES  179

Query  1720  -LNCSIGDLSGCQGLDVEE-GRDDVKPSGDSRDFMMSRFLPAAKAAV------------L  1583
              LNCS+  +S   G +    G     P   +RDFM+ RFLPAAKA              L
Sbjct  180   FLNCSVTGMSAWDGPNTRSSGTFLTDPQ--TRDFMLGRFLPAAKAVAAEMPQYASRKQPL  237

Query  1582  VTEQPRLVKEA---------KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRK  1430
               EQPR  K+           KY P ++  +    G+  +E+EDE++   T      S  
Sbjct  238   PYEQPRETKKVVSGDTRPPQYKYRPNMIQQFPQDEGEEESEDEDEDDYGDT---GNLSAN  294

Query  1429  FWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGP  1250
                LFPR  +K S  LLNP PGMK +T+ P SS    V+++ +   +       +++   
Sbjct  295   ACGLFPRFCLKGSFCLLNPVPGMKVRTRVPVSS----VRKVGKQVKT----TYARSHKES  346

Query  1249  IEKQSYDAICKQRF-----RSGALSGE---LCKADKRGLKADGQYPHGGSRSGAISPYRN  1094
              ++ S+DA+ K +      R+G L  E     ++++    +D Q P   S    ISP R 
Sbjct  347   KDEHSWDAVYKHKLASRIQRTGVLEDESKLTSQSNRLTYWSDSQTPDE-SPPNRISPCRV  405

Query  1093  VTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEK  914
              T  S F EG+GFLG+P E +NLK +   S  +    L +     + + ES S S  VEK
Sbjct  406   GTRQSSFREGSGFLGIPEEVKNLKANGIDSHNKDHKSLREILFHQNSQIESGSVSPTVEK  465

Query  913   TVYVDSVNYVKTTSLDLCSSKPEGLMD  833
             T+YVDSV+ V+T++    S   + LM+
Sbjct  466   TLYVDSVHIVETSNSKSSSPDAKLLMN  492



>ref|XP_002305742.1| hypothetical protein POPTR_0004s05650g [Populus trichocarpa]
 gb|EEE86253.1| hypothetical protein POPTR_0004s05650g [Populus trichocarpa]
Length=735

 Score =   155 bits (392),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 175/573 (31%), Positives = 253/573 (44%), Gaps = 127/573 (22%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M + KLNL+ P++SVRRI++     +G   K +EN + NR+     L   K D  L +VT
Sbjct  1     MAERKLNLNAPLLSVRRISNIATTSDGAKTKKLENSRLNRRHA---LPPYKPDTSLDQVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCER--------  1889
             +PVAVPF WEQ PG+ +  +       ED S  P++PP R  D  R +  +R        
Sbjct  58    EPVAVPFHWEQIPGRAKDNSMEPPKVAEDASVTPKVPPRRSLDIVRHHKGKREPKVPKEA  117

Query  1888  ---PCHE-----DSFRFQTEP--------------------LALKNHAALMDSLVESM--  1799
                P        D  + Q E                     L L  H     S  +S+  
Sbjct  118   SVKPLISSRRVLDVVKHQKEKPEPKVPKQASVTQRNPPRKVLDLAKHQKEKKSNDQSLSR  177

Query  1798  -----------LGKGEFDVEGRDSRECTNPD-------VLESLS------LNCSIGDLSG  1691
                        + K ++  EG + +   N D        L++LS      +NCS    SG
Sbjct  178   PKAEANSFNKNVRKLDYSREGPNEKSGLNSDDDDVYSDALDALSPTDSISMNCSA---SG  234

Query  1690  CQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL------VTEQPRLVKEAK  1547
               G DV      VKPSG       +RDFMM+RFLPAAKA  L        +QP +V++ +
Sbjct  235   VSGFDVPV----VKPSGTFSKDQQTRDFMMNRFLPAAKAMALEPAHYASRKQPVVVEQLR  290

Query  1546  KYEPYVMS------------YYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLS  1403
                  V                S+Y  D+  +  ++E D         S K    FPRL 
Sbjct  291   PITKVVHGNRTPPPSKSQSIIISNYGQDIEEKESEDEYDGYE-GSGNISTKACGWFPRLC  349

Query  1402  VKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYDAI  1223
              K SLGLLNP PG+K +TQ  + SSTN+V++L+R +P+       ++ S  ++K   DA 
Sbjct  350   FKNSLGLLNPIPGLKLRTQA-SMSSTNDVEKLSRASPN-------RSVSQIVKKHLKDAA  401

Query  1222  CKQRFRSGALSGEL--------CKADKRGLKADGQYPHGGS------------RSGAISP  1103
              K +  SG  S  L        C +++    +D Q     S            RSG +SP
Sbjct  402   NKLKQDSGGQSPRLPEVENKLSCASNRFIYASDRQTISRTSPFRRSAGTSPFRRSGCVSP  461

Query  1102  YRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDV  923
             YRN    S F  G GFLG+P+EAE+L+ S  + ++ +      +    + +G S   S V
Sbjct  462   YRNEAPQSPF-RGRGFLGIPKEAEDLRASRLNLYKGISKSQELSSYYGAKRG-SRPASPV  519

Query  922   VEKTVYVDSVNYVKTTSLDLCSSKPEGLMDPEE  824
             VEKT+YVD+V+       D  SS  +  +D E+
Sbjct  520   VEKTLYVDTVHKAGILFPDSRSSNIKKYVDSEK  552



>ref|XP_006449510.1| hypothetical protein CICLE_v10014532mg [Citrus clementina]
 gb|ESR62750.1| hypothetical protein CICLE_v10014532mg [Citrus clementina]
Length=661

 Score =   153 bits (386),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 163/499 (33%), Positives = 237/499 (47%), Gaps = 77/499 (15%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSN-VRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             M++ KLN + P++SVRR ++  V   +G N K VE+   +R+     +   ++D  L +V
Sbjct  1     MDERKLNFNAPLLSVRRYSTTAVASSDGENGKMVESSASSRRYS---IPFYRTDLNLEQV  57

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRK------PDSRRFYSCERP  1886
             T+P AVPF WEQ PG R  + G ++   ED    PRL P +       P ++ F    R 
Sbjct  58    TEPAAVPFMWEQIPG-RPKDGGPELEHSEDAPVTPRLTPLKALNIIKYPLAKEFDDLPR-  115

Query  1885  CHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLSLN  1715
                       E  +L  +   +DS  E+   K + D +  D       D L   +S S+N
Sbjct  116   ---------VESRSLNENMCTLDSPNEANDWKQQLDTD--DDVYSDALDTLSSTDSYSIN  164

Query  1714  CSIGDLSGCQGLDVEE-GRDDVKPSGDSRDFMMSRFLPAAKAAVL------------VTE  1574
             CS+  LSG  G  V+  G     P   +RDFMM RFLPAAKA  L              E
Sbjct  165   CSLSGLSGSDGQVVKRSGTFSTDP--QTRDFMMRRFLPAAKAMALEPPQYASRKQPVTIE  222

Query  1573  QPRLVKE--AKKYEPYV-MSYYSDYAGDVVTenedeendNMTI-------------DQHK  1442
             QPR V +  ++   P V  S +  + G+ V E E+EE +                 D   
Sbjct  223   QPRQVIKVVSEDRRPLVNKSIFIPHYGEDVEEEEEEEEEEEEEEEEETEDEVDEYDDSGN  282

Query  1441  WSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKA  1262
              SRK   L PRL +  SL LLNP PG+K++T + + SS+++V+ L + A +   N+    
Sbjct  283   LSRKACGLLPRLCLNKSLCLLNPMPGLKARTHS-SVSSSSDVRNLGKAAYTESRNQT---  338

Query  1261  YSGPIEKQSYDAICKQRFRSGALSGEL--------CKADKRGLKADGQYPHGGS--RSGA  1112
                 ++K   DA+ K +  SG  S +L        C + +    +D Q     S  R G 
Sbjct  339   ----VKKHVRDAVYKHQAESGVQSPKLLGIENKMTCGSKQFACLSDQQMAGRSSPYRRG-  393

Query  1111  ISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSP  932
             ISPYRN    S F  G GFLGVP+EAEN++ +  + +    +   +     SFK    S 
Sbjct  394   ISPYRNERPQSPF-RGGGFLGVPKEAENVRANKLNPYNRAGSKSQELFPHHSFKKRFGSL  452

Query  931   SDVVEKTVYVDSVNYVKTT  875
             S  VEKT+YVD+VN+ K +
Sbjct  453   SPAVEKTLYVDTVNFSKIS  471



>gb|KHF99143.1| hypothetical protein F383_20211 [Gossypium arboreum]
Length=740

 Score =   153 bits (386),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 169/553 (31%), Positives = 243/553 (44%), Gaps = 125/553 (23%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLN + P++SVRR +      +   +K +ENP P  +       +   D  L +VT
Sbjct  1     MEERKLNFNAPLLSVRRFSGTSSFQDRNKQKIIENPAPAIRDALPWYSL---DASLDQVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR-----KPDSRRFYSCERPC-  1883
             +PVAVPF WEQ PGK +G         ++ S  PRLPPGR     KP        E  C 
Sbjct  58    EPVAVPFVWEQIPGKAKGGAEHVFEMDKEASGTPRLPPGRVLQVVKP------PVENDCV  111

Query  1882  HEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESL------S  1721
              ++  R Q E  ++ ++A  +D L +    K   + E  D  +    D L++L      S
Sbjct  112   KQNMARSQAETYSVNDNATKLDYLNDGTNEKCVLESENDDDDDDVYSDALDTLSPTDSFS  171

Query  1720  LNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVT------  1577
             +NCSI  LSG  GL         KPSG       ++DFM+ RFLPAAKA  L T      
Sbjct  172   MNCSISGLSGLDGL-------VAKPSGTFSTDPQTQDFMLRRFLPAAKAMALETPQYSLR  224

Query  1576  ------EQPRLVKE---------AKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHK  1442
                   EQPR VK+           +YE  ++ Y++    +  T++E  +      D   
Sbjct  225   KQSTAPEQPREVKKLVVADRKPLVNQYETAIVPYHNQDVDEEETDDESIDYQ----DSGN  280

Query  1441  WSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKR-------------LTR  1301
              SRK   L PRL  K SL LLNP PG+K +T + + SST +V +               +
Sbjct  281   LSRKACGLLPRLCFKNSLCLLNPVPGLKVRTHS-SMSSTRDVAKPCKATYLKSHSQIAEK  339

Query  1300  NA---------------PSGPLNKARKAYSGP-IEKQSYDAICKQ----------RFRSG  1199
             NA               P  P+NK+  A+  P + K   D   +            F+S 
Sbjct  340   NARDVVHKDKSARGVRSPRLPMNKSDGAFEPPRLSKDKSDTAFQSPRLSKDKPDTAFQSP  399

Query  1198  ALSGE------------------LCKADKRGLKADGQY-----PHGGSRSGAISPYRNVT  1088
              LS +                  +C +++     D Q      P     S  ISPYR   
Sbjct  400   RLSRDKPNSDVQSPRLPEIGKELICVSNQFSSSNDQQIVYKSPPKKLPGSARISPYRRER  459

Query  1087  TSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWD-TPIKSSFKGESDSPSDVVEKT  911
               S F  G GFLG+P+EAE  K +M   +   + +  +  P +SS +G S   S  VEKT
Sbjct  460   PQSPF-RGGGFLGMPKEAEKYKANMMVKYTRSNNNSQELVPYQSSRQG-SGPLSPAVEKT  517

Query  910   VYVDSVNYVKTTS  872
             +YVD+VN + +++
Sbjct  518   LYVDTVNEMASSN  530



>ref|XP_010999739.1| PREDICTED: uncharacterized protein LOC105107498 [Populus euphratica]
 ref|XP_010999740.1| PREDICTED: uncharacterized protein LOC105107498 [Populus euphratica]
Length=735

 Score =   151 bits (381),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 174/576 (30%), Positives = 251/576 (44%), Gaps = 133/576 (23%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M + KLNL+ P++SVRR ++     +G   K +EN   NR+     L   K D  L +VT
Sbjct  1     MAERKLNLNAPLLSVRRFSNITTTSDGAKTKKLENSLLNRRHA---LPPYKPDTSLDQVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCER--------  1889
             +PVAVPF WEQ PG+ +  +       E+ S  P++PP R  D  R +  +R        
Sbjct  58    EPVAVPFHWEQIPGRAKDNSMEPPKVAEEASVTPKVPPRRSLDIVRHHKGKREPKVPKEA  117

Query  1888  ---PCHE-----DSFRFQTEP--------------------LALKNHAALMDSLVESM--  1799
                P        D  + Q E                     L L  H     S  +S+  
Sbjct  118   SVKPLISSRRALDVVKHQKEKPEPKVPKQASVTQRNPPRKVLDLAKHQKEKKSNDQSLSR  177

Query  1798  -----------LGKGEFDVEGRDSRECTNPD-------VLESLS------LNCSIGDLSG  1691
                        + K ++  EG + +   N D        L++LS      +NCS    SG
Sbjct  178   PKAEANSFNKNVRKLDYSREGPNEKSGLNSDDDDVYSDALDTLSPTDSISMNCSA---SG  234

Query  1690  CQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL------------VTEQPR  1565
               G DV+     VKPSG       +RDFMM+RFLPAAKA  L            V EQ R
Sbjct  235   VSGFDVQV----VKPSGTFSKDQQTRDFMMNRFLPAAKAMALEPAHYASRKQPVVGEQLR  290

Query  1564  LVKEA---------KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFP  1412
              + +           K +  ++S Y    G  + E E E+  +        S K    FP
Sbjct  291   QITKVVRGNRTPPPSKSQSIIISNY----GQDIEEKESEDEYDGYEGSGNISTKACGWFP  346

Query  1411  RLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSY  1232
             RL  K SLGLLNP PG+K + Q  + SSTN+V++L+R +P+       ++ S  ++K   
Sbjct  347   RLCFKNSLGLLNPIPGLKLRNQA-SMSSTNDVEKLSRASPN-------RSVSQIVKKHLK  398

Query  1231  DAICKQRFRSGALSGEL--------CKADKRGLKADGQYPHGGS------------RSGA  1112
             DA  K +  SG  S  L        C +++    +D Q     S            RSG 
Sbjct  399   DAANKLKQDSGGQSPRLPEFENKLSCASNRFIYASDRQTMSRTSPLRRSAGTSPFRRSGC  458

Query  1111  ISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSP  932
             +SPYRN    S F  G GFLG+P+EAE+L+ S  + ++ +      +    + +G S   
Sbjct  459   VSPYRNEAPQSPF-RGRGFLGIPKEAEDLRASRLNLYKGISKSQELSSYYGAKRG-SRPA  516

Query  931   SDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMDPEE  824
             S VVEKT+YVD+V+       D  SS  +  +D E+
Sbjct  517   SPVVEKTLYVDTVHKAGILFPDSRSSNIKKYVDSEK  552



>ref|XP_011085986.1| PREDICTED: uncharacterized protein LOC105167851 isoform X1 [Sesamum 
indicum]
Length=626

 Score =   147 bits (370),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 150/484 (31%), Positives = 229/484 (47%), Gaps = 76/484 (16%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +L++  P++S+RR +S     E +N    +     R  ++Q   + KSD E  +V
Sbjct  1     MMEERQLDIGAPLLSMRRFSSPSYSSELLNS---QVTGKLRSSRQQSPPLNKSDWEYVKV  57

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRL-PPGRKPDSRRFYSCERPCHEDS  1871
             T+  +VPF WEQ PG+ + E   +V+  E+ S  PRL  PGR     R+ S ER  +++ 
Sbjct  58    TEQASVPFQWEQIPGRTKSEVQIQVHTLEESSNTPRLQSPGRVAVPSRYNSGERSNNQNI  117

Query  1870  FRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDLSG  1691
             +R Q E     +HA L++ L +S+  K E      D    +     ES SLN S+  LSG
Sbjct  118   YRPQIEAFLFGDHATLLEKLHQSLNCKDESGTLS-DGDAYSIALQTESWSLNYSVSGLSG  176

Query  1690  CQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLV---------TEQPRLVK  1556
              Q          VKPSG       +RDFMM RFL AAKA VL           EQP+ VK
Sbjct  177   YQS-------SGVKPSGTFSIDRQTRDFMMDRFLTAAKAVVLELPKHVVKKPNEQPKAVK  229

Query  1555  EAKKYE---------PYVMSYYSDYAGDVVTenedeendNMTIDQHKW------SRKFWK  1421
             +    E          Y + YY  Y  +V +E+           +HK+      S K   
Sbjct  230   KMVSDERNRLLGHSGSYPLQYYIQYTDNVESED----------GEHKYTFPVKKSGKSRL  279

Query  1420  LFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEK  1241
             + P    K SL +L+  PGMKSK   P SS+  + ++LTRNA S P +K + A       
Sbjct  280   IIPLFCAKDSLCILSTSPGMKSKFHAPTSSAA-DARKLTRNAQSRPSDKNKAA-------  331

Query  1240  QSYDAICKQRFRSGALSGELCKADKRGLKADGQY--PHGGSRSGAISPYR-----NVTTS  1082
                  + K++  SG +S +L +   +      Q    H  + SG +SP+R     +++ S
Sbjct  332   ----VLHKRKSNSGLMSRDLPEIKNKLTGNSNQLISSHIRNESG-VSPFRRYRSCSISPS  386

Query  1081  SRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSF--KGESDSPS-DVVEKT  911
              + S+ + FL + +E  +   +   S R++   L     K+    +G   +P+ D VEKT
Sbjct  387   RKKSQNSPFLDLRKEFPDYTANKIDSSRKLFEFLQGAS-KNQLCERGSGPTPTGDAVEKT  445

Query  910   VYVD  899
             VY+D
Sbjct  446   VYID  449



>ref|XP_011039432.1| PREDICTED: uncharacterized protein LOC105135997 [Populus euphratica]
 ref|XP_011039433.1| PREDICTED: uncharacterized protein LOC105135997 [Populus euphratica]
 ref|XP_011039434.1| PREDICTED: uncharacterized protein LOC105135997 [Populus euphratica]
Length=737

 Score =   145 bits (365),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 158/549 (29%), Positives = 245/549 (45%), Gaps = 121/549 (22%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLNL+ P++SVRR ++     +G   K +EN + N++     L + K D  L +VT
Sbjct  1     MEQRKLNLNAPLLSVRRFSNIATTSDGAKTKKLENSRFNKRHT---LPLYKPDASLDQVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCER----PCHE  1877
             +PVAVPF WEQ PGK +  +       E+ S  P +PP R  D  R +  +R    P  E
Sbjct  58    EPVAVPFHWEQIPGKAKDNSLETPEVPEEASVTPNVPPRRSLDILRHHKGKRESKGPNKE  117

Query  1876  DSF----------------RFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTN  1745
              S                 + + EP A K+ +    +    +L   +   E +   +  +
Sbjct  118   ASVTPRISSRKVMHVVKHHKEKPEPKAPKDVSVTQRNPPRRVLDLVKHHNESKPKDQSVS  177

Query  1744  PDVLESLS-------LNCSIGDLSGCQGLDVEEGRDDV----------------------  1652
                +++ S       LNCS    +   GLD  +  DDV                      
Sbjct  178   MPKIKAYSSNEKVNKLNCSGEGANEKAGLD-SDNDDDVYSDALQTLSPTDSISMNCSATG  236

Query  1651  ---------KPSG------DSRDFMMSRFLPAAKAAVL------VTEQPRLVKEAKKYEP  1535
                      KPSG       +RDFMMSRFLPAAKA  +        +QP +++++++   
Sbjct  237   LSGFDVPLVKPSGTFTTDQQTRDFMMSRFLPAAKAMAVEPAHYSSRKQPIVIEQSRQITK  296

Query  1534  YV-----------MSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSVKTSL  1388
              V            S    + G  + E E E+  +   +    S K    FPRL +K SL
Sbjct  297   VVHENRTPPPIKSQSLIIPHYGQDIEEKESEDECDGYENSGDISTKACGWFPRLCIKNSL  356

Query  1387  GLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYDAICKQRF  1208
             GLLNP PG+K  TQ  + SSTN+V++L+R A         ++YS  ++K   DA  K + 
Sbjct  357   GLLNPIPGLKLGTQA-SMSSTNDVEKLSRAA-------HNRSYSQTVKKHFKDAANKLKQ  408

Query  1207  RSGALSGELCKADKRGLKADGQYPHGGS--------------------RSGAISPYRNVT  1088
              SG  S +L + + +   +  ++ +G                      R+G +SP+RN  
Sbjct  409   DSGRQSPKLLEFENKLSCSSNRFIYGSDRQTMSRTSPFRRSAGTSPFRRAGCVSPHRNEA  468

Query  1087  TSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGE---SDSPSDVVE  917
                 F  G GFLG+P+EAE+L+ S  + ++ +      +   SS+ G    S   S +VE
Sbjct  469   PQPAF-RGRGFLGIPKEAEDLRASTVNLYKGISK----SQELSSYYGSKRWSRPASPIVE  523

Query  916   KTVYVDSVN  890
             KT+YVD+V+
Sbjct  524   KTLYVDTVH  532



>ref|XP_002276750.3| PREDICTED: uncharacterized protein LOC100245463 [Vitis vinifera]
 ref|XP_010657043.1| PREDICTED: uncharacterized protein LOC100245463 [Vitis vinifera]
 ref|XP_010657044.1| PREDICTED: uncharacterized protein LOC100245463 [Vitis vinifera]
 ref|XP_010657045.1| PREDICTED: uncharacterized protein LOC100245463 [Vitis vinifera]
Length=684

 Score =   143 bits (360),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 156/525 (30%), Positives = 235/525 (45%), Gaps = 98/525 (19%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVP--KSDCELSE  2051
             ME  +LN + P++SVRR +S V   E      VE+ + N       L +P  KS+ +   
Sbjct  7     MEDKQLNFNQPLLSVRRFSSTVASTE------VESKRKNDSSLSNILPLPTYKSELKSGP  60

Query  2050  VTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERP---CH  1880
             V  P AVPF WEQ PG+ + E+  ++     P T P+LPPGR  +++     +RP     
Sbjct  61    VRNPGAVPFIWEQTPGRPKDESKPQI-----PPTTPKLPPGRILNTK-----QRPPDKVS  110

Query  1879  EDSFRFQTEPLALKNHAALMDSLVESMLGKGEFD--VEGRDSRECTNPDVL---------  1733
             +D     T+   + +++  + SL E++     F   VE + S    + DV          
Sbjct  111   KDPIVAGTQTANILSNSRNVSSLDENVTKLENFKEGVEDKGSSGSEDGDVAYLDALDTLS  170

Query  1732  --ESLSLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAV---  1586
               ES  LNCS+  LSG  G        DVKPSG       +RDFMM RFLPAAKA     
Sbjct  171   RSESFFLNCSVSGLSGLDG-------PDVKPSGTFSTDPQTRDFMMGRFLPAAKAMASET  223

Query  1585  ---------------LVTEQPRLVKEAKKYE------PYVMSYYSDYAGDVVTenedeen  1469
                            +   QPR VK     +       Y ++  S YA D     E+ E+
Sbjct  224   PPYASRRQPVAQRQPVAQAQPRQVKNVVSGDRRPPLYQYRLNVSSHYAQD--KGREESED  281

Query  1468  dNMTIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASS--------STNEVK  1313
             ++  ++    S K   LFPR  +K S  L+NP   M  + + PASS        S ++  
Sbjct  282   EDNYVETELLSAKVCGLFPRFGLKNSFCLMNPVLRMGVQARVPASSLRATRARFSYSDAS  341

Query  1312  RLTRNAPSGPLNKARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPH  1133
              LT N  S   N   +  SG +++     + ++         E  ++ K   K+D Q P 
Sbjct  342   TLTENKHS--RNVVNEKKSGGLQRSKLQELKRK---------EENESSKTNYKSDSQKPD  390

Query  1132  GGS-----RSGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTP  968
             G S     + G + PYR+ +  S F+E  GF G+     +L    F S ++    ++   
Sbjct  391   GSSLYMRLQGGGMLPYRSDSLLSHFNEEKGFHGIHEAPMSLGVDGFGSHQQ-GQKIFREL  449

Query  967   IKSSFKGESDSPSDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMD  833
             + SS + ES   S  VEKT+Y+DSV+ V+  + +   S  +GL D
Sbjct  450   LASSPQRESGLESPTVEKTLYIDSVHIVEPRNSNSSRSDMKGLSD  494



>ref|XP_008225296.1| PREDICTED: uncharacterized protein LOC103324955 [Prunus mume]
Length=877

 Score =   142 bits (359),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 136/425 (32%), Positives = 187/425 (44%), Gaps = 77/425 (18%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLNL+   +SVRRI +     +G   K ++ P          L   KSD  L +VT
Sbjct  1     MEERKLNLNARFLSVRRIATTTVCTDGEKEKIIQRPDGRHT-----LPPYKSDFCLEQVT  55

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHED--S  1871
             +PVAVPF WE  PGK + +   +  P E  S  PRLPPG+  D     + E+  H D   
Sbjct  56    EPVAVPFHWEHIPGKAKEDKEPETQPREKTSVTPRLPPGKPIDYVTKQTLEKD-HADRNG  114

Query  1870  FRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGR-----DSRECTNPDVLESLSLNCSI  1706
              R Q +  +L  +   +    E    +   +VE       D+ E  +P   ES S NCS 
Sbjct  115   IRPQFKSYSLNENVMDLKCSKEKTNERRALEVEDEDDVYSDALETISP--TESFSFNCSA  172

Query  1705  GDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVT------------EQPRL  1562
               LS   G DV++ R        +RD MMSRFLPAAKA  L T            EQPR 
Sbjct  173   SGLSQSDGADVKQSR-AFSVDLQTRDLMMSRFLPAAKAMALETPHYAAKKQYIAPEQPRQ  231

Query  1561  VKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHK-----------------WSR  1433
             V    + +   +S            NE   +  +  DQ+K                  S 
Sbjct  232   VTRVIREDIRPLS------------NEQGSHMELQYDQYKEEEESEGEDDEYDPSGSISA  279

Query  1432  KFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSG  1253
             K   LFPRL ++ SL LL+P PGMK +T+   SSS+  ++        G      +++S 
Sbjct  280   KGCGLFPRLCLRNSLCLLSPVPGMKGRTRALMSSSSGVIR--PEKTTCG------RSHSQ  331

Query  1252  PIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGG------------SRSGAI  1109
             P+ K + DA  K + + G  SGEL K + +      ++ H G            SRS  I
Sbjct  332   PLNKHALDAAYKHKSKGGVKSGELHKFENKKAGESSRFSHSGDLKKGRSSPLRHSRSACI  391

Query  1108  SPYRN  1094
             SPYRN
Sbjct  392   SPYRN  396


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 76/161 (47%), Gaps = 39/161 (24%)
 Frame = -1

Query  1273  ARKAYSGPIEK------QSYDAICKQRFRS----GALSGELCKADKRGLKADGQYPHGG-  1127
             +R +YSG ++K       +  + C   +R+    G  SGEL K++ +   A     H G 
Sbjct  523   SRFSYSGDLKKGRSSTFSNSRSACISPYRNEAPCGVKSGELQKSEYKQAGASSCLSHSGD  582

Query  1126  -----------SRSGAISPYRNVTTSSRFSEGTGFLGVPREAE-------NLKGSMFSSF  1001
                        SRS  ISPYRN    S F  G GFLG+PRE         NL       F
Sbjct  583   FKNGRSSPFRHSRSACISPYRNEAPKSPFP-GVGFLGIPREESVKANSKFNLHNKGGHKF  641

Query  1000  REVDTHLWDTPIKSSFKG-ESDSPSDVVEKTVYVDSVNYVK  881
             +EV +H      + S +G  S+SP+  +EKT+YVD+VN  K
Sbjct  642   QEVLSH------QRSIQGPRSESPT--IEKTLYVDTVNTAK  674



>ref|XP_007212805.1| hypothetical protein PRUPE_ppa001223mg [Prunus persica]
 gb|EMJ14004.1| hypothetical protein PRUPE_ppa001223mg [Prunus persica]
Length=877

 Score =   140 bits (353),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 137/418 (33%), Positives = 196/418 (47%), Gaps = 63/418 (15%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLNL+   +SVRRI +     +G   K ++ P          L   KSD  L +VT
Sbjct  1     MEERKLNLNARFLSVRRIATTPVCTDGEKEKIIQRPDGRHT-----LPPYKSDFCLEQVT  55

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
             +PVAVPF WE  PGK + +   +  P E+ S  PRLPPG+  D     + E+  H D   
Sbjct  56    EPVAVPFHWEHIPGKAKEDKEPETQPREETSVTPRLPPGKPIDYVTKQTLEKD-HADRNG  114

Query  1864  FQTEPLALKNHAALMDSLV--ESMLGKGEFDVEGRD-----SRECTNPDVLESLSLNCSI  1706
              + +  +  ++  +MD     E    +   +VE  D     + E  +P   ES S NCS 
Sbjct  115   IRPQFKSYSSNENVMDLKCSKEKTNERRALEVEDEDDVYSDALETISP--TESFSFNCSA  172

Query  1705  GDLSGCQGLDVEEGRD---DVKPSGDSRDFMMSRFLPAAKAAVLVT------------EQ  1571
               LS   G DV++ R    D++    +RD MMSRFLPAAKA  L T            EQ
Sbjct  173   SGLSQSDGADVKQSRAFSVDLQ----TRDLMMSRFLPAAKAMALETPHYAAKKQYIAPEQ  228

Query  1570  PR----LVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTID-QHKWSRKFWKLFPRL  1406
             PR    +++E  +  P     + +   D   E E+ E ++   D     S K   LFPRL
Sbjct  229   PRQVTRVIREDIRPLPNEQGSHMELQYDQYKEEEESEGEDDEYDPSGSISAKGCGLFPRL  288

Query  1405  SVKTSLGLLNPFPGMKSKTQTPASSSTNEVK--RLTRNAPSGPLNKARKAYSGPIEKQSY  1232
              ++ SL LL+P PGMK +T+   SSS+  ++  + T            +++S P+ K + 
Sbjct  289   CLRNSLCLLSPVPGMKGRTRALMSSSSGVIRPEKTTYG----------RSHSQPLNKHAL  338

Query  1231  DAICKQRFRSGALSGELCKADKRGLKADGQYPHGG------------SRSGAISPYRN  1094
             DA  K + + G  SGEL K D +      ++ H G            SRS  ISPYRN
Sbjct  339   DAAYKHKSKGGIKSGELHKFDNKKAGESSRFSHSGDLKKGRSSPLRHSRSACISPYRN  396


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 62/127 (49%), Gaps = 29/127 (23%)
 Frame = -1

Query  1201  GALSGELCKADKRGLKADGQYPHGG------------SRSGAISPYRNVTTSSRFSEGTG  1058
             G  SGEL K++ +   A     H G            SRS  ISPYRN    S F  G G
Sbjct  557   GVKSGELQKSEYKQAGASSCLSHSGDFKNGRSSPFRHSRSACISPYRNEAPKSPFP-GVG  615

Query  1057  FLGVPREAE-------NLKGSMFSSFREVDTHLWDTPIKSSFKG-ESDSPSDVVEKTVYV  902
             FLG+PRE         NL+      F+EV +H      + S +G  S+SP+  +EKT+YV
Sbjct  616   FLGIPREESVKANSKFNLRNKGGHKFQEVLSH------QRSIQGPRSESPT--IEKTLYV  667

Query  901   DSVNYVK  881
             D+VN  K
Sbjct  668   DTVNTAK  674



>ref|XP_008341663.1| PREDICTED: uncharacterized protein LOC103404511 [Malus domestica]
Length=904

 Score =   140 bits (353),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 136/416 (33%), Positives = 194/416 (47%), Gaps = 58/416 (14%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLNL+ P +SVRRI +     +G   K ++ P          L   KSD  L +VT
Sbjct  1     MEERKLNLNAPFLSVRRITATPVIADGEKEKIMQRPNGRHT-----LPSYKSDFRLXQVT  55

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPG-----RKPDSRRFY---SCER  1889
             +PVAVPF WE  PGK + +N  ++ P E+ S  PRL PG     +K +S R Y   +  R
Sbjct  56    EPVAVPFHWEHIPGKAKEDNEAELQPTEEASVTPRLSPGKLIDVKKHNSERDYGDQNAAR  115

Query  1888  PCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCS  1709
               H  S+  +     LK    + +  +   L + E DV   D+ E  +P   +S SLNCS
Sbjct  116   SPHFKSYSLKENVKELKCSKDVTNERMALEL-QNEDDVYS-DALETISP--TKSFSLNCS  171

Query  1708  IGDLSGCQGLDVEEGR-DDVKPSGDSRDFMMSRFLPAAKAAVLVT------------EQP  1568
                LS  +  D++  R   + P   +RDFMM+RFLPAAKA  L T            E P
Sbjct  172   ASCLSQSESADIKPSRPSAIDP--QTRDFMMNRFLPAAKAMSLETPHAAKKQHTAAPEPP  229

Query  1567  RLVKEAKKYE-----PYVMSYYSDYAGDVVTenedeendNMTID-QHKWSRKFWKLFPRL  1406
             R +    + E     P       +       E ++ E ++   D     S K   LFPRL
Sbjct  230   RRITRVIRXEDTRPLPKEQGSQMELQHXQYEEEKESEGEDDDYDPSGSVSAKGCGLFPRL  289

Query  1405  SVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYDA  1226
              ++ SL LL P PGMK KT+   SSS+ +V R  ++          +++S  + K ++DA
Sbjct  290   CLRNSLCLLGPIPGMKVKTRDLMSSSS-KVARPEKSTYG-------RSHSQQLNKHAWDA  341

Query  1225  ICKQRFRSGALSGELCKADKRGLKADGQYPHGG------------SRSGAISPYRN  1094
               K++   G  SGEL K + +      ++ H G            SRS  ISPY N
Sbjct  342   AYKRKSNCGVQSGELLKLENKKAGESNRFTHSGDLKKGRXSPXXXSRSACISPYXN  397



>ref|XP_010057105.1| PREDICTED: uncharacterized protein LOC104445013 [Eucalyptus grandis]
 ref|XP_010057106.1| PREDICTED: uncharacterized protein LOC104445013 [Eucalyptus grandis]
 ref|XP_010057107.1| PREDICTED: uncharacterized protein LOC104445013 [Eucalyptus grandis]
 gb|KCW74113.1| hypothetical protein EUGRSUZ_E02752 [Eucalyptus grandis]
 gb|KCW74114.1| hypothetical protein EUGRSUZ_E02752 [Eucalyptus grandis]
 gb|KCW74115.1| hypothetical protein EUGRSUZ_E02752 [Eucalyptus grandis]
Length=645

 Score =   138 bits (348),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 158/536 (29%), Positives = 231/536 (43%), Gaps = 97/536 (18%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLN + P++SVRR +          RK     Q +   +R  L    SD  + +VT
Sbjct  1     MEERKLNFNSPLLSVRRYSMPTSSSSNKGRK----IQKSLSSRRHTLPSSDSDSNMDQVT  56

Query  2044  KPVAVPFCWEQAPGKRR-GENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
             +PVAVPF WE  PGK +  +   KV   E PS  PRLPP R   SR F            
Sbjct  57    EPVAVPFTWEHIPGKAKDNDQKSKVLLLEGPSVSPRLPPRR---SREF----------PL  103

Query  1867  RFQTEPLALKNHAALMDSLVESMLGKGEFDVEGR----------DSRECTNPDVLESLSL  1718
                 E  +  N  A +DS  +   G+ E D +            D+ E  +P    S S+
Sbjct  104   ARHLEGPSSNNITAKLDSFKQERTGEKEGDFKEDDDDDDEDAYSDAVETLSPPESLSFSV  163

Query  1717  NCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL---------  1583
             NCS+  LSG  G         +KPSG       +RDFMM RFLPAA+A  L         
Sbjct  164   NCSVSGLSGTDG-------PVMKPSGTFSVDSQTRDFMMGRFLPAARAMALEAPQYSSRK  216

Query  1582  ---VTEQPRLVKEA---------KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKW  1439
                 TEQ R VK+          K+Y   ++ YY   A +  + +EDE+      +    
Sbjct  217   QPATTEQTRDVKKLIVSESRPPPKQYSMEIVQYYKQDAWEEESADEDEDKGEENNNYGSV  276

Query  1438  SRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAY  1259
             S K   L PRL       LLNP PGMK ++ +P S   + +K  +++ P    ++ ++A 
Sbjct  277   SAKGCGLLPRLC------LLNPIPGMKPRSSSPISF-MSRMKGASKDGPPRSQSQPKRAD  329

Query  1258  SGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGS--RSGAISPYR---N  1094
             S            + +   G L+ +L   + R L +  ++ + G     G +SPYR   N
Sbjct  330   S------------EHKLDHGNLTPKLPGVENRMLSSSSRFNYSGELRAKGGLSPYRRSRN  377

Query  1093  VTTSSRFS-------EGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDS  935
                S + +       EG GFLG+ +EA N+  S      +   ++     K +    +  
Sbjct  378   DGVSPQRNRPALPPPEGFGFLGLSKEANNIDPSRLKLLLKKVDNMQKVSTKLTANQSNGL  437

Query  934   PSDVVEKTVYVDSVNYVKTTSLDLCSSKPEGL----MDPEEFKDLPERTSSNPNQE  779
              S   EKT+YVD+VN    +  D  SS  E L     +  E +    +T  NP++E
Sbjct  438   TSPAAEKTLYVDTVNTEAKSCCDSSSSNLEVLSNRAAEDMESRSDTRKTEENPSEE  493



>gb|KCW74116.1| hypothetical protein EUGRSUZ_E02752 [Eucalyptus grandis]
Length=651

 Score =   138 bits (348),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 158/536 (29%), Positives = 231/536 (43%), Gaps = 97/536 (18%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLN + P++SVRR +          RK     Q +   +R  L    SD  + +VT
Sbjct  1     MEERKLNFNSPLLSVRRYSMPTSSSSNKGRK----IQKSLSSRRHTLPSSDSDSNMDQVT  56

Query  2044  KPVAVPFCWEQAPGKRR-GENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
             +PVAVPF WE  PGK +  +   KV   E PS  PRLPP R   SR F            
Sbjct  57    EPVAVPFTWEHIPGKAKDNDQKSKVLLLEGPSVSPRLPPRR---SREF----------PL  103

Query  1867  RFQTEPLALKNHAALMDSLVESMLGKGEFDVEGR----------DSRECTNPDVLESLSL  1718
                 E  +  N  A +DS  +   G+ E D +            D+ E  +P    S S+
Sbjct  104   ARHLEGPSSNNITAKLDSFKQERTGEKEGDFKEDDDDDDEDAYSDAVETLSPPESLSFSV  163

Query  1717  NCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL---------  1583
             NCS+  LSG  G         +KPSG       +RDFMM RFLPAA+A  L         
Sbjct  164   NCSVSGLSGTDG-------PVMKPSGTFSVDSQTRDFMMGRFLPAARAMALEAPQYSSRK  216

Query  1582  ---VTEQPRLVKEA---------KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKW  1439
                 TEQ R VK+          K+Y   ++ YY   A +  + +EDE+      +    
Sbjct  217   QPATTEQTRDVKKLIVSESRPPPKQYSMEIVQYYKQDAWEEESADEDEDKGEENNNYGSV  276

Query  1438  SRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAY  1259
             S K   L PRL       LLNP PGMK ++ +P S   + +K  +++ P    ++ ++A 
Sbjct  277   SAKGCGLLPRLC------LLNPIPGMKPRSSSPISF-MSRMKGASKDGPPRSQSQPKRAD  329

Query  1258  SGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGS--RSGAISPYR---N  1094
             S            + +   G L+ +L   + R L +  ++ + G     G +SPYR   N
Sbjct  330   S------------EHKLDHGNLTPKLPGVENRMLSSSSRFNYSGELRAKGGLSPYRRSRN  377

Query  1093  VTTSSRFS-------EGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDS  935
                S + +       EG GFLG+ +EA N+  S      +   ++     K +    +  
Sbjct  378   DGVSPQRNRPALPPPEGFGFLGLSKEANNIDPSRLKLLLKKVDNMQKVSTKLTANQSNGL  437

Query  934   PSDVVEKTVYVDSVNYVKTTSLDLCSSKPEGL----MDPEEFKDLPERTSSNPNQE  779
              S   EKT+YVD+VN    +  D  SS  E L     +  E +    +T  NP++E
Sbjct  438   TSPAAEKTLYVDTVNTEAKSCCDSSSSNLEVLSNRAAEDMESRSDTRKTEENPSEE  493



>emb|CAN81695.1| hypothetical protein VITISV_042576 [Vitis vinifera]
Length=1185

 Score =   140 bits (352),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 157/526 (30%), Positives = 235/526 (45%), Gaps = 100/526 (19%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVP--KSDCELSE  2051
             ME  +LN + P++SVRR +S V   E      VE+ + N       L +P  KS+ +   
Sbjct  1     MEDKQLNFNQPLLSVRRFSSTVASTE------VESKRKNDSSLSNILPLPTYKSELKSGP  54

Query  2050  VTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERP---CH  1880
             V  P AVPF WEQ PG+ + E+  ++     P T P+LPPGR  +++     +RP     
Sbjct  55    VRNPGAVPFIWEQTPGRPKDESKPQI-----PPTXPKLPPGRILNTK-----QRPPDKVS  104

Query  1879  EDSFRFQTEPLALKNHAALMDSLVESMLGKGEFD--VEGRDSRECTNPDVL---------  1733
             +D     T+   + +++  + SL E++     F   VE + S    + DV          
Sbjct  105   KDPIVAGTQTANILSNSRNVSSLDENVTKLENFKEGVEDKGSSGSEDGDVAYLDALDTLS  164

Query  1732  --ESLSLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAV---  1586
               ES  LNCS+  LSG  G        DVKPSG       +RDFMM RFLPAAKA     
Sbjct  165   RSESFFLNCSVSGLSGLDG-------PDVKPSGTFSTDPQTRDFMMGRFLPAAKAMASET  217

Query  1585  ---------------LVTEQPRLVKEAKK-------YEPYVMSYYSDYAGDVVTenedee  1472
                            +   QPR VK           Y+ Y ++  S YA D     E+ E
Sbjct  218   PPYASRRQPVAQRQPVAQAQPRQVKNVVSGDRRPPLYQ-YRLNVSSHYAQD--KGREESE  274

Query  1471  ndNMTIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASS--------STNEV  1316
             +++  ++    S K   LFPR  +K S  L+NP   M  + + PASS        S ++ 
Sbjct  275   DEDNYVETELLSAKVCGLFPRFGLKNSFCLMNPVLRMGVQARVPASSLRATRARFSYSDA  334

Query  1315  KRLTRNAPSGPLNKARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYP  1136
               LT N  S   N   +  SG +++     + ++         E  ++ K   K D Q P
Sbjct  335   STLTENKHSR--NVVNEKKSGGLQRSKLQELKRK---------EENESSKTNYKXDSQKP  383

Query  1135  HGGS-----RSGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDT  971
              G S     + G + PYR+ +  S F+E  GF G+     +L    F S ++    ++  
Sbjct  384   DGSSLYMRLQGGGMLPYRSDSLLSHFNEEKGFHGIHEXPMSLGVDGFGSHQQ-GQKIFRE  442

Query  970   PIKSSFKGESDSPSDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMD  833
              + SS + ES   S  VEKT+Y+DSV+ V+  + +   S  +GL D
Sbjct  443   LLASSPQRESGLESPTVEKTLYIDSVHIVEPRNSNSSRSDMKGLSD  488



>ref|XP_009352764.1| PREDICTED: uncharacterized protein LOC103944087 [Pyrus x bretschneideri]
Length=923

 Score =   139 bits (351),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 138/418 (33%), Positives = 191/418 (46%), Gaps = 62/418 (15%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLNL+ P +SVRRI +     +G   K ++ P          L   KSD  L +VT
Sbjct  1     MEERKLNLNAPFLSVRRIATTPVIADGEKEKIMQRPDGRHT-----LPSYKSDFRLEQVT  55

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR-----KPDSRRFYSCE---R  1889
             +PVAVPF WE  PGK + +N  ++ P E+ S  PRLP G+     K +S R Y  +   R
Sbjct  56    EPVAVPFHWEHIPGKAKEDNEAELQPTEEASVTPRLPRGKLMDVTKHNSERAYGDQNEAR  115

Query  1888  PCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCS  1709
               H  ++  +     LK    + +  +   L + E DV   D+ E  +P   +S SLNCS
Sbjct  116   SPHFKAYSLKKNVKELKCSKDVTNERLALEL-QNEDDVYS-DALETISP--TKSFSLNCS  171

Query  1708  IGDLSGCQGLDVEEGR-DDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPRLVKEAKKYEPY  1532
                LS  +  DV+  R   + P   +RDFMM+RFLPAAKA  L  E P   K+     P 
Sbjct  172   ASCLSQSESADVKPSRPSAIDP--QARDFMMNRFLPAAKAMSL--ETPHAAKKQHTAAPE  227

Query  1531  VMSYYSDYAGDVVTenedeendNMTIDQH--------------------KWSRKFWKLFP  1412
                  +      VT    +E  +    QH                      S K   LFP
Sbjct  228   PPRRITRVIRREVTRPLPKEQVSQMELQHGQYEEEKESEGEDDDYNPSGSVSAKGCGLFP  287

Query  1411  RLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSY  1232
             RL ++ SL LL P PGMK KT+   SSS+ +V R  ++          +++S  + K ++
Sbjct  288   RLCLRNSLCLLGPIPGMKVKTRGLMSSSS-KVARPEKSTYG-------RSHSQQLNKHAW  339

Query  1231  DAICKQRFRSGALSGELCKADKR------------GLKADGQYPHGGSRSGAISPYRN  1094
             DA  K++   G  SGEL K + +             LK     P G S S  ISPYRN
Sbjct  340   DAAYKRKSNCGVQSGELLKLENKKAGESNRFTHSGDLKKGRSSPFGNSPSACISPYRN  397


 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 77/166 (46%), Gaps = 34/166 (20%)
 Frame = -1

Query  1306  TRNAPSGPLNKARKAYSGPIEKQSYDAICKQRFRS--GALSGELCKADKRGLKADGQYPH  1133
             +R A SG LNK R   S P        I   R  +  G  S EL K + + +     + H
Sbjct  576   SRFAHSGDLNKGR---SSPFRHSRSTCISPYRNVAPLGVHSAELQKLEYKQVSESSCHTH  632

Query  1132  GG------------SRSGAISPYRNVTTSSRFSEGTGFLGVPRE-------AENLKGSMF  1010
              G            SRSG ISPYRN    S F  G GFLG+PRE         NL     
Sbjct  633   SGDLNKGRSSPFRHSRSGCISPYRNEAPKSPFP-GVGFLGIPREESTKANSKSNLHKKGG  691

Query  1009  SSFREVDTHLWDTPIKSSFKG-ESDSPSDVVEKTVYVDSVNYVKTT  875
              SF+EV +H      + + +G  S+SP  +VEKT+YVD+VN  K +
Sbjct  692   HSFQEVTSH------QRNIQGPRSESP--IVEKTLYVDTVNIGKLS  729



>emb|CBI21990.3| unnamed protein product [Vitis vinifera]
Length=641

 Score =   137 bits (345),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 155/513 (30%), Positives = 223/513 (43%), Gaps = 111/513 (22%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVP--KSDCELSE  2051
             ME  +LN + P++SVRR +S V   E      VE+ + N       L +P  KS+ +   
Sbjct  1     MEDKQLNFNQPLLSVRRFSSTVASTE------VESKRKNDSSLSNILPLPTYKSELKSGP  54

Query  2050  VTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDS  1871
             V  P AVPF WEQ PG+ + E+  ++     P T P+LPPGR  +++     +RP     
Sbjct  55    VRNPGAVPFIWEQTPGRPKDESKPQI-----PPTTPKLPPGRILNTK-----QRPP----  100

Query  1870  FRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLSLNCSIGD  1700
                              D  VE    KG    E  D       D L   ES  LNCS+  
Sbjct  101   -----------------DKGVED---KGSSGSEDGDVAYLDALDTLSRSESFFLNCSVSG  140

Query  1699  LSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAV----------------  1586
             LSG  G        DVKPSG       +RDFMM RFLPAAKA                  
Sbjct  141   LSGLDG-------PDVKPSGTFSTDPQTRDFMMGRFLPAAKAMASETPPYASRRQPVAQR  193

Query  1585  --LVTEQPRLVKEAKK-------YEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSR  1433
               +   QPR VK           Y+ Y ++  S YA D     E+ E+++  ++    S 
Sbjct  194   QPVAQAQPRQVKNVVSGDRRPPLYQ-YRLNVSSHYAQD--KGREESEDEDNYVETELLSA  250

Query  1432  KFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASS--------STNEVKRLTRNAPSGPLN  1277
             K   LFPR  +K S  L+NP   M  + + PASS        S ++   LT N  S   N
Sbjct  251   KVCGLFPRFGLKNSFCLMNPVLRMGVQARVPASSLRATRARFSYSDASTLTENKHS--RN  308

Query  1276  KARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGS-----RSGA  1112
                +  SG +++     + ++         E  ++ K   K+D Q P G S     + G 
Sbjct  309   VVNEKKSGGLQRSKLQELKRK---------EENESSKTNYKSDSQKPDGSSLYMRLQGGG  359

Query  1111  ISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSP  932
             + PYR+ +  S F+E  GF G+     +L    F S ++    ++   + SS + ES   
Sbjct  360   MLPYRSDSLLSHFNEEKGFHGIHEAPMSLGVDGFGSHQQ-GQKIFRELLASSPQRESGLE  418

Query  931   SDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMD  833
             S  VEKT+Y+DSV+ V+  + +   S  +GL D
Sbjct  419   SPTVEKTLYIDSVHIVEPRNSNSSRSDMKGLSD  451



>ref|XP_002528543.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33855.1| conserved hypothetical protein [Ricinus communis]
Length=607

 Score =   136 bits (342),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 183/664 (28%), Positives = 273/664 (41%), Gaps = 152/664 (23%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSE-  2051
             +ME+ +L+ + P++SVRR +S V  +E  N+K  EN             +PK   EL   
Sbjct  6     LMEEKQLDFNQPLLSVRRFSSTVSTIEADNKKKTENAFSKVPP------LPKYKSELKSG  59

Query  2050  -VTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERP----  1886
              V  P  VPF WE++PGK + E   +    + P  +P+LPPGR  +  R    + P    
Sbjct  60    PVRNPGTVPFVWERSPGKPKCEIKPQTVALQQPPMIPKLPPGRMLNVERQGLNKAPGGTA  119

Query  1885  ---CHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLS--  1721
                C   +    +   +  +   + +      + K   D+ G +  E T  D L++LS  
Sbjct  120   AGQCEARNGLLGSYGFSSSDRNVIKEESSREKMEKT--DMSGSEDDE-TYVDALDTLSRS  176

Query  1720  ----LNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVT--  1577
                 LNCSI  +SG  G        D+KPSG       +RDFMM RFLPAAKA    T  
Sbjct  177   ESFFLNCSISGVSGLDG-------PDMKPSGTFSTDPQTRDFMMGRFLPAAKAMASETPQ  229

Query  1576  ----------EQPRLVKE---AKKYEPYV-------MSYYSDYAGDVVTenedeendNMT  1457
                       EQPR +K+    +KY P+        M + S  +G    E ED++ +   
Sbjct  230   HSTKKQPAAQEQPRQIKKTLGVEKYHPFNECRRQSDMPHCSQCSGVKEIEQEDDDYNYEG  289

Query  1456  IDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLN  1277
              D    S K   LFPRL ++ S  LL+P PGM+ + Q P S S      +T+  P     
Sbjct  290   PDNS--SPKVCGLFPRLCLQNSFCLLSPVPGMRKQVQLPISLS-----HMTKVKP-----  337

Query  1276  KARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYR  1097
                          SY A C +    G                              SPY 
Sbjct  338   -------------SYAACCTETMNEG---------------------------NGTSPYH  357

Query  1096  NVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVE  917
             +  + S  SE  GFLGVP + +N     F++  +   +  +       + ES   S +VE
Sbjct  358   DKFSQSAVSEEKGFLGVPEKPKNSGARGFNAHAKGGKNFRELLANERNEWESAPASSLVE  417

Query  916   KTVYVDSVNYVKTTSLDLCSSKPEGLMD----------------PEEFKDLPERTSSNP-  788
             KT+Y+DSV  +K  + +  S   + L++                   F+D+    S+ P 
Sbjct  418   KTLYIDSVQMIKPQTSNSSSPDTKDLINCRRDDQDKEIDGTATFDSSFQDIKNANSAYPK  477

Query  787   -NQEPNQKRGSSTSRSSRENF----KPDYRSY-----------SDVTsslspypplpksp  656
              N  P +       + +REN     K D +S                +     PPLPKSP
Sbjct  478   VNVLPEKSSIQDPIKMTRENVADNGKTDLKSQLCTELGDQETPDSCYTLHPLPPPLPKSP  537

Query  655   SESWLWRTLPSIPSR--------GGHNDQTNQSPRATNTATKREITVSSCSEHHCNSYYT  500
             SESWL RTLP++ S+        G H     Q+P+  +   K E  V + +    +  ++
Sbjct  538   SESWLKRTLPAVSSKHTSLKSFPGMHAYPVVQAPKVQSPDLKWETIVKTSNVQCGHLRFS  597

Query  499   EELI  488
             EEL+
Sbjct  598   EELL  601



>ref|XP_004172354.1| PREDICTED: uncharacterized LOC101207534 [Cucumis sativus]
Length=676

 Score =   137 bits (344),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 146/507 (29%), Positives = 224/507 (44%), Gaps = 95/507 (19%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLN + P++SVRR +     +   N K  EN   +R+       V +    L +VT
Sbjct  1     MEERKLNFNAPLMSVRRFSKAASSISKANEKKSENSHFSRRST---FPVSRPQFNLDQVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKV------YPCEDPSTMPRLPPGRKPDSRRFYSCERPC  1883
             +PVAVPF WEQ PG+ + ++G         +P E   + PRL  G   D+ ++ S    C
Sbjct  58    EPVAVPFYWEQIPGRAKNDSGSASPEVHLPHPPERTCSTPRLSFGTALDANKYSSEMEAC  117

Query  1882  HEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSL-----  1718
             H+D     +      N   +     ++  G+        D  +    D  E+LSL     
Sbjct  118   HQDGCESSS-----SNAIVVRLESAKASGGRSLASENDDDDDDDDFSDARETLSLTGSFS  172

Query  1717  --NCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL-------  1583
               NCS+  +SG  G         VKPSG       +RDFMMSRFLPAAKA VL       
Sbjct  173   VNNCSVSGISGYNG-------PMVKPSGTFRTDPQTRDFMMSRFLPAAKAMVLEPAKYSL  225

Query  1582  -----VTEQPRLVKEA--------KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQH-  1445
                    EQPR VK+A        K+ E  ++     Y  D V   ++ + ++ ++D   
Sbjct  226   KKKLVAVEQPRQVKKAENRRISPIKRLESTLL---LQYGKDEVHGVDEVDEESDSVDDEY  282

Query  1444  ----KWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLN  1277
                   S +   L P +  K SLGLLNP PGM+ +T+ P S        +T+    G   
Sbjct  283   DNSGHISARGCGLIPNICFKNSLGLLNPVPGMRIRTEAPMS--------VTKKV-GGSSR  333

Query  1276  KARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRS-----GA  1112
                 +Y   + K ++DA  KQ+  +   S +L +      K  G+  H  S +     G 
Sbjct  334   TLHHSYGQKMNKHAWDATYKQKSEAAVGSPKLLEVKD---KWTGESKHFSSSTDLQMKGR  390

Query  1111  ISPYRNVTTSSRFSEGTG--------FLGVPREAENLKGSMFSSFREVDTHLWDTP-IKS  959
              SP+R+   +S F             F+ VP+E + +  S      ++D H  DTP I++
Sbjct  391   SSPFRHSRAASPFRNEASRSPCRRQPFV-VPKEVDIISKSK----GDIDCH--DTPSIQA  443

Query  958   SFKGESDSPSDVVEKTVYVDSVNYVKT  878
             + K   D  + ++EKT+Y+D+ +   T
Sbjct  444   TNKDGVDMANILMEKTLYIDTASVAGT  470



>ref|XP_004150220.1| PREDICTED: uncharacterized protein LOC101207534 [Cucumis sativus]
 gb|KGN65629.1| hypothetical protein Csa_1G470450 [Cucumis sativus]
Length=676

 Score =   136 bits (342),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 146/507 (29%), Positives = 223/507 (44%), Gaps = 95/507 (19%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLN + P++SVRR +     +   N K  EN   +R+       V +    L +VT
Sbjct  1     MEERKLNFNAPLMSVRRFSKAASSISKANEKKSENSHFSRRST---FPVSRPQFNLDQVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKV------YPCEDPSTMPRLPPGRKPDSRRFYSCERPC  1883
             +PVAVPF WEQ PG+ + ++G         +P E   + PRL  G   D+ ++ S    C
Sbjct  58    EPVAVPFYWEQIPGRAKNDSGSASPEVHLPHPPERTCSTPRLSFGTALDANKYSSEMEAC  117

Query  1882  HEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSL-----  1718
             H+D     +      N   +     ++  G+        D  +    D  E+LSL     
Sbjct  118   HQDGCESSS-----SNAIVVRLESAKASGGRSLASENDDDDDDDDFSDARETLSLTGSFS  172

Query  1717  --NCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL-------  1583
               NCS+  +SG  G         VKPSG       +RDFMMSRFLPAAKA VL       
Sbjct  173   VNNCSVSGISGYNG-------PMVKPSGTFRTDPQTRDFMMSRFLPAAKAMVLEPAKYSL  225

Query  1582  -----VTEQPRLVKEA--------KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQH-  1445
                    EQPR VK+A        K+ E  ++     Y  D V   ++ + ++ ++D   
Sbjct  226   KKKLVAVEQPRQVKKAENRRISPIKRLESTLL---LQYGKDEVHGVDEVDEESDSVDDEY  282

Query  1444  ----KWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLN  1277
                   S +   L P +  K SLGLLNP PGM+ +T+ P S        +T+    G   
Sbjct  283   DNSGHISARGCGLIPNICFKNSLGLLNPVPGMRIRTEAPMS--------VTKKV-GGSSR  333

Query  1276  KARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRS-----GA  1112
                 +Y   + K ++DA  KQ+  +   S  L +      K  G+  H  S +     G 
Sbjct  334   TLHHSYGQKMNKHAWDATYKQKSEAAVGSPRLLEVKD---KWTGESKHFSSSTDLQMKGR  390

Query  1111  ISPYRNVTTSSRFSEGTG--------FLGVPREAENLKGSMFSSFREVDTHLWDTP-IKS  959
              SP+R+   +S F             F+ VP+E + +  S      ++D H  DTP I++
Sbjct  391   SSPFRHSRAASPFRNEASRSPCRRQPFV-VPKEVDIISKSK----GDIDCH--DTPSIQA  443

Query  958   SFKGESDSPSDVVEKTVYVDSVNYVKT  878
             + K   D  + ++EKT+Y+D+ +   T
Sbjct  444   TNKDGVDMANILMEKTLYIDTASVAGT  470



>ref|XP_008443305.1| PREDICTED: uncharacterized protein LOC103486924 [Cucumis melo]
 ref|XP_008443314.1| PREDICTED: uncharacterized protein LOC103486924 [Cucumis melo]
Length=675

 Score =   135 bits (341),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 145/503 (29%), Positives = 221/503 (44%), Gaps = 88/503 (17%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLN + P++SVRR +     +   N K  EN   +R+       V +    L +VT
Sbjct  1     MEERKLNFNAPLMSVRRFSKAASSIYKANEKKSENSHFSRRST---FPVSRPQFNLDQVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKV------YPCEDPSTMPRLPPGRKPDSRRFYSCERPC  1883
             +PVAVPF WEQ PG+ + ++G         +P E   + PRL  G   D+ ++ S    C
Sbjct  58    EPVAVPFYWEQIPGRAKNDSGSASPEVQLPHPPERTCSTPRLSFGTALDANKYSSEMEAC  117

Query  1882  HEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTN---PDVLESLSL--  1718
             H+D     +      ++A ++   +ES    G   +   +  +  +    D  E+LSL  
Sbjct  118   HQDGCESSS------SNAIVVR--LESAKASGARSLASENDDDDDDDDFSDARETLSLTG  169

Query  1717  -----NCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL----  1583
                  NCS+  +SG  G         VKPSG       +RDFMMSRFLPAAKA VL    
Sbjct  170   SFSVNNCSVSGISGYNG-------PMVKPSGTFRTDPQTRDFMMSRFLPAAKAMVLEPAK  222

Query  1582  --------VTEQPRLVK--EAKKYEPYVM---SYYSDYAGDVVTenedeendNMTIDQH-  1445
                       EQPR VK  E ++  P      +    Y  D V   ++ + ++ ++D   
Sbjct  223   YSLKKKLVAVEQPRQVKKVENRRMSPIKRLESTLLLQYGKDEVHGVDEVDEESDSVDDEY  282

Query  1444  ----KWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLN  1277
                   S +   L P +  K SLGLLNP PGM+ +T+ P  S T +V   +R        
Sbjct  283   DNSGNISARGCGLIPNICFKNSLGLLNPVPGMRIRTEAPM-SVTKKVGESSRT-------  334

Query  1276  KARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKR--GLKADGQYPHGGSRSGAISP  1103
                  Y     K ++DA  KQ+  +   S +L +   +  G      +       G  SP
Sbjct  335   -LHHPYGQKTNKHAWDATYKQKSEAAVGSHKLLEVKDKWTGESKHFSFSTDLQMKGRSSP  393

Query  1102  YRNVTTSSRFSEGTG--------FLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKG  947
             +R+   +S F             F+ VP+E + +  S      +VD H  DTP   + K 
Sbjct  394   FRHSRAASPFRNEASQSPCRRQPFV-VPKEVDTISKSK----GDVDFH--DTPSIQANKD  446

Query  946   ESDSPSDVVEKTVYVDSVNYVKT  878
               D  S ++EKT+Y+D+ +  +T
Sbjct  447   GVDMASFLMEKTLYIDTASVAET  469



>ref|XP_011085987.1| PREDICTED: uncharacterized protein LOC105167851 isoform X2 [Sesamum 
indicum]
Length=560

 Score =   134 bits (337),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 124/380 (33%), Positives = 181/380 (48%), Gaps = 64/380 (17%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +L++  P++S+RR +S     E +N    +     R  ++Q   + KSD E  +V
Sbjct  1     MMEERQLDIGAPLLSMRRFSSPSYSSELLNS---QVTGKLRSSRQQSPPLNKSDWEYVKV  57

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRL-PPGRKPDSRRFYSCERPCHEDS  1871
             T+  +VPF WEQ PG+ + E   +V+  E+ S  PRL  PGR     R+ S ER  +++ 
Sbjct  58    TEQASVPFQWEQIPGRTKSEVQIQVHTLEESSNTPRLQSPGRVAVPSRYNSGERSNNQNI  117

Query  1870  FRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDLSG  1691
             +R Q E     +HA L++ L +S+  K E      D    +     ES SLN S+  LSG
Sbjct  118   YRPQIEAFLFGDHATLLEKLHQSLNCKDESGTLS-DGDAYSIALQTESWSLNYSVSGLSG  176

Query  1690  CQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLV---------TEQPRLVK  1556
              Q          VKPSG       +RDFMM RFL AAKA VL           EQP+ VK
Sbjct  177   YQS-------SGVKPSGTFSIDRQTRDFMMDRFLTAAKAVVLELPKHVVKKPNEQPKAVK  229

Query  1555  EAKKYE---------PYVMSYYSDYAGDVVTenedeendNMTIDQHKW------SRKFWK  1421
             +    E          Y + YY  Y  +V +E+           +HK+      S K   
Sbjct  230   KMVSDERNRLLGHSGSYPLQYYIQYTDNVESED----------GEHKYTFPVKKSGKSRL  279

Query  1420  LFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEK  1241
             + P    K SL +L+  PGMKSK   P SS+  + ++LTRNA S P +K + A       
Sbjct  280   IIPLFCAKDSLCILSTSPGMKSKFHAPTSSAA-DARKLTRNAQSRPSDKNKAA-------  331

Query  1240  QSYDAICKQRFRSGALSGEL  1181
                  + K++  SG +S +L
Sbjct  332   ----VLHKRKSNSGLMSRDL  347



>ref|XP_007148041.1| hypothetical protein PHAVU_006G175400g [Phaseolus vulgaris]
 gb|ESW20035.1| hypothetical protein PHAVU_006G175400g [Phaseolus vulgaris]
Length=687

 Score =   135 bits (339),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 148/521 (28%), Positives = 225/521 (43%), Gaps = 102/521 (20%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M + KLN++ P++SVRR ++    L    +K +E            L   KSD  L +VT
Sbjct  1     MAERKLNINAPLMSVRRGSATSPSLTEARKKILEKRHS--------LPYHKSDATLDQVT  52

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMP--RLPPGRKPDSRRFYSCERPCHEDS  1871
             KPVAVPF WE  PG+R+G  G + +P +  S  P  RLPPG   ++ +            
Sbjct  53    KPVAVPFNWEHIPGRRKGNGGSEPHPPKATSITPSPRLPPGNSTNATK------------  100

Query  1870  FRFQTEPLALKNHAAL-----------------MDSLVESMLGKGEFDVEGRDSR-----  1757
                  +PL  +N AA                  +D++ E    K E  VE R S      
Sbjct  101   -----QPLERENKAANKFKSSNKSKSFSVSVAKVDTVKERKTEKIEKIVESRRSNVKYDD  155

Query  1756  --ECTNPDVLESLS------LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPA  1601
               +    D LE+LS      +NCS+  +SG + +   +          +RDFMM+RFLPA
Sbjct  156   DDDDAFSDALETLSHTESFSMNCSVSGVSGLENMSANKS-GTFSTDQQTRDFMMNRFLPA  214

Query  1600  AKA-------------AVLVTEQPR----LVKEAKK-----YEPYVMSYYSDYAGDVVTe  1487
             AKA             +VLV +QPR    L++E KK     +   ++ Y+     +   +
Sbjct  215   AKAMTLQPSQYSSKKQSVLVEQQPRDVSKLIREEKKPLSNRHNTAIIPYHGHGQEEESED  274

Query  1486  nedeendNMTIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRL  1307
               D    + + D    + K   L P+L ++ SL LLNP   +K K Q    S++  VK  
Sbjct  275   EGDGNECDNSSD---IAAKGCGLLPQLHIRNSLCLLNPVAAIKMKNQVSLPSASEVVK--  329

Query  1306  TRNAPSGPLNKARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGG  1127
                      +  R     P  K+++DAI K +  S A S +  +  K+      ++ + G
Sbjct  330   -----PNKTSHIRSFSPVPAVKKAWDAIHKNKSSSRAASPDKQEGKKKLTSESNRFTYSG  384

Query  1126  S-RSGAISPYR-------NVTTSSRFS---EGTGFLGVPREAENLKGSMFSSFREVDTHL  980
                 G +SP+R        ++ S R      G   LG  +EAEN K S       V   +
Sbjct  385   ELLPGRLSPFRRSRAAATGISPSRRPQSPFRGAKLLGDSKEAENYKFSKVKFHSGVLGTV  444

Query  979   WDTPIKSSFKGESDSPSDVVEKTVYVDSVNYVKTTSLDLCS  857
              D  +    K  S S S  +EKT+Y+D+V+  K  S ++ S
Sbjct  445   QDV-LSQGNKRTSYSGSLTLEKTLYIDTVSTAKLPSSNVSS  484



>gb|KDP36298.1| hypothetical protein JCGZ_09805 [Jatropha curcas]
Length=714

 Score =   134 bits (338),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 148/499 (30%), Positives = 227/499 (45%), Gaps = 86/499 (17%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ +L+L+ P +SVRR +S V   E  N++ ++N  P   +    L V KS+ +   V 
Sbjct  1     MEEKQLDLNQPFLSVRRFSSTVATAEVDNKRQIDNALPKVPR----LPVYKSELKSGPVR  56

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
              P  VPF WE+ PG+ + E+  ++   E P  +P+LPPG      R  + ER   + S  
Sbjct  57    NPGTVPFVWEKTPGRPKCESKPQIMAHEIPPVVPKLPPG------RILNVERQALDRSTE  110

Query  1864  FQTEPLALKNHAALMDSLV----ESMLGKGEFDVEGRDSRECTNPDVLESLS------LN  1715
               T     +    L+D+ V     S  G  E D+ G +  +    D L++LS      LN
Sbjct  111   RATTAGQSETRNVLLDTNVTKEESSREGMEETDISGSEDDDGIYVDALDTLSRSESFFLN  170

Query  1714  CSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAA------------  1589
             CS+   SG  GLD      D+KPSG       +RDFMM RFLPAAKA             
Sbjct  171   CSV---SGVSGLDCP----DMKPSGTFSTDPQTRDFMMGRFLPAAKAMASETPPHYTRKQ  223

Query  1588  VLVTEQPRLVKEAKKYEPY-------VMSYYSDYAGDVVTenedeendNMTIDQHKWSRK  1430
             ++  EQPR +      + +       + +  +   G+ V E EDE++D    D    S K
Sbjct  224   LVAQEQPRKITTVSVQKRHSFDQCKRISNTSNCSQGNGVEEIEDEDDDYDGPDNS--SLK  281

Query  1429  FWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGP  1250
                LFPRL ++ S  LLNP PGM+ + Q P SSS               + KAR +Y   
Sbjct  282   VCGLFPRLYLQNSFCLLNPVPGMRKQPQVPISSSH--------------MRKARSSYPSH  327

Query  1249  IEKQSYDAICK---QRFRSGALSGELCKADKRGLKA---------DGQYPHGGS-----R  1121
              + Q+ +  CK   Q+  S  L       DK  LK+         D Q  +G S     +
Sbjct  328   YD-QTVNEDCKDAAQKHLSRGLLETSMNEDKSKLKSESNKSSCRNDNQKLNGSSLYERLQ  386

Query  1120  SGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGES  941
                  PY +  + S  ++   FL +  +++N + + F++  +      +     +   E+
Sbjct  387   GNGTLPYHDKFSQSGINKEKRFLEIHEKSKNPELAGFNAHVKNAKSFGELLANENVGWET  446

Query  940   DSPSDVVEKTVYVDSVNYV  884
              S S +VEKT+Y+DSV+ +
Sbjct  447   TSASPLVEKTLYIDSVHML  465



>ref|XP_008345909.1| PREDICTED: uncharacterized protein LOC103408870 [Malus domestica]
Length=920

 Score =   134 bits (338),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 138/404 (34%), Positives = 189/404 (47%), Gaps = 48/404 (12%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLNL+ P +SVRRI +     +    K V+ P          L   KSD  L +VT
Sbjct  1     MEERKLNLNAPFLSVRRIATTPVIADREKEKIVQRPDGRHS-----LPPYKSDFCLEQVT  55

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR-----KPDSRRFYSCE---R  1889
             +PVAVPF WE  PGK   + G +    E+ S  PRLPPG+     K  S R +  +   R
Sbjct  56    EPVAVPFHWEHIPGK--AKEGKEAEATEEVSVTPRLPPGKLRNVTKQSSERDHGDQXGAR  113

Query  1888  PCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCS  1709
               H +++  +     LK    +M+    S L + E D+   D+ E  +P   +S SLNCS
Sbjct  114   SPHFNAYSTKENVKELKCSKEVMNQRGASEL-EDEDDIYS-DALETISP--TKSFSLNCS  169

Query  1708  IGDLSGCQGLDVEEG-RDDVKPSGDSRDFMMSRFLPAAKAAVLVT------------EQP  1568
                 S   G D +      V P   +RDF+M+RFLPAAKA  L T            EQP
Sbjct  170   ASCRSQSDGADAKSSIASAVDP--QTRDFLMNRFLPAAKAMALETPHAAKKQHTAAPEQP  227

Query  1567  ----RLVKEAKKYEPYVM-SYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLS  1403
                 R+++E  +  P    S      G    E E E  D+        S K    FPRL 
Sbjct  228   RQITRVIREDTRPLPKEQGSQMELQHGQYEEEEESEGEDDEYDPSGSVSAKGCGXFPRLC  287

Query  1402  VKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYDAI  1223
             ++ SL LL P PGMK KT+   SSS+  V R  ++A         ++ S P+ K ++DA 
Sbjct  288   LRNSLCLLGPIPGMKVKTRALTSSSSG-VARPEKSAYG-------RSLSQPLNKHAWDAA  339

Query  1222  CKQRFRSGALSGELCKADKRGLKADGQYPHGGS-RSGAISPYRN  1094
             CK++   G  SGEL K D +         H G  + G+ SP+RN
Sbjct  340   CKRKSNCGVQSGELLKLDNKKAAESNHLTHSGDLKKGSSSPFRN  383


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 74/162 (46%), Gaps = 36/162 (22%)
 Frame = -1

Query  1291  SGPLNKARKAYSGPIEKQSYDAICKQRFRS----GALSGELCKADKRGLKADGQYPHGG-  1127
             SG LNK R   S P       + C   +RS    G  S EL K + + +    ++ H G 
Sbjct  578   SGDLNKGR---SSPFRHSR--STCLSPYRSEAPRGVHSAELQKFEYKQVGESSRFTHSGD  632

Query  1126  -----------SRSGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFS-------SF  1001
                        SRSG ISPYRN    S F  G GFLGVPRE      S F+       S 
Sbjct  633   LNKXRSSPFRHSRSGCISPYRNEAPKSPFP-GAGFLGVPREENTKSNSKFNLHKKGGHSS  691

Query  1000  REVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVDSVNYVKTT  875
             +EV +H  +     S     +SP  +VEKT+YVD+VN  K +
Sbjct  692   QEVTSHQRNNQGPGS-----ESP--IVEKTLYVDTVNVAKLS  726



>ref|XP_002890798.1| hypothetical protein ARALYDRAFT_890443 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67057.1| hypothetical protein ARALYDRAFT_890443 [Arabidopsis lyrata subsp. 
lyrata]
Length=574

 Score =   129 bits (323),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 175/633 (28%), Positives = 272/633 (43%), Gaps = 112/633 (18%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKN--VEnpqpnrqqqrqPLCVPKSDCELSE  2051
             ME+ KLN +VP++S RR+          N+ N  ++      +    P+ VP+   +  E
Sbjct  1     MEERKLNFNVPLLSTRRMQKTAAVSVRRNKSNNFIDYDSKTSECPSVPVLVPEMSLD-DE  59

Query  2050  VTKPVAVPFCWEQAPGKRRGENGGKVYPC-----EDPSTMPRLPPGRKPDSRRFYSCERP  1886
             VT+PV+VPF WEQAPG+ +G NG +   C     ++   +P LPPG+  D          
Sbjct  60    VTEPVSVPFTWEQAPGRLKG-NGFRPQVCVLTQEKEQVFIPCLPPGKAVDG---------  109

Query  1885  CHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLS-----  1721
                                    +L      KG+   E  D  +    D L++LS     
Sbjct  110   -----------------------NLTRLQSSKGKQVEESEDGEDDVFSDALDTLSPKDSF  146

Query  1720  -LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPR-------  1565
               N SI  +S   G++ ++  D       SRDFMMSRFLPAAKA  +  EQP        
Sbjct  147   SFNNSISGVSEYGGVETKKPLD-----AQSRDFMMSRFLPAAKA--MTVEQPHYASNRKP  199

Query  1564  -------------LVKEAKKYEP--YVMSYYSDYAGDVVTenedeendNMTIDQHKW-SR  1433
                          LV   K+  P  Y  SYY  Y  ++  E    ++ +  + ++ + S+
Sbjct  200   STFMAEPIIQMRELVPGEKQQTPNRYDESYY--YHQNIDDEEGGADDKDDEVSEYAYLSK  257

Query  1432  KFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSG  1253
             K   + P+L  K SLG+LN   G K+K  +P +S +++  + ++ A         K    
Sbjct  258   KGCGMLPQLCFKDSLGMLNTVSGFKAKHNSPITSPSHDQVKSSKVA-------QLKYRFQ  310

Query  1252  PIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGA-------ISPYRN  1094
              ++K + D++ K +  SG +   +  +      ++       +RS +       +SP+RN
Sbjct  311   SVKKLALDSVSKHKL-SGKVQSPVHPSFGNKFNSESNLISAANRSSSPYRHTHCMSPFRN  369

Query  1093  VTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEK  914
                SS F    GF    +E ENL+ +  S       ++  T  +  +   + S S   EK
Sbjct  370   TGNSSPFHPA-GFPETHKETENLRANRLSKHTR---NISRTSQELLYPKSNGSTSARFEK  425

Query  913   TVYVDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPNQKRGSSTSRSSRE  734
             TVYVD+ N+    S D  +S    ++ PEE  D+  +  +NP+ E  +     +    + 
Sbjct  426   TVYVDTENF--PMSNDQHNSN--VMVYPEE-ADMARKPDANPDLEAFENISIRSGEMVKG  480

Query  733   NFKPDYRSYSDVTsslspypplpkspSESWLWRTLPS----IPSRGGHNDQTNQSPRATN  566
             N   +  S  D        PP PK PSESWL   LPS    IPSR  H     +   A N
Sbjct  481   NELVEISSGLD---QSLLAPPSPKRPSESWLCHNLPSVTSQIPSRRYHPFNLQKQDLAEN  537

Query  565   --TATKREITVSSCSEHHCNSYYTEELIPYGSH  473
                 TK E  V +   H  +  Y+EEL+ + SH
Sbjct  538   YRNVTKWETIVKTSYMHRDHIRYSEELVAHTSH  570



>gb|EYU28091.1| hypothetical protein MIMGU_mgv1a010560mg [Erythranthe guttata]
 gb|EYU28092.1| hypothetical protein MIMGU_mgv1a010560mg [Erythranthe guttata]
Length=309

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 107/307 (35%), Positives = 158/307 (51%), Gaps = 27/307 (9%)
 Frame = -1

Query  2218  KTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVTKP  2039
             + +L+L+ P++S RR +S     E V  K +E P P  +QQ   L    SD E  +V KP
Sbjct  5     QQQLDLNAPLLSARRYSSPSCSAELVKWKVLEKPPPPARQQS--LPSKTSDWEYEDVCKP  62

Query  2038  VAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHE-DSFRF  1862
              AVPF WEQ PG+ + E   +    ++PS  PRLPP R     RF S ER   + + +R 
Sbjct  63    AAVPFHWEQIPGRPKNEAESQPQTPQEPSITPRLPP-RLSGPTRFASGERSNDQGNIYRA  121

Query  1861  QTEPLALKNHAALMDSLVESMLGK--GEFDVEGRDSRECTNPDVLESLSL------NCSI  1706
             Q E  +  +HA L++ L +S+  K   E + +     +    D L++LS+      N S+
Sbjct  122   QVEAFSFADHATLIEKLNDSLKCKDESESESQEEQDEDAAYSDALDTLSVTGSWSWNYSV  181

Query  1705  GDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVT---EQPRLVKEAKK---  1544
               +SGC  +   +   +     ++RDFMM+RFLPAAKAAVL T   +Q  LV++ KK   
Sbjct  182   SGISGCNSISGPKPSGNFCIDTNTRDFMMNRFLPAAKAAVLETPKKQQKVLVEQPKKPLF  241

Query  1543  -------YEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSVKTSLG  1385
                     +P    YY++Y   V +++E     + T    K + K W + PR  VK S+ 
Sbjct  242   RKAVSGEIKPSPKQYYNEYVDYVESDDEIPNFKSNT--PVKKTGKAWGIIPRFCVKNSMC  299

Query  1384  LLNPFPG  1364
             LLNP PG
Sbjct  300   LLNPLPG  306



>ref|XP_010104398.1| hypothetical protein L484_010350 [Morus notabilis]
 gb|EXC00243.1| hypothetical protein L484_010350 [Morus notabilis]
Length=775

 Score =   128 bits (322),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 149/499 (30%), Positives = 218/499 (44%), Gaps = 75/499 (15%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  +L+ + P++SVRR +S     E  N++  + P P          V KS+ +   V 
Sbjct  1     MEDKQLDFNQPLLSVRRFSSPAVPPEADNKRKTDKPLPKLPPLP----VYKSELKSGPVR  56

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
              P  VPF WE+ PGK + E   +    E P   P+LPPGR  + R+  S +      + +
Sbjct  57    NPGTVPFVWERTPGKPKDEKTSRPQAPEQPPIAPKLPPGRVLNVRQEASDKGSKGTIATQ  116

Query  1864  FQTEP-LALKNHAALMD--SLVESMLGKGEFD---VEGRDSRECTNPDVLESLS------  1721
              QT   L+     + +D  S  E  + K E +     G    + T  D L++LS      
Sbjct  117   SQTRSILSSSKDVSDLDKRSFTEDKISKLETEDKSSSGSGDGDETYLDALDTLSRSESFF  176

Query  1720  LNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAV---------  1586
             LNCSI   SG  GLD      DVKPSG       +RDFMM RFLPAAK            
Sbjct  177   LNCSI---SGVSGLD----DPDVKPSGTFSTDQQTRDFMMGRFLPAAKVMASDTHQYALR  229

Query  1585  ---LVTEQPRLVKEA---KKYEPYVMSY------YSDYAGDVVTenedeendNMTIDQHK  1442
                +V EQPR + +     K  P  ++       Y+   G   +E+E    +   I    
Sbjct  230   KPQVVREQPRQINKVVSGDKRRPLNLNKPNRLPPYAQELGGEESEDESVTYEGSDI----  285

Query  1441  WSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPL---NKA  1271
              S K   LFPR  +K S  LLNP PGMK ++Q P SS    V+R+  N+ S       K 
Sbjct  286   LSDKVCGLFPRFCLKNSFCLLNPVPGMKMQSQFPISS----VRRVPANSSSASTCRETKV  341

Query  1270  RKAYSGPIEKQSY---------DAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRS  1118
               A     E++S              K +++S  +     K+D + +     Y H   + 
Sbjct  342   EHAEHLVYEQKSMVREQTAELNKGKIKLKYKSNGIED---KSDSQKVDQSSLYRH--QQG  396

Query  1117  GAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESD  938
               +S Y +  +  +  E  GFLG+  +  N +   F   +   ++  +     + K E  
Sbjct  397   NGLSLYHSGHSQLKLPEQKGFLGIREKKRNSRERGFDIHKSRRSNFRELLNNENTKLEVG  456

Query  937   SPSDVVEKTVYVDSVNYVK  881
             S S VVEKT+Y+DSV+ VK
Sbjct  457   SGSPVVEKTLYIDSVHTVK  475



>ref|XP_004293955.1| PREDICTED: uncharacterized protein LOC101297914 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=709

 Score =   127 bits (320),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 156/538 (29%), Positives = 227/538 (42%), Gaps = 111/538 (21%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  KLN S P++SVRRI++           +     P     R  L  PKSD  L +VT
Sbjct  1     MEGRKLNFSAPLLSVRRISAAPVSTNA----DAGKVTPRLANGRHTLPPPKSDFSLEQVT  56

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
             KPVAVPF WE  PG+ +     KV   E+ S  P+LPPG+  D+++    +    + S R
Sbjct  57    KPVAVPFHWEDIPGRSKEGEEPKVQSQEEASVTPKLPPGKLVDAKKKPLEKEQADQKSIR  116

Query  1864  FQTEPLALKNHAALMDSLVESMLGKGEFDVEGR-----DSRECTNPDVLESLSLNCSIGD  1700
                +  +    A  +    E +  +     E       D+ E  +P   ES S+NCS   
Sbjct  117   PCLKSFSSTETATEVQCSKEGVNERKASKFEDEDDVYSDAHEMLSPPT-ESFSMNCSAAG  175

Query  1699  LSGCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAAVLVT--------------EQP  1568
              S            +VKPS D  ++DFMM RFLPAAKA  L T              EQP
Sbjct  176   TSHSYSA-------NVKPSIDPQTQDFMMKRFLPAAKAMALETPHIAIKKQQYTAPLEQP  228

Query  1567  RLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSR------KFWKLFPRL  1406
             R V    + +   +        ++V   +++E +    ++ ++ +      K   LFPRL
Sbjct  229   RQVTRVIRQDTSPLPNQQRSHMELVQYGQNKEEEESEGEEDEYDKPGYITPKGCGLFPRL  288

Query  1405  SVKTSLGLLNPFPGMKSKTQTPASSSTN-------------------EVKRLTR----NA  1295
              ++ SL  L P P MKS+ +   S S+                     +KR+ +     +
Sbjct  289   GIRNSLCPL-PVPAMKSRARALMSCSSGVAIPGKTTGKSSRSRSHSLPLKRVIKTTNSQS  347

Query  1294  PSGPLNKARK-----AYSGPIEK--------------------QSYDAICKQRFRSGALS  1190
              S PLNK  K     ++S P+ K                     +Y+    +RF SG L 
Sbjct  348   HSQPLNKVIKPANIQSHSQPLNKVIKPATSHSHCQPLNKRDQGAAYNLKVDRRFYSGELP  407

Query  1189  GELCKADKRGL-KADGQYPHG------GSRSGAISPYRNVTTSSRFSEGTGFLGVPREAE  1031
                 +A +  L +  G+ P G       SRS  ISPYRN    S F+ G GFLGVP+E  
Sbjct  408   RLNNQAAQSNLFRHSGEQPKGRSSPFRQSRSPCISPYRNERPKSPFT-GGGFLGVPKEDS  466

Query  1030  --------NLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVDSVNYVK  881
                     N+   +    +EV TH  +       K    +   ++EKT+YVD+VN  K
Sbjct  467   VKANSSKFNMNDKVGHKSQEVLTHQRN-------KQGPYTVIPMIEKTLYVDTVNTTK  517



>ref|XP_004293954.1| PREDICTED: uncharacterized protein LOC101297914 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=711

 Score =   127 bits (319),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 156/538 (29%), Positives = 227/538 (42%), Gaps = 111/538 (21%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  KLN S P++SVRRI++           +     P     R  L  PKSD  L +VT
Sbjct  1     MEGRKLNFSAPLLSVRRISAAPVSTNA----DAGKVTPRLANGRHTLPPPKSDFSLEQVT  56

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
             KPVAVPF WE  PG+ +     KV   E+ S  P+LPPG+  D+++    +    + S R
Sbjct  57    KPVAVPFHWEDIPGRSKEGEEPKVQSQEEASVTPKLPPGKLVDAKKKPLEKEQADQKSIR  116

Query  1864  FQTEPLALKNHAALMDSLVESMLGKGEFDVEGR-----DSRECTNPDVLESLSLNCSIGD  1700
                +  +    A  +    E +  +     E       D+ E  +P   ES S+NCS   
Sbjct  117   PCLKSFSSTETATEVQCSKEGVNERKASKFEDEDDVYSDAHEMLSPPT-ESFSMNCSAAG  175

Query  1699  LSGCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAAVLVT--------------EQP  1568
              S            +VKPS D  ++DFMM RFLPAAKA  L T              EQP
Sbjct  176   TSHSYSA-------NVKPSIDPQTQDFMMKRFLPAAKAMALETPHIAIKKQQYTAPLEQP  228

Query  1567  RLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSR------KFWKLFPRL  1406
             R V    + +   +        ++V   +++E +    ++ ++ +      K   LFPRL
Sbjct  229   RQVTRVIRQDTSPLPNQQRSHMELVQYGQNKEEEESEGEEDEYDKPGYITPKGCGLFPRL  288

Query  1405  SVKTSLGLLNPFPGMKSKTQTPASSSTN-------------------EVKRLTR----NA  1295
              ++ SL  L P P MKS+ +   S S+                     +KR+ +     +
Sbjct  289   GIRNSLCPL-PVPAMKSRARALMSCSSGVAIPGKTTGKSSRSRSHSLPLKRVIKTTNSQS  347

Query  1294  PSGPLNKARK-----AYSGPIEK--------------------QSYDAICKQRFRSGALS  1190
              S PLNK  K     ++S P+ K                     +Y+    +RF SG L 
Sbjct  348   HSQPLNKVIKPANIQSHSQPLNKVIKPATSHSHCQPLNKRDQGAAYNLKVDRRFYSGELP  407

Query  1189  GELCKADKRGL-KADGQYPHG------GSRSGAISPYRNVTTSSRFSEGTGFLGVPREAE  1031
                 +A +  L +  G+ P G       SRS  ISPYRN    S F+ G GFLGVP+E  
Sbjct  408   RLNNQAAQSNLFRHSGEQPKGRSSPFRQSRSPCISPYRNERPKSPFT-GGGFLGVPKEDS  466

Query  1030  --------NLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVDSVNYVK  881
                     N+   +    +EV TH  +       K    +   ++EKT+YVD+VN  K
Sbjct  467   VKANSSKFNMNDKVGHKSQEVLTHQRN-------KQGPYTVIPMIEKTLYVDTVNTTK  517



>ref|XP_010109884.1| hypothetical protein L484_003815 [Morus notabilis]
 gb|EXC24837.1| hypothetical protein L484_003815 [Morus notabilis]
Length=771

 Score =   127 bits (318),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 138/425 (32%), Positives = 193/425 (45%), Gaps = 81/425 (19%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKS-DCELSEV  2048
             M + KLN S P++SVRRI S        NRK V+N  PNR+Q       P   D  L +V
Sbjct  1     MAERKLNFSAPLMSVRRIASRPMSPIRDNRKIVKNSSPNRRQMTIVRDSPSEPDFNLEQV  60

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHED-S  1871
             T+PVAVPF WEQ PG+R+  +  +  P E  S  PR+PPG       F   ++P     +
Sbjct  61    TEPVAVPFNWEQIPGQRKNADKPERQPREATSITPRVPPGNV-----FEVAKQPLDTHYA  115

Query  1870  FRFQTEPLALKNHAALMDSLVESM---------LGKGEFDVEGRD--SRECTNPDVLESL  1724
             +R  T P  +K   +   ++ ES          +G  E DVE  D  S         ES+
Sbjct  116   YRSDTRP-QIKTLYSCNSNVAESNKYSKEATNEIGALELDVEEEDVYSDALDTLSSKESV  174

Query  1723  SLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL-------  1583
             SLNCS   LSG  G  +      +KPSG       +RDFMM RFLPAAKA  L       
Sbjct  175   SLNCSGSGLSGSDGAGL------LKPSGSFSTDPQTRDFMMKRFLPAAKAMALEAPRTYS  228

Query  1582  -------VTEQPRLVKEAKKYEPY---------VMSYYSDYAGDVVTenedeendNMTID  1451
                    V EQPR VK+    E           ++  Y DY      + E++  +   +D
Sbjct  229   PKRQASVVQEQPREVKKVIGEEKRPLNDLIGSSLVPRYGDYQD--AEDEEEDSEEEEEVD  286

Query  1450  QH-----KWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSG  1286
             +H       S +    FPRL  + SL LL P PG+K KT TP  +++N+           
Sbjct  287   RHYDDPRNLSMRGCGFFPRLCFRNSLSLLGPVPGLKVKTGTPRKTASNQ-----------  335

Query  1285  PLNKARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGS-RSGAI  1109
                    ++S  + K+++D+  KQ+   G  S EL   + +      +Y + G  + G +
Sbjct  336   -------SHSKSV-KKAWDSTFKQKSDGGFRSSELLAVENKRAGESKRYTYSGDLQRGRL  387

Query  1108  SPYRN  1094
             SP RN
Sbjct  388   SPLRN  392


 Score = 54.7 bits (130),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = -1

Query  652  ESWLWRTLPSIPSRGGHNDQTNQSP--RATNTATKREITVSSCSEHHCNSYYTEELIPYG  479
            ESWLWRT+PSIP R       +++P  + ++T+TK E  V + + HH +S Y+EEL+ + 
Sbjct  706  ESWLWRTIPSIPLRNSFLKSRSKTPESKTSSTSTKWETIVKTSNLHHDHSMYSEELVAHI  765

Query  478  S  476
            S
Sbjct  766  S  766



>gb|KHN28614.1| hypothetical protein glysoja_040482 [Glycine soja]
Length=677

 Score =   126 bits (316),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 141/498 (28%), Positives = 221/498 (44%), Gaps = 60/498 (12%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M + +LN++ P++SVRR  +    L    +K +E            L   KSD    +VT
Sbjct  1     MAERRLNINAPLMSVRRSAATPPSLTEAKKKILEKRHT--------LPYYKSDTFSDQVT  52

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTM--PRLPPGRKPDS-RRFYSCERPCHED  1874
             +PVAVPF WE  PG+R+G  G +  P +  S    PRLPPG+  ++ ++    E      
Sbjct  53    EPVAVPFNWEHIPGRRKGNGGSEPQPPKATSITPSPRLPPGKSINATKQPLEKESKAANK  112

Query  1873  SFRFQTEPLAL-KNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESL------SLN  1715
             S  F    + +  +    ++ +VES     ++D +  +       D LE+L      S+N
Sbjct  113   SKSFNVSVVKVDSDKERKVEKIVESRRSNVKYDDDDDNDDNDAYSDALENLSPTESFSMN  172

Query  1714  CSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKA-------------AVLVTE  1574
             CS+  +SG + L   +          +RDFMMSRFLPAAKA             + LV +
Sbjct  173   CSVSGVSGLENLGANKS-GSFSTDQQTRDFMMSRFLPAAKAMTLLPPQYSSKKQSALVEQ  231

Query  1573  QPR----LVKEAKKYEPYVM-SYYSDYAGDVVTenedeendNMTIDQ-HKWSRKFWKLFP  1412
             QPR    LV++ KK  P    +    Y G    E  ++E D+   D     + K   L P
Sbjct  232   QPRDVSKLVRDDKKQLPIKHNTAIIPYTGQNQEEESEDEVDDNEYDNSSNIAAKGCGLLP  291

Query  1411  RLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSY  1232
             +L ++ SL LLNP   MK K Q P   ++  VK           +  R     P  K+++
Sbjct  292   QLHIRNSLCLLNPVAVMKMKNQAPLPPASEVVK-------PNKSSHVRSFSPVPAVKKAW  344

Query  1231  DAICKQRFRSGALSGELCKADKRGLKADGQYPHGGS-RSGAISPYRNVTTS---------  1082
             +AI K +  S A S +  +  K+      ++ + G    G +SP+R    +         
Sbjct  345   EAIHKNKSSSRAASPDKQEGKKKWTSESNRFTYSGELLPGRLSPFRRSRAAAAGISPCRS  404

Query  1081  ---SRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKT  911
                S F  G    G  +EAEN K         V  ++ D P + + K  S S +  +EKT
Sbjct  405   KPQSPF-RGAKLPGDTKEAENYKFGKVKFHSGVLGNVHDVPSQGA-KRTSYSGNLTIEKT  462

Query  910   VYVDSVNYVKTTSLDLCS  857
             +Y+D+ +  K +S ++ S
Sbjct  463   LYIDTASTAKLSSSNISS  480



>ref|XP_003547171.1| PREDICTED: uncharacterized protein LOC100786935 isoform X1 [Glycine 
max]
 ref|XP_006597477.1| PREDICTED: uncharacterized protein LOC100786935 isoform X2 [Glycine 
max]
Length=677

 Score =   125 bits (315),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 141/498 (28%), Positives = 221/498 (44%), Gaps = 60/498 (12%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M + +LN++ P++SVRR  +    L    +K +E            L   KSD    +VT
Sbjct  1     MAERRLNINAPLMSVRRSAATPPSLTEAKKKILEKRHT--------LPYYKSDTFSDQVT  52

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTM--PRLPPGRKPD-SRRFYSCERPCHED  1874
             +PVAVPF WE  PG+R+G  G +  P +  S    PRLPPG+  + +++    E      
Sbjct  53    EPVAVPFNWEHIPGRRKGNGGSEPQPPKATSITPSPRLPPGKSINATKQPLEKESKAANK  112

Query  1873  SFRFQTEPLAL-KNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESL------SLN  1715
             S  F    + +  +    ++ +VES     ++D +  +       D LE+L      S+N
Sbjct  113   SKSFNVSVVKVDSDKERKVEKIVESRRSNVKYDDDDDNDDNDAYSDALENLSPTESFSMN  172

Query  1714  CSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKA-------------AVLVTE  1574
             CS+  +SG + L   +          +RDFMMSRFLPAAKA             + LV +
Sbjct  173   CSVSGVSGLENLGANKS-GSFSTDQQTRDFMMSRFLPAAKAMTLLPPQYSSKKQSALVEQ  231

Query  1573  QPR----LVKEAKKYEPYVM-SYYSDYAGDVVTenedeendNMTIDQ-HKWSRKFWKLFP  1412
             QPR    LV++ KK  P    +    Y G    E  ++E D+   D     + K   L P
Sbjct  232   QPRDVSKLVRDDKKQLPIKHNTAIIPYTGQNQEEESEDEVDDNEYDNSSNIAAKGCGLLP  291

Query  1411  RLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSY  1232
             +L ++ SL LLNP   MK K Q P   ++  VK           +  R     P  K+++
Sbjct  292   QLHIRNSLCLLNPVAVMKMKNQAPLPPASEVVK-------PNKSSHIRSFSPVPAVKKAW  344

Query  1231  DAICKQRFRSGALSGELCKADKRGLKADGQYPHGGS-RSGAISPYRNVTTS---------  1082
             +AI K +  S A S +  +  K+      ++ + G    G +SP+R    +         
Sbjct  345   EAIHKNKSSSRAASPDKQEGKKKWTSESNRFTYSGELLPGRLSPFRRSRAAAAGISPCRS  404

Query  1081  ---SRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKT  911
                S F  G    G  +EAEN K         V  ++ D P + + K  S S +  +EKT
Sbjct  405   KPQSPF-RGAKLPGDTKEAENYKFGKVKFHSGVLGNVHDVPSQGA-KRTSYSGNLTIEKT  462

Query  910   VYVDSVNYVKTTSLDLCS  857
             +Y+D+ +  K +S ++ S
Sbjct  463   LYIDTASTAKLSSSNISS  480



>ref|XP_006307092.1| hypothetical protein CARUB_v10008679mg [Capsella rubella]
 gb|EOA39990.1| hypothetical protein CARUB_v10008679mg [Capsella rubella]
Length=583

 Score =   125 bits (313),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 170/644 (26%), Positives = 268/644 (42%), Gaps = 127/644 (20%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKN--VEnpqpnrqqqrqPLCVPKSDCELSE  2051
             M + KLN + P++S RR+ +        N+ N  ++      +     + VP+    L +
Sbjct  1     MTERKLNFNAPLLSTRRMQNTTAVSVRRNKSNNFIDYDSKTSESPSVSVLVPEM-MGLDQ  59

Query  2050  VTKPVAVPFCWEQAPGKRRGENGGKVYPC----EDPSTMPRLPPGRKPDSRRFYSCERPC  1883
              T+PV+VPF WEQAPG+ RG N  +   C    E+    P LPPG+  D           
Sbjct  60    FTEPVSVPFTWEQAPGRLRG-NDLRPQVCDLTQEEEVLKPCLPPGKAIDG----------  108

Query  1882  HEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIG  1703
               +  R Q+            +  V S            D+R+  +P   +S S N SI 
Sbjct  109   --NMTRLQSSKGKQVEEPEDDEDDVFS------------DARDTLSPK--DSFSFNNSI-  151

Query  1702  DLSGCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAAVLV-----------------  1580
              +SG  G    E +  +K S D  SRDFMMSRFLPAAKA  +                  
Sbjct  152   -ISGVSGYSGVEAKKPLKLSEDTQSRDFMMSRFLPAAKAMTVEQSHYASNRKPSSFMPEP  210

Query  1579  TEQPR-LVKEAKKYEP-------YVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFW  1424
             T Q R LV   K+  P        V SYY  Y  D + + E   ++ +  +    S++  
Sbjct  211   TIQVRELVPGEKQQTPNRYDDESIVPSYY--YHQD-IDDEESIVDEEVASEYAYISKRGC  267

Query  1423  KLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIE  1244
              + P+L  K SL +LN  PG+K+K  +P +SS++++ +      S  +++ +  +   ++
Sbjct  268   GMLPQLCFKESLSMLNTVPGLKAKHNSPVTSSSHDLVK------SSKVSQLKSRFQT-VK  320

Query  1243  KQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGA-------ISPYRNVTT  1085
             K + D++ K +  SG +   + ++  +   ++       +RS +       +SP+R+   
Sbjct  321   KLALDSVSKHKL-SGKVQSPVHQSIGKKFNSESNLLSAANRSSSPYRHTRCMSPFRSTGN  379

Query  1084  SSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSS--FKGESDSPSDVVEKT  911
             SS F    GF    +E ENL+ +  S       H  +  +     ++  +DS S ++EKT
Sbjct  380   SSPF-HPVGFPETRKETENLRANRLSK------HTRNISMSQELLYQKSNDSTSSLLEKT  432

Query  910   VYVDSVN------------YVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSN-PNQEPNQ  770
             VYVD+ N             +     D+   K +G  D E F+D+  R S    N +  +
Sbjct  433   VYVDTENDPMTEDQRNSNVMIFPEEADMARKKKDGNPDLEAFEDISIRRSGEMVNGDELE  492

Query  769   KRGSSTSRSSRENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPSIPS-----RGG  605
             K  S +  S      P   S                   ESWL   LPS+ S     R  
Sbjct  493   KINSGSDWSLLAPPSPKKPS-------------------ESWLCHNLPSVASQIPSRRYS  533

Query  604   HNDQTNQSPRATNTATKREITVSSCSEHHCNSYYTEELIPYGSH  473
              N Q           TK E  V +   H  +  Y+EELI + SH
Sbjct  534   FNLQKQDLTENYRDVTKWETIVKTSYMHRDHMRYSEELIAHTSH  577



>ref|XP_009350271.1| PREDICTED: uncharacterized protein LOC103941775 [Pyrus x bretschneideri]
 ref|XP_009350334.1| PREDICTED: uncharacterized protein LOC103941775 [Pyrus x bretschneideri]
Length=972

 Score =   124 bits (312),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 130/417 (31%), Positives = 182/417 (44%), Gaps = 63/417 (15%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLNL+ P +SVRRI +     +    K ++ P          L   KSD  L +VT
Sbjct  1     MEERKLNLNAPFLSVRRIATTPVIADREKEKILQRPDGRHS-----LPPYKSDFCLEQVT  55

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYS--------CER  1889
             +PVAVPF WE+ PGK   + G +    E+ S  PRLPPG+  +  +  S          R
Sbjct  56    EPVAVPFHWERIPGK--AKVGKEAEATEEVSVTPRLPPGKLINVTKQSSEGDHGDQNGAR  113

Query  1888  PCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCS  1709
               H +++  +     LK    +M+    S   + E D+   D+ E  +P    S SLNCS
Sbjct  114   SPHFNAYSTKENVKELKCSKEVMNQRGASE-SEDEDDIYS-DALETISP--TRSFSLNCS  169

Query  1708  IGDLSGCQGLDVEEG-RDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPRLVKEAKKYEPY  1532
                 S   G D +      V P   +RDF+M+RFLPAAKA  L  E P    +     P 
Sbjct  170   ASCRSQSHGADAKSSIASAVDP--QTRDFLMNRFLPAAKAMAL--ETPHAANKQHTAAPE  225

Query  1531  VMSYYSDYAGDVVTenedeendNMTIDQHKW-------------------SRKFWKLFPR  1409
                  +    +       E+   M +   ++                   S K   LFPR
Sbjct  226   QPRQITRVIREDTRPLPKEQRSQMELQHRQYEEEEESEGEDDEYDPSGSVSAKGCGLFPR  285

Query  1408  LSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYD  1229
             L ++ SL LL P PGMK KT+   SSS+  V R  ++A         ++ S P+ K ++D
Sbjct  286   LCLRNSLCLLGPIPGMKVKTRALTSSSSG-VARPEKSAYG-------RSLSQPLNKHAWD  337

Query  1228  AICKQRFRSGALSGELCKADKR------------GLKADGQYPHGGSRSGAISPYRN  1094
             A  K++   G  SGEL K D +             LK     P G SR   +SPYRN
Sbjct  338   AAYKRKSNCGVQSGELLKLDNKKAGESNRFTHSGDLKKGSSSPFGNSRRACVSPYRN  394


 Score = 56.6 bits (135),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 74/157 (47%), Gaps = 26/157 (17%)
 Frame = -1

Query  1291  SGPLNKARKAYSGPIEKQSYDAICKQRFRS----GALSGELCKADKRGLKADGQYPHGG-  1127
             SG LNK R   S P       + C   +RS    G  S EL K + + +    ++ H G 
Sbjct  630   SGDLNKGR---SSPFRYSR--STCISPYRSEAPRGVHSAELQKFEYKRVGESSRFTHAGD  684

Query  1126  -----------SRSGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHL  980
                        SRSG ISPYRN    S F    GFLGVPRE EN K +   +  +   H 
Sbjct  685   LNKSRSSPFRHSRSGCISPYRNEAPKSPFPVA-GFLGVPRE-ENTKANSKFNLHKKGGHS  742

Query  979   WD--TPIKSSFKGESDSPSDVVEKTVYVDSVNYVKTT  875
                 T ++ + +G   S S +VEKT+YVD+VN  K +
Sbjct  743   SQEVTSLQRNNQGPG-SESPIVEKTLYVDTVNVAKLS  778



>ref|XP_002317416.2| hypothetical protein POPTR_0011s07290g [Populus trichocarpa]
 gb|EEE98028.2| hypothetical protein POPTR_0011s07290g [Populus trichocarpa]
Length=737

 Score =   123 bits (309),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 107/327 (33%), Positives = 163/327 (50%), Gaps = 66/327 (20%)
 Frame = -1

Query  1732  ESLSLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL----  1583
             +S+S+NCS    +G  G DV      VKPSG       +RDFMMSRFLPAAKA  L    
Sbjct  226   DSISMNCSA---TGLSGFDVPL----VKPSGTFTTDQQTRDFMMSRFLPAAKAMALEPAH  278

Query  1582  --VTEQPRLVKEAKKYEPYV-----------MSYYSDYAGDVVTenedeendNMTIDQHK  1442
                 +QP ++++++++   V            S+     G  + E E E+  +   +   
Sbjct  279   YSSRKQPIVIEQSRQFTKVVHENRTPPPIKSQSFIIPRYGQDIEEKESEDECDGYENSGD  338

Query  1441  WSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKA  1262
              S K    FPRL +K SLGLLNP PG+K  TQ  + SSTN+V++L+R A         ++
Sbjct  339   ISTKACGWFPRLCIKNSLGLLNPIPGLKLGTQA-SMSSTNDVEKLSRAA-------HNRS  390

Query  1261  YSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGS--------------  1124
             YS  ++K   DA  K +  SG  S +L + + +   +  ++ +G                
Sbjct  391   YSQTVKKHFKDAANKLKQDSGGQSPKLLEVENKLSCSSNRFIYGSDRQTMSRTSPFRRSA  450

Query  1123  ------RSGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIK  962
                   R+G +SP+RN    S F  G GFLG+P+EAE+L+ S  + ++ +      +   
Sbjct  451   GTSPFRRAGCVSPHRNEAPQSAF-RGRGFLGIPKEAEDLRASRLNLYKGISK----SQEL  505

Query  961   SSFKGE---SDSPSDVVEKTVYVDSVN  890
             SS+ G    S   S +VEKT+YVD+V+
Sbjct  506   SSYYGSKRWSRPASPIVEKTLYVDTVH  532


 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 62/112 (55%), Gaps = 3/112 (3%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLNL+ P++SVRR ++     +G   K +EN + N++     L + K D  L +VT
Sbjct  1     MEQRKLNLNAPLLSVRRFSNIATTSDGAKTKKLENSRFNKRHT---LPLYKPDASLDQVT  57

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCER  1889
             +PVAVPF WEQ PGK +  +       E+ S  P  PP R  D  R +  +R
Sbjct  58    EPVAVPFHWEQIPGKAKDNSLETPAVPEEASITPNGPPRRSMDILRHHKGKR  109



>ref|XP_008353439.1| PREDICTED: uncharacterized protein LOC103417008, partial [Malus 
domestica]
Length=319

 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 113/331 (34%), Positives = 153/331 (46%), Gaps = 46/331 (14%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ KLNL+ P +SVRRI +     +G   K ++ P          L   KSD  L +VT
Sbjct  1     MEERKLNLNAPFLSVRRITATPVIADGEKEKIMQRPNGRHT-----LPSYKSDFRLXQVT  55

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPG-----RKPDSRRFY---SCER  1889
             +PVAVPF WE  PGK + +N  ++ P E+ S  PRL PG     +K +S R Y   +  R
Sbjct  56    EPVAVPFHWEHIPGKAKEDNEAELQPTEEASVTPRLSPGKLIDVKKHNSERDYGDQNAAR  115

Query  1888  PCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCS  1709
               H  S+  +     LK    + +  +   L + E DV   D+ E  +P   +S SLNCS
Sbjct  116   SPHFKSYSLKENVKELKCSKDVTNERMALEL-QNEDDVYS-DALETISP--TKSFSLNCS  171

Query  1708  IGDLSGCQGLDVEEGRDDVKPSG---DSRDFMMSRFLPAAKAAVLVTEQPRLVKEAKKYE  1538
                LS  +  D++  R    PS     +RDFMM+RFLPAAKA  L  E P   K+     
Sbjct  172   ASCLSQSESADIKPSR----PSAIDPQTRDFMMNRFLPAAKAMSL--ETPHAAKKQHTAA  225

Query  1537  PYVMSYYSDYAGDVVTenedeendNMTIDQHKW--------------------SRKFWKL  1418
             P      +       T    +E  +    QH+                     S K   L
Sbjct  226   PEPPRRITRVIRHEDTRPLPKEQGSQMELQHRQYEEEKESEGEDDDYDPSGSVSAKGCGL  285

Query  1417  FPRLSVKTSLGLLNPFPGMKSKTQTPASSST  1325
             FPRL ++ SL LL P PGMK KT+   SSS+
Sbjct  286   FPRLCLRNSLCLLGPIPGMKVKTRDLMSSSS  316



>gb|KHG24123.1| Protein arginine N-methyltransferase 7 [Gossypium arboreum]
Length=708

 Score =   123 bits (308),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 145/498 (29%), Positives = 216/498 (43%), Gaps = 85/498 (17%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME  +L+ + P++SVRR  S V   E    K  +N             V KS+ +   +
Sbjct  6     LMEDKQLDFNRPLLSVRRFTSQVAGSESEGNKKTDNSLNKVPNPP----VYKSELKSGPL  61

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
               P  VPF WE+ PG+ + E+  +    + P   P+LPPGR    ++  S  +     +F
Sbjct  62    RNPGTVPFVWEKTPGRPKEESNIQTDALDRPPIAPKLPPGRALRDKQ-QSPRKGSDAKTF  120

Query  1867  R-FQTEPLALKNHAALMDSLVESML--GKGEFDVEG----RDSRECTNPDVLESLS----  1721
               +QTE +A  +      +L E+      GE +  G    +DS E    D L++LS    
Sbjct  121   APYQTEMVASSSQNVPSLALNETTYECANGEMEETGSSGSKDSGEAY-VDALDTLSRSES  179

Query  1720  --LNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAV-------  1586
               LNCSI  +SG  G        D+KPSG       +RDFMM RFLPAAKA         
Sbjct  180   FFLNCSISGVSGLDG-------SDIKPSGTFSSDPQTRDFMMGRFLPAAKAVASETPPYA  232

Query  1585  -----LVTEQPRLVKE---AKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRK  1430
                  +  E PR +K+   A K +P   S  + +      +  +E  D+   D   +S  
Sbjct  233   TKKQPIAREPPRQIKKLVIADKQQPLYASSPNKFT-HAQDDWSEESEDDCYSDSQNFSVN  291

Query  1429  FWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGP  1250
                LFP+  +K SL LLNP PG+K+  Q  A ++ ++ +R  +++     N+    +S  
Sbjct  292   VCGLFPQFLLKNSLCLLNPIPGVKA--QKSAQTAYSDHRREAKSSYLRSCNETETEHS--  347

Query  1249  IEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRFS  1070
                   +A  K+R  +G    E    DK  LK+      G S+    S  RN   +S F 
Sbjct  348   ------EAAGKKRL-TGIAQTEEAIEDKNNLKS------GSSKKSYRSDCRNPEGASLFR  394

Query  1069  EGTG-------------------FLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKG  947
                G                   FLG+P +A+N + S F   +    +L +         
Sbjct  395   HFQGNNVSSYPSQISWPGHQEKRFLGIPDKAKNYRVSSFDPHKPGSKNLQECLASECISQ  454

Query  946   ESDSPSDVVEKTVYVDSV  893
             ES S S  VEKT+YVDSV
Sbjct  455   ESGSASP-VEKTLYVDSV  471



>ref|XP_003590280.1| hypothetical protein MTR_1g050940 [Medicago truncatula]
Length=683

 Score =   121 bits (304),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 155/495 (31%), Positives = 216/495 (44%), Gaps = 77/495 (16%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M + KLN++ P++SVRR ++    L    RK +E            L   KS+  L +VT
Sbjct  1     MSERKLNINAPLMSVRRNSATSPSLTESKRKILEKRHT--------LASYKSEMTLDQVT  52

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVY--PCEDPST--MPRLPPGRKPDS------------  1913
             +PVAVPF WE  PGK +G NG +V   P ++PS   +PRLPPG+   S            
Sbjct  53    EPVAVPFNWEHIPGKCKGNNGSEVLQIPPKNPSFTPIPRLPPGKSVKSATQPMVKESNVA  112

Query  1912  RRFYSCERPCHEDSFRFQTEPLALKNHAALMDSLV---ESMLGKGEFDVEGRDSRECTNP  1742
              RF S  +         +T+    +      +  +    S + + E D    D+ E  + 
Sbjct  113   NRFTSSNKSKSFTGNMVKTDCDREREKEKETEKKIVSRRSNVKEVENDDAYSDAVESLS-  171

Query  1741  DVLESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKA--------  1592
              + ES SLNCS+   SG  GLD  E +     S D  +RDFMM+RFLPAAKA        
Sbjct  172   HLTESFSLNCSV---SGVSGLDNLEAKKFGTFSTDQQTRDFMMNRFLPAAKAMTIQPSQY  228

Query  1591  -----AVLVTEQPR----LVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKW  1439
                  +VLV +QPR    LV+ AKK  P V      Y G+   E  ++E D    D    
Sbjct  229   SSKKPSVLVEQQPRDVNKLVQNAKK--PLVTDIIP-YTGECQEEESEDEGDVYDNDNSDS  285

Query  1438  SR-KFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKA  1262
                K   L P L V+ SL  LN   GMK K Q    SS  EV +  + +        R  
Sbjct  286   VLGKGCGLLPNLHVRNSLPSLNSVAGMKVKNQVTLPSSACEVVKPNKRS------SIRSF  339

Query  1261  YSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGG------------SRS  1118
                P  K++++AI + +  + A S E  +  KR      ++ + G            SR+
Sbjct  340   SPIPAVKKAWEAIHRNKSSTAAASPETQEGKKRWSSESNRFAYSGELLPGRLSPFRRSRA  399

Query  1117  GA--ISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGE  944
              A  ISP R+   S     GT  LG   EAE  K             +   P + + K  
Sbjct  400   AAAGISPCRSRQQSPF--RGTKLLGDSNEAETNKSCNLKFHSSGLGKIQGVPNQGA-KRS  456

Query  943   SDSPSDVVEKTVYVD  899
             S S S  +EKT+Y+D
Sbjct  457   SYSGSLAMEKTLYID  471



>ref|XP_003636800.1| hypothetical protein MTR_060s0021 [Medicago truncatula]
 gb|KEH36600.1| DUF688 family protein [Medicago truncatula]
Length=682

 Score =   121 bits (304),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 161/509 (32%), Positives = 225/509 (44%), Gaps = 77/509 (15%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M + KLN++ P++SVRR ++    L    RK +E            L   KS+  L +VT
Sbjct  1     MSERKLNINAPLMSVRRNSATSPSLTESKRKILEKRHT--------LASYKSEMTLDQVT  52

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVY--PCEDPST--MPRLPPGRKPDS------------  1913
             +PVAVPF WE  PGK +G NG +V   P ++PS   +PRLPPG+   S            
Sbjct  53    EPVAVPFNWEHIPGKCKGNNGSEVLQIPPKNPSFTPIPRLPPGKSVKSATQPMVKESNVA  112

Query  1912  RRFYSCERPCHEDSFRFQTEPLALKNHAALMDSLV---ESMLGKGEFDVEGRDSRECTNP  1742
              RF S  +         +T+    +      +  +    S + + E D    D+ E  + 
Sbjct  113   NRFTSSNKSKSFTGNMVKTDCDREREKEKETEKKIVSRRSNVKEVENDDAYSDAVESLS-  171

Query  1741  DVLESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKA--------  1592
              + ES SLNCS+   SG  GLD  E +     S D  +RDFMM+RFLPAAKA        
Sbjct  172   HLTESFSLNCSV---SGVSGLDNLEAKKFGTFSTDQQTRDFMMNRFLPAAKAMTIQPSQY  228

Query  1591  -----AVLVTEQPR----LVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKW  1439
                  +VLV +QPR    LV+ AKK  P V      Y G+   E  ++E D    D    
Sbjct  229   SSKKPSVLVEQQPRDVNKLVQNAKK--PLVTDIIP-YTGECQEEESEDEGDVYDNDNSDS  285

Query  1438  SR-KFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKA  1262
                K   L P L V+ SL  LN   GMK K Q    SS  EV +  + +        R  
Sbjct  286   VLGKGCGLLPNLHVRNSLPSLNSVAGMKVKNQVTLPSSACEVVKPNKRS------SIRSF  339

Query  1261  YSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGG------------SRS  1118
                P  K++++AI + +  + A S E  +  KR      ++ + G            SR+
Sbjct  340   SPIPAVKKAWEAIHRNKSSTAAASPETQEGKKRWSSESNRFAYSGELLPGRLSPFRRSRA  399

Query  1117  GA--ISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGE  944
              A  ISP R+   S     GT  LG   EAE  K             +   P + + K  
Sbjct  400   AAAGISPCRSRQQSPF--RGTKLLGDSNEAETNKSCNLKFHSSGLGKIQGVPNQGA-KRS  456

Query  943   SDSPSDVVEKTVYVDSVNYVKTTSLDLCS  857
             S S S  +EKT+Y+DS + VK +S +L S
Sbjct  457   SYSGSLAMEKTLYIDSSSTVKLSSSNLSS  485



>ref|XP_004485899.1| PREDICTED: uncharacterized protein LOC101504403 isoform X1 [Cicer 
arietinum]
 ref|XP_004485900.1| PREDICTED: uncharacterized protein LOC101504403 isoform X2 [Cicer 
arietinum]
 ref|XP_004485901.1| PREDICTED: uncharacterized protein LOC101504403 isoform X3 [Cicer 
arietinum]
 ref|XP_004485902.1| PREDICTED: uncharacterized protein LOC101504403 isoform X4 [Cicer 
arietinum]
Length=686

 Score =   120 bits (302),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 148/510 (29%), Positives = 229/510 (45%), Gaps = 76/510 (15%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M + KLN++ P++SVRR ++    L    +K +E            L   KSD  L +VT
Sbjct  1     MSERKLNINAPLMSVRRNSATSPSLTASKKKMLEKRHT--------LASYKSDMTLEQVT  52

Query  2044  KPVAVPFCWEQAPGKRRGENGGKV---YPCEDPST--MPRLPPGRKPDSRRFYSCERPCH  1880
             +PVAVPF WE  PG+ +G NG       P ++ S   +PRLPPG+   S      E+ C+
Sbjct  53    EPVAVPFNWEHIPGRCKGSNGNGSEPQIPFKNTSITPIPRLPPGKSTKSAN-QPLEKECN  111

Query  1879  EDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSR------ECTN---PDVLES  1727
               + +F T     K+ +  +  L      + E  +E R S       E T+    D LE+
Sbjct  112   VAN-KF-TSSNKTKSFSGNLVKLYCERERESEKKIENRRSNVKEKEDEETDDVYSDALET  169

Query  1726  L------SLNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKA---------  1592
             L      S+NCS+  +SG    D ++          +R+FMM+RFLPAAKA         
Sbjct  170   LSHTESFSMNCSVSGVSGLDNFDAKKF-GTFSTDQQTREFMMNRFLPAAKAMTIQPSQYS  228

Query  1591  -----AVLVTEQPR----LVKEAKKYEPYVMSYYSD---YAGDVVTenedeendNMTIDQ  1448
                   VLV +Q R    LV+ AKK  P V  + +D   Y G V  +  ++E+D    D 
Sbjct  229   SKKQSVVLVEQQLRDINKLVQNAKK--PLVNKHTTDIIPYTGQVQDDESEDESDVYDNDN  286

Query  1447  H-KWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKA  1271
                   K   L P L ++ SL LLNP  G+K K Q P  S++ EV +  +++        
Sbjct  287   SASMLSKGCGLLPNLHIRNSLSLLNPVAGIKMKNQGPLISAS-EVGKTNKSS------HI  339

Query  1270  RKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGS-RSGAISPY-R  1097
             R     P  K++++AI K +  +     E+ +  K+      ++   G    G +SP+ R
Sbjct  340   RSFSPVPAVKKAWEAIHKNKSSNVVAPPEMQEGKKKWSIESNRFGFSGELLPGRLSPFRR  399

Query  1096  NVTTSSRFS----------EGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKG  947
             +   ++  S          +G   LG  +E E  K      +      +   P + + K 
Sbjct  400   SRAAAASISPCRSKPQSPFQGVKLLGDSKETEINKSGNLKFYSTGLGKVQGVPNQGA-KR  458

Query  946   ESDSPSDVVEKTVYVDSVNYVKTTSLDLCS  857
              S S S  +EKT+Y+D+ + VK  S +L S
Sbjct  459   SSYSGSLAIEKTLYIDTSSTVKLPSTNLNS  488



>ref|XP_008229123.1| PREDICTED: uncharacterized protein LOC103328503 isoform X2 [Prunus 
mume]
Length=739

 Score =   121 bits (303),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 146/497 (29%), Positives = 212/497 (43%), Gaps = 75/497 (15%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +LN + P++SVRR ++ V   E   ++  E   P        L V KS+ +   V
Sbjct  6     LMEEKQLNFNQPLLSVRRFSATVVSSEADEKRKTEKSLPKLPP----LPVYKSELKSGPV  61

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR-----KPDSRRFYSC----  1895
               P  VPF WEQ PG+ + E        E   T P+LPPGR     K  + +   C    
Sbjct  62    RNPGTVPFVWEQIPGRPKDERKSPNRALEWLPTAPKLPPGRVSKVKKQATDKGSKCTTAA  121

Query  1894  ERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESL  1724
             + P        Q         A   DS    M  KG   + G D  + T  D L   ES 
Sbjct  122   QSPTGNVPSNSQNVSTLDTKEATKYDSSKVEMEDKG---IAGSDDGDETYLDALSRSESF  178

Query  1723  SLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVTEQPRL  1562
              +NCS+  LSG  GL       D+KPSG       +RDFMM RFLPAAKA    T Q   
Sbjct  179   FMNCSVSGLSGLDGL-------DIKPSGTFSTDPQTRDFMMGRFLPAAKAMASETPQYAS  231

Query  1561  VKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSVKTSLGL  1382
              K+    E  ++         VV+ ++          QH  ++   K  P   V+   G 
Sbjct  232   RKQPVAREQPLLQEQPSGMKKVVSGDK----------QHPLNQHRPKDLPHY-VQDIAGD  280

Query  1381  LNPFPGMKSKTQTPASSSTNEVKRL-TRNAPSGPLNKARKAYSGPIEKQSYDAICKQRFR  1205
              N   GM+ + Q P SS    V+R+  +++ +    +A+K +SG          C++R  
Sbjct  281   KNEDEGMRVQAQLPISS----VRRVRAKSSYAISYREAKKEHSG-------GDSCEKRLM  329

Query  1204  SGALSGELCKADKRGL--------------KADGQYPHGGSRSGAISPYRNVTTSSRFSE  1067
             SG     + + DK  L              K DG   +   +   ISPYRN        E
Sbjct  330   SGHPEARVPE-DKNDLIHESNQITNRIDCQKLDGSPMYRRLQGSGISPYRNECAQ---HE  385

Query  1066  GTGFLGVPREAENLKGSMFSS-FREVDTHLWDTPIKSSFKGESDSP-SDVVEKTVYVDSV  893
                FLG+P +A+N + ++ S  +R+   +  +     +       P S VVEKT+Y+DSV
Sbjct  386   QKCFLGIPEKAKNYREAISSGKYRKCHNNFQELLAAENVAELEMGPGSPVVEKTLYIDSV  445

Query  892   NYVKTTSLDLCSSKPEG  842
               VK+ +   CSS  +G
Sbjct  446   QTVKSPNSKSCSSDAKG  462



>ref|XP_008229122.1| PREDICTED: uncharacterized protein LOC103328503 isoform X1 [Prunus 
mume]
Length=740

 Score =   121 bits (303),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 146/497 (29%), Positives = 212/497 (43%), Gaps = 75/497 (15%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +LN + P++SVRR ++ V   E   ++  E   P        L V KS+ +   V
Sbjct  6     LMEEKQLNFNQPLLSVRRFSATVVSSEADEKRKTEKSLPKLPP----LPVYKSELKSGPV  61

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR-----KPDSRRFYSC----  1895
               P  VPF WEQ PG+ + E        E   T P+LPPGR     K  + +   C    
Sbjct  62    RNPGTVPFVWEQIPGRPKDERKSPNRALEWLPTAPKLPPGRVSKVKKQATDKGSKCTTAA  121

Query  1894  ERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESL  1724
             + P        Q         A   DS    M  KG   + G D  + T  D L   ES 
Sbjct  122   QSPTGNVPSNSQNVSTLDTKEATKYDSSKVEMEDKG---IAGSDDGDETYLDALSRSESF  178

Query  1723  SLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVTEQPRL  1562
              +NCS+  LSG  GL       D+KPSG       +RDFMM RFLPAAKA    T Q   
Sbjct  179   FMNCSVSGLSGLDGL-------DIKPSGTFSTDPQTRDFMMGRFLPAAKAMASETPQYAS  231

Query  1561  VKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSVKTSLGL  1382
              K+    E  ++         VV+ ++          QH  ++   K  P   V+   G 
Sbjct  232   RKQPVAREQPLLQEQPSGMKKVVSGDK----------QHPLNQHRPKDLPHY-VQDIAGD  280

Query  1381  LNPFPGMKSKTQTPASSSTNEVKRL-TRNAPSGPLNKARKAYSGPIEKQSYDAICKQRFR  1205
              N   GM+ + Q P SS    V+R+  +++ +    +A+K +SG          C++R  
Sbjct  281   KNEDEGMRVQAQLPISS----VRRVRAKSSYAISYREAKKEHSG-------GDSCEKRLM  329

Query  1204  SGALSGELCKADKRGL--------------KADGQYPHGGSRSGAISPYRNVTTSSRFSE  1067
             SG     + + DK  L              K DG   +   +   ISPYRN        E
Sbjct  330   SGHPEARVPE-DKNDLIHESNQITNRIDCQKLDGSPMYRRLQGSGISPYRNECAQ---HE  385

Query  1066  GTGFLGVPREAENLKGSMFSS-FREVDTHLWDTPIKSSFKGESDSP-SDVVEKTVYVDSV  893
                FLG+P +A+N + ++ S  +R+   +  +     +       P S VVEKT+Y+DSV
Sbjct  386   QKCFLGIPEKAKNYREAISSGKYRKCHNNFQELLAAENVAELEMGPGSPVVEKTLYIDSV  445

Query  892   NYVKTTSLDLCSSKPEG  842
               VK+ +   CSS  +G
Sbjct  446   QTVKSPNSKSCSSDAKG  462



>ref|XP_007048701.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX92858.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=759

 Score =   120 bits (302),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 149/533 (28%), Positives = 234/533 (44%), Gaps = 77/533 (14%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME  +L+ + P++SVRR  S     +   +K  +   P   +      + KS+ +   V
Sbjct  36    LMEDKQLDFNQPLLSVRRFTSPGAASDSECKKKTDTSLPKILRPP----IYKSELKSGPV  91

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
               P  VPF WE+ PG+ + E+  +    E P   PRLPPGR  + ++ +S  +  +  +F
Sbjct  92    RNPGTVPFVWEKTPGRPKEESNSQAQALEQPLLAPRLPPGRILNDKQ-HSSRKGFNGKTF  150

Query  1867  ---RFQTEPLALKNHAALMDSLVESMLGKGEFDVEG----RDSRECTNPDVL------ES  1727
                +  T P   +  ++L  +  +     G+ +  G    +DS E    D L      ES
Sbjct  151   TPSQTGTVPSCSQKVSSLKRNETKYESSSGDMEETGSSGSKDSDEAY-VDALDTFSRTES  209

Query  1726  LSLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAV-------  1586
               LNCSI  +SG  G        ++KPSG       +RDFMM RFLPAAKA         
Sbjct  210   FFLNCSISGVSGFDG-------PEIKPSGIFTTDPQTRDFMMGRFLPAAKAVASEIPPYA  262

Query  1585  -----LVTEQPRLVKEA---KKYEPYVMS---YYSDYAGDVVTenedeendNMTIDQHKW  1439
                  +  E  R VK+     K +P  +S    + ++A D   E  + E+D         
Sbjct  263   SRKQPVAREPQRQVKKVVIVDKQQPLYVSSPNKFPNHAQDDWLEESEGEDDYS--GSQNS  320

Query  1438  SRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAY  1259
             S K   LFP+  +K+S  LLNP PGMK + Q PA  + +  +R  +++     N+    Y
Sbjct  321   SAKVCGLFPQFLLKSSFCLLNPVPGMKIQAQKPAKPAHSVRRRQAKSSYLRSGNETESEY  380

Query  1258  SGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKA---------DGQYPHGGSRS----  1118
             +    ++    I +        + EL + DK  LK+         D Q P   S S    
Sbjct  381   AKAATEKGLTRISR--------TEELIE-DKNNLKSGSSHMSYRSDCQNPDAASLSRHLQ  431

Query  1117  -GAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGES  941
                +S Y +   S    +  GFLG+P +A+N   S     ++   +  +     S   ES
Sbjct  432   GNVVSSYPS-QISQLVHQEKGFLGIPEKAKNYGVSSIDPLKKGSNNFQELLALQSKYQES  490

Query  940   DSPSDVVEKTVYVDSVNYVKTTSLDLCSSK-PEGLMDPEEFKDLPERTSSNPN  785
                S VVEKT+YVDSV+ V +T+    ++K  +G+ D  E    P +    P+
Sbjct  491   GLDSPVVEKTLYVDSVHKVISTNPYFSATKTAQGMEDDSEIVVKPGKVEETPS  543



>ref|XP_007048702.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX92859.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=723

 Score =   120 bits (300),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 148/532 (28%), Positives = 234/532 (44%), Gaps = 77/532 (14%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  +L+ + P++SVRR  S     +   +K  +   P   +      + KS+ +   V 
Sbjct  1     MEDKQLDFNQPLLSVRRFTSPGAASDSECKKKTDTSLPKILRPP----IYKSELKSGPVR  56

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF-  1868
              P  VPF WE+ PG+ + E+  +    E P   PRLPPGR  + ++ +S  +  +  +F 
Sbjct  57    NPGTVPFVWEKTPGRPKEESNSQAQALEQPLLAPRLPPGRILNDKQ-HSSRKGFNGKTFT  115

Query  1867  --RFQTEPLALKNHAALMDSLVESMLGKGEFDVEG----RDSRECTNPDVLESLS-----  1721
               +  T P   +  ++L  +  +     G+ +  G    +DS E    D L++ S     
Sbjct  116   PSQTGTVPSCSQKVSSLKRNETKYESSSGDMEETGSSGSKDSDEAY-VDALDTFSRTESF  174

Query  1720  -LNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAV--------  1586
              LNCSI  +SG  G        ++KPSG       +RDFMM RFLPAAKA          
Sbjct  175   FLNCSISGVSGFDG-------PEIKPSGIFTTDPQTRDFMMGRFLPAAKAVASEIPPYAS  227

Query  1585  ----LVTEQPRLVKEA---KKYEPYVMS---YYSDYAGDVVTenedeendNMTIDQHKWS  1436
                 +  E  R VK+     K +P  +S    + ++A D   E  + E+D         S
Sbjct  228   RKQPVAREPQRQVKKVVIVDKQQPLYVSSPNKFPNHAQDDWLEESEGEDDYS--GSQNSS  285

Query  1435  RKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYS  1256
              K   LFP+  +K+S  LLNP PGMK + Q PA  + +  +R  +++     N+    Y+
Sbjct  286   AKVCGLFPQFLLKSSFCLLNPVPGMKIQAQKPAKPAHSVRRRQAKSSYLRSGNETESEYA  345

Query  1255  GPIEKQSYDAICKQRFRSGALSGELCKADKRGLKA---------DGQYPHGGSRS-----  1118
                 ++    I +        + EL + DK  LK+         D Q P   S S     
Sbjct  346   KAATEKGLTRISR--------TEELIE-DKNNLKSGSSHMSYRSDCQNPDAASLSRHLQG  396

Query  1117  GAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESD  938
               +S Y +   S    +  GFLG+P +A+N   S     ++   +  +     S   ES 
Sbjct  397   NVVSSYPS-QISQLVHQEKGFLGIPEKAKNYGVSSIDPLKKGSNNFQELLALQSKYQESG  455

Query  937   SPSDVVEKTVYVDSVNYVKTTSLDLCSSK-PEGLMDPEEFKDLPERTSSNPN  785
               S VVEKT+YVDSV+ V +T+    ++K  +G+ D  E    P +    P+
Sbjct  456   LDSPVVEKTLYVDSVHKVISTNPYFSATKTAQGMEDDSEIVVKPGKVEETPS  507



>ref|XP_011086364.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105168115 
[Sesamum indicum]
Length=671

 Score =   119 bits (299),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 144/500 (29%), Positives = 227/500 (45%), Gaps = 88/500 (18%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  KLN + P++SVRR    +      ++K+ +    N +     L   +S+ +   + 
Sbjct  1     MEDKKLNFNQPLLSVRRYAPAL-----TSQKSDQRKAENSRPLIPRLPAYRSELKSGPIR  55

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSR--------------R  1907
              P AVPF WEQ PG+ + E   +   C+ P   P+LPPGR P++               +
Sbjct  56    NPGAVPFVWEQTPGQPKEEIKAQTQNCDRPPIAPKLPPGRYPEANQQECPKVPPSITRSK  115

Query  1906  FYSCERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNP-----  1742
              ++   PC  D+ + Q   +   +H+       +      +  VE ++S +  +      
Sbjct  116   NHAVNAPCASDT-KKQAINVPRDSHSTPSHEENDKNFESSKETVEEKESSDSGDSDGAYV  174

Query  1741  DVLESLS------LNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAA  1598
             D L++LS      LNCS   LSG   L       D KP+G       +RDFMM+RFLPAA
Sbjct  175   DALDTLSRTESFFLNCSTSGLSGLDDL-------DAKPTGSFSTDLQTRDFMMNRFLPAA  227

Query  1597  KAAV------------LVTEQPRLVKE-AKKYEP---YVMSYYSDYAGDVVTenedeend  1466
             KA              ++ EQP+ VK+   +Y+P   Y  S+   Y+       E+EE  
Sbjct  228   KAMASETPQYAPKRQHVLQEQPQKVKKIGTQYKPSLRYGPSFAKRYSHYHDNGEEEEEES  287

Query  1465  NMTIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSG  1286
             +   DQH+       L PR  +K+SL LLNP P M  +T+ P SS+ N+V+   R++ +G
Sbjct  288   DDEYDQHESLPAVCGLLPRFCLKSSLCLLNPVPAMSVRTRVPTSSA-NKVQ--PRSSSAG  344

Query  1285  PLNKAR-KAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAI  1109
               ++   +  SG  E +S D I K +             +K  L  +     G   S + 
Sbjct  345   SYSETENECRSGRTEPKSIDKIHKAKLDD----------EKTELTNES----GRLESDST  390

Query  1108  SPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPS  929
             S YR+   S  F E           E L+     +F+E+   L D   + S K ES++ +
Sbjct  391   STYRDSPLS--FLEDKEVXXXXNGFE-LQEKGIRTFKEI---LAD---QGSPK-ESNAGA  440

Query  928   DVVEKTVYVDSVNYVKTTSL  869
              ++EKT+YVD+V  V++ SL
Sbjct  441   LIIEKTLYVDTVQRVESPSL  460



>gb|KHN48001.1| hypothetical protein glysoja_015471 [Glycine soja]
Length=675

 Score =   119 bits (298),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 158/505 (31%), Positives = 222/505 (44%), Gaps = 86/505 (17%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +M++ KLN+  P++SVRR       L   N+K +E PQ         L   KSD  L +V
Sbjct  1     MMDERKLNIDAPLMSVRRSFGISPSLTEANKKILEKPQT--------LPHYKSDTALDQV  52

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPS---TMPRLPPGRKPDSRRFYSCERPCHE  1877
             T+PVAVPF WE  PG+ +  +G +  P    S   T P LPPG+  +  +    + P   
Sbjct  53    TEPVAVPFNWEHIPGRPKDYDGSEPQPPTQASITPTAPTLPPGKSTNVAKQSLEKEPNVA  112

Query  1876  DSFRFQTEPLAL-------KNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSL  1718
             ++FR  +   +L       K H     + VE      +      D+ E  +P   E +S+
Sbjct  113   NNFRPSSISNSLREKIDCDKEHKDEKINKVEENDDYDDDSDIYSDALETLSP--TEPMSM  170

Query  1717  NCSIGDLSGCQGLD-VEEGRDDVKPSG-DSRDFMMSRFLPAAKAAVL-------------  1583
             NCS   LSG  GLD V+E R     +   + DFMMSRFL AAKA  +             
Sbjct  171   NCS---LSGVSGLDNVDENRCGTSSTDKQAHDFMMSRFLNAAKAMTIQPPQYASFRKQQP  227

Query  1582  -VTEQPR----LVKEAKKYEPYVMSYYSD---YAGDV-VTenedeendNMTIDQHKWSRK  1430
              + EQPR    LV E KK   +V  + +D   Y G     E E+EE+D+ T D    S K
Sbjct  228   VLAEQPREFIKLVPEQKKS--FVNRHITDIVPYTGQCQEEEEEEEESDDETNDYANNSAK  285

Query  1429  FWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGP  1250
                LFPRL V+ SL LLNP PG K   Q P  S+   VK           +  R     P
Sbjct  286   GCGLFPRLCVRNSLCLLNPVPGTKMGNQFPLYSAYEVVK-------PDKSSHIRSHRPAP  338

Query  1249  IEKQSYDAICKQRFRSGALSGELCKAD--KRGLKADGQYPHGGS--RSGAISPYRNVTTS  1082
               K+++DAI K +  S + +    K D  K+      +Y + G   + G +SP+R    +
Sbjct  339   AIKKAWDAINKSKLSSSSRAASPDKKDVRKKWTSESSRYNYSGELKQLGRLSPFRRSRAA  398

Query  1081  SRFSE-----------GTGFLGVPREAENLKGSMF-------SSFREVDTHLWDTPIKSS  956
             S               G   LG   +A+N             +S +EV         K S
Sbjct  399   SAGVSPFRSKPQPPFPGAKLLGDSEQADNNHSGKLKFPNRGHASIQEV----LSQGAKKS  454

Query  955   FKGESDSPSDVVEKTVYVDSVNYVK  881
             +   S S    VEKT+Y+D+ + VK
Sbjct  455   YSFGSLS----VEKTLYIDTASTVK  475



>ref|XP_006585173.1| PREDICTED: uncharacterized protein LOC102660500 isoform X1 [Glycine 
max]
Length=651

 Score =   119 bits (297),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 158/505 (31%), Positives = 222/505 (44%), Gaps = 86/505 (17%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +M++ KLN+  P++SVRR       L   N+K +E PQ         L   KSD  L +V
Sbjct  1     MMDERKLNIDAPLMSVRRSFGISPSLTEANKKILEKPQT--------LPHYKSDTALDQV  52

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPS---TMPRLPPGRKPDSRRFYSCERPCHE  1877
             T+PVAVPF WE  PG+ +  +G +  P    S   T P LPPG+  +  +    + P   
Sbjct  53    TEPVAVPFNWEHIPGRPKDYDGSEPQPPTQASITPTAPTLPPGKSTNVAKQSLEKEPNVA  112

Query  1876  DSFRFQTEPLAL-------KNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSL  1718
             ++FR  +   +L       K H     + VE      +      D+ E  +P   E +S+
Sbjct  113   NNFRPSSISNSLREKIDCDKEHKDEKINKVEENDDYDDDSDIYSDALETLSP--TEPMSM  170

Query  1717  NCSIGDLSGCQGLD-VEEGRDDVKPSG-DSRDFMMSRFLPAAKAAVL-------------  1583
             NCS   LSG  GLD V+E R     +   + DFMMSRFL AAKA  +             
Sbjct  171   NCS---LSGVSGLDNVDENRCGTSSTDKQAHDFMMSRFLNAAKAMTIQPPQYASFRKQQP  227

Query  1582  -VTEQPR----LVKEAKKYEPYVMSYYSD---YAGDV-VTenedeendNMTIDQHKWSRK  1430
              + EQPR    LV E KK   +V  + +D   Y G     E E+EE+D+ T D    S K
Sbjct  228   VLAEQPREFIKLVPEQKKS--FVNRHITDIVPYTGQCQEEEEEEEESDDETNDYANNSAK  285

Query  1429  FWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGP  1250
                LFPRL V+ SL LLNP PG K   Q P  S+   VK           +  R     P
Sbjct  286   GCGLFPRLCVRNSLCLLNPVPGTKMGNQFPLYSAYEVVK-------PDKSSHIRSHRPAP  338

Query  1249  IEKQSYDAICKQRFRSGALSGELCKAD--KRGLKADGQYPHGGS--RSGAISPYRNVTTS  1082
               K+++DAI K +  S + +    K D  K+      +Y + G   + G +SP+R    +
Sbjct  339   AIKKAWDAINKSKLSSSSRAASPDKKDVRKKWTSESSRYNYSGELKQLGRLSPFRRSRAA  398

Query  1081  SRFSE-----------GTGFLGVPREAENLKGSMF-------SSFREVDTHLWDTPIKSS  956
             S               G   LG   +A+N             +S +EV         K S
Sbjct  399   SAGVSPFRSKPQPPFPGAKLLGDSEQADNNHSGKLKFPNRGHASIQEV----LSQGAKKS  454

Query  955   FKGESDSPSDVVEKTVYVDSVNYVK  881
             +   S S    VEKT+Y+D+ + VK
Sbjct  455   YSFGSLS----VEKTLYIDTASTVK  475



>ref|XP_008381206.1| PREDICTED: uncharacterized protein LOC103444076 isoform X1 [Malus 
domestica]
 ref|XP_008381207.1| PREDICTED: uncharacterized protein LOC103444076 isoform X1 [Malus 
domestica]
Length=736

 Score =   117 bits (292),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 144/503 (29%), Positives = 214/503 (43%), Gaps = 85/503 (17%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +L+L+ P++SVRR +  V   E  +++  +   P        L   KS+ +   V
Sbjct  6     MMEEKQLDLNQPLLSVRRYSPTVVSSEADDKRKADKSLPKLPP----LPFYKSELKSGPV  61

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR---------KPDSRRFYSC  1895
               P  VPF WEQ PG+ + E   +    E P+T PRLPPGR            S+R  + 
Sbjct  62    RHPGTVPFVWEQIPGRPKDERNSQTQGLERPATTPRLPPGRVSIAKKQALDKGSKRTTAA  121

Query  1894  ERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESL  1724
             + P        + +           DS  E M  K   D E  D       D L   ES 
Sbjct  122   QSPTGHVLSNSKNDSTFDTKEVTKCDSSKEGMEDKDISDSEDGDETYLDALDALSRSESF  181

Query  1723  SLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVTEQPRL  1562
               NCS+  LSG  G        DVKP+G       +RDFMM RFLPAAKA  + +E P+ 
Sbjct  182   YYNCSVSGLSGLDG-------PDVKPTGTFSTDPQTRDFMMGRFLPAAKA--MASETPQY  232

Query  1561  VKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSVKTSLGL  1382
                + + +P            +  E            QH  ++      P  +V+   G 
Sbjct  233   ---STRKQPVAREQ------PICQEQPRGMKVASGNKQHPLNQYKPNDLPH-NVQDITGD  282

Query  1381  LNPFPGMKSKTQTPASSSTNEVKRL-TRNAPSGPLNKARKAYSGPIEKQSYDAICKQRFR  1205
              +   GM+++ Q P SS    V+ +  +++ +    +A+  +SG       DA C+QR  
Sbjct  283   KSENEGMRAQAQLPISS----VRSVRAKSSYASAYREAKNEHSG------GDA-CEQRLM  331

Query  1204  SGALSGELCKADKRGLKA--------------DGQYPHGGSRSGAISPYRNVTTSSRFSE  1067
             +G     + K DK  LK               DG   H   +   ISPYR         E
Sbjct  332   NGHQEAVIPK-DKNDLKCESNQITKISECEKLDGSPVHRRHQGSNISPYRK---ECFHHE  387

Query  1066  GTGFLGVPREAENLKGSMFS--------SFREVDTHLWDTPIKSSFKGESDSPSDVVEKT  911
               GFLG+P +A+N + +  S        +FRE+      T   + +K    SP  VVEKT
Sbjct  388   EKGFLGIPEKAKNFRETSSSGKYRKGHNNFREI----LATENIAEWKMGPGSP--VVEKT  441

Query  910   VYVDSVNYVKTTSLDLCSSKPEG  842
             +Y+DSV+ VK+ + +  SS  +G
Sbjct  442   LYIDSVHTVKSPNSNSHSSDTKG  464



>gb|KHN06405.1| hypothetical protein glysoja_010749 [Glycine soja]
Length=669

 Score =   115 bits (288),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 153/501 (31%), Positives = 217/501 (43%), Gaps = 84/501 (17%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +M + KLN+  P++SVRR       L   NRK +E PQ         L   KSD  L +V
Sbjct  1     MMNERKLNIDAPLMSVRRSFGTSPSLTEANRKILEKPQT--------LPHYKSDTTLDQV  52

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
             T+PVAVPF WE  PG+ +  +G +       S  P LPPG+  +  +    + P   ++F
Sbjct  53    TEPVAVPFNWEHIPGRSKDYDGSEPQLPTKASITPTLPPGKSTNVAKQSLEKEPNVANNF  112

Query  1867  RFQTEPLAL-------KNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCS  1709
             R  +   +L       K H       VE      +      D+ E  +P   E LS+NCS
Sbjct  113   RPPSISNSLSEKIDCNKEHKDEKMKKVEENDDYDDDGDVYSDALETLSP--TEPLSMNCS  170

Query  1708  IGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVL-------------VTEQP  1568
             + D+SG   + V +          + DFMMSRFL AAKA  +             +TEQP
Sbjct  171   VSDVSGLDNV-VADMCGASSTDKQAHDFMMSRFLTAAKAMTIQPPQYASSRKQTVLTEQP  229

Query  1567  R----LVKEAKKYEPYVMSYYSDYAGDVV--------TenedeendNMTIDQHKWSRKFW  1424
             R    LV E KK      S+ S +  D+V         E E+EE+DN T D    S K  
Sbjct  230   REFIKLVPEQKK------SFVSRHITDIVPYTGQCQEEEEEEEESDNETNDYANNSAKGC  283

Query  1423  KLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIE  1244
              LFPRL V+ SL LLNP PG K   Q P  S+  EV +  +++        R     P  
Sbjct  284   GLFPRLCVRNSLCLLNPVPGTKMGNQFPLYSAY-EVGKPDKSS------HIRSHRPAPSI  336

Query  1243  KQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGS--RSGAISPYRNVTTSSR--  1076
             K+++DAI K +  S A S +     K+      +Y + G   + G +SP+R    +S   
Sbjct  337   KKAWDAINKSKSSSRAASPDKQDVRKKWTSESSRYTYSGELKKLGRLSPFRRSRAASAGV  396

Query  1075  --FSE-------GTGFLGVPREAENLKGSMF-------SSFREVDTHLWDTPIKSSFKGE  944
               F         G   LG  ++ +N             SS +EV        +    K  
Sbjct  397   SPFQSKPQPPFPGAKLLGDSKQDDNNHSGKLKFPSRGHSSIQEV--------LSQGAKRS  448

Query  943   SDSPSDVVEKTVYVDSVNYVK  881
                 S  VEKT+Y+D+ + +K
Sbjct  449   YSFGSLTVEKTLYIDTASTIK  469



>ref|XP_009350316.1| PREDICTED: uncharacterized protein LOC103941849 [Pyrus x bretschneideri]
 ref|XP_009350317.1| PREDICTED: uncharacterized protein LOC103941849 [Pyrus x bretschneideri]
Length=733

 Score =   115 bits (287),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 144/510 (28%), Positives = 203/510 (40%), Gaps = 97/510 (19%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +L+L+ P++SVRR +  V   E  +++  +   P        L   KS+ +   V
Sbjct  5     MMEEKQLDLNQPLLSVRRYSPTVVSSEADDKRKADKSLPKLPP----LPFYKSELKSGPV  60

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPD---------SRRFYSC  1895
               P  VPF WEQ PG+ + E   +    E P+T PRLPPGR  +         S+R  + 
Sbjct  61    RHPGTVPFVWEQIPGRPKAERNSQTQGLERPATTPRLPPGRVSNAKKQALDRGSKRTTAA  120

Query  1894  ERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESL  1724
             + P        + +           DS  E M  K   D E  D       D L   ES 
Sbjct  121   QSPTGNVLSNSKNDSTFDTKEVTKCDSSKEGMEDKDISDSEDGDEAYLDALDALSRIESF  180

Query  1723  SLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVTEQPRL  1562
               NCS+  LSG  G        D+KP+G       +RDFMM RFLPAAKA    T Q   
Sbjct  181   YYNCSVSGLSGLDG-------PDIKPTGTFSTDPQTRDFMMGRFLPAAKAMASDTPQ---  230

Query  1561  VKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSVKTSLGL  1382
                           YS     V  E    +     +    W+++     P    K +   
Sbjct  231   --------------YSTRKQPVAREQPICQEQPRGMKVASWNKQ----HPLNQYKPNDLP  272

Query  1381  LNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKAR------KAYSGPIEKQSYDAIC  1220
              N   G KS+         NE  R+    P   +   R       AY     + S+   C
Sbjct  273   HNDITGDKSE---------NEGMRVQAQLPISSVRSVRAKSSYASAYREAKNEHSWGDAC  323

Query  1219  KQRFRSGALSGELCKADKRGLKA--------------DGQYPHGGSRSGAISPYRNVTTS  1082
             +QR  +G     + K DK  LK               DG   H   +   ISPYR     
Sbjct  324   EQRLVNGHQDAVIPK-DKNDLKCESNQITKISECEKLDGSPVHRRQQGSNISPYRK---E  379

Query  1081  SRFSEGTGFLGVPREAENLKGSMFS--------SFREVDTHLWDTPIKSSFKGESDSPSD  926
                 E  GFLG+P +A+N + +  S        +FRE    L  T   + ++    SP  
Sbjct  380   CFHHEEKGFLGIPEKAKNSRETSSSGKYQKGHNNFRE----LLATENIAEWEMGPGSP--  433

Query  925   VVEKTVYVDSVNYVKTTSLDLCSSKPEGLM  836
             VVEKT+Y+DSV+ VK+ + +  SS  +G M
Sbjct  434   VVEKTLYIDSVHTVKSPNSNSHSSDTKGNM  463



>ref|XP_006580168.1| PREDICTED: uncharacterized protein LOC102665249 isoform X1 [Glycine 
max]
 ref|XP_006580169.1| PREDICTED: uncharacterized protein LOC102665249 isoform X2 [Glycine 
max]
 ref|XP_006580170.1| PREDICTED: uncharacterized protein LOC102665249 isoform X3 [Glycine 
max]
 ref|XP_006580171.1| PREDICTED: uncharacterized protein LOC102665249 isoform X4 [Glycine 
max]
Length=669

 Score =   114 bits (286),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 153/501 (31%), Positives = 217/501 (43%), Gaps = 84/501 (17%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +M + KLN+  P++SVRR       L   NRK +E PQ         L   KSD  L +V
Sbjct  1     MMNERKLNIDAPLMSVRRSFGTSPSLTEANRKILEKPQT--------LPNYKSDTTLDQV  52

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
             T+PVAVPF WE  PG+ +  +G +       S  P LPPG+  +  +    + P   ++F
Sbjct  53    TEPVAVPFNWEHIPGRSKDYDGSEPQLPTKASITPILPPGKSTNVAKQSLEKEPNVANNF  112

Query  1867  RFQTEPLAL-------KNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCS  1709
             R  +   +L       K H       VE      +      D+ E  +P   E LS+NCS
Sbjct  113   RPPSISNSLSEKIDCNKEHKDEKMKKVEENDDYDDDGDVYSDALETLSP--TEPLSMNCS  170

Query  1708  IGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVL-------------VTEQP  1568
             + D+SG   + V +          + DFMMSRFL AAKA  +             +TEQP
Sbjct  171   VSDVSGLDNV-VADMCGASSTDKQAHDFMMSRFLTAAKAMTIQPPQYASSRKQTVLTEQP  229

Query  1567  R----LVKEAKKYEPYVMSYYSDYAGDVV--------TenedeendNMTIDQHKWSRKFW  1424
             R    LV E KK      S+ S +  D+V         E E+EE+DN T D    S K  
Sbjct  230   REFIKLVPEQKK------SFVSRHITDIVPYTGQCQEEEEEEEESDNETNDYANNSAKGC  283

Query  1423  KLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIE  1244
              LFPRL V+ SL LLNP PG K   Q P  S+  EV +  +++        R     P  
Sbjct  284   GLFPRLCVRNSLCLLNPVPGTKMGNQFPLYSAY-EVGKPDKSS------HIRSHRPAPSI  336

Query  1243  KQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGS--RSGAISPYRNVTTSSR--  1076
             K+++DAI K +  S A S +     K+      +Y + G   + G +SP+R    +S   
Sbjct  337   KKAWDAINKSKSSSRAASPDKQDVRKKWTSESSRYTYSGELKKLGRLSPFRRSRAASAGV  396

Query  1075  --FSE-------GTGFLGVPREAENLKGSMF-------SSFREVDTHLWDTPIKSSFKGE  944
               F         G   LG  ++ +N             SS +EV        +    K  
Sbjct  397   SPFQSKPQPPFPGAKLLGDSKQDDNNHSGKLKFPSRGHSSIQEV--------LSQGAKRS  448

Query  943   SDSPSDVVEKTVYVDSVNYVK  881
                 S  VEKT+Y+D+ + +K
Sbjct  449   YSFGSLTVEKTLYIDTASTIK  469



>ref|XP_006415597.1| hypothetical protein EUTSA_v10007223mg [Eutrema salsugineum]
 ref|XP_006415600.1| hypothetical protein EUTSA_v10007223mg [Eutrema salsugineum]
 gb|ESQ33950.1| hypothetical protein EUTSA_v10007223mg [Eutrema salsugineum]
 gb|ESQ33953.1| hypothetical protein EUTSA_v10007223mg [Eutrema salsugineum]
Length=563

 Score =   112 bits (281),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 168/643 (26%), Positives = 258/643 (40%), Gaps = 140/643 (22%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M + KLN + P++S RR+  N       N+ N +    +       L V   +  L +VT
Sbjct  1     MAERKLNFNAPLLSTRRMQRNKAVSVRRNKTN-KFIDDSNTNGSSSLPVLVPEIGLDQVT  59

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTM--PRLPPGRKPDSRRFYSC--ERPCHE  1877
             +P +VPF WEQAPG+ +G N  +   C+    +  P LPPG+  D      C  E+    
Sbjct  60    EPASVPFTWEQAPGRLKG-NDFRFQACDSTQQVFTPCLPPGKVMD---ILKCPVEKAIDG  115

Query  1876  DSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDL  1697
             +  R Q          +     VE  + + E DV   D+R   +P   +S S+N S   L
Sbjct  116   NLTRLQ----------SFKGKQVEE-VSEDEDDVFS-DARATLSPK--DSFSINHS---L  158

Query  1696  SGCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAAVLVTEQPRLVKEAK--------  1547
             SG  G  V E +  +  S D  SRDFM++RFLPAAKA  +  EQP      K        
Sbjct  159   SGVSGYGVVETKKPLNRSADAQSRDFMLNRFLPAAKA--MTVEQPHYASNRKPSTFMSEP  216

Query  1546  -----------------KYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKL  1418
                              +Y+  ++  Y D+      E+E+++ D+   +     ++   +
Sbjct  217   TIQIRELVPGEKRQTPNRYDESIVPPYYDHQDINDEESEEDDVDDGVSEYAYLPKRGCGM  276

Query  1417  FPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQ  1238
              P+L  K SLG+LN  PG+K+K        +++V +L             K+    ++K 
Sbjct  277   LPQLCFKESLGMLNTVPGLKAKHSHDHQVKSSKVSQL-------------KSRFQSVKKL  323

Query  1237  SYDAICKQRFRSGALSGELCKADKR---------GLKADGQYPHGGSRSGAISPYRNVTT  1085
             + D++ K        S       K+          +++   Y H    S  +SP+R+   
Sbjct  324   ALDSVSKHNLGGKVQSPIHPSVGKKFNSEPNLTVAVRSSSPYRH----SRCMSPFRSTGN  379

Query  1084  SSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSS--FKGESDSPSDVVEKT  911
             SS F     F    +EAENL+ +       ++ H+ +        +   + S S + EKT
Sbjct  380   SSPFHPAC-FSETRKEAENLRAN------RLNKHIRNRSRSQELLYPKSNGSTSSLSEKT  432

Query  910   VYVDSVNYVKTT------------SLDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPNQK  767
             VYVD+ N+  T               D+   KPE  +D E F++L               
Sbjct  433   VYVDTENFPITNDQHNSNDMIIPKEADMGGKKPEANLDLEAFENL---------------  477

Query  766   RGSSTSRSSRENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPSIPS-----RGGH  602
               S TS   R    P                P PK PSESWL   LPS+ S     R   
Sbjct  478   --SITSGRERSPLAP----------------PSPKKPSESWLLHNLPSVTSLIPARRYPF  519

Query  601   NDQTNQSPRATNTATKREITVSSCSEHHCNSYYTEELIPYGSH  473
             N Q       +   T  E  V +   H  +  Y+EEL+ + SH
Sbjct  520   NPQKQDLNETSRDVTNWETIVKTTYMHRDHIRYSEELVSHTSH  562



>dbj|BAD94645.1| hypothetical protein [Arabidopsis thaliana]
Length=577

 Score =   112 bits (280),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 177/633 (28%), Positives = 256/633 (40%), Gaps = 109/633 (17%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKN--VEnpqpnrqqqrqPLCVPKSDCELSE  2051
             ME+ KLN SVP++S RR+          N+ N   +      +    P+ VP       E
Sbjct  1     MEERKLNFSVPLLSTRRMQKTAGVSVRRNKSNNFTDYDSKTSECPSVPVLVPYMMGLDDE  60

Query  2050  VTKPVAVPFCWEQAPGKRRGENGGKVYPC-----EDPSTMPRLPPGRKPDSRRFYSCERP  1886
             VT+P +VPF WEQAPG+ +G N  K   C     E+    P LPPG+  D          
Sbjct  61    VTEPASVPFTWEQAPGRLKG-NDFKPQVCVLMKEEEQVFTPCLPPGKAVD----------  109

Query  1885  CHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLSLN  1715
                                A M  L  S   + E   +  D       D L   +S S N
Sbjct  110   -------------------ANMTRLQSSKGKQVEESDDDEDDVFSDALDTLSPKDSFSFN  150

Query  1714  CSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLV---------------  1580
              SI  +S   G++ ++  D       SRDFMMSRFLPAAKA  +                
Sbjct  151   NSISGVSEYGGVETKKPLD-----AQSRDFMMSRFLPAAKAMTVEQSHYASNRKPSTFMA  205

Query  1579  --TEQPR-LVKEAKKYEP------YVMSYYSDYAGDVVTenedeendNMTIDQHKW-SRK  1430
               T Q R LV   K+  P       V SYY  Y  D+  E      ++  + ++ + S++
Sbjct  206   EPTIQIRELVPGEKQQTPNRYDVSIVPSYY--YHQDIDDEESKVGEEDDEVSEYAYLSKR  263

Query  1429  FWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGP  1250
                + P+L  K SLG+LN  PG K+K  +P +S +++  + ++ A         K     
Sbjct  264   GCGMLPQLCFKDSLGMLNTVPGFKAKHNSPITSPSHDQVKSSKVA-------QLKYRFQS  316

Query  1249  IEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRF-  1073
             ++K + D++ K +  SG +   +  ++ +   ++        RS   SPYR+    S F 
Sbjct  317   VKKLALDSVSKHKL-SGKVHSPVHPSNGKKFNSESNLISAAKRSS--SPYRHSRCMSPFR  373

Query  1072  SEGTG----FLGVP---REAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEK  914
             S G G      G P   RE ENL+ +  S+      H  +    S       S   ++EK
Sbjct  374   STGNGSPLHHAGFPETRRETENLRANRLSN------HTRNISRTSQELLYPKSNGSILEK  427

Query  913   TVYVDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPNQKRGSSTSRSSRE  734
             TVYVD+ N   T            ++ PEE      +  +NP  E  +     +S   + 
Sbjct  428   TVYVDTENDHMTND----QHNSNLMIFPEEADMTGRKPDANPELEAFENISIRSSEMVKG  483

Query  733   NFKPDYRSYSDVTsslspypplpkspSESWLWRTLPS----IPSRGGH--NDQTNQSPRA  572
             N   +  S  D         P PK PSESWL   LPS    I SR  H  N Q       
Sbjct  484   NELVEISSGFD---RSPLAQPSPKRPSESWLCHNLPSVTSQITSRRYHPFNPQKQDLTEN  540

Query  571   TNTATKREITVSSCSEHHCNSYYTEELIPYGSH  473
                 TK E  V +   H  +  Y+EEL+ + SH
Sbjct  541   YRNGTKWETIVKTSYMHRDHIRYSEELVAHTSH  573



>ref|NP_174218.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF88115.1|AC021043_8 Unknown protein [Arabidopsis thaliana]
 gb|AAN13010.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31064.1| uncharacterized protein AT1G29240 [Arabidopsis thaliana]
Length=577

 Score =   111 bits (278),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 178/633 (28%), Positives = 257/633 (41%), Gaps = 109/633 (17%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKN--VEnpqpnrqqqrqPLCVPKSDCELSE  2051
             ME+ KLN SVP++S RR+          N+ N   +      +    P+ VP       E
Sbjct  1     MEERKLNFSVPLLSTRRMQKTAGVSVRRNKSNNFTDYDSKTSECPSVPVLVPYMMGLDDE  60

Query  2050  VTKPVAVPFCWEQAPGKRRGENGGKVYPC-----EDPSTMPRLPPGRKPDSRRFYSCERP  1886
             VT+P +VPF WEQAPG+ +G N  K   C     E+    P LPPG+  D          
Sbjct  61    VTEPASVPFTWEQAPGRLKG-NDFKPQVCVLMKEEEQVFTPCLPPGKAVD----------  109

Query  1885  CHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLSLN  1715
                                A M  L  S   + E   +  D       D L   +S S N
Sbjct  110   -------------------ANMTRLQSSKGKQVEESDDDEDDVFSDALDTLSPKDSFSFN  150

Query  1714  CSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLV---------------  1580
              SI  +S   G++ ++  D       SRDFMMSRFLPAAKA  +                
Sbjct  151   NSISGVSEYGGVETKKPLD-----AQSRDFMMSRFLPAAKAMTVEQSHYASNRKPSTFMA  205

Query  1579  --TEQPR-LVKEAKKYEP------YVMSYYSDYAGDVVTenedeendNMTIDQHKW-SRK  1430
               T Q R LV   K+  P       V SYY  Y  D+  E      ++  + ++ + S++
Sbjct  206   EPTIQIRELVPGEKQQTPNRYDVSIVPSYY--YHQDIDDEESKVGEEDDEVSEYAYLSKR  263

Query  1429  FWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGP  1250
                + P+L  K SLG+LN  PG K+K  +P +S +++  + ++ A         K     
Sbjct  264   GCGMLPQLCFKDSLGMLNTVPGFKAKHNSPITSPSHDQVKSSKVA-------QLKYRFQS  316

Query  1249  IEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRF-  1073
             ++K + D++ K +  SG +   +  ++ +   ++        RS   SPYR+    S F 
Sbjct  317   VKKLALDSVSKHKL-SGKVHSPVHPSNGKKFNSESNLISAAKRSS--SPYRHSRCMSPFR  373

Query  1072  SEGTG----FLGVP---REAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEK  914
             S G G      G P   RE ENL+ +  S+      H  +    S       S   ++EK
Sbjct  374   STGNGSPLHHAGFPETRRETENLRANRLSN------HTRNISRTSQELLYPKSNGSILEK  427

Query  913   TVYVDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPNQKRGSSTSRSSRE  734
             TVYVD+ N   T            ++ PEE      +  +NP  E  +     +S   + 
Sbjct  428   TVYVDTENDHMTND----QHNSNLMIFPEEADMTGRKPDANPELEAFENISIRSSEMVKG  483

Query  733   NFKPDYRSYSDVTsslspypplpkspSESWLWRTLPS----IPSRGGH--NDQTNQSPRA  572
             N   +  S  D        PP PK PSESWL   LPS    I SR  H  N Q       
Sbjct  484   NELVEISSGFD---RSPLAPPSPKRPSESWLCHNLPSVTSQITSRRYHPFNPQKQDLTEN  540

Query  571   TNTATKREITVSSCSEHHCNSYYTEELIPYGSH  473
                 TK E  V +   H  +  Y+EEL+ + SH
Sbjct  541   YRNGTKWETIVKTSYMHRDHIRYSEELVAHTSH  573



>gb|KHN08430.1| hypothetical protein glysoja_014195 [Glycine soja]
Length=684

 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 144/514 (28%), Positives = 225/514 (44%), Gaps = 89/514 (17%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M + +LN++ P++SVRR ++    L    +K +E            L   KSD    +VT
Sbjct  1     MAERRLNINAPLMSVRRSSATPPSLTEAKKKILEKRHT--------LPYYKSDTSSDQVT  52

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTM--PRLPPGRKPDSRRFYSCERPCHEDS  1871
             +PVAVPF WE  PG+R+G  G +  P +  S    PRLPPG+  ++ +  + E+     +
Sbjct  53    EPVAVPFNWEHIPGRRKGNGGSEPQPPKANSITPSPRLPPGKSINATK-QTLEKESKTAN  111

Query  1870  FRFQTEPLALKNHAAL---------MDSLVESMLGKGEFDVEGR-----DSRECTNPDVL  1733
                 +      N + +          + +VES     +FD +       D+ E  +P   
Sbjct  112   KFKSSNKSKSFNVSVVKVDSDKERKAEKIVESRRSNVKFDDDDDNDAYSDALENLSP--T  169

Query  1732  ESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKA-------------  1592
             ES S+NCS+  +SG   LD  +          +RDFMMSRFLPAAKA             
Sbjct  170   ESFSMNCSVSGVSGLDNLDANKF-GTFSTDQQTRDFMMSRFLPAAKAMTLQPPQYSSKKQ  228

Query  1591  AVLVTEQPR----LVKEAKK---------YEPYVMSYYSDYAGDVVTenedeendNMTID  1451
             +VLV +QPR    LV+E KK           PY   +  + + D V   E + + N+   
Sbjct  229   SVLVEQQPRDVSKLVREEKKPLPNKHNTAIIPYTGQHQEEESEDEVDGYEYDNSSNI---  285

Query  1450  QHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQT---PASSSTNEVKRLTRNAPSGPL  1280
                 + K   L P+L ++ SL LLNP   MK K +    PAS    EV +  +++     
Sbjct  286   ----AAKGCGLLPQLHIRNSLCLLNPVAAMKMKNKAILPPAS----EVVKPNKSS-----  332

Query  1279  NKARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGS-RSGAISP  1103
                R     P  K++++AI K +  S A S +  +  K+      ++ + G    G +SP
Sbjct  333   -HIRSFSPVPAVKKAWEAIHKSKSSSRAASPDKQEGKKKWTSESNRFTYSGELLPGRLSP  391

Query  1102  YRNVTTS------------SRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKS  959
             +R    +            S F  G    G  +EAEN           V  ++ D  +  
Sbjct  392   FRRSRAAAAGISPCRSKPQSPF-RGAKLPGDTKEAENYMFGKVKFHSGVLGNVHDV-LSQ  449

Query  958   SFKGESDSPSDVVEKTVYVDSVNYVKTTSLDLCS  857
               K  S S +  +EKT+YVD+ +  K +S ++ S
Sbjct  450   GAKRTSYSGNLTIEKTLYVDTASTAKLSSSNISS  483



>ref|XP_011033746.1| PREDICTED: uncharacterized protein LOC105132125 isoform X1 [Populus 
euphratica]
 ref|XP_011033747.1| PREDICTED: uncharacterized protein LOC105132125 isoform X1 [Populus 
euphratica]
 ref|XP_011033748.1| PREDICTED: uncharacterized protein LOC105132125 isoform X1 [Populus 
euphratica]
Length=698

 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 135/499 (27%), Positives = 212/499 (42%), Gaps = 74/499 (15%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +MEK +L+ + P++SVRR +S     E   ++  ++             V KS+ +   +
Sbjct  6     LMEKKQLDFNQPLLSVRRYSSTASTKEAKIKRKTDDALSRIPPP-----VYKSELKSGPL  60

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
             + P  VPF WE++PG+ + E+  +    + P   P+LPPGR    ++  S +     +  
Sbjct  61    SNPGTVPFVWERSPGRPKDESKPQNRALQRPPVAPKLPPGRILKDQQQASVK---GSEGA  117

Query  1867  RFQTEPLALKNHAALMDSLVESMLGKGEFDV--EGRDSRECTNPDVLESLS------LNC  1712
             +          H++  +  +E +  K   D    G ++ E    D L+ LS      LNC
Sbjct  118   KLADRSQTRNGHSSFQNETIEEISKKAIKDASSSGSETGEEAYADALDILSRSESFFLNC  177

Query  1711  SIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAV------------  1586
             SI  +SG  G        D+KPSG        +DFMM+RFLPAAKA              
Sbjct  178   SISGVSGLDG-------PDLKPSGAFFTDQHGQDFMMARFLPAAKAMASETPQCFTRKQP  230

Query  1585  LVTEQPRLVKEAKKYEPYVMSYYSDY------AGDVVTenedeendNMTIDQHKWSRKFW  1424
             +V E PR + +A   E + ++ YS Y        D V ++EDE++D+        S K  
Sbjct  231   VVRELPRQIAKATSAERHPLNRYSPYNIPNYAQADAVEDSEDEDHDDDR--PDDPSLKLC  288

Query  1423  KLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIE  1244
              L P+L  + SL  +NP  GM+ + Q P S+     K  + NA S  +       +   E
Sbjct  289   GLLPQLCSQNSLCFMNPVLGMRKQVQVPISAVCT-TKSGSSNAASRNVTAHEHQRNDKYE  347

Query  1243  KQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRF---  1073
             K+    I              CK + + L  D      G  S   SP     T S+F   
Sbjct  348   KRESIKIA-------------CKTENKKL--DESSACKGWHSKVASP-----TDSQFPQP  387

Query  1072  -SEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVDS  896
               E      +P + ++   S F    +  T   +     S + ES S   V EKT+Y+DS
Sbjct  388   VHEEQRCTEIPDKCKDSVASDFIRCAKGSTIFRELLANESREWESVSAVSVAEKTLYIDS  447

Query  895   VNYVKTTSLDLCSSKPEGL  839
             ++ VK  + +  SS   GL
Sbjct  448   MHMVKPQNSNSSSSDARGL  466



>ref|XP_011033749.1| PREDICTED: uncharacterized protein LOC105132125 isoform X2 [Populus 
euphratica]
Length=696

 Score =   108 bits (271),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 133/499 (27%), Positives = 212/499 (42%), Gaps = 76/499 (15%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +MEK +L+ + P++SVRR +S     E   ++  ++             V KS+ +   +
Sbjct  6     LMEKKQLDFNQPLLSVRRYSSTASTKEAKIKRKTDDALSRIPPP-----VYKSELKSGPL  60

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
             + P  VPF WE++PG+ + E+  +    + P   P+LPPGR    ++  S +     +  
Sbjct  61    SNPGTVPFVWERSPGRPKDESKPQNRALQRPPVAPKLPPGRILKDQQQASVK---GSEGA  117

Query  1867  RFQTEPLALKNHAALMDSLVESMLGKGEFDV--EGRDSRECTNPDVLESLS------LNC  1712
             +          H++  +  +E +  K   D    G ++ E    D L+ LS      LNC
Sbjct  118   KLADRSQTRNGHSSFQNETIEEISKKAIKDASSSGSETGEEAYADALDILSRSESFFLNC  177

Query  1711  SIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAV------------  1586
             SI  +SG  G        D+KPSG        +DFMM+RFLPAAKA              
Sbjct  178   SISGVSGLDG-------PDLKPSGAFFTDQHGQDFMMARFLPAAKAMASETPQCFTRKQP  230

Query  1585  LVTEQPRLVKEAKKYEPYVMSYYSDY------AGDVVTenedeendNMTIDQHKWSRKFW  1424
             +V E PR + +A   E + ++ YS Y        D V ++EDE++D+        S K  
Sbjct  231   VVRELPRQIAKATSAERHPLNRYSPYNIPNYAQADAVEDSEDEDHDDDR--PDDPSLKLC  288

Query  1423  KLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIE  1244
              L P+L  + SL  +NP  GM+ + Q P S+             SG  N A +  +    
Sbjct  289   GLLPQLCSQNSLCFMNPVLGMRKQVQVPISAVC--------TTKSGSSNAASRNVTAHER  340

Query  1243  KQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRF---  1073
                Y+   ++  +        CK + + L  D      G  S   SP     T S+F   
Sbjct  341   NDKYEK--RESIKIA------CKTENKKL--DESSACKGWHSKVASP-----TDSQFPQP  385

Query  1072  -SEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVDS  896
               E      +P + ++   S F    +  T   +     S + ES S   V EKT+Y+DS
Sbjct  386   VHEEQRCTEIPDKCKDSVASDFIRCAKGSTIFRELLANESREWESVSAVSVAEKTLYIDS  445

Query  895   VNYVKTTSLDLCSSKPEGL  839
             ++ VK  + +  SS   GL
Sbjct  446   MHMVKPQNSNSSSSDARGL  464



>ref|XP_007159457.1| hypothetical protein PHAVU_002G239200g [Phaseolus vulgaris]
 gb|ESW31451.1| hypothetical protein PHAVU_002G239200g [Phaseolus vulgaris]
Length=673

 Score =   105 bits (262),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 143/497 (29%), Positives = 215/497 (43%), Gaps = 77/497 (15%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +M++ KLN+  P++SVRR       L    R           ++ Q L    SD  L +V
Sbjct  6     MMDERKLNIDAPLMSVRRSFGPPPSLTETRR---------ILEKPQTLPHCNSDTTLDQV  56

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPST--MPRLPPGRKPDSRRFYSCERPCHED  1874
             T PVAVPF WE  PG+ +  +G +  P    S    P LPPG+  +  +    +      
Sbjct  57    TDPVAVPFNWEHIPGRPKDYDGSEPQPRVQASVTPTPTLPPGKSTNHAKQLLEKDANVAS  116

Query  1873  SFRFQTEPLALKNH----AALMDSLVESMLGKGEFDVEG---RDSRECTNPDVLESLSLN  1715
             SFR  T   +            D  +E +    E+D +G    D+ E  +P   E LS+N
Sbjct  117   SFRSPTTSNSFSEKIDYDGEHKDEKIEKVEENDEYDYDGDVFSDALETLSP--TEPLSMN  174

Query  1714  CSIGDLSGCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAAVL-------------V  1580
             CS+   SG  GL+  +       S D  ++DFMMSRFL AAKA  +             +
Sbjct  175   CSV---SGVSGLNNSDANMCGASSTDKQAQDFMMSRFLHAAKAMTIQPPQYISSRKQSVL  231

Query  1579  TEQPR----LVKEAKKYEPYVMSYYSDYAGDVV------TenedeendNMTIDQHKWSRK  1430
              EQPR    LV E KK      S+ + +  D+V       E+E+EE+ + T D    S K
Sbjct  232   AEQPREFIKLVPEQKK------SFVNRHITDIVPYNGQCQEDEEEESGDETNDYANISAK  285

Query  1429  FWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGP  1250
                L PRL V+ SL +LNP    K   Q    S+  EV +  +++        R     P
Sbjct  286   GCGLLPRLCVRNSLCILNPVTETKIGNQLSLYSAY-EVGKPDKSS------HIRSHGPAP  338

Query  1249  IEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGS--RSGAISPYRNVTTSSR  1076
             + K+++DAI  ++  S A S +     K+      +Y + G   + G +SP+R    ++ 
Sbjct  339   VIKKAWDAINMRKSSSRAASPDKKDLRKKWTSESSRYTYSGEMKQLGRLSPFRRSRAAAA  398

Query  1075  -----------FSEGTGFLGVPREAE-NLKGSMFSSFREVDTHLWDTPIKSSFKGESDSP  932
                           G   LG  ++A+ NL G +   F    +      +    K  S S 
Sbjct  399   GISPFPSKPQPLFPGAKSLGDSKQADNNLSGKL--KFPSRGSARIQEMLSQGAKRSSSSG  456

Query  931   SDVVEKTVYVDSVNYVK  881
             S  VEKT+Y+D+ + VK
Sbjct  457   SLTVEKTLYIDTASTVK  473



>ref|XP_006415598.1| hypothetical protein EUTSA_v10007223mg [Eutrema salsugineum]
 ref|XP_006415599.1| hypothetical protein EUTSA_v10007223mg [Eutrema salsugineum]
 ref|XP_006415601.1| hypothetical protein EUTSA_v10007223mg [Eutrema salsugineum]
 gb|ESQ33951.1| hypothetical protein EUTSA_v10007223mg [Eutrema salsugineum]
 gb|ESQ33952.1| hypothetical protein EUTSA_v10007223mg [Eutrema salsugineum]
 gb|ESQ33954.1| hypothetical protein EUTSA_v10007223mg [Eutrema salsugineum]
Length=568

 Score =   104 bits (260),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 137/525 (26%), Positives = 220/525 (42%), Gaps = 102/525 (19%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M + KLN + P++S RR+  N       N+ N +    +       L V   +  L +VT
Sbjct  1     MAERKLNFNAPLLSTRRMQRNKAVSVRRNKTN-KFIDDSNTNGSSSLPVLVPEIGLDQVT  59

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTM--PRLPPGRKPDSRRFYSC--ERPCHE  1877
             +P +VPF WEQAPG+ +G N  +   C+    +  P LPPG+  D      C  E+    
Sbjct  60    EPASVPFTWEQAPGRLKG-NDFRFQACDSTQQVFTPCLPPGKVMD---ILKCPVEKAIDG  115

Query  1876  DSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDL  1697
             +  R Q          +     VE  + + E DV   D+R   +P   +S S+N S   L
Sbjct  116   NLTRLQ----------SFKGKQVEE-VSEDEDDVFS-DARATLSPK--DSFSINHS---L  158

Query  1696  SGCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAAVLVTEQPRLVKEAK--------  1547
             SG  G  V E +  +  S D  SRDFM++RFLPAAKA  +  EQP      K        
Sbjct  159   SGVSGYGVVETKKPLNRSADAQSRDFMLNRFLPAAKA--MTVEQPHYASNRKPSTFMSEP  216

Query  1546  -----------------KYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKL  1418
                              +Y+  ++  Y D+      E+E+++ D+   +     ++   +
Sbjct  217   TIQIRELVPGEKRQTPNRYDESIVPPYYDHQDINDEESEEDDVDDGVSEYAYLPKRGCGM  276

Query  1417  FPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQ  1238
              P+L  K SLG+LN  PG+K+K        +++V +L             K+    ++K 
Sbjct  277   LPQLCFKESLGMLNTVPGLKAKHSHDHQVKSSKVSQL-------------KSRFQSVKKL  323

Query  1237  SYDAICKQRFRSGALSGELCKADKR---------GLKADGQYPHGGSRSGAISPYRNVTT  1085
             + D++ K        S       K+          +++   Y H    S  +SP+R+   
Sbjct  324   ALDSVSKHNLGGKVQSPIHPSVGKKFNSEPNLTVAVRSSSPYRH----SRCMSPFRSTGN  379

Query  1084  SSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSS--FKGESDSPSDVVEKT  911
             SS F     F    +EAENL+ +       ++ H+ +        +   + S S + EKT
Sbjct  380   SSPFHPAC-FSETRKEAENLRAN------RLNKHIRNRSRSQELLYPKSNGSTSSLSEKT  432

Query  910   VYVDSVNYVKTT------------SLDLCSSKPEGLMDPEEFKDL  812
             VYVD+ N+  T               D+   KPE  +D E F++L
Sbjct  433   VYVDTENFPITNDQHNSNDMIIPKEADMGGKKPEANLDLEAFENL  477



>ref|XP_006852401.1| hypothetical protein AMTR_s00021p00026070 [Amborella trichopoda]
 gb|ERN13868.1| hypothetical protein AMTR_s00021p00026070 [Amborella trichopoda]
Length=758

 Score =   104 bits (260),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 145/562 (26%), Positives = 230/562 (41%), Gaps = 129/562 (23%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRIN-SNVRHLEGVNRKNVEnpqpnrqqqrqPLCVP--KSDCELS  2054
             ME+ +L+ + P++SVRR + ++V    G N+++        +   Q L  P  KSD +  
Sbjct  1     MEEKQLDFNAPLLSVRRFSGTSVTSEVGDNKRS-------EKLAVQNLTPPTYKSDLKSG  53

Query  2053  EVTKPVAVPFCWEQAPGK-RRGENGGKVYPCEDPSTMPRLPPGRKPDSRRF-YSCERPCH  1880
              V  P  +PF WEQ PG+ + G N G     E P   P+LPPGRK ++++     E+P +
Sbjct  54    PVRNPGTIPFVWEQIPGRPKDGGNDGSPKSLERPPLAPKLPPGRKFNAKKPPKDDEKPEN  113

Query  1879  ED---SFRFQTEPLALKNHAALMDSLVESMLGKGEFDVE--------GRDSRECTN----  1745
             +D   + R Q    +  ++ + + + + S    G             G   +E TN    
Sbjct  114   KDIMNATRLQPIETSTGSYGSSLKTNIRSFSTSGYHGASSKTNMKSFGNSYKESTNSMAL  173

Query  1744  --------------------PDVLESLS------LNCSIGDLSGCQGLDVEEGRDDVKPS  1643
                                  D L++LS      LNCSI  +S   G D++   D+    
Sbjct  174   LERKFSNEGGSSDIEDDDVFADALDTLSQTESCFLNCSISGVSALDGQDLKT-LDNGGLD  232

Query  1642  GDSRDFMMSRFLPAAKAAVLVTEQPRLVKEAKKY---EPY-VMSYYSDYAGDVVTenede  1475
               +R FM+ RFLPAA+A  + +E P+     K     EP   ++  S     +VT   + 
Sbjct  233   LSTRKFMIDRFLPAARA--MASESPQYAPSRKPQVGNEPVRQVTNISRDGSPLVTRVPNH  290

Query  1474  endNMTIDQHKW--------------------SRKFWKLFPRLSVKTSLGLLNPF---PG  1364
                   I + +                     SRK   LFP   +K S+ LLNP    P 
Sbjct  291   YLIQKHIQEQQAGYEEEDDDDDDDDGDYSVDSSRKVCGLFP-WRLKNSICLLNPVIHAPR  349

Query  1363  MKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYDAICKQRFRSGALSGE  1184
              K+  Q P   ++       +   S P+   ++      E+++++A+ + +  +G+ + E
Sbjct  350   AKTSKQMPLRDTSRPADYQIKT--SSPVTLTQR------EQETWEAVYRHKLVNGSQTHE  401

Query  1183  LCK----------------ADKRGLKADGQYPHGGS----RSGAISPYRNVTTSSRFSEG  1064
             + +                  +    +D Q P   S      G ISPYRN    S F EG
Sbjct  402   VVEDASKPTSDSASTPSVYGKQPNYSSDSQTPDDMSPYRHSMGGISPYRNEAPRSPFHEG  461

Query  1063  TGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVDSVNYV  884
              GFLG P+  +  K         VD +   T         S S S   EKTVY+DSV+  
Sbjct  462   MGFLGFPKTEKTFK---------VDKYSSSTTSHRGSDRRSGSLSPAAEKTVYIDSVH--  510

Query  883   KTTSLDLCSSKP-EGLMDPEEF  821
                   L +SKP  G ++ +EF
Sbjct  511   -----GLGASKPGSGHLESKEF  527



>ref|XP_010686211.1| PREDICTED: uncharacterized protein LOC104900492 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010686212.1| PREDICTED: uncharacterized protein LOC104900492 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010686213.1| PREDICTED: uncharacterized protein LOC104900492 [Beta vulgaris 
subsp. vulgaris]
Length=650

 Score =   102 bits (254),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 141/508 (28%), Positives = 221/508 (44%), Gaps = 79/508 (16%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             MEK +LN S P++S RR +S +R    +N+ +      +  + R  +    SD  L EV 
Sbjct  1     MEKKQLNFSAPLMSARRYSSPLRTSGELNKVD------SPPKNRHSIPSKPSDVTLEEVV  54

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCED---------PSTMPRLPPGRKP-DSRRFYSC  1895
             KP +VPF WEQ PGK +  N  + +  +          P +MP  PPG+K  +   F + 
Sbjct  55    KPGSVPFMWEQTPGKAKDGNESQRHSHDQVSMAITSKLPPSMP-FPPGKKSGELNGFRTP  113

Query  1894  ERPCHEDSF----RFQTEPLALKNHAALMDSLVESMLGKGEF---DVEGRDSRECTNPDV  1736
              +   E +     +F  E  + + H  L   L    + + +    + E   S E  + D+
Sbjct  114   SKLSGELNVLRPHKFSGELKSFRPHNKLSGELKTMTMVRWDSSRDNTEMNASSESEDDDL  173

Query  1735  L-----------ESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAA  1589
                         ES S+NCS+  LS  +  +  +  D++     +RDFMM+RFLPAAKA 
Sbjct  174   TFSDAIETFSQRESFSINCSVSGLSASERSETRQF-DNLPTDPRARDFMMNRFLPAAKAM  232

Query  1588  VLVTEQ----PRLV-----KEAKKYEPYV--------MSYYSDYAGDVVTenedeendNM  1460
              L   Q     +LV     KE K   P          +     Y G  +   E +E ++ 
Sbjct  233   TLEPSQYASRKQLVAVDQSKEVKALVPRAKTPPPNQNVCSIVPYTGQDIGSEESDEEEDS  292

Query  1459  TIDQHKWSRKFWK--LFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSG  1286
                +   S K       P    K SL L+NP P MK ++++  SS++   K +   +   
Sbjct  293   YDGRSTLSVKVKACGFLPWFCSKNSLRLVNPLPTMKHRSKSALSSASKLSKLVKTKSWRS  352

Query  1285  PLNKARK--AYSGPIEKQSYDAICKQRFRSGALSGELCKADK---------RGLKADGQY  1139
             P  K+ K   Y+            K + R    S EL K  K         R L+     
Sbjct  353   PSQKSVKPDPYTN----------TKHKVRQVYKSCELQKPPKHTSRPMFYSRELQTRSGS  402

Query  1138  PHGGSRSGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKS  959
             P+  SR  ++SP++N +  S + +G GFL VPR   + + +  S   +  +  +D P + 
Sbjct  403   PYRSSRRSSVSPFQNESPHSLYEKGVGFLAVPRRVNSFEDNR-SKIHQKGSKRFDEPGRM  461

Query  958   SFKGESDSPSDVVEKTVYVDSVNYVKTT  875
             +    + SP  VV+KT+YVDSVN  K +
Sbjct  462   TRSSGTRSP--VVDKTLYVDSVNITKVS  487



>ref|XP_008368737.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103432330 
[Malus domestica]
Length=825

 Score =   102 bits (254),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 133/494 (27%), Positives = 199/494 (40%), Gaps = 96/494 (19%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPK-------S  2069
             +ME+ +L+L+ P++SVRR +     LE  +++  +              +PK       +
Sbjct  5     MMEEKQLDLNQPLLSVRRFSPTAVTLEANDKRKTDXS------------IPKLPLFPFTN  52

Query  2068  DCELSEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPD---------  1916
               +   V  P +VPF WE+ PG  + E   +    E P T PRLPPGR  +         
Sbjct  53    QNKSGPVRHPGSVPFVWEKVPGXPKDEXNSQTRGIEQPPTTPRLPPGRVLNAKKQALDKC  112

Query  1915  SRRFYSCERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDV  1736
             S+R  + + P       F              DSL E M  K   D E  D       D 
Sbjct  113   SKRTTTAQSPTGNVLSNFNNVSTFDTKEVTKCDSLKEGMDDKDIADSEDGDETYLDALDT  172

Query  1735  L---ESLSLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVL  1583
             L   ES   NCSI  LSG  G        D KPSG       +R+FMM RFLPAAKA V 
Sbjct  173   LSRSESFYYNCSISGLSGLDG-------PDAKPSGTFSTDPQTRNFMMGRFLPAAKAMVS  225

Query  1582  VTEQPRLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLS  1403
              T Q    K+    E  +          VV+           + QH  ++      P  +
Sbjct  226   DTPQYATRKQPXAREQAISQEQPRGMKKVVSG----------VKQHPLNQYRPNDLPH-N  274

Query  1402  VKTSLGLLNPFPGMKSKTQTPASSSTNEVKRL-TRNAPSGPLNKARKAYSGPIEKQSYDA  1226
              +   G  +   GM+   + P SS    V RL  +++ +    +A+  +SG       DA
Sbjct  275   FQVIAGDKSENEGMRVXPRLPVSS----VSRLRAKSSYASAXREAKNEHSGG------DA  324

Query  1225  ICKQRFRSGALSGEL--------CKADKRGL----KADGQYPHGGSRSGAISPYRNVTTS  1082
              C+QR  +G     +        C++++  +    K DG   +   +   ISPYR     
Sbjct  325   -CEQRLTNGHQEAGMPEDRNDLQCESNQIKISECQKLDGSPVYRHQQGSNISPYRK---E  380

Query  1081  SRFSEGTGFLGVPREAENLKGS--------MFSSFREVDTHLWDTPIKSSFKGESDSPSD  926
                 E  GFLG+P + +N + +          ++FRE    L  T   + ++    SP  
Sbjct  381   CFHHEEKGFLGLPEKVKNSRDTSSSGKYRKXHNNFRE----LLATENVAQWEMGPGSP--  434

Query  925   VVEKTVYVDSVNYV  884
             V EK +Y+D V+ V
Sbjct  435   VFEKNLYIDFVHTV  448



>ref|XP_009767174.1| PREDICTED: uncharacterized protein LOC104218389 [Nicotiana sylvestris]
Length=632

 Score =   100 bits (249),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 105/339 (31%), Positives = 149/339 (44%), Gaps = 51/339 (15%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  +LNLS P +SVRR++        V+ ++                  KS+ +   V 
Sbjct  1     MEDKQLNLSQPFLSVRRVSPT-----AVSGRDETKKTEYSLPTVTHPPRYKSELKSGPVR  55

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRK----PDSRRFYSCE--RPC  1883
              P  VPF WEQ+PGK + E+  ++   E P   PRLPPGRK     DS   +  +  R  
Sbjct  56    NPGVVPFLWEQSPGKPKYESKRQIRSSEKPPIAPRLPPGRKLKDNQDSDNAHESQNIRKS  115

Query  1882  HEDSFRFQTEP-LALKNHAALMDSL---VESMLGKGEFDVEGRDSRECTNPDVL---ESL  1724
                + +  T   + L+  A  +DS+    E    K + + E  D      PD L   ES 
Sbjct  116   QIGNTQHSTPSCMNLEEKAKKIDSIDCSKEIKQDKEKSESEDGDEAYMDAPDKLSRTESF  175

Query  1723  SLNCSIGDLSGCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAAV------------  1586
              LNCS   LSG  GLD    +       D  +RDFM+ RFLPAAKA              
Sbjct  176   FLNCS---LSGLSGLDEPAAKPFSISLTDPQTRDFMIDRFLPAAKAMASEKTLEMPHCAP  232

Query  1585  ----LVTEQPRLVKEAK--------KYEPYVMSYYSDYAGDVVTenedeendNMTIDQHK  1442
                  V EQPR +K+          +Y P    +YS +  +   E  D+++ +     + 
Sbjct  233   RKQPAVQEQPRQLKKVVNGDKRPQLRYGPSFARHYSQFHDNGEEEESDDDSYDDGNVPY-  291

Query  1441  WSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSST  1325
                K   L PR  +K+S  LLNP PGM  +T+ PAS ++
Sbjct  292   ---KVCGLLPRFCLKSSFCLLNPVPGMSVRTRVPASPAS  327



>ref|XP_002320413.2| hypothetical protein POPTR_0014s13950g [Populus trichocarpa]
 gb|EEE98728.2| hypothetical protein POPTR_0014s13950g [Populus trichocarpa]
Length=698

 Score = 99.0 bits (245),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 133/499 (27%), Positives = 206/499 (41%), Gaps = 75/499 (15%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +MEK +L+ + P++SVRR +S     E   ++  ++             V KS+ +   +
Sbjct  6     LMEKKQLDFNQPLLSVRRFSSTASTKEAKIKRKTDDALSRISPPP----VYKSELKSGPL  61

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
               P  VPF WE++PG+ + E+  +    + P   P+LPPGR    ++  S +     +  
Sbjct  62    RNPGTVPFVWERSPGRPKDESKPQNRALQRPPIAPKLPPGRILKDQQQASVK---GSEGA  118

Query  1867  RFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNP-----DVL---ESLSLNC  1712
             +          H++  +   E +  +   D     S           D+L   ES  LNC
Sbjct  119   KLADRSQTRNGHSSFQNETKEEISKEAIKDASSSGSESGEEAYADALDILSRSESFFLNC  178

Query  1711  SIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAV------------  1586
             SI  +SG  G        D+KPSG        +DFMM+RFLPAAKA              
Sbjct  179   SISGVSGLDG-------PDLKPSGAFFTDQHGQDFMMARFLPAAKAMASETPQCFTRKQP  231

Query  1585  LVTEQPRLVKEAKKYEPYVMSYYS-----DYA-GDVVTenedeendNMTIDQHKWSRKFW  1424
             +V E PR + +A   E + ++ YS     +YA  D V ++EDE+ D+        S K  
Sbjct  232   VVRELPRQIAKATGVERHPLNRYSPNNIPNYAQADAVEDSEDEDCDDDR--PDDPSLKLC  289

Query  1423  KLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIE  1244
              L P+L  + SL  +NP  GM+ +   P SS             SG  N A +  +    
Sbjct  290   GLLPQLCSQNSLCFMNPVLGMRKQVPVPISSVC--------TTKSGSSNAASRNVTAHER  341

Query  1243  KQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRF---  1073
                Y+   ++  +        CK + + L  D      G  S   SP     T S+F   
Sbjct  342   NAMYEK--RESIKIA------CKTENKRL--DESSACKGWHSKVASP-----TDSQFPQP  386

Query  1072  -SEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVDS  896
               E      +P +  N   S F    +  T   +     S + ES S   V EKT+Y+DS
Sbjct  387   VHEERRCTEIPDKCRNSAASDFIQCAKGSTIFRELLATESREWESVSAVSVAEKTLYIDS  446

Query  895   VNYVKTTSLDLCSSKPEGL  839
             ++ VK  + +  SS   GL
Sbjct  447   MHMVKPQNSNSSSSDARGL  465



>ref|XP_008381208.1| PREDICTED: uncharacterized protein LOC103444076 isoform X2 [Malus 
domestica]
Length=732

 Score = 99.0 bits (245),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 127/473 (27%), Positives = 187/473 (40%), Gaps = 123/473 (26%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +L+L+ P++SVRR +  V   E  +++  +   P        L   KS+ +   V
Sbjct  6     MMEEKQLDLNQPLLSVRRYSPTVVSSEADDKRKADKSLPKLPP----LPFYKSELKSGPV  61

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR---------KPDSRRFYSC  1895
               P  VPF WEQ PG+ + E   +    E P+T PRLPPGR            S+R  + 
Sbjct  62    RHPGTVPFVWEQIPGRPKDERNSQTQGLERPATTPRLPPGRVSIAKKQALDKGSKRTTAA  121

Query  1894  ERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESL  1724
             + P        + +           DS  E M  K   D E  D       D L   ES 
Sbjct  122   QSPTGHVLSNSKNDSTFDTKEVTKCDSSKEGMEDKDISDSEDGDETYLDALDALSRSESF  181

Query  1723  SLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAV--------  1586
               NCS+  LSG  G        DVKP+G       +RDFMM RFLPAAKA          
Sbjct  182   YYNCSVSGLSGLDG-------PDVKPTGTFSTDPQTRDFMMGRFLPAAKAMASETPQYST  234

Query  1585  ----------LVTEQPRLVKEAKKYEPYVMSYY--SDYAGDVVTenedeendNMTIDQHK  1442
                       +  EQPR +K A   + + ++ Y  +D   +V          ++T D+  
Sbjct  235   RKQPVAREQPICQEQPRGMKVASGNKQHPLNQYKPNDLPHNV---------QDITGDK--  283

Query  1441  WSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRL-TRNAPSGPLNKARK  1265
                                       M+++ Q P SS    V+ +  +++ +    +A+ 
Sbjct  284   -------------------------SMRAQAQLPISS----VRSVRAKSSYASAYREAKN  314

Query  1264  AYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKA--------------DGQYPHGG  1127
              +SG       DA C+QR  +G     + K DK  LK               DG   H  
Sbjct  315   EHSG------GDA-CEQRLMNGHQEAVIPK-DKNDLKCESNQITKISECEKLDGSPVHRR  366

Query  1126  SRSGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFS--------SFREV  992
              +   ISPYR         E  GFLG+P +A+N + +  S        +FRE+
Sbjct  367   HQGSNISPYRK---ECFHHEEKGFLGIPEKAKNFRETSSSGKYRKGHNNFREI  416



>ref|XP_007216809.1| hypothetical protein PRUPE_ppa023132mg [Prunus persica]
 gb|EMJ18008.1| hypothetical protein PRUPE_ppa023132mg [Prunus persica]
Length=702

 Score = 98.6 bits (244),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 121/418 (29%), Positives = 171/418 (41%), Gaps = 76/418 (18%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +LN + P++SVRR ++ V   E   ++  E   P        L V KS+ +   V
Sbjct  6     LMEEKQLNFNQPLLSVRRFSATVVSSEADEKRKAEKSLPKLPP----LPVYKSELKSGPV  61

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR-----KPDSRRFYSC----  1895
               P  VPF WEQ PG+ + E        E   T P+LPPGR     K  + +   C    
Sbjct  62    RNPGTVPFVWEQIPGRPKDERKSPNQALEWLPTAPKLPPGRVSKVKKQATDKGSECTTAA  121

Query  1894  ERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESL  1724
             + P        Q             DS    M  KG   + G D  + T  D L   ES 
Sbjct  122   QSPTGNVLSNSQNVSTLDTKEVTKYDSSKVEMEDKG---IAGSDDGDETYLDALSRSESF  178

Query  1723  SLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVTEQPRL  1562
              +NCSI  LSG  GL       D+KPSG       +RDFMM RFLPAAKA    T Q   
Sbjct  179   FMNCSISGLSGLDGL-------DIKPSGTFSTDPQTRDFMMGRFLPAAKALASETPQYAS  231

Query  1561  VKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSVKTSLGL  1382
              K+    E  ++         VV+ ++          QH  ++   K  P   V+   G 
Sbjct  232   RKQPVAREQPLLQEQPSGMKKVVSGDK----------QHPLNQHRPKDLPHY-VQDIAGD  280

Query  1381  LNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYDAICKQRFRS  1202
              +   GM+ + Q P SS    V+R+          +A+ +Y          AI  +  + 
Sbjct  281   KSEDEGMRVQAQLPISS----VRRV----------RAKSSY----------AISYREAKK  316

Query  1201  GALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRFSEGTGFLGVPREAEN  1028
                +   C+      K DG   +   +   ISPYRN  +     E  GFLG+P +A+N
Sbjct  317   EITNRSDCQ------KLDGSPMYRRLQGSGISPYRNECSQ---HEEKGFLGIPEKAKN  365



>emb|CDX90178.1| BnaA08g18060D [Brassica napus]
Length=509

 Score = 97.8 bits (242),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 156/624 (25%), Positives = 255/624 (41%), Gaps = 158/624 (25%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVN-RKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             M + KLNL  P++S RR+         V+ R+N      +      P+ VP  D  L   
Sbjct  1     MAERKLNLEAPLLSTRRMQKT----SAVSVRRNKTFDFTHDDTSSVPVLVP--DMGLDHF  54

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
             T+  +VPF WEQAPG+ +G +    +    P     LPPG+  D                
Sbjct  55    TESASVPFTWEQAPGRLKGNDSTTTHEVFTPC----LPPGKAID----------------  94

Query  1867  RFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDLSGC  1688
                      +N ++    + E    +  F     D+R+  +P   +S S+N SI  +SG 
Sbjct  95    ---------RNLSSKTKQVDEEEESEDVFS----DARDTLSPK--DSFSVNQSISGVSG-  138

Query  1687  QGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAAV------------------------  1586
              G+ V E +  + P  D  SRDFM++RFLPAAKA                          
Sbjct  139   YGV-VAEMKKTLNPCEDPQSRDFMLNRFLPAAKAMTVEQSHYALNRKPSSCMSEPTLQIR  197

Query  1585  -LVTEQPRLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPR  1409
              LV E+ R  + +K+Y+  ++     Y    + + E EE D+   +     R+   + P+
Sbjct  198   ELVPEEKR--QTSKRYDESLV--LPCYDHQYIDDEESEEGDDEVSEYAYLPRRGCGMLPQ  253

Query  1408  LSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYD  1229
             L  K SLG+LN  PG K+K      SS  +V +L             K+    +++ + D
Sbjct  254   LCFKESLGMLNTVPGFKTKRNDQVKSS--KVSQL-------------KSRFQSVKQLALD  298

Query  1228  AICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRF--SEGTGF  1055
             ++ KQ+  SG +   +  +  +   ++       SRS   SPYR+    S F  +  T F
Sbjct  299   SVSKQKL-SGKVQSPVHPSMGKKFNSESNLSCAASRSS--SPYRHPRCMSPFRTANTTCF  355

Query  1054  LGVPREAENLKGSMFSSFREVDTHLWDTPIKSS----FKGESDSPSDVVEKTVYVDSVNY  887
                 +E ENL+ +       ++ H+ +  I SS    +  ++ S S ++EK VYVD    
Sbjct  356   PDTRKETENLRAN------RLNKHIRN--ISSSQDLLYPKDNGSTSSLLEKAVYVD----  403

Query  886   VKTTSLDLCSSKPEGLMDPEEFKDLPERTSSN--PNQEPNQKRGSSTSRSSRENFKPDYR  713
                  ++    KP+  ++ E+F+++  ++  +  P   P+ K+ S               
Sbjct  404   -----MEEAEKKPDTNLEHEDFENISIKSGKDRSPLAPPSPKKPS---------------  443

Query  712   SYSDVTsslspypplpkspSESWLWRTLPS----IPSRGGH-NDQTNQSPRATNTATKRE  548
                                 ESWLW  LPS    I SRG   N Q         + +K E
Sbjct  444   --------------------ESWLWHNLPSVNSQIHSRGYRFNPQKQDVSENFRSVSKWE  483

Query  547   ITVSSCSEHHCNSYYTEELIPYGS  476
               V +   H  +  ++EEL+ + S
Sbjct  484   TIVKTSYMHRDHIRFSEELVAHTS  507



>ref|XP_009370525.1| PREDICTED: uncharacterized protein LOC103959880 [Pyrus x bretschneideri]
Length=727

 Score = 98.6 bits (244),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 123/446 (28%), Positives = 179/446 (40%), Gaps = 73/446 (16%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +L+L+ P++SVRR +      E  +++  +   P        L   KS+ +   V
Sbjct  5     MMEEKQLDLNQPLLSVRRFSPTAVTSEADDKRKTDKSIPKLPP----LPFYKSELKSGPV  60

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPD---------SRRFYSC  1895
               P  VPF WE+ PG+ + E   +    E P T PRLPPGR  +         S+R  + 
Sbjct  61    GHPGTVPFVWEKVPGRPKDERNSQTRGLEQPPTTPRLPPGRVLNAKKQALDKCSKRTTTA  120

Query  1894  ERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESL  1724
             +         F              DSL E M  K   D E  D      PD L   ES 
Sbjct  121   QSSTGNVHSDFNNVSTFDTKEVTKCDSLKEGMDDKDIADSEDGDETYLDAPDTLSRSESF  180

Query  1723  SLNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVTEQPRL  1562
               NCSI  LSG  G        D KP G       +RDFMM RFLPAAKA V  T Q   
Sbjct  181   YYNCSISGLSGLDG-------PDAKPCGTFSTDPQTRDFMMGRFLPAAKAMVSDTPQYAT  233

Query  1561  VKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSVKTSLGL  1382
              K+    E  +          V +           + QH  ++      P  +V+   G 
Sbjct  234   RKQPVAREQAISQEQPRGMKKVASG----------VKQHPLNQYRPNDLPH-NVQDIAGG  282

Query  1381  LNPFPGMKSKTQTPASSSTNEVKRL-TRNAPSGPLNKARKAYSGPIEKQSY-------DA  1226
              +   GM+ + ++P SS    V RL  +++ +    +A+  +SG    Q         D 
Sbjct  283   KSENEGMRGQPRSPISS----VSRLRAKSSYASAYREAKNEHSGGDGHQEAGMPEDRNDL  338

Query  1225  ICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRFSEGTGFLGV  1046
              C+    S  +    C+      K DG   +   +   ISPYR         E  GFLG+
Sbjct  339   KCE----SNQIKISECQ------KLDGSPVYRRQQGSNISPYRK---ECFHHEEKGFLGL  385

Query  1045  PREAENLKGSMFS--------SFREV  992
             P +A+N + ++ S        +FRE+
Sbjct  386   PEKAKNSRDTISSGKYRKGHNNFREL  411



>ref|XP_006348878.1| PREDICTED: uncharacterized protein LOC102602497 isoform X3 [Solanum 
tuberosum]
Length=593

 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 103/344 (30%), Positives = 144/344 (42%), Gaps = 60/344 (17%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME  +LNL  P +SVRR++  V        K   +        R      KS+ +   V
Sbjct  6     LMEDKQLNLDQPFLSVRRVSPTVTSGSDETMKTEYSLPTVTHPPRY-----KSELKSGPV  60

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRK----PDSRRFYSCERPCH  1880
               P  VPF WEQ+PGK + E+  ++   E P   PRLPPGRK     DS + +  +    
Sbjct  61    RNPGVVPFRWEQSPGKPKYESKRQIRATEKPPIAPRLPPGRKLKDNQDSDKAHESQNVSE  120

Query  1879  EDSFRFQTEPLALKN------HAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ES  1727
                   Q   L   N          +D   + +    + D E  D      P+ L   ES
Sbjct  121   SQIGNAQHSTLKYMNLDEKVKKIESIDCSKDMIQDMEKCDSEDADEVYMDAPNTLSRTES  180

Query  1726  LSLNCSIGDLSGCQGLDVEEGRDDVKPSGDS------RDFMMSRFLPAAKAAV-------  1586
               +NCS+   SG  GLD  E     KPSG S      RDFM+ RFLPAAKA         
Sbjct  181   FFVNCSV---SGLSGLDEPEA----KPSGTSLRDPQARDFMIDRFLPAAKAMASEKSLEM  233

Query  1585  ---------LVTEQPRLVKEAK--------KYEPYVMSYYSDYAGDVVTenedeendNMT  1457
                       V EQPR  K+          +Y P     YS +  +   E++D+   +  
Sbjct  234   PHYAPRKQPAVQEQPRQPKKVVNGDKRPQLRYGPSFALRYSQFHDNYEEESDDDSCYDGN  293

Query  1456  IDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSST  1325
             +       K   L PR  +K+S  L+NP PGM ++T+ P S ++
Sbjct  294   L-----PTKVCGLLPRFCLKSSFCLMNPVPGMSARTRVPMSPAS  332



>ref|XP_006348876.1| PREDICTED: uncharacterized protein LOC102602497 isoform X1 [Solanum 
tuberosum]
 ref|XP_006348877.1| PREDICTED: uncharacterized protein LOC102602497 isoform X2 [Solanum 
tuberosum]
Length=594

 Score = 97.4 bits (241),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 103/344 (30%), Positives = 144/344 (42%), Gaps = 60/344 (17%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME  +LNL  P +SVRR++  V        K   +        R      KS+ +   V
Sbjct  6     LMEDKQLNLDQPFLSVRRVSPTVTSGSDETMKTEYSLPTVTHPPRY-----KSELKSGPV  60

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRK----PDSRRFYSCERPCH  1880
               P  VPF WEQ+PGK + E+  ++   E P   PRLPPGRK     DS + +  +    
Sbjct  61    RNPGVVPFRWEQSPGKPKYESKRQIRATEKPPIAPRLPPGRKLKDNQDSDKAHESQNVSE  120

Query  1879  EDSFRFQTEPLALKN------HAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ES  1727
                   Q   L   N          +D   + +    + D E  D      P+ L   ES
Sbjct  121   SQIGNAQHSTLKYMNLDEKVKKIESIDCSKDMIQDMEKCDSEDADEVYMDAPNTLSRTES  180

Query  1726  LSLNCSIGDLSGCQGLDVEEGRDDVKPSGDS------RDFMMSRFLPAAKAAV-------  1586
               +NCS+   SG  GLD  E     KPSG S      RDFM+ RFLPAAKA         
Sbjct  181   FFVNCSV---SGLSGLDEPEA----KPSGTSLRDPQARDFMIDRFLPAAKAMASEKSLEM  233

Query  1585  ---------LVTEQPRLVKEAK--------KYEPYVMSYYSDYAGDVVTenedeendNMT  1457
                       V EQPR  K+          +Y P     YS +  +   E++D+   +  
Sbjct  234   PHYAPRKQPAVQEQPRQPKKVVNGDKRPQLRYGPSFALRYSQFHDNYEEESDDDSCYDGN  293

Query  1456  IDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSST  1325
             +       K   L PR  +K+S  L+NP PGM ++T+ P S ++
Sbjct  294   L-----PTKVCGLLPRFCLKSSFCLMNPVPGMSARTRVPMSPAS  332



>gb|EYU30775.1| hypothetical protein MIMGU_mgv1a023439mg [Erythranthe guttata]
Length=537

 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 107/336 (32%), Positives = 149/336 (44%), Gaps = 51/336 (15%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINS-NVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             ME+ KLN + P +SVRR  S NV        K   N   +       L   KS+ +   +
Sbjct  1     MEEKKLNFNRPFLSVRRNYSPNVTPRTSDETKTTNNNSRSAASVIPQLPSHKSELKSGPI  60

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
               P AVPF WEQ PG+ + E   K    + P   P+LPPGR P     +     C++++ 
Sbjct  61    RNPGAVPFIWEQTPGQPKQETKPKTRNSDRPPLAPKLPPGRNPKPNNPHDI---CNDNNV  117

Query  1867  RFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSREC----TNPDVLESLS------L  1718
                     + N A   D++VE +    E + E  D +E     T  D L++LS      L
Sbjct  118   S------PITNDANRRDAIVEKLERSQEREDEEEDEKESCDSETYVDALDTLSRTESFFL  171

Query  1717  NCSIGDLSGCQGLDVE-EGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPRLVKEAKK-  1544
             NCS+  LSG   LDV+  GR    P    R+ MM RFLPAAKA  L  E P+  KEA+K 
Sbjct  172   NCSMSGLSGLDDLDVKPSGRFSTDPQA--RELMMDRFLPAAKAMTL--ETPQYNKEAQKQ  227

Query  1543  --------------------YEP---YVMSYYSDYAGDVVTenedeendNMTIDQHKWSR  1433
                                 ++P   Y  S+   Y     +E E EE ++      + + 
Sbjct  228   NAVQEQHQQQNQIKKIVNHQHKPSLRYGPSFAKRYLHYQESEEEQEEEESDDEYDQRANA  287

Query  1432  K-FWKLFPRLSVKTSL-GLLNPFPGMKSKTQTPASS  1331
                  L PR  +K+S  GLLNP P +  +T+ P SS
Sbjct  288   MGVCGLIPRFCLKSSFGGLLNPVPAISVRTRVPISS  323



>ref|XP_007132845.1| hypothetical protein PHAVU_011G129400g [Phaseolus vulgaris]
 ref|XP_007132846.1| hypothetical protein PHAVU_011G129400g [Phaseolus vulgaris]
 gb|ESW04839.1| hypothetical protein PHAVU_011G129400g [Phaseolus vulgaris]
 gb|ESW04840.1| hypothetical protein PHAVU_011G129400g [Phaseolus vulgaris]
Length=697

 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 141/504 (28%), Positives = 212/504 (42%), Gaps = 138/504 (27%)
 Frame = -1

Query  2230  VVMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSE  2051
              +ME+ +L+   P++SVRRI+S V   E  N++  +   P R      L   KSD +   
Sbjct  5     TLMEEKQLDFDQPLLSVRRISSTVAS-ENENKRKPDKAIPKRPP----LPFYKSDLKSGP  59

Query  2050  VTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDS  1871
             V+ P  VPF WE+ PG+ + E+  +      PS  P+LPPGR   + +  S + P     
Sbjct  60    VSNPGTVPFVWEKTPGRPKTESRIQTQAVGRPSIAPKLPPGRVLKADQQDSDKVPKLTSV  119

Query  1870  FRFQTE-PLALKNHAALMDSLV---ESMLGKGEFDVEGRDSRECTNPDVLESLS------  1721
              + +TE  ++   HAA +D+ V   ES     E +  G D+ + T  D L++LS      
Sbjct  120   SQSRTECSVSDSQHAASLDNKVTKDESPKEVIEKENSGSDNEDETYLDALDTLSRTESFF  179

Query  1720  LNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAV---------  1586
             ++CS+  LS       E    DV+PSG       +RDFM+ RFLPAAKA           
Sbjct  180   MSCSVSGLS-------EWDDQDVQPSGSFSTDQQARDFMIDRFLPAAKAMASETPSLQHH  232

Query  1585  ----LVT-EQPRLVKEA----------KKYEPYVMSYYSDYAGDVVTenedeendNMTID  1451
                 LVT +QP+L +E           +K++  +  Y  D     +   E E+  +   +
Sbjct  233   SRKPLVTLQQPKLGREVVTGPNSRPLNEKWQKVLPHYAQD-----IGREESEDESDDNDE  287

Query  1450  QHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKA  1271
                ++ K   LFPR        L+NP PG++ + + P+               SG  NK+
Sbjct  288   CENYAPKVCGLFPRFC------LINPVPGLRMEGRIPS---------------SGVQNKS  326

Query  1270  RKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNV  1091
               ++                              +R  K  G+  + G  S        +
Sbjct  327   TASH------------------------------RRTAKEHGRTANNGKMS--------L  348

Query  1090  TTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDS-----PSD  926
              + S F++     G    AEN K S+            D P +   K ES        S 
Sbjct  349   NSQSGFTKEKKDFGT---AENSKQSI------------DPPRRGCSKSESSQLESSCESP  393

Query  925   VVEKTVYVDSVNYVKTTSLDLCSS  854
             VVEKT+YVDSV+ VK  SL  CSS
Sbjct  394   VVEKTLYVDSVHKVK--SLSACSS  415



>ref|XP_009109678.1| PREDICTED: uncharacterized protein LOC103835287 [Brassica rapa]
Length=522

 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 162/627 (26%), Positives = 264/627 (42%), Gaps = 151/627 (24%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVN-RKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             M + KLNL  P++S RR+    +    V+ R+N             P+ VP  D  L   
Sbjct  1     MAERKLNLEAPLLSTRRM----QKTSAVSVRRNKTFDFTQDDTSSVPVLVP--DMGLDHF  54

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
             T+  +VPF WEQAPG+ +G +     P E     P LPPG+  D                
Sbjct  55    TESSSVPFTWEQAPGRLKGNDS--TTPQE--VFTPCLPPGKAIDRN--------------  96

Query  1867  RFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDLSGC  1688
                     L +    +D   E        DV   D+R+  +P   +S S+  SI  +SG 
Sbjct  97    --------LSSKTKQVDEEEEESE-----DVFS-DARDTLSPK--DSFSVKNSISGVSG-  139

Query  1687  QGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAAVL------VTEQP------------  1568
              G+ V E +  + P  D  SRDFM++RFLPAAKA  +      +  +P            
Sbjct  140   YGV-VTEMKKTLNPCEDPQSRDFMLNRFLPAAKAMTVEQSHYALNRKPSSCMSEPTLQIR  198

Query  1567  RLVKEAKKY------EPYVMSYY-SDYAGDVVTenedeendNMTIDQHKW-SRKFWKLFP  1412
              LV E K+       E  V+ YY   Y  D     E+   D+  + ++ +  R+   + P
Sbjct  199   ELVPEEKRQTFKRYDESLVLPYYDHQYIDD-----EESNEDDGEVSEYAYLPRRGCGMLP  253

Query  1411  RLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSY  1232
             +L  K SLG+LN  PG K+K +  +  S ++VK       S  +++ +  +   ++K + 
Sbjct  254   QLCFKESLGMLNTVPGFKTKHK--SFPSHDQVK-------SSKVSQLKSRFQS-VKKLAL  303

Query  1231  DAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRF--SEGTG  1058
              ++ KQ+  SG +   +  +  +   ++   P   SRS   SPYR+    S F  +  T 
Sbjct  304   VSVSKQKL-SGKVQSPVHPSIGKKFNSETNLPCSASRSS--SPYRHPRCMSPFRTANATC  360

Query  1057  FLGVPREAENLKGSMFSSFREVDTHLWDTPIKSS----FKGESDSPSDVVEKTVYVDSVN  890
             F    +E ENL+ +       ++ H+ +  I SS    +  ++ S S + EK VYV++  
Sbjct  361   FPDTRKETENLRAN------RLNKHIRN--ISSSQELLYSKDNGSTSSLSEKIVYVETNI  412

Query  889   YVKTTSLDL---CSSKPEGLMDPEEFKDLPERTSSN--PNQEPNQKRGSSTSRSSRENFK  725
               K+  +        KP+  ++ E+F+++  ++  +  P   P+ K+ S           
Sbjct  413   SPKSNVMIFPEEAEKKPDTNLELEDFENISIKSGKDRSPLAPPSPKKPS-----------  461

Query  724   PDYRSYSDVTsslspypplpkspSESWLWRTLPS----IPSRGGHNDQTNQSPRATNTAT  557
                                     ESWLW  LPS    IPSRG   +  NQ      + +
Sbjct  462   ------------------------ESWLWHNLPSVNSQIPSRGYRFNPQNQDV----SVS  493

Query  556   KREITVSSCSEHHCNSYYTEELIPYGS  476
             K E  V +   H  +  ++EEL+ + S
Sbjct  494   KWETIVKTSYMHRDHIRFSEELVAHTS  520



>gb|EPS57778.1| hypothetical protein M569_17039 [Genlisea aurea]
Length=613

 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 150/506 (30%), Positives = 214/506 (42%), Gaps = 96/506 (19%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             MEK KLNLS P++S RR +S ++  E      VEN  P RQ  R PL  P       +  
Sbjct  1     MEKRKLNLSAPLLSARRYSSPLKSGEMA----VENQPPIRQHPRAPLLEPH--WNFDDPL  54

Query  2044  KPVA----VPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKP----DSRRFYSCER  1889
             KP A    +PF WE +PG+ R ++  + Y   + S  P  P GR      +  R      
Sbjct  55    KPAAGGGGIPFQWELSPGRPR-DDLFRRYHSGEISKAPPPPVGRTSYFSGEVTRLTPARF  113

Query  1888  PCHEDS----FRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLS  1721
               H  S    ++ Q E  +  +HA L++ L +S+        EG DS   ++     +L 
Sbjct  114   SDHHHSSNSIYKPQVEAFSFNDHAHLVEKLNDSLNCD-----EGTDSETFSS-----ALD  163

Query  1720  LNCSIGDLSGCQGLDVEEGRDDVKPSGDS-------RDFMMSRFLPAAKAAVLVTEQ---  1571
             LN ++               +  KPSG S       RD MM+RFL AAKAAV+ T +   
Sbjct  164   LNYAVNG-------------NAKKPSGKSSSVDTQTRDLMMNRFLQAAKAAVVETPEFAP  210

Query  1570  PRLVKEAKKYEP---------YVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKL  1418
              +L K A K  P             +     G      +D+++        K S K W +
Sbjct  211   KKLPKPANKKPPNNAPSSSSYASPYHKQSGNGSEFESEDDDQDCKNNNTASKKSGKAWGI  270

Query  1417  FPRLSVKTSLGLLNPFPGMKSKTQ--------TPASSSTNEVKRLTRNAPSGPLNKARKA  1262
              PR  VK +L LLNP PG+KS+          TP +++     R TRNA SGPL+K+   
Sbjct  271   LPRFCVKNTLCLLNPIPGIKSRMHLQHTTTPSTPTAAAAASAGRFTRNARSGPLDKS---  327

Query  1261  YSGPIEKQSYDAICKQRFRSGALSGELCKA---------DKRGLKAD-------GQYPHG  1130
                P+    +    K++F SG LS +L K          D+R L          G  P  
Sbjct  328   -GFPL----FPEPQKKKFYSGLLSRDLLKNESKLTAEDRDRRHLANSQDSFFRAGLSPLR  382

Query  1129  GSRSGAISPYRNVTTSSRFSE--GTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSS  956
               RSG  SP+RN    S FS             + +   +  +S R++   L +     +
Sbjct  383   RYRSGNPSPHRNDLPKSSFSGPLNESASAENSNSNSNASNKIASSRKLFNALNNVSRNHT  442

Query  955   FKGESDSPSDVVEKTVYVDSVNYVKT  878
             + G      D VEKTVY+D  +Y K 
Sbjct  443   YVGGGGG-GDAVEKTVYIDKCSYNKN  467



>emb|CDY43328.1| BnaC03g59000D [Brassica napus]
Length=511

 Score = 95.9 bits (237),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 157/624 (25%), Positives = 252/624 (40%), Gaps = 156/624 (25%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVN-RKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             M + KLNL  P++S RR+         V+ R+N      +      P  +P  D  L   
Sbjct  1     MAERKLNLEAPLLSTRRMQKT----SSVSVRRNKTFDFTHDDTSSVPALIP--DMGLDHF  54

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
             T   +VPF WEQAPGK +G +     P E     P LPPG+  D                
Sbjct  55    TDSASVPFTWEQAPGKLKGNDS--TTPQE--VFTPCLPPGKAIDRN--------------  96

Query  1867  RFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDLSGC  1688
                     L +    +D   E        DV   D+R+  +P   +S S+N SI  +SG 
Sbjct  97    --------LSSKTKQVDEEEEESE-----DVFS-DARDTLSPK--DSFSVNHSISGVSG-  139

Query  1687  QGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAAV------------------------  1586
              G+ V E +  + PS D  SRDFM++RFLPAAKA                          
Sbjct  140   YGVVVAEKKKTLNPSEDPQSRDFMLNRFLPAAKAMTVEQSHYALNRKPSTCMSEPTLQIR  199

Query  1585  -LVTEQPRLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPR  1409
              LV E+ R  + +K+Y+  ++    D+ G  +   E +E+D    +     R+   + P+
Sbjct  200   ELVPEEKR--QTSKRYDESIVLPCYDHQG--IDGEESDEDDGEVSEYAYLPRRGCGMLPQ  255

Query  1408  LSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYD  1229
             L  K SLG+LN  PG K+K      SS  +V +L             K+    +++ + D
Sbjct  256   LCFKESLGMLNTVPGFKTKRNDQVKSS--KVSQL-------------KSRFQSVKQLALD  300

Query  1228  AICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRF--SEGTGF  1055
             ++ K +  SG +   +  +  +   ++       SRS   SPYR+    S F  +  T F
Sbjct  301   SVSKHKL-SGKVQSPVHPSMGKKFNSESNLTCAASRSS--SPYRHPRCMSPFRTANATCF  357

Query  1054  LGVPREAENLKGSMFSSFREVDTHLWDTPIKSS----FKGESDSPSDVVEKTVYVDSVNY  887
                 +E ENL+ +       ++ H+ +  I SS    +  ++ S S ++EK VYVD    
Sbjct  358   HDTRKETENLRAN------RLNKHIRN--ISSSQELLYSKDNGSTSSLLEKAVYVD----  405

Query  886   VKTTSLDLCSSKPEGLMDPEEFKDLPERTSSN--PNQEPNQKRGSSTSRSSRENFKPDYR  713
                  ++    K +  ++ E+F+++  ++  +  P   P+ K+ S               
Sbjct  406   -----IEEAEKKQDTNLELEDFENISIKSGKDRSPLAPPSPKKPS---------------  445

Query  712   SYSDVTsslspypplpkspSESWLWRTLPSIPS-----RGGHNDQTNQSPRATNTATKRE  548
                                 ESWLW  LPS+ S     R   + Q       T   +K E
Sbjct  446   --------------------ESWLWHNLPSVTSQIPSRRYPFHPQKESLNGNTRNVSKWE  485

Query  547   ITVSSCSEHHCNSYYTEELIPYGS  476
               V +   H  +  ++EEL+ + S
Sbjct  486   TIVKTSYMHRDHIRFSEELVAHTS  509



>ref|XP_010499440.1| PREDICTED: uncharacterized protein LOC104776958 [Camelina sativa]
 ref|XP_010499441.1| PREDICTED: uncharacterized protein LOC104776958 [Camelina sativa]
Length=580

 Score = 95.9 bits (237),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 152/581 (26%), Positives = 232/581 (40%), Gaps = 125/581 (22%)
 Frame = -1

Query  2038  VAVPFCWEQAPGKRRGENGGKVYPC-----EDPSTMPRLPPGRKPDSRRFYSCERPCHED  1874
              +VPF WEQAPG+ +G N  +   C     E+    P  PPG+  D             +
Sbjct  60    ASVPFTWEQAPGRLKG-NDFRPQVCDLTQEEEQVFKPCRPPGKAIDG------------N  106

Query  1873  SFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDLS  1694
               R Q    +LK          E  +          D+R+  +P   +S S N SI   S
Sbjct  107   MTRLQ----SLKGKQVEESEDDEDDVFS--------DARDTLSPK--DSFSFNNSI---S  149

Query  1693  GCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAAVLVTEQPR---------------  1565
             G  G  V E +  +K S D  SR+FM++RFLPAAKA  +  EQP                
Sbjct  150   GVSGYGVVETKKPLKSSEDNQSREFMLNRFLPAAKA--MTVEQPHYASNRKPSSFMPEPT  207

Query  1564  -----LVKEAKKYEP------YVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKL  1418
                  LV   K+  P       V SYY     D      ++E+D+   +    S++   +
Sbjct  208   IQIRELVPGEKQQTPNRYDESVVPSYYHHQDIDGEASENNDEDDDGGSEYAYLSKRGCGM  267

Query  1417  FPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQ  1238
             FP+L  K SL +LN  PG KSK  +P +S +++  + ++ A         K+    ++K 
Sbjct  268   FPQLCFKDSLTMLNTVPGFKSKHNSPVTSPSHDQVKSSKVA-------QLKSRFQSVKKL  320

Query  1237  SYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGA-------ISPYRNVTTSS  1079
             + D+  K +  SG +   +  +  +   ++       SRS +       +SP+R+   SS
Sbjct  321   ALDSFSKHKL-SGKVQSPVHSSTGKKFNSESNLLSPASRSSSPYRHTRCMSPFRSTGNSS  379

Query  1078  RFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSF--KGESDSPSDVVEKTVY  905
              F    GF    +E ENL+ +  S       H  +  +      +  + S S ++EKTVY
Sbjct  380   PF-HPVGFPETRKETENLRANRLSK------HTRNISLSQELLHRKSNGSISSLLEKTVY  432

Query  904   VDSVNYVKT----TSLDLCS-------SKPEGLMDPEEFKDLPERTSSNPNQEPNQKRGS  758
             VD+ N   T     S  + S       +KPE   D E F+++  R+      +  +K  S
Sbjct  433   VDTENDPMTEDQYNSNAMTSPEEADMGNKPEANHDLEAFENISIRSGEMVKGDELEKINS  492

Query  757   STSRSSRENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPSIPSRGGH------ND  596
              +  S      P   S                   ESWL   LPS+ +   H      N 
Sbjct  493   GSDWSLLAPPSPKKPS-------------------ESWLCHNLPSVAASQIHSRRYSFNI  533

Query  595   QTNQSPRATNTATKREITVSSCSEHHCNSYYTEELIPYGSH  473
             Q           TK E  V +   H  +S Y+EEL+ + SH
Sbjct  534   QKQDLTENYRNVTKWETIVKTSYMHRDHSRYSEELVAHSSH  574



>ref|XP_010549410.1| PREDICTED: uncharacterized protein LOC104820601 [Tarenaya hassleriana]
Length=617

 Score = 95.1 bits (235),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 157/654 (24%), Positives = 269/654 (41%), Gaps = 117/654 (18%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M + KLN + P++S RR  +    +    + + E+ + +    +  +C P  D  L  +T
Sbjct  1     MAERKLNFNAPLLSTRRSQTTAVSVRRTKKLSDEDFKRSEGSSKVAVCYP--DMALDPIT  58

Query  2044  KPVAVPFCWEQAPGKRRGEN-GGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
              P +VPF WEQ PG+ +G++   + +        PR PPG+  D  +    +    E++ 
Sbjct  59    DPASVPFTWEQEPGRLKGDSLRPETHDSMQDFVPPRNPPGKVMDLLKSPWGKDSDGENAV  118

Query  1867  RFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSL----NCSIG-  1703
             R            AL D++    + KG+  V+  D  +  +       +L    +CS G 
Sbjct  119   R-----------TALDDNVTRLQILKGK-QVQESDDDDDDDAFSDALDTLSPKESCSAGV  166

Query  1702  --DLSGCQGLDVEEGRDDVKPSG-DSRDFMMSRFLPAAKAAVLVTEQP------------  1568
                +SG  G  +E  +  +      +RDFM++RFLPAAKA  +  EQP            
Sbjct  167   NHSISGVSGYGIEMKKPPILAEDPQTRDFMLNRFLPAAKA--MTVEQPQYASKRQLSPVM  224

Query  1567  -------------RLVKEA---------KKYEPYVMSYYSDYAGDVVTenedeendNMTI  1454
                          R ++E           +YE  +  YY +   D     ++E+  +   
Sbjct  225   SEPTRQIRDIVPARQIREIVSAEKCRTPNRYESIIPPYYHEQVEDAEESEDEEDEVSEFA  284

Query  1453  DQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNK  1274
             +    S++     P+L  + SLG+L   PG+K K  +  +SS  +VK       +  +++
Sbjct  285   NSAYMSKRGCGFLPQLCFRNSLGMLKTVPGLKPKPDSLVTSSHRQVK-------ASKVSQ  337

Query  1273  ARKAYSGPIEKQSYDAICKQRFRSGA---LSGELCKADKRGLKADGQYPHGGSRS-----  1118
              +  +     K + D++ KQ+    A   +   + K   R  +  GQ     SRS     
Sbjct  338   LKSQFQ--TVKIALDSVYKQKSSDRAQSPMHPSVAKKFNRESEQLGQNLATASRSSSPYR  395

Query  1117  --GAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGE  944
               G +SPYR+   SS      GF G  +EAENL+ +  +   +  +   +     S +  
Sbjct  396   HAGCMSPYRSTANSSPL-HPMGFPGTRKEAENLRANRLNKHIKSISRSQELIYPKSARHG  454

Query  943   SDSPSDVVEKTVYVDSVNYVKTT---SLDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPN  773
               + S V EKT+Y+D+ N    +   +LD+     + L +PE  + + E           
Sbjct  455   CSTIS-VPEKTMYIDTGNSPIASNRQNLDI-----KMLPEPELVETVSEEVD--------  500

Query  772   QKRGSSTSRSSRENFKPDYRSYSDVTss------------lspypplpkspSESWLWRTL  629
                  ++ + S  N + D  S  ++                   PPLPK PSESWL R L
Sbjct  501   ----KTSGKKSDTNLELDAISSGEIVKVDGLGKIERGGEPSPLAPPLPKKPSESWLMRNL  556

Query  628   PSIPS-----RGGHNDQTNQSPRATNTATKREITVSSCSEHHCNSYYTEELIPY  482
             PS+ S     R     Q       +++ +K E  V +   H  +  Y+EEL+ +
Sbjct  557   PSVSSQISSRRSPFRPQRMNPEEKSSSVSKWETIVKTSYVHSDHIRYSEELVAH  610



>ref|XP_008448243.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Cucumis 
melo]
Length=805

 Score = 94.4 bits (233),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 135/517 (26%), Positives = 212/517 (41%), Gaps = 122/517 (24%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME  +L+ + P +SVRR++S    +E  +  N        + +  PL V KS+ +    
Sbjct  147   LMENNQLDFNQPFLSVRRVSS----METSSNAN---ETVRAENRWPPLPVYKSELKSGPS  199

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRR----------FYS  1898
               P  +PF WE APG+ +     +    +  S  P+  P   PDS++            S
Sbjct  200   RNPGNIPFLWEHAPGRPKDGRKSRTIDSKSTSAAPKHSPRVLPDSKQEQCNSQGSTSSNS  259

Query  1897  CERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ES  1727
                P HE+  +F+T           +   +E  L     D E  D       D L   ES
Sbjct  260   AHFPSHENMVKFKT-----------LSERIERDLS----DSEDEDETYLEANDTLSRSES  304

Query  1726  LSLNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVT----------  1577
              S+NCS+  LSG    DV +          +RD MM RFLPAAKA    T          
Sbjct  305   FSMNCSVTGLSGFDDSDV-KSTGTFSKDQQTRDLMMGRFLPAAKALASETPQVSLRKVSF  363

Query  1576  --EQPRLVKEAKKYE----------PYVMSYYS-----DYAGDVVTenedeendNMTIDQ  1448
               EQ R+ K+  + E          P + SY++     DY    V       + +M +D+
Sbjct  364   QREQQRVAKKLVEMEKQQRRVNSLPPMLPSYFAPLNTHDYDEISV-------DGDMNVDE  416

Query  1447  HKWSR-KFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSG--PLN  1277
              ++S  K   LF R  ++ S  LL+P PGMK++  + AS+   +   LT ++ S    L 
Sbjct  417   SEYSSTKPCGLFARFCLRNSFCLLHPLPGMKTQGSSVASAQRVKNDNLTDSSCSSIKNLQ  476

Query  1276  KARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYR  1097
                KA       + ++    +R          C+++++    D +             Y+
Sbjct  477   NENKALDKNQMVELHEESTVRR----------CQSNRKSTSNDFK-----------KQYK  515

Query  1096  NVTTSSRFSEGTGFLGVPREAENLK---------GSMFSSFREVDTHLWDTPIKSSFKGE  944
             ++       EG  F   P + E +K         GS  + FRE+   L + P        
Sbjct  516   DL-----LFEGKAF---PNDLERVKSSKVHNEPHGSGRTKFREL---LANEP--------  556

Query  943   SDSPSDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMD  833
             S   S VVEKT++VDSV  +K+ SL+  S+  +G  D
Sbjct  557   SSLSSFVVEKTLHVDSVRSIKSQSLNSSSADTKGTTD  593



>ref|XP_004505483.1| PREDICTED: uncharacterized protein LOC101506881 isoform X1 [Cicer 
arietinum]
 ref|XP_004505484.1| PREDICTED: uncharacterized protein LOC101506881 isoform X2 [Cicer 
arietinum]
 ref|XP_004505485.1| PREDICTED: uncharacterized protein LOC101506881 isoform X3 [Cicer 
arietinum]
Length=710

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 146/330 (44%), Gaps = 58/330 (18%)
 Frame = -1

Query  2230  VVMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSE  2051
              +ME+ +LN + P +SVRR +S +   E  N++  + P   R      L   KSD +   
Sbjct  5     TLMEEKQLNFNQPFLSVRRFSS-IADSEDDNKRKTDKPSAKRSS----LPAYKSDLKSGP  59

Query  2050  VTKPVAVPFCWEQAPGKRRGENG-GKVYPCEDPSTMPRLPPGR--KPDSRRF------YS  1898
             V+ P  VPF WE+ PG+ + ++   + +P E     P+LPPGR  K + + F       S
Sbjct  60    VSNPGTVPFVWEKTPGRPKNDSKLQQTWPVEGLHIAPKLPPGRVLKVELQDFEKVTKGAS  119

Query  1897  CERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ES  1727
               +   E +  +     +L +  A  +   E +L KG    +  D       D L   ES
Sbjct  120   VTQSRTESTVSYSPSVASLDSKEANHERRKEVILEKGSSCSDDEDETYLDARDTLSRTES  179

Query  1726  LSLNCSIGDLSGCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAA------------  1589
               +NCS+   SG  G D +E R     S D  +RDFM+ RFLPAAKA             
Sbjct  180   FFMNCSV---SGMSGWDDQEVRPSENFSADQQARDFMIGRFLPAAKAMASETPHMQYPSR  236

Query  1588  ---VLVTEQPRLVKEA----------KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQ  1448
                V   EQPR V++A          +K++  +  Y  D + DV      ++  ++    
Sbjct  237   KPFVRQVEQPRQVRKAESGAKSHPLDQKWQKVLPHYAQDTSWDV-----SDDESDVNDRY  291

Query  1447  HKWSRKFWKLFPRLSVKTSLGLLNPFPGMK  1358
               ++ K   LFPR        LLNP PG++
Sbjct  292   ESYAPKICGLFPRFC------LLNPLPGLR  315



>ref|XP_010323685.1| PREDICTED: uncharacterized protein LOC101245858 isoform X2 [Solanum 
lycopersicum]
Length=591

 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 102/344 (30%), Positives = 148/344 (43%), Gaps = 60/344 (17%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME  +LNL  P +SVRR +  V       +K   +        R      KS+ +   V
Sbjct  6     LMEDKQLNLDQPFLSVRRASPTVASGSDETKKTEYSLPSVTHPPRY-----KSELKSGPV  60

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRK----PDSRRFYSCERPCH  1880
               P  VPF WEQ+PGK + E+  ++   E P   PRLPPGRK     DS + +  +    
Sbjct  61    RNPGVVPFRWEQSPGKPKYESKRQIRATEKPPIAPRLPPGRKLKDIQDSDKAHESQNVSE  120

Query  1879  E---DSFRFQTEPLALKNHAALMDSL--VESMLGKGE-FDVEGRDSRECTNPDVL---ES  1727
                 ++  F    + L      ++S+   + M+   E  D E  D       + L   ES
Sbjct  121   SQTGNAQHFTPSCMNLDEKVKKIESIDCSKDMIQDMEKCDSEDADEVYLDASNTLSRTES  180

Query  1726  LSLNCSIGDLSGCQGLDVEEGRDDVKPSGDS------RDFMMSRFLPAAKAAV-------  1586
               +NCS+   SG  GLD  E     K SG S      RDFM+ RFLPAAKA         
Sbjct  181   FFVNCSV---SGLSGLDEPEA----KLSGTSLRDPQARDFMIDRFLPAAKAMASEKSLET  233

Query  1585  ---------LVTEQPRLVKEA--------KKYEPYVMSYYSDYAGDVVTenedeendNMT  1457
                       V EQPR +K+          +Y P     YS +  +   E++D+   +  
Sbjct  234   PQYAPRKQPAVQEQPRQLKKVLNGDKRPQLRYGPSFALRYSQFHDNYEEESDDDSCYDGN  293

Query  1456  IDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSST  1325
             +       K   L PR  +K+S  L+NP PGM ++T+ P S ++
Sbjct  294   L-----PTKVCGLLPRFCLKSSFCLMNPIPGMSARTRVPMSPAS  332



>ref|XP_004505486.1| PREDICTED: uncharacterized protein LOC101506881 isoform X4 [Cicer 
arietinum]
Length=682

 Score = 92.8 bits (229),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 146/330 (44%), Gaps = 58/330 (18%)
 Frame = -1

Query  2230  VVMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSE  2051
              +ME+ +LN + P +SVRR +S +   E  N++  + P   R      L   KSD +   
Sbjct  5     TLMEEKQLNFNQPFLSVRRFSS-IADSEDDNKRKTDKPSAKRSS----LPAYKSDLKSGP  59

Query  2050  VTKPVAVPFCWEQAPGKRRGENG-GKVYPCEDPSTMPRLPPGR--KPDSRRF------YS  1898
             V+ P  VPF WE+ PG+ + ++   + +P E     P+LPPGR  K + + F       S
Sbjct  60    VSNPGTVPFVWEKTPGRPKNDSKLQQTWPVEGLHIAPKLPPGRVLKVELQDFEKVTKGAS  119

Query  1897  CERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ES  1727
               +   E +  +     +L +  A  +   E +L KG    +  D       D L   ES
Sbjct  120   VTQSRTESTVSYSPSVASLDSKEANHERRKEVILEKGSSCSDDEDETYLDARDTLSRTES  179

Query  1726  LSLNCSIGDLSGCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAA------------  1589
               +NCS+   SG  G D +E R     S D  +RDFM+ RFLPAAKA             
Sbjct  180   FFMNCSV---SGMSGWDDQEVRPSENFSADQQARDFMIGRFLPAAKAMASETPHMQYPSR  236

Query  1588  ---VLVTEQPRLVKEA----------KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQ  1448
                V   EQPR V++A          +K++  +  Y  D + DV      ++  ++    
Sbjct  237   KPFVRQVEQPRQVRKAESGAKSHPLDQKWQKVLPHYAQDTSWDV-----SDDESDVNDRY  291

Query  1447  HKWSRKFWKLFPRLSVKTSLGLLNPFPGMK  1358
               ++ K   LFPR        LLNP PG++
Sbjct  292   ESYAPKICGLFPRFC------LLNPLPGLR  315



>ref|XP_004303187.1| PREDICTED: uncharacterized protein LOC101308888 [Fragaria vesca 
subsp. vesca]
Length=726

 Score = 92.8 bits (229),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 135/508 (27%), Positives = 214/508 (42%), Gaps = 71/508 (14%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ +LN + P++SVRR ++     E  +++         Q +  PL   KS+ +   V 
Sbjct  1     MEENQLNFNRPLLSVRRYSATTVSSEADDKRKT----AKSQPKLPPLPAYKSELKSGPVR  56

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
              P  VPF WEQ PG+ + E+  K +  E     PRLPPGR    ++    +      + +
Sbjct  57    NPGTVPFIWEQIPGRPKDESIPKNHALEGSQVAPRLPPGRVSKVKKQGLDKGSKGTTAAQ  116

Query  1864  FQTEPLALKNHA-ALMDSLVE-----SMLGKGEFDVEGRDSRECTNPDVL---ESLSLNC  1712
              Q   +   +H  + M+  V+     S   KGE    G ++ + T  D L   ES  +NC
Sbjct  117   SQNGNILSSSHTISAMERKVDIKEETSKERKGERT--GSENGDETYLDALSRTESAYMNC  174

Query  1711  SIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVTEQPRLVKEA  1550
             S+  LSG  G        D+ P G       +RDFMM RFLPAAKA  + +E P     A
Sbjct  175   SVSGLSGLDG-------PDIIPCGTFSTDPQTRDFMMGRFLPAAKA--MASETPH---NA  222

Query  1549  KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSVKTSLGLLNPF  1370
              +  P            +  E        MT D+   S ++  ++    ++         
Sbjct  223   PRKHPVAREQ------PISREEPRRVKKIMTGDKQHQSNQYRPVY----IQDIAQEARED  272

Query  1369  PGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYDAICKQRFRSGALS  1190
              GM+   Q P  S     + L  ++ +G   +A   + G         + ++R  S    
Sbjct  273   EGMRMPVQLPIYSV---CRVLGNSSYAGSHTEAENKHGGT-------GVYRERLISRDQE  322

Query  1189  GELCKAD---KR----------GLKADGQYPHGGSRSGAISPYRNVTTSSRFSEGTGFLG  1049
               L + +   KR          GL  DG   +   +   ISPYR   + S   +G  FLG
Sbjct  323   AGLHEDNIDLKRESDQISNRSDGLPLDGSSVNRRLQGSGISPYRRECSQSILHDGKCFLG  382

Query  1048  VPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVDSVNYVKTTSL  869
             +P +A+  K +  S          +     + + E+   S VVEKT+YVDSV  VK++S 
Sbjct  383   IPEKAKRSKETSSSDKYRKGCRFLERLSSENAEWEARIGSPVVEKTLYVDSVQTVKSSSS  442

Query  868   DL----CSSKPEGLMDPEEFK-DLPERT  800
             +        + +GL+D +    D+PER+
Sbjct  443   NSFFSDIKGEIKGLIDYKRNDLDIPERS  470



>gb|KGN46972.1| hypothetical protein Csa_6G154530 [Cucumis sativus]
Length=658

 Score = 92.4 bits (228),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 137/499 (27%), Positives = 211/499 (42%), Gaps = 128/499 (26%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  +L+ + P +SVRR++S    +E  +  N        + +  PL V KS      + 
Sbjct  1     MENKQLDFNQPFLSVRRVSS----METPSDAN---GTVRTENRWPPLPVYKSKLISGSLR  53

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCER--------  1889
              P  VPF WE APG+ +     +   C+  S  P+  PG  PDS++ Y C+R        
Sbjct  54    NPGNVPFLWEHAPGRPKDGRKSRTIDCKSTSAAPKHSPGMFPDSKQEY-CKRQGSTSSNS  112

Query  1888  ---PCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSL  1718
                P H++  +F+T  L  +    L DS  E      E  +E  D+   +     ES S+
Sbjct  113   AHFPSHKNMVKFKT--LRERIERDLSDSEDEE-----ENYLEANDTLSRS-----ESFSM  160

Query  1717  NCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVT-------  1577
             NCS+  LSG     +++G  DVK +G       +RDFMM RFLPAAKA    T       
Sbjct  161   NCSVTGLSG-----LDDG--DVKSTGSFSKDHQTRDFMMGRFLPAAKALASETPQVSLRK  213

Query  1576  -----EQPRLVKEAKKYE---------PYVM-SYYS-----DYAGDVVTenedeendNMT  1457
                  EQ R+ K+  + E         P  + SY++     DY    V       + +M 
Sbjct  214   PSFQREQQRVAKKLVEMEKQQRRVNSLPTTLPSYFAPPNTHDYDEISV-------DGDMN  266

Query  1456  IDQHKWSR-KFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPL  1280
             +D+ ++S  K    F R  +  S  LL+P PGM+    T  SS T+              
Sbjct  267   VDESEYSSTKSCGFFARFCLSDSFCLLHPLPGMR----TQGSSVTS--------------  308

Query  1279  NKARKAYSGPIEKQSYDAICKQRFRSGALSG-ELCKADKRGLKADGQYPHGGSRSGAISP  1103
               A++  +  +  +S  +I   +    +L+G ++ +  +      GQ     + +     
Sbjct  309   --AQRVQNDNLTDRSCGSIKNLQNEKKSLNGNQMVELHEESTVLSGQSNRKSTSNDLKKQ  366

Query  1102  YRNVTTSSRFSEGTGFLGVPREAENLK---------GSMFSSFREVDTHLWDTPIKSSFK  950
             Y+N+       EG     VP + E +K         GS  + FRE+   L + P      
Sbjct  367   YKNL-----LFEGKA---VPNDPERVKSSKVHIEPHGSGRTKFREL---LANEP------  409

Query  949   GESDSPSDVVEKTVYVDSV  893
               S   S VVEKT++VDSV
Sbjct  410   --SSVSSFVVEKTLHVDSV  426



>ref|XP_004243280.1| PREDICTED: uncharacterized protein LOC101245858 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010323682.1| PREDICTED: uncharacterized protein LOC101245858 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010323683.1| PREDICTED: uncharacterized protein LOC101245858 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010323684.1| PREDICTED: uncharacterized protein LOC101245858 isoform X1 [Solanum 
lycopersicum]
Length=592

 Score = 92.0 bits (227),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 102/344 (30%), Positives = 148/344 (43%), Gaps = 60/344 (17%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME  +LNL  P +SVRR +  V       +K   +        R      KS+ +   V
Sbjct  6     LMEDKQLNLDQPFLSVRRASPTVASGSDETKKTEYSLPSVTHPPRY-----KSELKSGPV  60

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRK----PDSRRFYSCERPCH  1880
               P  VPF WEQ+PGK + E+  ++   E P   PRLPPGRK     DS + +  +    
Sbjct  61    RNPGVVPFRWEQSPGKPKYESKRQIRATEKPPIAPRLPPGRKLKDIQDSDKAHESQNVSE  120

Query  1879  E---DSFRFQTEPLALKNHAALMDSL--VESMLGKGE-FDVEGRDSRECTNPDVL---ES  1727
                 ++  F    + L      ++S+   + M+   E  D E  D       + L   ES
Sbjct  121   SQTGNAQHFTPSCMNLDEKVKKIESIDCSKDMIQDMEKCDSEDADEVYLDASNTLSRTES  180

Query  1726  LSLNCSIGDLSGCQGLDVEEGRDDVKPSGDS------RDFMMSRFLPAAKAAV-------  1586
               +NCS+   SG  GLD  E     K SG S      RDFM+ RFLPAAKA         
Sbjct  181   FFVNCSV---SGLSGLDEPEA----KLSGTSLRDPQARDFMIDRFLPAAKAMASEKSLET  233

Query  1585  ---------LVTEQPRLVKEA--------KKYEPYVMSYYSDYAGDVVTenedeendNMT  1457
                       V EQPR +K+          +Y P     YS +  +   E++D+   +  
Sbjct  234   PQYAPRKQPAVQEQPRQLKKVLNGDKRPQLRYGPSFALRYSQFHDNYEEESDDDSCYDGN  293

Query  1456  IDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSST  1325
             +       K   L PR  +K+S  L+NP PGM ++T+ P S ++
Sbjct  294   L-----PTKVCGLLPRFCLKSSFCLMNPIPGMSARTRVPMSPAS  332



>gb|EPS64531.1| hypothetical protein M569_10250, partial [Genlisea aurea]
Length=297

 Score = 89.4 bits (220),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 100/322 (31%), Positives = 143/322 (44%), Gaps = 68/322 (21%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             MEK +LNL+ P++S RR++S V  +E   ++  +    ++          +SD  L +  
Sbjct  1     MEKRQLNLNAPLLSTRRLSSPVEVIEKYIQRPPKPGNASKW---------ESDFLLKKPA  51

Query  2044  KPVAVPFCWEQAPGKRR---GENGGK-----VYPCEDPSTMPRLPPGRKPDSRRFYSCER  1889
                 +PF WEQ+PG+ +   G   G        P    S +PRL PGR     R  S  +
Sbjct  52    AAGGIPFHWEQSPGRPKDGIGTPAGNSKLDAFRPYH--SVVPRLLPGRFSSDERIQSSCK  109

Query  1888  PCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCS  1709
             P        Q E L+   HA L+  L ES+    E    G +S   T  D L+ LS   S
Sbjct  110   P--------QVESLSFSEHANLVQKLNESLNCDEE---TGSESEHDTYSDALDMLSPRES  158

Query  1708  IGDLSGCQGLDVEEGRDDVKPS-----GDSRDFMMSRFLPAAKAAVLVT-----------  1577
              G  S             VKP+       +RD MM+RFL AAKAAV+ T           
Sbjct  159   GGSHSS----------PVVKPNKPCLDTQARDLMMNRFLRAAKAAVVETPGYAVKKCACV  208

Query  1576  --EQPRLVKEAKKYE-----PYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKL  1418
               + P+ V++A  Y      P V   Y  +  +  +EN+ +    +     K SRK W +
Sbjct  209   NNKLPKPVEKAVVYRETTPIPNVSYGYHHHTNEAESENDQDCKSTV-----KKSRKAWSI  263

Query  1417  FPRLSVKTSLGLLNPFPGMKSK  1352
              PRL VK +L LLNP  G+KS+
Sbjct  264   LPRLCVKNALRLLNPLSGIKSR  285



>ref|XP_009603490.1| PREDICTED: uncharacterized protein LOC104098459 [Nicotiana tomentosiformis]
 ref|XP_009603491.1| PREDICTED: uncharacterized protein LOC104098459 [Nicotiana tomentosiformis]
 ref|XP_009603493.1| PREDICTED: uncharacterized protein LOC104098459 [Nicotiana tomentosiformis]
Length=638

 Score = 92.0 bits (227),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 100/339 (29%), Positives = 144/339 (42%), Gaps = 51/339 (15%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  +LNLS P +SVRR++          +K   +        R      KS+ +   V 
Sbjct  7     MEDKQLNLSQPFLSVRRVSPTSASGRDETKKTEYSLPTVTHPPRY-----KSELKSGPVR  61

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRK-------PDSRRFYSCERP  1886
              P  VPF WEQ+PGK + E+  ++   + P   PRLPPGRK        ++R   +  + 
Sbjct  62    NPGVVPFLWEQSPGKPKYESKRQIRASDKPPIAPRLPPGRKLKDNQDSDNARESQNVSKG  121

Query  1885  CHEDSFRFQTEPLALKNHAALMDSL-VESMLGKGEFDVEGRDSREC--TNPDVL---ESL  1724
                ++       + L      +DS+     + + +   E  D  E     PD L   ES 
Sbjct  122   QIGNAQHSSPSCMNLDEKMKKIDSIDCSKEIKQDKEKSESGDGDEAYMDAPDKLSRTESF  181

Query  1723  SLNCSIGDLSGCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAAV------------  1586
              LNCSI   SG  GLD  E +       D  +RDFM+ RFLPAAKA              
Sbjct  182   FLNCSI---SGLSGLDEPEAKPFSTSLTDPQTRDFMIDRFLPAAKAMASEKTLEMPHYAP  238

Query  1585  ----LVTEQPRLVKEAK--------KYEPYVMSYYSDYAGDVVTenedeendNMTIDQHK  1442
                  V EQPR +K+          +Y P     YS +  +   E  D+++ +       
Sbjct  239   RKQPAVQEQPRQLKKVVNGDKRPQLRYGPSFARRYSQFHDNGEEEESDDDSYDDG----N  294

Query  1441  WSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSST  1325
                K   L PR  +K+S  LLNP PGM  +T+ P S ++
Sbjct  295   LPYKVCGLLPRFCLKSSFCLLNPVPGMSVRTRVPISPAS  333



>ref|XP_011083000.1| PREDICTED: uncharacterized protein LOC105165626 [Sesamum indicum]
 ref|XP_011083001.1| PREDICTED: uncharacterized protein LOC105165626 [Sesamum indicum]
 ref|XP_011083002.1| PREDICTED: uncharacterized protein LOC105165626 [Sesamum indicum]
Length=630

 Score = 91.7 bits (226),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 144/491 (29%), Positives = 214/491 (44%), Gaps = 91/491 (19%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSE-  2051
             +ME  KLNL+ P++SVRR +S + + + ++ + V++ +P   +      +P    EL   
Sbjct  6     LMEDKKLNLNQPLLSVRR-HSTMSNTQKLDERKVDSARPVMGR------IPHYRSELKSG  58

Query  2050  -VTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSR-RFYSCERPCHE  1877
              V KP AVPF WEQAPG+ + E   +   C  P   PRLPPGR P +  R  S   P   
Sbjct  59    PVGKPGAVPFQWEQAPGRPKEEIKAQTRNCSKPLISPRLPPGRCPKANSRLVS---PSTN  115

Query  1876  DSFRFQTEPLALKNHAALMDSLVESMLGKG---EFDVEGR--DSRECTNP--DVLESLS-  1721
             D+ + Q   +   +  AL  SL ES+ G G   E   EG+  DS +C     D L++LS 
Sbjct  116   DN-KIQDVNIHCDSLIAL--SLDESIKGFGSSRETIEEGKSSDSGDCGEAYVDALDTLSR  172

Query  1720  -----LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFM-----MSRFLPAAKAAV-----  1586
                  LNCS   L+G   LD        K SG    F+       +FLPA K        
Sbjct  173   TGSFSLNCSTSGLTGMDDLDA-------KTSGI---FLTDPQTQDKFLPAVKGVSKTPQY  222

Query  1585  ------LVTEQP----RLVKE---AKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQH  1445
                   +V +QP    ++VK+   A ++ P     YS +    + +  +EE  N    QH
Sbjct  223   APQKQSIVDKQPQQFKKIVKQDESAIQHGPSFAKLYSHHQN--IKDEAEEEESNDDCHQH  280

Query  1444  KWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARK  1265
                     L PRL + +S+ +LNP   M   T+           R++R     P + +  
Sbjct  281   GNLSAVCCLLPRLCLNSSVCILNPVTAMSMTTRL----------RISRANRIRPTSSSAG  330

Query  1264  AYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTT  1085
             +Y+   ++      CK         G+L  A+ +  K   +   G   S     Y +   
Sbjct  331   SYAKTEDQ------CKSNISEIKPVGKLRTAELKENKTSVKSESGQLESHNTLAYCDEPL  384

Query  1084  SSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVY  905
             S  F E T   G  +  E+ + S F +F+E+   L D         E +S   VVEKTVY
Sbjct  385   S--FLEDTKHTGT-QGYESCEKS-FRTFKEL---LAD----EGSPKELESGGGVVEKTVY  433

Query  904   VDSVNYVKTTS  872
             VD+V  V+  S
Sbjct  434   VDTVQDVEDMS  444



>ref|XP_004137030.1| PREDICTED: uncharacterized protein LOC101218044 [Cucumis sativus]
 ref|XP_004155516.1| PREDICTED: uncharacterized LOC101218044 [Cucumis sativus]
 gb|KGN43630.1| hypothetical protein Csa_7G048630 [Cucumis sativus]
Length=717

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 106/359 (30%), Positives = 162/359 (45%), Gaps = 61/359 (17%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +L+ + P++SVRR  S     E   +   E+  P        L V KS+ +   V
Sbjct  7     LMEEKQLDFNQPLLSVRRFTSTETSFETNEKTRPESKIPP-------LPVYKSELKSGPV  59

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR-KPDSRRFYSCERPCHEDS  1871
               P  VPF WE+ PGK + E+      C+ P  +P+LPPGR +  ++  ++      +++
Sbjct  60    RIPGTVPFLWERTPGKPKDESSTNTQICKRPPLVPKLPPGRVQKVNQEVHTSVNASLDEN  119

Query  1870  FRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDLSG  1691
              R + E +     +   D   E  + +   D   R SR        ES  LNCSI   SG
Sbjct  120   AREEVEEMT-SCKSGNDDEEEEEEVYR---DANDRFSRS-------ESFFLNCSI---SG  165

Query  1690  CQGLDVEEGRDDVKPSGDS------RDFMMSRFLPAAKA------------AVLVTEQPR  1565
               GLD  E    +KPS  S      RDFMM RFLPAAKA              + TE+PR
Sbjct  166   VSGLDDSE----IKPSEASSMDPHTRDFMMDRFLPAAKAMASETPPHTIRKQTVSTERPR  221

Query  1564  ---LVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSVKT  1394
                LV    +     +   + +  ++  E  D+E+D+     +  S +     PR  +K 
Sbjct  222   EVKLVTNRDRQSRPNLHVQTKHVKEIFMEESDDEDDDYDESGYS-STQGCGFLPRFCLKG  280

Query  1393  SLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSG----PLNKARKAYSGPIEKQSYD  1229
             S GLLNP PGM+ +  +        V+R+ RN+  G     +N+ R+ +   I KQ  +
Sbjct  281   SFGLLNPVPGMRMQATS--------VRRI-RNSSIGCSKDAVNERRQIHGQGITKQQLE  330



>ref|XP_004251869.1| PREDICTED: uncharacterized protein LOC101253258 [Solanum lycopersicum]
Length=610

 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 94/336 (28%), Positives = 147/336 (44%), Gaps = 61/336 (18%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  +L  + P++SVRRI+  +     +++++ +    N           KS+     V 
Sbjct  1     MEGKQLKFNQPLLSVRRISPAM-----ISQRDEKKKFDNSFPTMTHPPHYKSELNSGLVV  55

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
             KP AVPF WEQ PG+ + E+  + +  E P T P+LPPGRK    + Y+        + +
Sbjct  56    KPGAVPFLWEQTPGRPKDESRPQTHFTEKPLTAPKLPPGRKLRDNQDYN-------QTGK  108

Query  1864  FQTEPLALKN------HAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLS------  1721
             +QT  L+  +           DS  E M  K +   E  D    T  D L++LS      
Sbjct  109   YQTAMLSCTSSDENVKKIESFDSSKEVMHDKEKIKSENDDE---TYLDALDALSRTESSF  165

Query  1720  LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAV--LVTEQPRLVKEAK  1547
             LNCS+  LS     + ++ R     +  ++DFMM RFLPAAKA      +E P  V++ +
Sbjct  166   LNCSVSGLSEFDEPNAKQSRTS-SANPQTKDFMMGRFLPAAKAMTSDKTSETPYYVRKKQ  224

Query  1546  ----------------------KYEPYVMSYYS---DYAGDVVTenedeendNMTIDQHK  1442
                                   +Y P    Y+S   DY  +      +EE+D+   +   
Sbjct  225   TPIVDQRRQTNNIRNGDRQPQLRYGPSFTLYHSQAHDYKEE------EEESDDGCYESGN  278

Query  1441  WSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPAS  1334
              S     L P   +++S  LLNP P M ++ + P S
Sbjct  279   LSTNICGLLPHFCLRSSFRLLNPVPAMSARPRIPVS  314



>gb|KDO37998.1| hypothetical protein CISIN_1g006533mg [Citrus sinensis]
Length=641

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 100/343 (29%), Positives = 147/343 (43%), Gaps = 74/343 (22%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME  +L+ + P++SVRR +S     E   +K  +N  P        L V KS+ +   +
Sbjct  6     LMEDKQLDFNQPLLSVRRFSSTAAPSEAQVKKKTDNSLPKIPP----LPVYKSELKSGPI  61

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR----KPDS-RRFYSCERPC  1883
               P +VPF WEQ PG+ + E   +    E P   P+LPPGR    KP +  + Y   R  
Sbjct  62    RNPGSVPFLWEQTPGRPKDEGKSQTRSIERPPIAPKLPPGRISNIKPQALEKVYEGRR--  119

Query  1882  HEDSFRFQTEPLALKN---HAALMDSLVESMLGKGEFDVEGRDSRECTN--------PDV  1736
                     ++ L+  N    +    S  +    K E   EG D    +          D 
Sbjct  120   -------NSKLLSAGNVVSSSQSASSPSDKNTAKCESSAEGMDETRSSRSEDGNEAYADA  172

Query  1735  LESLS------LNCSIGDLSGCQGLDVEEGRDDVKPSGD------SRDFMMSRFLPAAKA  1592
             L++LS       NCS+   SG  GLD EE    +KPSG       +RDFMM+RFLPAAKA
Sbjct  173   LDTLSRTESFFFNCSV---SGVSGLDDEE----MKPSGTFSSDQWTRDFMMTRFLPAAKA  225

Query  1591  AV------------LVTEQPRLVKEA---------KKYEPYVMSYYSDYAGDVVTenede  1475
                           +  E PR ++           K+Y P  + +   +A D   + E+ 
Sbjct  226   IASGAPQHKNRKQPVTQELPRNIQRVVNMDRRPPPKQYSPNSLQF---HAQD--KKWEES  280

Query  1474  endNMTIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQ  1346
             ++++        S       P   +KTS  LLNP PGM+ + Q
Sbjct  281   DHEDDDDGPGNSSATVCGFLPPFCLKTSFCLLNPVPGMRLQAQ  323



>ref|XP_010478283.1| PREDICTED: uncharacterized protein LOC104757253 [Camelina sativa]
 ref|XP_010478284.1| PREDICTED: uncharacterized protein LOC104757253 [Camelina sativa]
 ref|XP_010478285.1| PREDICTED: uncharacterized protein LOC104757253 [Camelina sativa]
Length=577

 Score = 87.0 bits (214),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 155/571 (27%), Positives = 241/571 (42%), Gaps = 108/571 (19%)
 Frame = -1

Query  2038  VAVPFCWEQAPGKRRGENGGKVYPC-----EDPSTMPRLPPGRKPDSRRFYSCERPCHED  1874
              +VPF WEQAPG+ +G N  +   C     E+    P  P G+  D             +
Sbjct  60    ASVPFTWEQAPGRLKG-NDFRPQVCDLTQEEEQVFKPCRPLGKAIDG------------N  106

Query  1873  SFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDLS  1694
               +FQ+            +  V S            D+R+  +P   +S S N SI   S
Sbjct  107   MTKFQSSKGKQVEETEDDEDDVFS------------DARDTLSPK--DSFSFNNSI---S  149

Query  1693  GCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAAVLVTEQPR---------------  1565
             G  G  V E +  +K S D  SR+FM++RFLPAAKA  +  EQP                
Sbjct  150   GVSGYGVVETKKPLKSSEDTQSREFMLNRFLPAAKA--MTVEQPHYASNRKPSSFMPEPT  207

Query  1564  -----LVKEAKKYEP------YVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKL  1418
                  LV   K+  P       V SYY     D      +++  +   +    S++   +
Sbjct  208   IQIRELVPGEKQQTPNRYDESIVPSYYHHQDLDDEASENNDDGGS---EYAYLSKRGCGM  264

Query  1417  FPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQ  1238
              P+L  K SL +LN  PG K+K  +P +S ++++ + ++ A         K+    ++K 
Sbjct  265   LPQLCFKDSLTMLNTVPGFKAKPNSPVTSPSHDLVKSSKVA-------QLKSRFQSVKKL  317

Query  1237  SYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRF-SEGT  1061
             + D++ K +  SG +   +  +  +   ++       SRS   SPYR+    S F S G+
Sbjct  318   ALDSVSKHKL-SGKVQSPVHSSIGKKFNSESNLVSAASRSS--SPYRHTRCISPFRSTGS  374

Query  1060  GF--LGVP---REAENLKGSMFSSFREVDTHLWDTPIKSSF---KGESDSPSDVVEKTVY  905
              F  +G P   +E ENL+ +  S       H  +  +       KG   S S ++EKTVY
Sbjct  375   PFHPVGFPETRKETENLRANRLSK------HTRNISLSQELLHRKGYG-SISSLLEKTVY  427

Query  904   VDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPNQKRGSSTSRSSRENFK  725
             VD+      T  D  +S+   ++ PEE  D+ ++  +N + E  +   + + RS  E  K
Sbjct  428   VDT-EIDPMTEEDQHNSR--VMIFPEE-ADMGKKPEANHDLEAFE---NISIRSGGEMVK  480

Query  724   PD-YRSYSDVTsslspypplpkspSESWLWRTLPSIPSRGGH------NDQTNQSPRATN  566
              D     +  +      PP PK PSESWL   LPS+ +   H      N Q         
Sbjct  481   GDELEKINSGSDWSLLAPPSPKKPSESWLCHNLPSVAASQIHSRRYSFNIQKQDLTENYR  540

Query  565   TATKREITVSSCSEHHCNSYYTEELIPYGSH  473
               TK E  V +   H  +S Y+EEL+ + SH
Sbjct  541   NVTKWETIVKTSYMHRDHSRYSEELVAHTSH  571



>ref|XP_010460696.1| PREDICTED: uncharacterized protein LOC104741512 [Camelina sativa]
Length=584

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 145/583 (25%), Positives = 239/583 (41%), Gaps = 128/583 (22%)
 Frame = -1

Query  2038  VAVPFCWEQAPGKRRGENGGKVYPC-----EDPSTMPRLPPGRKPDSRRFYSCERPCHED  1874
              +VPF WEQAPG+ +G N  +   C     E+    P  PPG+  D             +
Sbjct  63    ASVPFTWEQAPGRLKG-NDFRTQVCDLTQEEEQVYKPCRPPGKAIDG------------N  109

Query  1873  SFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDLS  1694
               R Q+        +   +  V S            D+R+  +P   +S S N SI   S
Sbjct  110   MTRLQSSKGKQVEESEDDEDDVFS------------DARDTLSPK--DSFSFNNSI---S  152

Query  1693  GCQGLDVEEGRDDVKPSGDSR--DFMMSRFLPAAKAAVLVTEQPR---------------  1565
             G  G  V E +  +K   D++  +FM++RFLPAAKA  +  EQP                
Sbjct  153   GVSGYGVVETKKPLKSCEDTQSWEFMLNRFLPAAKA--MTVEQPHYASNRKPSSFMPEPT  210

Query  1564  -----LVKEAKKYEP------YVMSYYSDYAGDVVTenedeendNMTIDQHKW-SRKFWK  1421
                  LV   K+  P       V SYY     D      ++++D+    ++ + S++   
Sbjct  211   IQMRELVPGEKQQTPNRYDESIVPSYYHHQDIDDEASENNDDDDDDGGSEYAYLSKRGCG  270

Query  1420  LFPRLSVKTSLGLLNPFPGMKSKTQTPASS-STNEVKRLTRNAPSGPLNKARKAYSGPIE  1244
             + P+L  K SL +LN  PG K+K  +  +S S ++VK       S  +++ +  +   ++
Sbjct  271   MLPQLCFKDSLTMLNTVPGFKAKHNSLMTSPSHDQVK-------SSKVSQLKSRFQS-VK  322

Query  1243  KQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGA-------ISPYRNVTT  1085
             K + D++ K +  SG +   +  +  +   ++       SRS +       +SP+R+   
Sbjct  323   KLALDSVSKHKL-SGKVQSPVHSSIGKKFNSESNLLSPASRSSSPYRHTRCMSPFRSTGN  381

Query  1084  SSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSS--FKGESDSPSDVVEKT  911
             SS F    GF    +E ENL+ +  S       H  +  +     ++  + S S ++EKT
Sbjct  382   SSPF-HPVGFPETRKETENLRANRLSK------HTRNISLSQELLYQKSNGSISSLLEKT  434

Query  910   VYVDSVNYVKT----TSLDLCS-------SKPEGLMDPEEFKDLPERTSSNPNQEPNQKR  764
             VYVD+ N   T     S  + S        KPE   D E F+++  R+      +  +K 
Sbjct  435   VYVDTENDPMTEDQYNSNAMTSPEEADMGKKPEANHDLEAFENISIRSGEMVKGDELEKI  494

Query  763   GSSTSRSSRENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPSIPSRGGHNDQTNQ  584
              S +  S      P   S                   ESWL   LPS+ +   H+ + + 
Sbjct  495   NSGSDWSLLAPPSPKKPS-------------------ESWLCHNLPSVAASQIHSRRYSF  535

Query  583   SPRATN------TATKREITVSSCSEHHCNSYYTEELIPYGSH  473
             +P+  +        TK E  V +   H  +S Y+EEL+ + SH
Sbjct  536   NPQKQDLTENYRNVTKWETIVKTSYMHRDHSRYSEELVAHTSH  578



>ref|XP_006446800.1| hypothetical protein CICLE_v10014575mg [Citrus clementina]
 gb|ESR60040.1| hypothetical protein CICLE_v10014575mg [Citrus clementina]
Length=641

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 97/343 (28%), Positives = 146/343 (43%), Gaps = 74/343 (22%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME  +L+ + P++SVRR +S     E   +K  +N  P        L V KS+ +   +
Sbjct  6     LMEDKQLDFNQPLLSVRRFSSTAAPSEAQVKKKTDNSLPKIPP----LPVYKSELKSGPI  61

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR----KPDS-RRFYSCERPC  1883
               P +VPF WEQ PG+ + E   +    E P   P+LPPGR    KP +  + Y   R  
Sbjct  62    RNPGSVPFLWEQTPGRPKDEGKSQTRSIERPPIAPKLPPGRISNIKPQALEKVYEGRR--  119

Query  1882  HEDSFRFQTEPLALKN---HAALMDSLVESMLGKGEFDVEGRDSRECTN--------PDV  1736
                     ++ L+  N    +    +  +    K E   EG D    +          D 
Sbjct  120   -------NSKLLSAGNVVSSSQSASAPSDKNTAKCESSAEGMDETRSSRSEDGNEAYADA  172

Query  1735  LESLS------LNCSIGDLSGCQGLDVEEGRDDVKPSGD------SRDFMMSRFLPAAKA  1592
             L++LS       NCS+   SG  GLD EE    +KPSG       +RDFMM+RFLPAAKA
Sbjct  173   LDTLSRTESFFFNCSV---SGVSGLDDEE----MKPSGTFSSDQWTRDFMMTRFLPAAKA  225

Query  1591  AV------------LVTEQPRLVKEA---------KKYEPYVMSYYSDYAGDVVTenede  1475
                           +  E PR ++           K+Y P  + +++        + E+ 
Sbjct  226   IASGAPQHKNRKQPVTQELPRNIQRVVNMDRRPPPKQYSPNSVQFHAQDK-----KWEES  280

Query  1474  endNMTIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQ  1346
             ++++        S       P   +KTS  LLNP PGM+ + Q
Sbjct  281   DHEDDDDGPGNSSATVCGFLPPFCLKTSFCLLNPVPGMRLQAQ  323



>emb|CDP15941.1| unnamed protein product [Coffea canephora]
Length=698

 Score = 86.7 bits (213),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 133/500 (27%), Positives = 214/500 (43%), Gaps = 90/500 (18%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME  +LNLS P++SVRR  S V   E  ++KN ++   +  +        KS+ +   V
Sbjct  30    MMEDKQLNLSRPLLSVRRHTSTVAS-EKDSKKNDQSSISSVTRPPPFY---KSELKSGPV  85

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
                  VPF WEQ+PG  + E   + +         R P   KP   R     +  +++S 
Sbjct  86    RNAGTVPFVWEQSPGMPKFERTLETH-------TERPPVAPKPPPGRVLKANQQDNDNSS  138

Query  1867  RFQT-------EPLALKNHAALMDS-----LVESMLGKGEFDVEGRDSRECTNPDVLESL  1724
             +  T        P   ++ + L DS     + E  + +     +  +  +    D L++L
Sbjct  139   KKLTVNKSQVGNPQGSQSASELGDSSRRFKITEDTVEEAHERKDDSEDEDEVFEDALDTL  198

Query  1723  S------LNCSIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAV--  1586
             S      +NCS+  +SG   LDV        PSG       +RDFM+ RFLPAAKA V  
Sbjct  199   SRTESFFVNCSVSGISGLDDLDV-------MPSGTFSTDPQARDFMIGRFLPAAKAMVSE  251

Query  1585  ------------LVTEQPRLVKEAK--------KYEPYVMSYYSDYAGDVVTenedeend  1466
                         +V + PR +K+          +Y P    +YS++  +     E+EE+D
Sbjct  252   TPQYAPAPKKRPVVQDNPRQLKKVVNADNRPQLRYGPTFAKHYSEFHDN----GEEEESD  307

Query  1465  NMTIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSG  1286
             +  ++      K   L PR   K+   LLNP PGM  +T+TP S +T   + L R++ + 
Sbjct  308   DDYVEHENVPSKVCGLLPRFCFKSR--LLNPLPGMSVRTRTPMSPTT---RMLARSSSAS  362

Query  1285  PLNKARKAYSGPIEKQSYDAICKQRFRSGALSGEL--------CKADKRGLKADGQYPHG  1130
               +K     S      S D + +QR   G+ + EL         K+ +  LK+       
Sbjct  363   TCSKTENELS------SVD-MSEQRSIDGSQTAELHEGKNNLNVKSSQISLKSQKYEKSL  415

Query  1129  GSRSGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFK  950
              +  G +S + N + +S   +   F  +P E ++      SS  +      D     S  
Sbjct  416   ANGHGGVSSHYNESPAS--IDQRAFPVIPVEPQDASVDGCSSDEKSYRSFRDLLADQSPS  473

Query  949   GESDSPSDVVEKTVYVDSVN  890
              E +S S  VEKT+YVD+V+
Sbjct  474   EEVNSASPAVEKTLYVDTVH  493



>gb|KHN34238.1| hypothetical protein glysoja_035873 [Glycine soja]
Length=707

 Score = 85.5 bits (210),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 100/345 (29%), Positives = 150/345 (43%), Gaps = 73/345 (21%)
 Frame = -1

Query  2230  VVMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSE  2051
              +ME+ +L+ + P++SVRRI+S         RK           +R PL   KS+ +   
Sbjct  5     TLMEEKQLDFNQPLLSVRRISSTAASENDYKRK-----PDKPVPKRPPLPFYKSELKSGP  59

Query  2050  VTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR-----KPDSRRF-----Y  1901
             VT P  VPF WE+ PG+ + E+  +    E PS  P+LPPGR     + DS +       
Sbjct  60    VTNPGTVPFVWEKTPGRPKNESKQQTQAVERPSVAPKLPPGRVLKVEQQDSDKVPKGASV  119

Query  1900  SCERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---E  1730
             +  R     S   +T  L  K     +  ++E        D    D       D L   E
Sbjct  120   TQSRTGSSVSDSPRTASLDNKVTKHEIPQVIEEKASSVSND---EDENYLDALDTLSRTE  176

Query  1729  SLSLNCSIGDLSGCQGLDVEEGRDDVKPSGD------SRDFMMSRFLPAAKAAVLVTEQP  1568
             S  ++CS+  LS   G        DV+PSG+      +RDFM+ RFLPAAKA  + +E P
Sbjct  177   SFFMSCSVSGLSEWDG-------PDVQPSGNFSTDQQTRDFMIGRFLPAAKA--MASETP  227

Query  1567  RL-------------VKEAKKYE---------PYVMSYYSDYAGDVVTenedeendNMTI  1454
             ++             +K+A+K E         P        YA D+  E  ++E+     
Sbjct  228   QIQHNSRKSLVTQEQLKQARKVESGANSRPLNPKWQKVLPHYAQDIGREESEDES-----  282

Query  1453  DQH----KWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASS  1331
             D H     ++ K   LFPR        LLNP PG++ + + P+S+
Sbjct  283   DDHDGYENYAPKVCGLFPRFC------LLNPVPGLRMEGRIPSST  321



>ref|XP_009602914.1| PREDICTED: uncharacterized protein LOC104097983 [Nicotiana tomentosiformis]
 ref|XP_009602915.1| PREDICTED: uncharacterized protein LOC104097983 [Nicotiana tomentosiformis]
 ref|XP_009602916.1| PREDICTED: uncharacterized protein LOC104097983 [Nicotiana tomentosiformis]
 ref|XP_009602917.1| PREDICTED: uncharacterized protein LOC104097983 [Nicotiana tomentosiformis]
 ref|XP_009602918.1| PREDICTED: uncharacterized protein LOC104097983 [Nicotiana tomentosiformis]
Length=604

 Score = 85.1 bits (209),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 96/339 (28%), Positives = 150/339 (44%), Gaps = 61/339 (18%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  +L  + P++SVRRI+  +     +++++ +    N  +        KS+ +   V 
Sbjct  4     MEDKQLKFNQPLLSVRRISPAM-----ISQRDEKKTIDNSFRAMTHPPHFKSELKSGLVG  58

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRK-PDSRRFYSCERPCHEDSF  1868
             KP  VPF WE +PG+ + E G +    E+P T+P+LPPG K  D + F         +S 
Sbjct  59    KPGTVPFLWEDSPGRPKDERGPQTCFTENPPTIPKLPPGWKLRDDQDFEKA-----LEST  113

Query  1867  RFQTEPLALKNHAALMDSLVESMLGKGEFD-----------VEGRDSRECTNPDVLESLS  1721
             + QT    + N     D L E++     FD           +E  D  E T  D  ++LS
Sbjct  114   KIQTG--NILNAKPSCDYLDENIKKIESFDSSKEMTEDKENIESEDGDE-TYLDARDTLS  170

Query  1720  ------LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVL--------  1583
                   LNC++  LSG    + +  R  +     ++D MM RFLPAAKA           
Sbjct  171   RTESSFLNCNVSGLSGYDEPNAKPFRTSLT-DLRAKDLMMGRFLPAAKAMASDKTSETPY  229

Query  1582  --------VTEQPRLVKEA--------KKYEPYVMSYYSDYAGDVVTenedeendNMTID  1451
                     V +Q R +K+          +Y P    Y++    +     ++EE+D+   D
Sbjct  230   YVRKKQPPVRDQSRQIKKVLNGDRRPQLRYGPSFTLYHAQAHDN-----KEEESDDDCYD  284

Query  1450  QHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPAS  1334
                 + K   L PR  +K+S  LLNP PGM  +T+ P S
Sbjct  285   NGNLANKVCGLLPRFCLKSSFSLLNPVPGMSVRTRVPVS  323



>ref|XP_010035863.1| PREDICTED: uncharacterized protein LOC104425004 [Eucalyptus grandis]
 ref|XP_010035864.1| PREDICTED: uncharacterized protein LOC104425004 [Eucalyptus grandis]
 ref|XP_010035865.1| PREDICTED: uncharacterized protein LOC104425004 [Eucalyptus grandis]
 ref|XP_010035866.1| PREDICTED: uncharacterized protein LOC104425004 [Eucalyptus grandis]
 ref|XP_010035867.1| PREDICTED: uncharacterized protein LOC104425004 [Eucalyptus grandis]
 gb|KCW47348.1| hypothetical protein EUGRSUZ_K01136 [Eucalyptus grandis]
Length=667

 Score = 85.1 bits (209),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 117/439 (27%), Positives = 171/439 (39%), Gaps = 86/439 (20%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME T+LN + P ++VRR +S V  +EG +++  +   P        L   KS+ +   +
Sbjct  1     MMEDTQLNFNQPFLTVRRFSSTVASVEGRDKRRTDKSLPTIPP----LPPYKSELKSGPI  56

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
               P  VPF WEQ PG+ + E+  +    + P   P+LPPGR    ++  S +        
Sbjct  57    RNPGTVPFVWEQCPGRPKNESLLRSQTPQCPPAAPKLPPGRIARVKQHDSEKTSDGAMGV  116

Query  1867  RFQTEPLALK-NHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLS------LNCS  1709
             + Q   +     +A   D  V+      E    G D  +    D L++ S      LNCS
Sbjct  117   QSQMRNMVFNYENAQSNDEGVKKKDTTEEKGTAGSDYGDEAYLDALDTFSRSESFFLNCS  176

Query  1708  IGDLSGCQGLDVE-EGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQP-RLVKE------  1553
             +  LSG  G D+   GR    P   +RDFMM RFLPAAKA  + +E P   V+       
Sbjct  177   VSGLSGVDGSDMRLSGRFSRDPP--ARDFMMGRFLPAAKA--MASEAPLHFVQRQSVAQD  232

Query  1552  -----AKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKW-----SRKFWKLFPRLS  1403
                   KK    V +   +    +V           + D   +     + K   L PR  
Sbjct  233   LPRHPVKKAAVGVENRRLEVLKPIVLPVTQVGVGEESEDDDYYESETSTTKGCGLLPRFC  292

Query  1402  VKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSG-PIEKQSYDA  1226
                   LLNP PGM+ +T       T              +N     Y G P  K + +A
Sbjct  293   ------LLNPVPGMRMQTGGLTVHKTQ-------------VNSTYAKYQGEPHSKHNKNA  333

Query  1225  ICKQRFRSGALSGEL---------------CKADKRG------LKADGQYPH--------  1133
               +QR   G L  EL               CK    G      L+ +G++ H        
Sbjct  334   SDEQRSVGGCLMSELHENKFDLKSTQSRTKCKKKLEGSSLYGRLQGNGKFEHHNRFSKSV  393

Query  1132  --GGSRSGAISPYRNVTTS  1082
               G  RS  +SP+ NV  S
Sbjct  394   VQGQGRS--VSPHENVKNS  410



>ref|XP_006358968.1| PREDICTED: uncharacterized protein LOC102584213 [Solanum tuberosum]
Length=611

 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 112/423 (26%), Positives = 182/423 (43%), Gaps = 87/423 (21%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  +L  + P++SVRRI+  +     +++++ +    N           KS+     V 
Sbjct  1     MEGKQLKFNQPLLSVRRISPAM-----ISQRDEKMKFDNSFPTMTHPPHYKSELNSGLVV  55

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRK-PDSRRFYSCERPCHEDSF  1868
              P  VPF WEQ PGK + E+  + +  E P T P+LPPG K  D++ F        + + 
Sbjct  56    MPGTVPFLWEQTPGKPKDESRPQTHFTEKPPTAPKLPPGWKLRDNQDF--------DQTG  107

Query  1867  RFQTEPLALKNHA-------ALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLS----  1721
             +FQ   L+  + +          DS  E M  K +  +E  D  E    D L++LS    
Sbjct  108   KFQNAMLSFTSSSDENVKKMESFDSSKEMMHDKEK--IESEDDNEAY-LDALDTLSRTGS  164

Query  1720  --LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAV--LVTEQPRLVKE  1553
               LNCS+  LS     + ++ R     +  ++DFMM RFLPAAKA      +E P  V++
Sbjct  165   SFLNCSVSGLSEFDEPNAKQSRTSST-NPQTKDFMMGRFLPAAKAMTSDKTSETPYYVRK  223

Query  1552  AK----------------------KYEPYVMSYYS---DYAGDVVTenedeendNMTIDQ  1448
              +                      +Y P    Y+S   DY  +      +EE+D+   ++
Sbjct  224   KQPPVEDQRRQTKNIINGDRQPQLRYGPSFTLYHSQAHDYKEE------EEESDDNCYER  277

Query  1447  HKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKAR  1268
                S     L P   +K+S  LLNP P M ++ + P S     V R    + S       
Sbjct  278   GNLSTNICGLLPHFCLKSSFRLLNPVPAMSARPRIPVSP----VSRTQTGSFST------  327

Query  1267  KAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAI---SPYR  1097
              ++SG   ++S   + +Q+   G+++ +L   DK  +K          R+ +I    PY 
Sbjct  328   TSFSGTENERSTSDVSEQKSVVGSITTQL-HEDKNDIKG---------RTYSIYANDPYN  377

Query  1096  NVT  1088
             N+T
Sbjct  378   NMT  380



>ref|XP_009790223.1| PREDICTED: uncharacterized protein LOC104237722 [Nicotiana sylvestris]
 ref|XP_009790224.1| PREDICTED: uncharacterized protein LOC104237722 [Nicotiana sylvestris]
 ref|XP_009790225.1| PREDICTED: uncharacterized protein LOC104237722 [Nicotiana sylvestris]
Length=604

 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 104/373 (28%), Positives = 165/373 (44%), Gaps = 61/373 (16%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  +L  + P++SVRRI+  +     +++++ +    N  +        KS+ +   V 
Sbjct  4     MEDKQLKFNQPLLSVRRISPAM-----ISQRDEKKTIDNSFRAITHPPHFKSELKSGLVG  58

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
             KP  VPF WE +PG+ + E G +++  E+P T P+LPPG K    + +  +     +S +
Sbjct  59    KPGTVPFLWEDSPGRPKDERGPQIHFTENPPTFPKLPPGWKLRENQDFEKDF----ESTK  114

Query  1864  FQTEPLALKNHAALMDSLVESMLGKGEFD-----------VEGRDSRECTNPDVLESLS-  1721
              QT    + N     D L E++     FD           +E  D  E T  D  ++LS 
Sbjct  115   IQTG--NILNAKPSCDYLDENIKKIESFDSSKEMTGDKENIESEDGDE-TYLDARDTLSR  171

Query  1720  -----LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVL---------  1583
                  LNC++  LSG    + +  R  +     ++D MM RFLPAAKA            
Sbjct  172   TESSFLNCNVSGLSGYDEPNAKPFRTSLT-DPRAKDLMMGRFLPAAKAMASDKTSETPYY  230

Query  1582  -------VTEQPRLVKEA--------KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQ  1448
                    V +Q R +K+          +Y P    Y+S        +NE+EE+D+   D 
Sbjct  231   VRKKQPPVQDQSRQIKKVLNGDRRPQLRYGPSFTLYHSQ-----AHDNEEEESDDDCYDN  285

Query  1447  HKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASS-STNEVKRLTRNAPSGPLNKA  1271
                + K   L P   +K+S  LLN  PGM  +T+ P S  S  +   L+  + SG  N+ 
Sbjct  286   GDLATKVCGLLPHFCLKSSFRLLNLVPGMSVRTRVPVSPVSRTQTGSLSTASCSGTENEV  345

Query  1270  RKAYSG-PIEKQS  1235
                Y+  P E +S
Sbjct  346   NSTYANDPYEHKS  358



>ref|XP_008455300.1| PREDICTED: uncharacterized protein LOC103495498 [Cucumis melo]
 ref|XP_008455301.1| PREDICTED: uncharacterized protein LOC103495498 [Cucumis melo]
Length=716

 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 92/308 (30%), Positives = 139/308 (45%), Gaps = 40/308 (13%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +L+ + P++SVRR  S     E   +   E+  P        L V KS+ +   V
Sbjct  7     LMEEKQLDFNQPLLSVRRFTSTETSSETNEKTRPESKIPP-------LPVYKSELKSGPV  59

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR-KPDSRRFYSCERPCHEDS  1871
               P  VPF WE+ PGK + E+       + P  +P+LPPGR +  ++   +      +++
Sbjct  60    RIPGTVPFVWERTPGKPKDESSANTQISKRPPLVPKLPPGRVQKLNQEVPTSVNASFDEN  119

Query  1870  FRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDLSG  1691
              R + E +A    + +  +  E    +   D   R SR        ES  LNCSI   SG
Sbjct  120   AREEVEEMA----SCMSGNDEEEEEDEVYRDANDRFSRS-------ESFFLNCSI---SG  165

Query  1690  CQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKA------------AVLVTEQPR---L  1562
               GLD  E +     S D  +RDFMM RFLPAAKA              +  E+PR   L
Sbjct  166   VSGLDDSEIKPSEASSMDPHTRDFMMDRFLPAAKAMASETPPHTIRKQTVSVERPREVKL  225

Query  1561  VKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSVKTSLGL  1382
             V    +     +   + +  ++  E  D+E+D+     +  S +     PR  +K S GL
Sbjct  226   VTNRDRQSRPNLHVQTKHVKEIFREESDDEDDDYDESGYS-STQGCGFLPRFCLKGSFGL  284

Query  1381  LNPFPGMK  1358
             LNP PGM+
Sbjct  285   LNPVPGMR  292



>ref|XP_010542726.1| PREDICTED: uncharacterized protein LOC104815844 [Tarenaya hassleriana]
 ref|XP_010542727.1| PREDICTED: uncharacterized protein LOC104815844 [Tarenaya hassleriana]
 ref|XP_010542728.1| PREDICTED: uncharacterized protein LOC104815844 [Tarenaya hassleriana]
Length=612

 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 91/321 (28%), Positives = 145/321 (45%), Gaps = 50/321 (16%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ +L+   P++S+RR +S      G    N      +   +     V KSD     V 
Sbjct  1     MEEKRLDFDRPLLSIRRPSSTPTSEPG----NRTRSHDSAAPKMLTPPVYKSDIRSGPVR  56

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCE-DPSTMPRLPPGRKPDSRRFYSCERPCHEDSF  1868
              P  VPF WE  PGK + +N       E  P  +P+LPPGR  + R   S          
Sbjct  57    NPGTVPFQWEHKPGKPKDDNKSDSQVLEQQPRLVPKLPPGRTLNVRENGSGR--------  108

Query  1867  RFQTEPLALKNH--AALMDSLVESMLGKGEF-DVEGRDSRECTNPDVLESLS------LN  1715
             + +TE +    H  AA+ ++   S   + E+ D +G ++      DV+++LS      LN
Sbjct  109   KAETEVVVQTKHGNAAIAENARSS--SRSEYDDCDGNEAYV----DVIDTLSRSESFFLN  162

Query  1714  CSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAV------------LVTEQ  1571
             CS+  +SG  G ++     D +    +RDFMM RFLPAAKA              L  EQ
Sbjct  163   CSVSGVSGLDGPNLHPFLSDPR----TRDFMMGRFLPAAKALASETPPHLTRKPPLPKEQ  218

Query  1570  PRLVKEA------KKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPR  1409
             P  +K+        K+   V  ++     +   ++ DEE D+ ++ +         L P+
Sbjct  219   PWQIKKEVVPKINMKHTKTVQRHFLVQQQERWEDSGDEEEDDESVTRKSTMPGVCGLLPQ  278

Query  1408  LSVKTSLGLLNPFPGMKSKTQ  1346
             + +K+S G+LNP P M+++ Q
Sbjct  279   ICLKSSFGVLNPVPSMRAQAQ  299



>ref|XP_008789379.1| PREDICTED: uncharacterized protein LOC103706890 [Phoenix dactylifera]
 ref|XP_008789380.1| PREDICTED: uncharacterized protein LOC103706890 [Phoenix dactylifera]
 ref|XP_008789381.1| PREDICTED: uncharacterized protein LOC103706890 [Phoenix dactylifera]
Length=719

 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 102/326 (31%), Positives = 141/326 (43%), Gaps = 54/326 (17%)
 Frame = -1

Query  1732  ESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAA-------------KA  1592
             ES  +NCS+  LSG     +  G     P    RDFMM RFLPAA             KA
Sbjct  202   ESFFMNCSVSGLSGIPESAMPSGSFSTDPQ--VRDFMMGRFLPAAQAMATGSPQYTFRKA  259

Query  1591  AVLVTEQP-------------RLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTID  1451
             A L  E P             RL+    +  P     Y+   G+  + +++EE ++    
Sbjct  260   ASLAREPPMRPAERFVSGDHRRLLPLPYQKRPNFGLQYAQKHGEGDSYDDEEEAEDCDET  319

Query  1450  QHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKA  1271
              H  S K   L PRL +K+S  LLNP PGMK + + PA       +R+      GP  K 
Sbjct  320   DHLPS-KACGLLPRLCLKSSFCLLNPVPGMKVRGRLPAPPG----RRI-----GGPRIKT  369

Query  1270  --RKAYSGPIEKQSYDAICK----QRFRSGALSGE-LCKADKRGL-------KADGQYPH  1133
                 ++    ++ S++A+ K    QR++     G     ++ + L        ADG  P 
Sbjct  370   FHHGSFGQDGDEDSWEAVHKHKLGQRYQPQVEDGRSRSTSESKQLTYWSDSPTADGSSPC  429

Query  1132  GGSRSGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVD-THLWDTPIKSS  956
               S  G ISPYRN      F E  GFLGVP+       +  S   E D  + W+     S
Sbjct  430   RHSAGGGISPYRNEAPPFPF-ERKGFLGVPKRGRKSSKTDGSDLCERDGENYWEMTPSQS  488

Query  955   FKGESDSPSDVVEKTVYVDSVNYVKT  878
              +  S S S  +EKT+YVDSVN  +T
Sbjct  489   SQQGSGSRSPALEKTLYVDSVNMPET  514



>ref|XP_003607595.1| hypothetical protein MTR_4g080050 [Medicago truncatula]
 gb|AES89792.1| DUF688 family protein [Medicago truncatula]
Length=696

 Score = 81.3 bits (199),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 96/326 (29%), Positives = 148/326 (45%), Gaps = 54/326 (17%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +L+   P++SVRR +S     E  N++  E P   R +    L   KS+ +   V
Sbjct  6     LMEEKQLDFDQPLLSVRRASS-TESSENNNKRKTEKPVSKRTR----LPAYKSELKSGPV  60

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR--KPDSRRFYSCERPCHED  1874
             + P  VPF WE +PG+ + E   +    E+P   P+LPPGR  K   R F    +     
Sbjct  61    SNPGTVPFVWENSPGRPKDEGKLQTRDIEEPLVAPKLPPGRVLKVKQRDFDKIPKGTSVS  120

Query  1873  SFRFQTEPLALKNHAALMDSLVESMLGKGEF----DVEGRDSRECTNPDVLESLS-----  1721
               R  +  ++     A ++S  E+   + E     +  G D  + T  D L++LS     
Sbjct  121   QSRTGST-VSNSMSVASLESKEENHDSRNEVVPKKESSGSDHEDETYVDALDTLSRTESF  179

Query  1720  -LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVT-----------  1577
              +NCS+  LSG    +V+   +       +RDFM+ RFLPAAKA    T           
Sbjct  180   FMNCSVSGLSGYGDREVQPP-ESFSADQQARDFMIDRFLPAAKAMASETPHIQYASRKPA  238

Query  1576  ---EQPRLVKEAK---KYEPY------VMSYYSDYAGDVVTenedeendNMTIDQHK-WS  1436
                EQPR V++ +   K  P       VM +Y       VT+ E+ E+++   D ++ ++
Sbjct  239   VRQEQPRQVRKVESGAKPRPVDQKWQKVMPHYVQ-----VTDREESEDESDDNDTYESYA  293

Query  1435  RKFWKLFPRLSVKTSLGLLNPFPGMK  1358
              K   LFPR        LLNP  G+K
Sbjct  294   PKVCGLFPRFC------LLNPLQGLK  313



>ref|XP_006469004.1| PREDICTED: uncharacterized protein LOC102629060 isoform X2 [Citrus 
sinensis]
Length=649

 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 99/342 (29%), Positives = 144/342 (42%), Gaps = 72/342 (21%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME  +L+ + P++SVRR +S     E   +K  +N  P        L V KS+ +   +
Sbjct  6     LMEDKQLDFNQPLLSVRRFSSTAAPSEAQVKKKTDNSLPKIPP----LPVYKSELKSGPI  61

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR----KPDSRRFYSCERPCH  1880
               P +VPF WEQ PG+ + E   +    E     P+LPPGR    KP +    S      
Sbjct  62    RNPGSVPFLWEQTPGRPKDEGKSQTRSIERLPIAPKLPPGRISNIKPQALEKVS------  115

Query  1879  EDSFRFQTEPLALKN-------HAALMDSLVESMLGKGEFDVEGRDSR-ECTN---PDVL  1733
                 R   + L+  N        ++  D          E   E R SR E  N    D L
Sbjct  116   --EGRRNNKLLSAGNVVSSSQSASSPSDKNTAKCESSAEVMDETRSSRSEDGNEAYADAL  173

Query  1732  ESLS------LNCSIGDLSGCQGLDVEEGRDDVKPSGD------SRDFMMSRFLPAAKAA  1589
             ++LS       NCS+   SG  GLD EE    +KPSG       +RDFMM+RFLPAAKA 
Sbjct  174   DTLSRTASFFFNCSV---SGVSGLDDEE----MKPSGTFSSDQWTRDFMMTRFLPAAKAI  226

Query  1588  V------------LVTEQPRLVKEA---------KKYEPYVMSYYSDYAGDVVTenedee  1472
                          +  E PR ++           K+Y P  + +++        + E+ +
Sbjct  227   ASGAPQHKNRKQPVTQELPRNIQRVVNMDRRPPPKQYSPNSLQFHAQD-----KKWEESD  281

Query  1471  ndNMTIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQ  1346
             +++        S       P   +KTS  LLNP PGM+ + Q
Sbjct  282   DEDDYDGPGNSSATVCGFLPPFCLKTSFCLLNPVPGMRLQAQ  323



>ref|XP_006469003.1| PREDICTED: uncharacterized protein LOC102629060 isoform X1 [Citrus 
sinensis]
Length=672

 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 101/342 (30%), Positives = 145/342 (42%), Gaps = 72/342 (21%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME  +L+ + P++SVRR +S     E   +K  +N  P        L V KS+ +   +
Sbjct  6     LMEDKQLDFNQPLLSVRRFSSTAAPSEAQVKKKTDNSLPKIPP----LPVYKSELKSGPI  61

Query  2047  TKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGR----KPDSRRFYSCERPCH  1880
               P +VPF WEQ PG+ + E   +    E     P+LPPGR    KP +    S      
Sbjct  62    RNPGSVPFLWEQTPGRPKDEGKSQTRSIERLPIAPKLPPGRISNIKPQALEKVS------  115

Query  1879  EDSFRFQTEPLALKN-------HAALMDSLVESMLGKGEFDVEGRDSR-ECTN---PDVL  1733
                 R   + L+  N        ++  D          E   E R SR E  N    D L
Sbjct  116   --EGRRNNKLLSAGNVVSSSQSASSPSDKNTAKCESSAEVMDETRSSRSEDGNEAYADAL  173

Query  1732  ESLS------LNCSIGDLSGCQGLDVEEGRDDVKPSGD------SRDFMMSRFLPAAKAA  1589
             ++LS       NCS+   SG  GLD EE    +KPSG       +RDFMM+RFLPAAKA 
Sbjct  174   DTLSRTASFFFNCSV---SGVSGLDDEE----MKPSGTFSSDQWTRDFMMTRFLPAAKAI  226

Query  1588  V------------LVTEQPRLVKEA---------KKYEPYVMSYYSDYAGDVVTenedee  1472
                          +  E PR ++           K+Y P  + +   +A D   + E+ +
Sbjct  227   ASGAPQHKNRKQPVTQELPRNIQRVVNMDRRPPPKQYSPNSLQF---HAQD--KKWEESD  281

Query  1471  ndNMTIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQ  1346
             +++        S       P   +KTS  LLNP PGM+ + Q
Sbjct  282   DEDDYDGPGNSSATVCGFLPPFCLKTSFCLLNPVPGMRLQAQ  323



>gb|KCW89648.1| hypothetical protein EUGRSUZ_A01920 [Eucalyptus grandis]
Length=659

 Score = 80.5 bits (197),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 126/502 (25%), Positives = 204/502 (41%), Gaps = 57/502 (11%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  +LN + P++S RR  S      G   + +      +     P    +S+ +   ++
Sbjct  1     MEDRQLNYNRPLLSTRRFPSTPTFSGGARDQGITGNPLAKLPPLPPAY--RSELKSGPIS  58

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCER----PCHE  1877
              P  VPF WE +PG  + E   ++     P   P+L  GR  + +   S ++     C+ 
Sbjct  59    SPGTVPFTWEWSPGTPKHERTMQIQTLRPPPASPKLSSGRTMNVKE-QSLDKVSNSNCNV  117

Query  1876  DSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLSLNCSI  1706
              S R    P           +   S  G  E   EG D      PD L   ES  LNCS+
Sbjct  118   RSQRVNVLPNDASKGGEAAAACESSKKGVSE---EG-DEVYVDAPDTLSRTESFFLNCSL  173

Query  1705  GDLSGCQGLDVE-EGRDDVKPSGDSRDFMMSRFLPAAKAAV------------LVTEQPR  1565
               +SG  GLD    G+    P  + +DFMM RFLPAA+A              L  EQP+
Sbjct  174   SGISGLDGLDNGVSGKFYTNP--EMQDFMMDRFLPAAQAMASETPPRPTRKQPLKREQPK  231

Query  1564  LVKEA---------KKYEPYVMSYYS-DYAG-DVVTenedeendNMTIDQHKWSRKFWKL  1418
              VK A         + Y P  +S+ + +  G D   +++D+++D    +  K S K   L
Sbjct  232   FVKRAINVVKQQREQHYRPTAISHCAPELIGLDSRGDDDDDDSDGEYDEPEKSSFKARGL  291

Query  1417  FPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQ  1238
               R  +K S  LLNP P +K++     S +     + +RNA S   +  ++  +      
Sbjct  292   LYRFCLK-SFCLLNPVPRVKTRAAGHVSLARRVQAKSSRNASSNERSSEQRYVNRHQVPG  350

Query  1237  SYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRFSEGTG  1058
             + D       +S  ++   C   +   +AD  +     +  +   ++  ++     E   
Sbjct  351   TQDEKLVLNSKSSPINKITCI--RESPRADRSFESRNFQGVSSVHFKTESSHPILREERN  408

Query  1057  FLGVPREAENLK-------GSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVD  899
             F G  R  EN +       G    SFRE  +   +        G +   +  VEKT+YVD
Sbjct  409   FFGNTRSTENSRVDGFIPPGKFLPSFREFLSSEENA-------GNAGFTAPSVEKTLYVD  461

Query  898   SVNYVKTTSLDLCSSKPEGLMD  833
              V+ +++ + D  SS   G+ D
Sbjct  462   RVHVIRSRNSDTSSSDKTGIPD  483



>gb|EYU28093.1| hypothetical protein MIMGU_mgv11b011332mg [Erythranthe guttata]
Length=215

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 106/227 (47%), Gaps = 37/227 (16%)
 Frame = -1

Query  1132  GGSRSGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSF  953
             G S+  +ISPYRN +  S F EG GFLGVP+  E+   +  +S R++   L D     S 
Sbjct  14    GASQLRSISPYRNESPKSPFREGVGFLGVPKGVEDFNANKIASSRKLFKALHDV----SR  69

Query  952   KGESDSPSDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPN  773
                S+   +VVEK VYV+SVN                    +E   L E    NPN E N
Sbjct  70    NQTSEKTGEVVEKKVYVESVN-----------------RKDQETPALDEGKKRNPNVELN  112

Query  772   QKRGSSTSRSSRENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPSIP-------S  614
               R        +    P  +  S +       PPLPKSPSESWLWRTLPSI        S
Sbjct  113   --RSVEKEEEEKLELDPLLKPSSPLA------PPLPKSPSESWLWRTLPSISLGNPFAHS  164

Query  613   RGGHNDQTNQSPRATNTATKREITVSSCSEHHCNSYYTEELIPYGSH  473
             R   + Q+ +  +    A K E  V + +  H +  Y++EL+P+ +H
Sbjct  165   RRNFHLQSKKQGQKLADA-KWETIVKTTNIRHDHVRYSQELVPHVTH  210



>ref|XP_006582277.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Glycine 
max]
 ref|XP_006582278.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Glycine 
max]
Length=687

 Score = 77.4 bits (189),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 117/265 (44%), Gaps = 39/265 (15%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME+ +L+ + P++SVRRI+S     E  N++  +     R      L   KS+ +   VT
Sbjct  7     MEEKQLDFNQPLLSVRRISSTAAS-ENDNKRKADKSVRKRPP----LPFYKSELKSGPVT  61

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHE----  1877
              P  VPF WE+ PG+ + E+  +    E PS  P+LPPG      R    E+ C +    
Sbjct  62    NPGTVPFVWEKTPGRPKNESKLQTRAVERPSVAPKLPPG------RVLKVEQQCSDKVPK  115

Query  1876  ----------DSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLES  1727
                        S        +L N     +S  E +    E +  G D  +    D L++
Sbjct  116   GASVTQSRTGSSVSDSPRTASLDNKVTKHESPQEVI---EEKESSGSDDEDENYLDALDT  172

Query  1726  LS------LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPR  1565
             LS      ++CS+  LS     +V+    +      +RDFM+ RFLPAAKA  + +E P+
Sbjct  173   LSRTESFFMSCSVSGLSEWDDQEVQLS-GNFSTDQQARDFMIGRFLPAAKA--MASETPQ  229

Query  1564  LVKEAKKYEPYVMSYYSDYAGDVVT  1490
             +   ++K  P V       A  VV+
Sbjct  230   IQHNSRK--PLVTQEQPKQAWKVVS  252



>ref|XP_010052771.1| PREDICTED: uncharacterized protein LOC104441341 [Eucalyptus grandis]
Length=667

 Score = 77.4 bits (189),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 128/512 (25%), Positives = 206/512 (40%), Gaps = 69/512 (13%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  +LN + P++S RR  S      G   + +      +     P    +S+ +   ++
Sbjct  1     MEDRQLNYNRPLLSTRRFPSTPTFSGGARDQGITGNPLAKLPPLPPAY--RSELKSGPIS  58

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCER----PCHE  1877
              P  VPF WE +PG  + E   ++     P   P+L  GR  + +   S ++     C+ 
Sbjct  59    SPGTVPFTWEWSPGTPKHERTMQIQTLRPPPASPKLSSGRTMNVKE-QSLDKVSNSNCNV  117

Query  1876  DSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLSLNCSI  1706
              S R    P           +   S  G  E   EG D      PD L   ES  LNCS+
Sbjct  118   RSQRVNVLPNDASKGGEAAAACESSKKGVSE---EG-DEVYVDAPDTLSRTESFFLNCSL  173

Query  1705  GDLSGCQGLDVE-EGRDDVKPSGDSRDFMMSRFLPAAKAAV------------LVTEQPR  1565
               +SG  GLD    G+    P  + +DFMM RFLPAA+A              L  EQP+
Sbjct  174   SGISGLDGLDNGVSGKFYTNP--EMQDFMMDRFLPAAQAMASETPPRPTRKQPLKREQPK  231

Query  1564  LVKEA---------KKYEPYVMSYYS-DYAG-DVVTenedeendNMTIDQHKWSRKFWKL  1418
              VK A         + Y P  +S+ + +  G D   +++D+++D    +  K S K   L
Sbjct  232   FVKRAINVVKQQREQHYRPTAISHCAPELIGLDSRGDDDDDDSDGEYDEPEKSSFKARGL  291

Query  1417  FPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQ  1238
               R  +K S  LLNP P +K++     S +     + +RNA S    ++ +     + +Q
Sbjct  292   LYRFCLK-SFCLLNPVPRVKTRAAGHVSLARRVQAKSSRNASSN--ERSSEHACDLVSQQ  348

Query  1237  SY----------DAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVT  1088
              Y          D       +S  ++   C   +   +AD  +     +  +   ++  +
Sbjct  349   RYVNRHQVPGTQDEKLVLNSKSSPINKITCI--RESPRADRSFESRNFQGVSSVHFKTES  406

Query  1087  TSSRFSEGTGFLGVPREAENLK-------GSMFSSFREVDTHLWDTPIKSSFKGESDSPS  929
             +     E   F G  R  EN +       G    SFRE  +   +        G +   +
Sbjct  407   SHPILREERNFFGNTRSTENSRVDGFIPPGKFLPSFREFLSSEENA-------GNAGFTA  459

Query  928   DVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMD  833
               VEKT+YVD V+ +++ + D  SS   G+ D
Sbjct  460   PSVEKTLYVDRVHVIRSRNSDTSSSDKTGIPD  491



>ref|XP_010414190.1| PREDICTED: uncharacterized protein LOC104700373 [Camelina sativa]
 ref|XP_010414191.1| PREDICTED: uncharacterized protein LOC104700373 [Camelina sativa]
Length=588

 Score = 77.0 bits (188),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 88/324 (27%), Positives = 140/324 (43%), Gaps = 56/324 (17%)
 Frame = -1

Query  2230  VVMEKTKLNLSVPIISVRR------INSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKS  2069
             ++ME+ +L+ + P+IS+RR        S  R  + V  K + +P            V KS
Sbjct  6     LMMEEKQLDFNRPLISIRRPTQTSESESKTRSFDSVTNKVLPSPP-----------VYKS  54

Query  2068  DCELSEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPG-------RKPDSR  1910
             D +   V  P  VPF WE  PGK + E    +    +   +P+LPPG       RKP++R
Sbjct  55    DIKSGPVRNPGTVPFQWEHQPGKPKDERKPVLQSNVERHFVPKLPPGRERVELVRKPEAR  114

Query  1909  RFYSCERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLE  1730
               +  +  C+  S  +  E    K+H++  D          ++D +G            E
Sbjct  115   ADHQTKTVCNNVS-SYHVE--DAKSHSSRFD----------DYDSDGTYLDATDTLSRSE  161

Query  1729  SLSLNCSIGDLSGCQGLD----VEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPRL  1562
             S   NCS  ++SG  GLD    + E    +     ++D MM RFLPAAKA    T  P L
Sbjct  162   SFFFNCS--NVSGVSGLDGSGILAEPFGTLSSDRQTQDLMMGRFLPAAKALTSETP-PHL  218

Query  1561  VKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHK--------WSRKFWKLFPRL  1406
             V++  K E  V               ++    + ++DQ +         +     L P++
Sbjct  219   VRKPPKPEEPVKQLKKKQNK----VEQNPYRFHHSLDQEEEEDENTNSMASGVCGLVPQI  274

Query  1405  SVKTSLGLLNPFPGMKSKTQTPAS  1334
              +++SLGLLNP P ++ + Q   S
Sbjct  275   CLRSSLGLLNPVPSVRMQAQRAVS  298



>ref|XP_009102870.1| PREDICTED: uncharacterized protein LOC103828973 isoform X2 [Brassica 
rapa]
Length=486

 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 148/614 (24%), Positives = 236/614 (38%), Gaps = 161/614 (26%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M + +LN   P++S RR+++    +    R+N       +      L    S+  L +VT
Sbjct  1     MAERRLNFKAPLLSTRRMHNTAVSV----RRN-------KSNNNFTLDSTTSEMGLDQVT  49

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
             +  +VPF W+Q+PG+ +G +      C D    P LPPG                  SFR
Sbjct  50    EVASVPFTWKQSPGRLKGHDSSPQKVC-DQVVTPCLPPGNL----------------SFR  92

Query  1864  FQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDLSGCQ  1685
                        A  ++   E +                   D     S N SI  +SG  
Sbjct  93    -----------AKQVEEDSEDVFSDAH--------------DTHSYFSPNHSITGVSGYS  127

Query  1684  GLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPRL-------------------  1562
              ++ +   +D +    SRDFM++RFLPAAKA  +  EQP                     
Sbjct  128   VVETKNLSEDPQ----SRDFMLNRFLPAAKA--MTVEQPHYGSNRKPSSFMSEPTIQIRD  181

Query  1561  -VKEAK-----KYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSV  1400
              V E K     +Y+   +S Y D+  D+  E   EE D+   +    SR+   +FP+L  
Sbjct  182   SVPEEKRKTPNRYDKSTLSPYYDHHQDIDNEESVEEEDDEVSEYAYLSRRGCGMFPQLCF  241

Query  1399  KTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYDAIC  1220
             K S+ +LN   G KSK  +P   S ++VK       S  +++ +  +   I++ + D++ 
Sbjct  242   KESVAMLN--TGFKSKQNSP---SHDQVK-------SSKVSQLKSRFQS-IKQLALDSVS  288

Query  1219  KQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRFSEGTGFLGVPR  1040
             K +     LS            +   Y H    +  +SP+RN    S F   T      +
Sbjct  289   KHKLGGKVLSPVHPNLTSSASMSSSPYRH----TKCMSPFRN---GSPFHRDTR-----K  336

Query  1039  EAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVDSVNYVKTTSLDLC  860
             E E+L+ +  +              K      + S S ++EKTVYVD+ +  KT      
Sbjct  337   ETESLRANRLN--------------KHISNISNASASSLLEKTVYVDTEDSPKTNI----  378

Query  859   SSKPEGLMDPEEFKDLPERTSSNPNQEPNQKRGSSTSRSSRENFKPDYRSYSDVTsslsp  680
                   ++ PEE +  P+   +N   E   K  SS  RS      P   S          
Sbjct  379   ------MIFPEEVEKKPD---TNLELEELGKINSSPGRSLLAPPLPKKPS----------  419

Query  679   ypplpkspSESWLWRTLPSIPSRGGHNDQTNQSPRATN------TATKREITVSSCSEHH  518
                      ESWL   LPS+ +    + +    P+  +      + TK E  V +   H 
Sbjct  420   ---------ESWLLHNLPSVVNSQTSSRRYTFHPKKESFNENSISVTKWETIVKTSYMHR  470

Query  517   CNSYYTEELIPYGS  476
              +  Y+EEL+ + S
Sbjct  471   DHIRYSEELVAHTS  484



>ref|XP_010469774.1| PREDICTED: uncharacterized protein LOC104749776 [Camelina sativa]
 ref|XP_010469775.1| PREDICTED: uncharacterized protein LOC104749776 [Camelina sativa]
 ref|XP_010469776.1| PREDICTED: uncharacterized protein LOC104749776 [Camelina sativa]
Length=596

 Score = 76.3 bits (186),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 96/351 (27%), Positives = 147/351 (42%), Gaps = 67/351 (19%)
 Frame = -1

Query  2233  CVVMEKTKLNLSVPIISVRR------INSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPK  2072
              ++ME+ +L+ + P+IS+RR        S  R  + V  K + +P            V K
Sbjct  5     SLMMEEKQLDFNRPLISIRRPTQTSESESKTRSFDSVTNKVLPSPP-----------VYK  53

Query  2071  SDCELSEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCE  1892
             SD +   V  P  VPF WE  PGK + E    +    +P  +P+LPPGR+    R     
Sbjct  54    SDIKSGPVRNPGTVPFQWEHQPGKPKDERKPVLQSNVEPHFVPKLPPGRE----RVELVR  109

Query  1891  RPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLS  1721
             +P      R   +   + N+ +              FD    D       D L   ES  
Sbjct  110   KP----EARADHQTKTVSNNVSSYHVEDAKSHNSSRFDDYDSDGTYLDATDTLSRSESFF  165

Query  1720  LNCSIGDLSGCQGLD----VEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQ-PRLVK  1556
              NCS  ++SG  GLD    V E    +     ++D MM RFLPAAKA  L +E  P LV+
Sbjct  166   FNCS--NVSGVNGLDGSGIVVEPFGTLSSDRQTQDLMMGRFLPAAKA--LTSETPPHLVR  221

Query  1555  EAKKYEPYV------MSYYSDYAGDVVTenedeendNMTIDQHK--------WSRKFWKL  1418
             +  K E  V      + +  +    V    ++    + ++DQ +         +     L
Sbjct  222   KPPKPEEPVKQLNKKVVFVKEKQNKV---EQNPYRFHHSLDQEEEEDENTSSMASGVCGL  278

Query  1417  FPRLSVKTSLGLLNPFPG-------------MKSKTQTPASSSTNEVKRLT  1304
              P++ +++SLGLLNP P              M+SK Q PA ++ ++ K  T
Sbjct  279   VPQICLRSSLGLLNPVPSVRMQAPRAVSVRRMRSKYQDPAPTNESQNKVQT  329



>ref|XP_006293862.1| hypothetical protein CARUB_v10022845mg [Capsella rubella]
 gb|EOA26760.1| hypothetical protein CARUB_v10022845mg [Capsella rubella]
Length=605

 Score = 75.9 bits (185),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 97/359 (27%), Positives = 151/359 (42%), Gaps = 59/359 (16%)
 Frame = -1

Query  2233  CVVMEKTKLNLSVPIISVRR------INSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPK  2072
              ++ME+ +L+ + P+ISVRR        S  R  + V  K +             L V K
Sbjct  5     SLMMEEKQLDFNRPLISVRRPAQTSESESKTRSYDSVTNKVL-----------PSLPVYK  53

Query  2071  SDCELSEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCE  1892
             SD +   V  P  VPF WE  PGK + E+   +    +P  +P+LPPGRK    R     
Sbjct  54    SDIKSGPVRIPGTVPFQWEHMPGKPKDESKPVLLSTVEPHFVPKLPPGRK----RIELGT  109

Query  1891  RPCHEDSFRFQTEPLALKNHAALMDS--LVESMLGKGEFDVEGRDSRECTNPDVL---ES  1727
             +P      + +     + + ++  D   + ++      +D    D       D L   ES
Sbjct  110   KPETRADHQTKAASNNVSSSSSSSDKYHVEDAKSYSSRYDDYDSDGTYLDATDTLSRSES  169

Query  1726  LSLNCSIGDLSGCQGLD----VEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPRLV  1559
                NCS  ++SG  GLD    + E    +     ++D MM RFLPAAKA  L +E P  +
Sbjct  170   FFYNCS--NVSGVSGLDGSGILVEPFGTLSSDRQTQDLMMGRFLPAAKA--LTSETPPHL  225

Query  1558  --KEAKKYEP--YVMSYYSDYAGDVVTenedeendNMTIDQHK--------WSRKFWKLF  1415
               K  K  EP   +M              ++    + ++DQ +         +     L 
Sbjct  226   ARKPPKPEEPAKQLMKKAVLVKEKQNKVEQNPYRFHHSVDQEEEEDENTSSMASGVCGLV  285

Query  1414  PRLSVKTSLGLLNPFPG-------------MKSKTQTPASSSTNEVKRLTRNAPSGPLN  1277
             P+L +++SLGLLNP P              M+SK Q PA S+ ++ K++  +     LN
Sbjct  286   PQLCLRSSLGLLNPIPSVRMQAQKAVSVRRMRSKYQDPAPSNESQNKQINEDKRKLKLN  344



>ref|XP_009416505.1| PREDICTED: uncharacterized protein LOC103997090 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416506.1| PREDICTED: uncharacterized protein LOC103997090 [Musa acuminata 
subsp. malaccensis]
Length=665

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 126/501 (25%), Positives = 201/501 (40%), Gaps = 77/501 (15%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVN---RKNVEnpqpnrqqqrqPLCVPKSDCEL  2057
             +ME  K++L  P++SVRR ++                E  Q     +R  L   KSD + 
Sbjct  5     LMEDKKIDLDAPLLSVRRFSAGAVAASSPTPPVSNGEEGDQRPPPPRRSSLPFYKSDLKS  64

Query  2056  SEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRF--YSCERPC  1883
               V  P  VPF WEQ PG+ +  +G        P   P+ PPG    +R+   ++ +   
Sbjct  65    GPVRVPGVVPFVWEQTPGQPK--DGSVRSSNVKPLVAPKPPPGNSVRTRKAVTFASDYVT  122

Query  1882  HEDSFRFQTEPLALKNHAALMDSLV------ESMLGKGEFDVEGRDSRECTNP--DVLES  1727
                S   + +P  ++      +  V      + +L     + E  +  +  +   D L++
Sbjct  123   ARSSESPKDDPKIVEGENVDKEEKVGKKPEHQPVLAVDNREEEVEEDDDDNDAFSDALDT  182

Query  1726  LS------LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAA--------  1589
             LS      +NCS+  LSG        GR    P    RDFM+ RFLPAA+A         
Sbjct  183   LSRTDSMLMNCSVSGLSGVPEAAKLSGRFPKDPP--VRDFMLERFLPAAQAMACESPQYA  240

Query  1588  -----------------VLVTEQPRLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNM  1460
                              VL+++  R      + +P  + +Y+     V + ++DEE++  
Sbjct  241   FRKATAPPREAIKPTDRVLISDNRRPAPIPYQNKPDYVPHYAKELEQVDSYDDDEEDEEY  300

Query  1459  TIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPL  1280
               D    S K   L P+  +K+S  LLNP P MK             V+R  R  P G  
Sbjct  301   YQDAGNLSSKACGLLPKFCLKSSFCLLNPVPVMK-------------VQRHLRRPPRGRT  347

Query  1279  NKARKAYSGPI------EKQSYDAICKQRFRS--GALSGELC--KADKRGLKADGQYPHG  1130
                +     P+      E+ S+ A+ + +      A   EL   +++   L  DG  P+ 
Sbjct  348   GNPQIRNMHPLSHSRVEEEPSWGAVFRHKLEQEHQAQVAELSRFRSESDSLTPDGSSPYQ  407

Query  1129  GSRSGAISPYRNVTTSSRFSEGTGFLG-VPREAENLKGSMFSSFREVDTHLWDTPIKSSF  953
              S     SPY++    +   E  G LG V RE+++ K        +V  + W+  I  S 
Sbjct  408   HS---VTSPYQSEGPPTSLHEEKGPLGVVSRESKSSKADGSDVGEKVVENHWE--INHSS  462

Query  952   KGESDSPSDVVEKTVYVDSVN  890
             +  S + S   EKT+YVD  N
Sbjct  463   QMGSGTMSPAPEKTLYVDVEN  483



>ref|XP_010510260.1| PREDICTED: uncharacterized protein LOC104786530 [Camelina sativa]
Length=595

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 92/340 (27%), Positives = 144/340 (42%), Gaps = 55/340 (16%)
 Frame = -1

Query  2230  VVMEKTKLNLSVPIISVRR------INSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKS  2069
             ++ME+ +L+ + P+IS+RR        S  R  + V  K + +P            V KS
Sbjct  6     LMMEEKQLDFNRPLISIRRPMQTSESESKTRSFDSVTNKVLPSPP-----------VYKS  54

Query  2068  DCELSEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCER  1889
             D +   V  P  VPF WE  PGK + E    +    +P  +P+LPPGR        +  R
Sbjct  55    DIKSGPVRNPGTVPFQWEHQPGKPKDERKPVLQSNVEPHFVPKLPPGRVRVELVRKAEAR  114

Query  1888  PCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCS  1709
               H      QT+ ++    +  ++    S     ++D +G            ES   NCS
Sbjct  115   ADH------QTKTVSNNVSSYHVEDAKSSSSRFDDYDSDGTYLDATDTLSRSESFFFNCS  168

Query  1708  IGDLSGCQGLD----VEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPRLVKEAKKY  1541
               ++SG  GLD    + E    +     ++D MM RFLPAAKA    T  P LV++  K 
Sbjct  169   --NVSGVNGLDGSGILVEPFGTLSSDRQTQDLMMGRFLPAAKALTSET-SPHLVRKPPKP  225

Query  1540  EPYVMSYYSDYAGDVVTenedeendNMTIDQHK--------WSRKFWKLFPRLSVKTSLG  1385
             E  V               ++    + ++DQ +         +     L P++ +++SLG
Sbjct  226   EEPVKQLKKKQNK----VEQNPYRFHHSLDQEEEEDENTSSMASGVCGLVPQICLRSSLG  281

Query  1384  LLNPFPG-------------MKSKTQTPASSSTNEVKRLT  1304
             LLNP P              M+SK Q PAS++ ++ K  T
Sbjct  282   LLNPVPSVRMQAQRAVSVRRMRSKYQDPASTNESQNKVQT  321



>ref|XP_010920169.1| PREDICTED: uncharacterized protein LOC105044068 [Elaeis guineensis]
 ref|XP_010920176.1| PREDICTED: uncharacterized protein LOC105044068 [Elaeis guineensis]
Length=720

 Score = 74.7 bits (182),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 97/326 (30%), Positives = 136/326 (42%), Gaps = 52/326 (16%)
 Frame = -1

Query  1732  ESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQ------  1571
             ES  +NCS+  LSG     +  G     P    RDFMM RFLPAA+A    + Q      
Sbjct  203   ESFFMNCSVSGLSGIPESAMPSGSFSTDP--QVRDFMMGRFLPAAQAMATGSPQYTFRKG  260

Query  1570  ------------PRLVKE---------AKKYEPYVMSYYSDYAGDVVTenedeendNMTI  1454
                          R+V            +K   +V  Y  ++ G    ++E+EE D    
Sbjct  261   TPPAREPPTRPAERVVSRDHRRPLPLPYQKRPNFVQQYAQEHEGGDSYDDEEEEEDCDE-  319

Query  1453  DQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNK  1274
                +   K   L PR  VK+S  LLNP PGMK + + PA           +    G L +
Sbjct  320   -TDRLPSKACGLLPRFCVKSSFCLLNPVPGMKVRPRLPAPLGRRIGNPRIKTFHHGSLGE  378

Query  1273  ARKAYSGPIEKQSYDAICK----QRFRSGALSGE-LCKADKRGL-------KADGQYPHG  1130
             A        ++ S++A+ K    QR++     G     ++ + L        ADG  P  
Sbjct  379   AG-------DEDSWEAVYKHKLGQRYQPQVEDGRSKSTSESKQLTYWSDSPTADGSSPCR  431

Query  1129  GSRSGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVD-THLWDTPIKSSF  953
              S  G ISP  N      F EG GFLGVP+       +  S   E D  + W+     S 
Sbjct  432   RSTGGGISPNPNEAPPLPF-EGKGFLGVPKRGRKSSKTDGSDSCERDGENYWEMTPPQSS  490

Query  952   KGESDSPSDVVEKTVYVDSVNYVKTT  875
             +  S S S  +EKT+YVDSVN ++T+
Sbjct  491   QQGSGSRSPALEKTLYVDSVNMLETS  516



>ref|XP_002881148.1| hypothetical protein ARALYDRAFT_482023 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57407.1| hypothetical protein ARALYDRAFT_482023 [Arabidopsis lyrata subsp. 
lyrata]
Length=591

 Score = 73.6 bits (179),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 105/415 (25%), Positives = 160/415 (39%), Gaps = 110/415 (27%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRR------INSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDC  2063
             ME+ +L+ + P+ISVRR        S  R  +  N K                 V KSD 
Sbjct  1     MEERQLDFNRPLISVRRPAQTSESESKTRSFDAANSK-----------IPPSPPVYKSDI  49

Query  2062  ELSEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPG-------RKPDSRRF  1904
             +   V  P  VPF WE  PGK + E    +    +P  +P+LPPG       RKP++R  
Sbjct  50    KSGPVRNPGTVPFQWEHKPGKPKDERKPVLQSFVEPHFVPKLPPGRERVELVRKPETRAD  109

Query  1903  YSCERPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESL  1724
             +  +     D +      L  +  +       +        D     SR        ES 
Sbjct  110   HQTKTVSSSDKY------LVEEAKSYSSRYDDDDDSDGTYLDATDTLSRS-------ESF  156

Query  1723  SLNCSIGDLSGCQGLD----VEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVT-------  1577
               NCS   +SG  GLD    + E    +     ++D MM RFLPAAKA    T       
Sbjct  157   FFNCSA--VSGVSGLDGSGILVEPFGTLSSDRQTQDLMMGRFLPAAKALTSETPPHLTRK  214

Query  1576  ----EQPR--------LVKEAK---KYEPYVMSYYSDYAGDVVTenedeendNMTIDQHK  1442
                 E+P         LVKE +   +  PY   + SD   +               D++ 
Sbjct  215   PPKPEEPTKQLMKKVVLVKEKQNKVEQNPYRFHHSSDQEEE---------------DENT  259

Query  1441  WS--RKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRL-TRNAPSGPLNKA  1271
              S       L P++ +++SLGLLNP P ++ + Q   S     V+R+ ++   S P N+ 
Sbjct  260   SSMGSSICGLVPQICLRSSLGLLNPVPSVRMQAQRAVS-----VRRMRSKYQDSTPCNEI  314

Query  1270  RKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAIS  1106
             +       +K++Y+ +                 DKR LK +G      S+  ++S
Sbjct  315   Q-------DKKTYETV---------------NEDKRKLKLNGSVAQVHSQDESLS  347



>ref|XP_009102868.1| PREDICTED: uncharacterized protein LOC103828973 isoform X1 [Brassica 
rapa]
Length=493

 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 121/496 (24%), Positives = 196/496 (40%), Gaps = 126/496 (25%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             M + +LN   P++S RR+++    +    R+N       +      L    S+  L +VT
Sbjct  1     MAERRLNFKAPLLSTRRMHNTAVSV----RRN-------KSNNNFTLDSTTSEMGLDQVT  49

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHEDSFR  1865
             +  +VPF W+Q+PG+ +G +      C D    P LPPG                  SFR
Sbjct  50    EVASVPFTWKQSPGRLKGHDSSPQKVC-DQVVTPCLPPGNL----------------SFR  92

Query  1864  FQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDLSGCQ  1685
                        A  ++   E +                   D     S N SI  +SG  
Sbjct  93    -----------AKQVEEDSEDVFSDAH--------------DTHSYFSPNHSITGVSGYS  127

Query  1684  GLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPRL-------------------  1562
              ++ +   +D +    SRDFM++RFLPAAKA  +  EQP                     
Sbjct  128   VVETKNLSEDPQ----SRDFMLNRFLPAAKA--MTVEQPHYGSNRKPSSFMSEPTIQIRD  181

Query  1561  -VKEAK-----KYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSV  1400
              V E K     +Y+   +S Y D+  D+  E   EE D+   +    SR+   +FP+L  
Sbjct  182   SVPEEKRKTPNRYDKSTLSPYYDHHQDIDNEESVEEEDDEVSEYAYLSRRGCGMFPQLCF  241

Query  1399  KTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYDAIC  1220
             K S+ +LN   G KSK  +P   S ++VK       S  +++ +  +   I++ + D++ 
Sbjct  242   KESVAMLN--TGFKSKQNSP---SHDQVK-------SSKVSQLKSRFQS-IKQLALDSVS  288

Query  1219  KQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRFSEGTGFLGVPR  1040
             K +     LS            +   Y H    +  +SP+RN    S F   T      +
Sbjct  289   KHKLGGKVLSPVHPNLTSSASMSSSPYRH----TKCMSPFRN---GSPFHRDTR-----K  336

Query  1039  EAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVDSVNYVKTTSLDL-  863
             E E+L+ +  +              K      + S S ++EKTVYVD+ +  KT  +   
Sbjct  337   ETESLRANRLN--------------KHISNISNASASSLLEKTVYVDTEDSPKTNIMIFP  382

Query  862   --CSSKPEGLMDPEEF  821
                  KP+  ++ EE 
Sbjct  383   EEVEKKPDTNLELEEL  398



>ref|XP_006410215.1| hypothetical protein EUTSA_v10016438mg [Eutrema salsugineum]
 ref|XP_006410216.1| hypothetical protein EUTSA_v10016438mg [Eutrema salsugineum]
 gb|ESQ51668.1| hypothetical protein EUTSA_v10016438mg [Eutrema salsugineum]
 gb|ESQ51669.1| hypothetical protein EUTSA_v10016438mg [Eutrema salsugineum]
Length=573

 Score = 73.6 bits (179),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 146/585 (25%), Positives = 230/585 (39%), Gaps = 112/585 (19%)
 Frame = -1

Query  2233  CVVMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVP------K  2072
              ++ME+ +L+ + P+ISVRR             +  E+             +P      K
Sbjct  3     MMMMEEKQLDFNRPLISVRRPT-----------QASESESKATSSDSLTSKIPPSPPVYK  51

Query  2071  SDCELSEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCE  1892
             SD +   V  P  VPF WE  PGK + E         +   +P+LPPG     RR  +  
Sbjct  52    SDIKSGPVRNPGTVPFQWEHKPGKPKDERKPDSQGLVETHFVPKLPPG-----RRVMNGS  106

Query  1891  RPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNC  1712
             R   E   + +T+  +    A    S  +    +   D     SR        ES   NC
Sbjct  107   REREESGKKSETDTRSNVEDAKSYSSRYDDDSDETYLDATDTLSR-------TESFFFNC  159

Query  1711  SIGDLSGCQGLDVEEGRDDVKPSG------DSRDFMMSRFLPAAKAAVLVTEQPRLV--K  1556
             S  ++SG  G  +      V+P G       ++D MM RFLPAAKA  L +E P L+  K
Sbjct  160   S--NVSGVDGQGIL-----VEPFGTLSSDRKTQDLMMGRFLPAAKA--LTSETPPLLARK  210

Query  1555  EAKKYEPYV--MSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSVKTSLGL  1382
               K  EP +  +    +            + + +  +          L P++ +++S G+
Sbjct  211   PPKPEEPAMKKLVLVKEKQNKAEQNPYRFQQEEVGKNTSSMGSGVCGLVPQICLRSSFGV  270

Query  1381  LNPFPGMKSKTQTPASSSTNEVKRL-TRNAPSGPLNKARKAYSGPIEKQSYDAICKQRFR  1205
             LN  P ++ + Q   S     V+R+ ++   S P N+ +        KQ           
Sbjct  271   LNLVPSVRMQAQRAVS-----VRRMRSKYQDSTPCNEIQN-------KQ-----------  307

Query  1204  SGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSR--FSEGTGFLGVPREAE  1031
                 + E    DKR LK +G    G S   + +P R  + +SR   S+  G L    +  
Sbjct  308   ----TNETVNEDKRKLKLNGSVAQGPSFPVSSTPERKESAASRTKISKNFGELLASDDTT  363

Query  1030  ---NLKGSMFSSFREVDT-HLWDTPIKSSFKGES---DSPS-DVV--------------E  917
                +L+  +      VDT H  D  ++  FK ES   D PS DVV              E
Sbjct  364   WKPSLEAPVAEKTLYVDTVHSVDKKVQEEFKEESLLKDYPSVDVVPVKEDAQSLIGAGEE  423

Query  916   KTVYV---DSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPNQKRGSSTSR  746
             + +YV   +      +  ++ C      +  P+    + E T    + E   +R ++   
Sbjct  424   EKIYVKRDEDTTEFSSLKVEECPDHAIVVALPKSIV-VEEITKEKIDLEAQLQRNTTNLE  482

Query  745   SSRENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPSIPSR  611
             SSR + +  Y               LPK+PS+SWL RTLP+IPS+
Sbjct  483   SSRLHHRSTYHIVPPPP--------LPKAPSDSWLKRTLPTIPSK  519



>emb|CDX94655.1| BnaC07g10030D [Brassica napus]
Length=486

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 152/618 (25%), Positives = 245/618 (40%), Gaps = 169/618 (27%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINS---NVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELS  2054
             M + +LN   P++S RR+++   +VR  + +N  +                   S+  L 
Sbjct  1     MAERRLNFKAPLLSTRRLHNTAVSVRRNKSINFTHDSKT---------------SELGLD  45

Query  2053  EVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHED  1874
             +VT+  +VPF WEQ+PG+ +G +  K     D    P LPPG                  
Sbjct  46    QVTEAASVPFTWEQSPGRLKGHDS-KPQQVSDQVFTPCLPPGNL----------------  88

Query  1873  SFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLSLNCSIGDLS  1694
             SFR                  V+ +  + E DV   D+R     D     S N SI  +S
Sbjct  89    SFR------------------VKHVEEEEEEDVFS-DAR-----DTYSYFSANHSITGVS  124

Query  1693  GCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPR-----------------  1565
             G   ++ +   +D      SRDFM++RFLPAAKA  +  EQP                  
Sbjct  125   GYSVVETKNPSED----HQSRDFMLNRFLPAAKA--MTVEQPHYGSNRKPSTFMPEPTIQ  178

Query  1564  ---LVKEAK-----KYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPR  1409
                LV + K     +Y+   +  Y D+   V  E   EE+D+   +    SR+   +FP+
Sbjct  179   KRDLVPDEKRQTRNRYDKSTLLPYYDHHQGVDNEESVEEDDDEVSEYAYLSRRGCGMFPQ  238

Query  1408  LSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYD  1229
             L  K S+ +L+   G +SK  +P   S ++VK       S  +++ +  +   I++ + D
Sbjct  239   LCFKESVAMLS--TGFQSKQNSP---SHDQVK-------SSKVSQLKSRFQS-IKQLALD  285

Query  1228  AICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRFSEGTGFLG  1049
             ++ K +     L G++       L +        + S + SPYR+    S F  G+ F  
Sbjct  286   SVSKHK-----LGGKVLSPVHPNLSS--------AASMSSSPYRHTRCMSPFRNGSPFHP  332

Query  1048  VPR-EAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVDSVNYVKTTS  872
               R E E+L+ +  +              K      + S S ++EKTVYVD+ +  KT  
Sbjct  333   DTRKETESLRANRLN--------------KHISNISNASASSLLEKTVYVDTEDSPKTNI  378

Query  871   LDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPNQKRGSSTSRSSRENFKPDYRSYSDVTs  692
                        + PEE +  P+   +N   E   K  SS  RS      P+  S      
Sbjct  379   ----------KIFPEEVEKKPD---TNLELEELGKINSSPGRSLLAPPLPNKPS------  419

Query  691   slspypplpkspSESWLWRTLPSIPSRGGHNDQTNQSPRATN------TATKREITVSSC  530
                          ESWL   LPS+ +    + +    P+  +      + TK E  V + 
Sbjct  420   -------------ESWLLHNLPSVVNSQTSSRRYTFHPKKESFNENSISVTKWETIVKTS  466

Query  529   SEHHCNSYYTEELIPYGS  476
               H  +  Y+EEL+ + S
Sbjct  467   YMHRDHIRYSEELVAHTS  484



>gb|AAV63883.1| hypothetical protein At2g30990 [Arabidopsis thaliana]
Length=444

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 86/322 (27%), Positives = 132/322 (41%), Gaps = 54/322 (17%)
 Frame = -1

Query  2233  CVVMEKTKLNLSVPIISVRR------INSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPK  2072
              ++ME+ +L+ + P+IS+RR        S  R  + V                    V K
Sbjct  5     SLMMEEKQLDFNRPLISIRRPTQTSESESKTRSFDSVTN-----------MIPPSPPVYK  53

Query  2071  SDCELSEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCE  1892
             SD +   V  P  VPF WE  PGK + E    +    +P  +P+LPPGR+    R     
Sbjct  54    SDIKSGPVRNPGTVPFQWEHKPGKPKDERKPVLQSFVEPHFVPKLPPGRE----RVVELG  109

Query  1891  RPCHEDSFRFQTEPLALKNHAALMDSLVES-------MLGKGEFDVEGRDSRECTNPDVL  1733
             R         QT+ ++  +   + D+   S           G + ++  D+   T     
Sbjct  110   RKPESTGADHQTKTVSSSDKYLVEDAKSNSSRYDDDDDDSDGTY-LDATDTLSRT-----  163

Query  1732  ESLSLNCSIGDLSGCQGLD----VEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQ-P  1568
             ES   NCS   +SG  GLD    + E    +     ++D MM RFLPAAKA  L +E  P
Sbjct  164   ESFFFNCSA--VSGASGLDGSGILVEPFGTLSTDRQTQDLMMGRFLPAAKA--LTSESPP  219

Query  1567  RLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHK--------WSRKFWKLFP  1412
              L ++  K E  V          V    ++      + DQ +         +     L P
Sbjct  220   HLARKPPKPEEPVKQLMKKKQNKV---EQNPYRFRHSPDQEEEDGNISSMMASGVCGLLP  276

Query  1411  RLSVKTSLGLLNPFPGMKSKTQ  1346
             +L +++SLGLLNP P ++ + Q
Sbjct  277   QLCLRSSLGLLNPVPSVRMQQQ  298



>dbj|BAH20020.1| AT2G30990 [Arabidopsis thaliana]
Length=593

 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 87/326 (27%), Positives = 133/326 (41%), Gaps = 54/326 (17%)
 Frame = -1

Query  2233  CVVMEKTKLNLSVPIISVRR------INSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPK  2072
              ++ME+ +L+ + P+IS+RR        S  R  + V                    V K
Sbjct  5     SLMMEEKQLDFNRPLISIRRPTQTSESESKTRSFDSVTN-----------MIPPSPPVYK  53

Query  2071  SDCELSEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCE  1892
             SD +   V  P  VPF WE  PGK + E    +    +P  +P+LPPGR+    R     
Sbjct  54    SDIKSGPVRNPGTVPFQWEHKPGKPKDERKPVLQSFVEPHFVPKLPPGRE----RVVELG  109

Query  1891  RPCHEDSFRFQTEPLALKNHAALMDSLVES-------MLGKGEFDVEGRDSRECTNPDVL  1733
             R         QT+ ++  +   + D+   S           G + ++  D+   T     
Sbjct  110   RKPESTGANHQTKTVSSSDKYLVEDAKSNSSRYDDDDDDSDGTY-LDATDTLSRT-----  163

Query  1732  ESLSLNCSIGDLSGCQGLD----VEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQ-P  1568
             ES   NCS   +SG  GLD    + E    +     ++D MM RFLPAAKA  L +E  P
Sbjct  164   ESFFFNCSA--VSGASGLDGSGILVEPFGTLSTDRQTQDLMMGRFLPAAKA--LTSESPP  219

Query  1567  RLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHK--------WSRKFWKLFP  1412
              L ++  K E  V          V    ++      + DQ +         +     L P
Sbjct  220   HLARKPPKPEEPVKQLMKKKQNKV---EQNPYRFRHSPDQEEEDGNISSMMASGVCGLLP  276

Query  1411  RLSVKTSLGLLNPFPGMKSKTQTPAS  1334
             +L +++SLGLLNP P ++ + Q   S
Sbjct  277   QLCLRSSLGLLNPVPSVRMQQQRAVS  302



>ref|NP_001031451.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_180656.3| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC08472.1| uncharacterized protein AT2G30990 [Arabidopsis thaliana]
 gb|AEC08473.1| uncharacterized protein AT2G30990 [Arabidopsis thaliana]
Length=593

 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 87/326 (27%), Positives = 133/326 (41%), Gaps = 54/326 (17%)
 Frame = -1

Query  2233  CVVMEKTKLNLSVPIISVRR------INSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPK  2072
              ++ME+ +L+ + P+IS+RR        S  R  + V                    V K
Sbjct  5     SLMMEEKQLDFNRPLISIRRPTQTSESESKTRSFDSVTN-----------MIPPSPPVYK  53

Query  2071  SDCELSEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCE  1892
             SD +   V  P  VPF WE  PGK + E    +    +P  +P+LPPGR+    R     
Sbjct  54    SDIKSGPVRNPGTVPFQWEHKPGKPKDERKPVLQSFVEPHFVPKLPPGRE----RVVELG  109

Query  1891  RPCHEDSFRFQTEPLALKNHAALMDSLVES-------MLGKGEFDVEGRDSRECTNPDVL  1733
             R         QT+ ++  +   + D+   S           G + ++  D+   T     
Sbjct  110   RKPESTGADHQTKTVSSSDKYLVEDAKSNSSRYDDDDDDSDGTY-LDATDTLSRT-----  163

Query  1732  ESLSLNCSIGDLSGCQGLD----VEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQ-P  1568
             ES   NCS   +SG  GLD    + E    +     ++D MM RFLPAAKA  L +E  P
Sbjct  164   ESFFFNCSA--VSGASGLDGSGILVEPFGTLSTDRQTQDLMMGRFLPAAKA--LTSESPP  219

Query  1567  RLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHK--------WSRKFWKLFP  1412
              L ++  K E  V          V    ++      + DQ +         +     L P
Sbjct  220   HLARKPPKPEEPVKQLMKKKQNKV---EQNPYRFRHSPDQEEEDGNISSMMASGVCGLLP  276

Query  1411  RLSVKTSLGLLNPFPGMKSKTQTPAS  1334
             +L +++SLGLLNP P ++ + Q   S
Sbjct  277   QLCLRSSLGLLNPVPSVRMQQQRAVS  302



>ref|XP_004504294.1| PREDICTED: uncharacterized protein LOC101497431 [Cicer arietinum]
Length=461

 Score = 68.9 bits (167),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 85/276 (31%), Positives = 122/276 (44%), Gaps = 42/276 (15%)
 Frame = -1

Query  1732  ESLSLNCSIGDLSGCQGLDVEEGRDDVKPSG-DSRDFMMSRFLPAAKAAVL---------  1583
             ESLS+ CS    SG   LD  + R     +   S+DFMM+RFLPAAKA  L         
Sbjct  65    ESLSMKCS---ESGLDNLDANKCRSKTSSTDKQSQDFMMNRFLPAAKAMTLKPPQHAPRK  121

Query  1582  ----VTEQP--RLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWK  1421
                 + EQP  +LV E KK    ++ Y   Y  +   E    E    T D    S K   
Sbjct  122   QQSVLLEQPSTKLVSEEKKTFVDIIPYTDQYQEEEQEEESGHE----TDDYTNTSAKGCG  177

Query  1420  LFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIEK  1241
             LFP   +K SL LLN  P  K + Q   S  + EV++  +   S   +  R   SGP  K
Sbjct  178   LFPSSCIKNSLCLLNQIPETKMENQI--SMWSYEVEKPNK---SSHFSSYR---SGPTIK  229

Query  1240  QSYDAICKQRFRSGALSGELCKADKRGL--KADGQYPHGGSRSGAISPYRNVTTSSRFSE  1067
             +++DAI K + RSGA S ++ +  K     +       G + +  IS +++   S    +
Sbjct  230   KAWDAIHKSKSRSGASSPDMHETRKLNQLSRLSSVRRSGTAAAAGISSFQSKPQSPF--Q  287

Query  1066  GTGFLGVPREAEN-------LKGSMFSSFREVDTHL  980
             G    G  + AEN        +    +SF+EV + +
Sbjct  288   GARMFGDSKHAENNQFRKLKFQSQEHASFQEVQSQV  323



>ref|XP_010666069.1| PREDICTED: uncharacterized protein LOC104883279 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010666070.1| PREDICTED: uncharacterized protein LOC104883279 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010666071.1| PREDICTED: uncharacterized protein LOC104883279 [Beta vulgaris 
subsp. vulgaris]
Length=611

 Score = 69.3 bits (168),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 128/500 (26%), Positives = 200/500 (40%), Gaps = 85/500 (17%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEVT  2045
             ME  +LN + P++SVRR  S+V       R N     P        L   KS+ +   V 
Sbjct  1     MEGKQLNFNRPLLSVRR-GSSVTAPPENERDNTRRNLPP-------LPYYKSELKSGPVR  52

Query  2044  KPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCE--RPCHEDS  1871
              P  VPF WE  PG+ + +N  +    E     P+LPPGR  +  +  + E  R     S
Sbjct  53    NPGVVPFKWEHKPGRPKDKNTVQKDSLERLPPTPKLPPGRIINHVQKQTDEILRDTSTYS  112

Query  1870  FRFQTE---PLALKN--HAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLS-----  1721
              R+Q E   P +L+N  H  +   +  S   K E  +   +    T  D  ++LS     
Sbjct  113   SRYQAEINDPHSLQNSSHDQVFSEVEGSEKDKEEKGISSSEDDNITYVDARDTLSRNDSF  172

Query  1720  LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAV------------LVT  1577
              NCS+   SG  G+D             ++DFMM RFLPAAKA              +  
Sbjct  173   FNCSV---SGVSGVDCPASSGAFS-DPQTKDFMMDRFLPAAKAVASDTPPFASRRNPVAR  228

Query  1576  EQPRLVKEAKKYEPYVMSYYS--DYAGDVVT---enedeendNMTIDQHKWSRKFWKLFP  1412
             EQ + + +  K++     YYS  D   + +    ++E+E+ ++ + +    S K   L P
Sbjct  229   EQAKPMTKVIKWKKQPPQYYSIPDTLPNSINGEWKDEEEDEEDESDESEDLSVKLCGLMP  288

Query  1411  RLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYS----GPIE  1244
             R        LLNP PGM+   +    S    V+  + NA +   NK +        G ++
Sbjct  289   RFC------LLNPIPGMRDHVE--EISRVRSVRTRSSNATAYRDNKHKDMIKDNSRGELK  340

Query  1243  KQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRFSEG  1064
             + S+      ++    ++  L       L  +G   H           ++ +  S     
Sbjct  341   RTSH------QYAPAPMNESLMDI---HLSCNGMARH-----------KSASPQSFLDRE  380

Query  1063  TGFLGVPREAENLKGSMFSSFREVDTHL-WDTP-----IKSSFKGESDSPSDVVEKTVYV  902
                LG+P E  +  GS  +  +   T     TP     I SS    +D      EKTVYV
Sbjct  381   KKLLGLPGEPRDFHGSKLNLPQNGHTRFELATPRDTEEITSSVVNPAD------EKTVYV  434

Query  901   DSVNYVKTTSLDLCSSKPEG  842
             DS   V++   +  +S+  G
Sbjct  435   DSEKMVESRHSNSSTSESRG  454



>ref|XP_009391420.1| PREDICTED: uncharacterized protein LOC103977582 [Musa acuminata 
subsp. malaccensis]
Length=526

 Score = 68.9 bits (167),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 109/265 (41%), Gaps = 68/265 (26%)
 Frame = -1

Query  1744  PDVL---ESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGDS------RDFMMSRFLPAAKA  1592
             PD L   ES  +NCS+  LS          R+ VKPS  +      +DFMM+RFLPAA+A
Sbjct  180   PDALSRTESFLMNCSVSGLSSF--------REHVKPSTHASREPQVQDFMMARFLPAAQA  231

Query  1591  ------------AVLVTEQP-----RLVKEAKKYEPYVMSYYSDYAGDVVTenedeendN  1463
                         A     +P     RLV E  +  P +      ++    T+++ EE+D+
Sbjct  232   LASGSPQYTFRKAATPAREPTRATDRLVSENLRRSPLLHHRRPSHS----TDDDGEEDDD  287

Query  1462  MTIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGP  1283
                +  +       L P+ S+K+S  L NPFPGMK + +        E+ R      S  
Sbjct  288   DYDNHGRTPSGACGLLPKFSLKSSFCLFNPFPGMKHRGRHLPPPRRREIHRPQIKNSSQE  347

Query  1282  LNKARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISP  1103
              ++  K  S P                          ++RG     Q+    S  GA+SP
Sbjct  348   EDEGTKLTSKP--------------------------NRRGDSPTAQH----SIGGAVSP  377

Query  1102  YRNVTTSSRFSEGTGFLGVPREAEN  1028
             YR     S F EG GFLGVP +  N
Sbjct  378   YRYEAPPSPFREGRGFLGVPGKESN  402



>gb|AAR99352.1| hypothetical protein At2g30990 [Arabidopsis thaliana]
 gb|AAR99353.1| hypothetical protein At2g30990 [Arabidopsis thaliana]
Length=444

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 84/322 (26%), Positives = 131/322 (41%), Gaps = 54/322 (17%)
 Frame = -1

Query  2233  CVVMEKTKLNLSVPIISVRR------INSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPK  2072
              ++ME+ +L+ + P+IS+RR        S  R  + V                    V K
Sbjct  5     SLMMEEKQLDFNRPLISIRRPTQTSESESKTRSFDSVTN-----------MIPPSPPVYK  53

Query  2071  SDCELSEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCE  1892
             S+ +   V  P  VPF WE  PGK + E    +    +P  +P+LPPGR+    R     
Sbjct  54    SBIKSGPVRNPGTVPFQWEHKPGKPKDERKPVLQSFVEPHFVPKLPPGRE----RVVELG  109

Query  1891  RPCHEDSFRFQTEPLALKNHAALMDSLVES-------MLGKGEFDVEGRDSRECTNPDVL  1733
             R         QT+ ++  +   + D+   S           G + ++  D+   T     
Sbjct  110   RKPESTGADHQTKTVSSSDKYLVEDAKSNSSRYDDDDDDSDGTY-LDATDTLSRT-----  163

Query  1732  ESLSLNCSIGDLSGCQGLD----VEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQ-P  1568
             ES   NC    +SG  GLD    + E    +     ++D MM RFLPAAKA  L +E  P
Sbjct  164   ESFFFNCXA--VSGASGLDGSGILVEPFGTLSTDRQTQDLMMGRFLPAAKA--LTSESPP  219

Query  1567  RLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHK--------WSRKFWKLFP  1412
              L ++  K E  V          V    ++      + DQ +         +     L P
Sbjct  220   HLARKPPKPEEPVKQLMKKKQNKV---EQNPYRFRHSPDQEEEDGNISSMMASGVCGLLP  276

Query  1411  RLSVKTSLGLLNPFPGMKSKTQ  1346
             +L +++SLGLLNP P ++ + Q
Sbjct  277   QLCLRSSLGLLNPVPSVRMQQQ  298



>gb|AAC20733.1| hypothetical protein [Arabidopsis thaliana]
Length=581

 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 87/323 (27%), Positives = 131/323 (41%), Gaps = 54/323 (17%)
 Frame = -1

Query  2224  MEKTKLNLSVPIISVRR------INSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDC  2063
             ME+ +L+ + P+IS+RR        S  R  + V                    V KSD 
Sbjct  1     MEEKQLDFNRPLISIRRPTQTSESESKTRSFDSVTN-----------MIPPSPPVYKSDI  49

Query  2062  ELSEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPC  1883
             +   V  P  VPF WE  PGK + E    +    +P  +P+LPPGR+    R     R  
Sbjct  50    KSGPVRNPGTVPFQWEHKPGKPKDERKPVLQSFVEPHFVPKLPPGRE----RVVELGRKP  105

Query  1882  HEDSFRFQTEPLALKNHAALMDSLVES-------MLGKGEFDVEGRDSRECTNPDVLESL  1724
                    QT+ ++  +   + D+   S           G + ++  D+   T     ES 
Sbjct  106   ESTGADHQTKTVSSSDKYLVEDAKSNSSRYDDDDDDSDGTY-LDATDTLSRT-----ESF  159

Query  1723  SLNCSIGDLSGCQGLD----VEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQ-PRLV  1559
               NCS   +SG  GLD    + E    +     ++D MM RFLPAAKA  L +E  P L 
Sbjct  160   FFNCSA--VSGASGLDGSGILVEPFGTLSTDRQTQDLMMGRFLPAAKA--LTSESPPHLA  215

Query  1558  KEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHK--------WSRKFWKLFPRLS  1403
             ++  K E  V          V    ++      + DQ +         +     L P+L 
Sbjct  216   RKPPKPEEPVKQLMKKKQNKV---EQNPYRFRHSPDQEEEDGNISSMMASGVCGLLPQLC  272

Query  1402  VKTSLGLLNPFPGMKSKTQTPAS  1334
             +++SLGLLNP P ++ + Q   S
Sbjct  273   LRSSLGLLNPVPSVRMQQQRAVS  295



>ref|XP_004504531.1| PREDICTED: uncharacterized protein LOC101494821 [Cicer arietinum]
Length=293

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 88/307 (29%), Positives = 131/307 (43%), Gaps = 49/307 (16%)
 Frame = -1

Query  1720  LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKA--------------AVL  1583
             +NCS+  +SG    D ++          +R+FMM+RFLPAAKA               VL
Sbjct  1     MNCSVSGVSGLDNFDAKK-FGTFSTDQQTREFMMNRFLPAAKAMTIQPSQYSSKKQSVVL  59

Query  1582  VTEQPR----LVKEAKKYEPYVMSYYSD---YAGDVVTenedeendNMTIDQHK-WSRKF  1427
             V +Q R    LV+ AKK  P V  + +D   Y G V  +  ++E D    D       K 
Sbjct  60    VEQQLRDINKLVQNAKK--PLVNKHTTDIIPYTGQVQDDESEDEGDVYDNDNSASMLSKG  117

Query  1426  WKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNA---PSGPLNKARKAYS  1256
               L P L ++ SL LLNP  G+K K Q P  S++ EV +  +++      P+   +KA+ 
Sbjct  118   CGLLPNLHIRNSLSLLNPVAGIKMKNQGPLISAS-EVGKTNKSSHIRSFSPVPAVKKAWE  176

Query  1255  GPIEKQSYDAIC-----KQRFR-SGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRN  1094
                + +S + +        RF  SG L G L    +    A G  P    RS   SP+  
Sbjct  177   AIHKNKSSNEVAPLEIESNRFGFSGELPGRLSPFRRSQAAAAGISP---CRSKPQSPF--  231

Query  1093  VTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEK  914
                     +G   LG  +E E  K      +      +   P + + K  S   S  +EK
Sbjct  232   --------QGVKLLGDAKETEINKSGNLKFYSTGLGKVQGVPNQGA-KRSSYLGSLAIEK  282

Query  913   TVYVDSV  893
             T+Y+D +
Sbjct  283   TLYIDII  289



>dbj|BAH19865.1| AT2G30990 [Arabidopsis thaliana]
Length=593

 Score = 67.0 bits (162),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 86/326 (26%), Positives = 132/326 (40%), Gaps = 54/326 (17%)
 Frame = -1

Query  2233  CVVMEKTKLNLSVPIISVRR------INSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPK  2072
              ++ME+ +L+ + P+IS+RR        S  R  + V                    V K
Sbjct  5     SLMMEEKQLDFNRPLISIRRPTQTSESESKTRSFDSVTN-----------MIPPSPPVYK  53

Query  2071  SDCELSEVTKPVAVPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCE  1892
             SD +   V  P  VPF WE  PGK +      +    +P  +P+LPPGR+    R     
Sbjct  54    SDIKSGPVRNPGTVPFQWEHKPGKPKDVRKPVLQSFVEPHFVPKLPPGRE----RVVELG  109

Query  1891  RPCHEDSFRFQTEPLALKNHAALMDSLVES-------MLGKGEFDVEGRDSRECTNPDVL  1733
             R         QT+ ++  +   + D+   S           G + ++  D+   T     
Sbjct  110   RKPESTGADHQTKTVSSSDKYLVEDAKSNSSRYDDDDDDSDGTY-LDATDTLSRT-----  163

Query  1732  ESLSLNCSIGDLSGCQGLD----VEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQ-P  1568
             ES   NCS   +SG  GLD    + E    +     ++D MM RFLPAAKA  L +E  P
Sbjct  164   ESFFFNCSA--VSGASGLDGSGILVEPFGTLSTDRQTQDLMMGRFLPAAKA--LTSESPP  219

Query  1567  RLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHK--------WSRKFWKLFP  1412
              L ++  K E  V          V    ++      + DQ +         +     L P
Sbjct  220   HLARKPPKPEEPVKQLMKKKQNKV---EQNPYRFRHSPDQEEEDGNISSMMASGVCGLLP  276

Query  1411  RLSVKTSLGLLNPFPGMKSKTQTPAS  1334
             +L +++SLGLLNP P ++ + Q   S
Sbjct  277   QLCLRSSLGLLNPVPSVRMQQQRAVS  302



>ref|XP_004502167.1| PREDICTED: uncharacterized protein LOC101494184 [Cicer arietinum]
Length=293

 Score = 64.7 bits (156),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 88/303 (29%), Positives = 137/303 (45%), Gaps = 41/303 (14%)
 Frame = -1

Query  1720  LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKA--------------AVL  1583
             +NCS+  +SG    D ++          +R+FMM+RFLPAAKA               VL
Sbjct  1     MNCSVSGVSGLDNFDAKK-FGTFSTDQQTREFMMNRFLPAAKAMTIQPSQYSSKKQSVVL  59

Query  1582  VTEQPR----LVKEAKKYEPYVMSYYSD---YAGDVVTenedeendNMTIDQHK-WSRKF  1427
             V +Q R    LV+ AKK  P V  + +D   Y G V  +  ++E D    D       K 
Sbjct  60    VEQQLRDINKLVQNAKK--PLVNKHTTDIIPYTGQVQDDESEDEGDVYDNDNSASMLSKG  117

Query  1426  WKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPI  1247
               L P L ++ SL LLNP  G+K K Q P  S++ EV +  +++        R     P 
Sbjct  118   CGLLPNLHIRNSLSLLNPVAGIKMKNQGPLISAS-EVGKTNKSS------HIRSFSPVPA  170

Query  1246  EKQSYDAICKQRFRSGALSGELCKADKRGLKAD--GQY-PHGGSRSGA--ISPYRNVTTS  1082
              K++++AI K +  +     E+ ++++ G   +  G+  P   SR+ A  ISP R+   S
Sbjct  171   VKKAWEAIHKNKSSNEVAPLEI-ESNRFGFSDELPGRLSPFRRSRAAAAGISPCRSKPQS  229

Query  1081  SRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYV  902
                 +G   LG  +E E  K      +      +   P + + K  S   S  +EKT+Y+
Sbjct  230   PF--QGVKLLGDAKETEINKSGNLKFYSTGLGKVQGVPNQGA-KRSSYLGSLAIEKTLYI  286

Query  901   DSV  893
             D +
Sbjct  287   DII  289



>ref|NP_180964.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001154551.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM14830.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08927.1| uncharacterized protein AT2G34170 [Arabidopsis thaliana]
 gb|AEC08928.1| uncharacterized protein AT2G34170 [Arabidopsis thaliana]
Length=523

 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 123/469 (26%), Positives = 195/469 (42%), Gaps = 79/469 (17%)
 Frame = -1

Query  1741  DVLESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGDSRD--FMMSRFLPAAKAAVLVTEQP  1568
             D L++LSL  SI    G + +         KPS  S D  FM+ RFLPAAK+  L  EQP
Sbjct  82    DALDTLSLKQSISGGGGVEAM---------KPSMPSEDPQFMLDRFLPAAKS--LTLEQP  130

Query  1567  ---------------------RLVKEAKKYEP--YVMSYYSDYAGDVVTenedeendNMT  1457
                                   +V    +  P  Y  S+   Y  D+  E  +E++D+  
Sbjct  131   PQYSWKRQPLPLMSEPMRQIRDIVPAENRATPTRYESSFTPSYYQDIDDEESEEDSDDDE  190

Query  1456  IDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSK---TQTPA-----SSSTNEVKRLTR  1301
             + ++   R    + P++  K SLG+L+   G+K K    +TP+     SS   ++K   +
Sbjct  191   VSEYLSKRGCGMMSPQICFKNSLGMLSSVNGLKEKPYSLRTPSHDQVKSSKVAQLKSRFQ  250

Query  1300  NAPSGPLNKARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSR  1121
             +     L+  +K   G I +        ++F  G+   E   +  R      Q       
Sbjct  251   SVKKLALDYKQKL--GSIAQSPVHPSVGKKFNFGSEQHESKSSASRPSSPYRQ-------  301

Query  1120  SGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGES  941
             +G +SPYR+V  SS      GF G  +EAE ++ +  +      +   ++    S K + 
Sbjct  302   NGCMSPYRSVGNSSPL-HAAGFPGTRKEAEVMRANRLNKHIRNISKSHESLYPKSTKQDC  360

Query  940   DSPSDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPNQKRG  761
              S S  +EKT+YVDS N  +T++ +  S+           K LPE  S  P  E  + + 
Sbjct  361   -STSSAMEKTLYVDSENSPRTSNENRSSN----------VKKLPETISEEPEMEGKKPKA  409

Query  760   --------SSTSRSSRENFKPDYRSYSDV-TsslspypplpkspSESWLWRTLPSIPS--  614
                     + +  S  +  K D    ++         PP PK PSESWL+  LPS+ S  
Sbjct  410   VRELKAVETLSISSGVKMMKADELGKNNSGCDLSPLAPPPPKKPSESWLFSNLPSVSSKI  469

Query  613   ---RGGHNDQTNQSPRATNTATKREITVSSCSEHHCNSYYTEELIPYGS  476
                R   + Q       + + TK E  V +   H  +  Y+EEL+ + S
Sbjct  470   PSPRYLFHPQKKNVEENSTSVTKWETIVKTSYTHRDHIRYSEELVAHSS  518



>ref|XP_009406233.1| PREDICTED: uncharacterized protein LOC103989171 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 83/309 (27%), Positives = 131/309 (42%), Gaps = 51/309 (17%)
 Frame = -1

Query  1732  ESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQ------  1571
             ESL +NCS+  +SG    D  +    V      RDFMM RFLPAA+A V  + Q      
Sbjct  195   ESLLMNCSVSGVSGMP--DAAKLSGSVPKDPQVRDFMMERFLPAAQAMVCESTQYTFRKA  252

Query  1570  ---PR---------LVKEAKKYEPYVMSYYS------DYAGDVVTenedeendNMTIDQH  1445
                PR          + +  +  P  M Y++       YA ++   + ++++++      
Sbjct  253   AGPPREATKPVERVAINDRNRRPPAPMRYHNMPDYFPQYAKELEEGDSNDDDEDDEYSDD  312

Query  1444  KWSR---KFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNK  1274
                    K   L  R  +K S  LLNP  G+K + + P        +  TR+     L  
Sbjct  313   DAGHLPSKACGLLSRFCLKNSFCLLNPVSGIKDRGRLPPPP-----RGRTRDP---QLWN  364

Query  1273  ARKAYSGPIEKQ-SYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYR  1097
               +   GP+E + S++ + + +    +   ++ +  K   ++D Q    GS +G  SPY 
Sbjct  365   LHRLSLGPVEDENSWETVYRHKLGQNS-RPQVAEVSKLRSESDSQT-ADGSVTGGSSPYH  422

Query  1096  NVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVE  917
             N        EG GFLG PR   +      S   + D + W+T   SS  G   S S  +E
Sbjct  423   N--------EGNGFLGNPRSKSSKTDD--SDAGDKDINRWETNHSSSRIGLG-SMSPALE  471

Query  916   KTVYVDSVN  890
             KT+Y+D  N
Sbjct  472   KTLYIDLAN  480



>ref|XP_006592874.1| PREDICTED: uncharacterized protein LOC102668249 [Glycine max]
Length=553

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 85/362 (23%), Positives = 146/362 (40%), Gaps = 74/362 (20%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +LNL+ P++SVRR +S +           ++   ++    +    P    EL+ V
Sbjct  6     LMEEKQLNLNQPLLSVRRFSSTLA-------SETDHKSKSQNSLARLPLPPAYKSELNSV  58

Query  2047  TKPVA--VPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHED  1874
              +  A  VPF WE+APG+ + E+  +    E P      PPGR   +++    E      
Sbjct  59    PERNAGNVPFVWEKAPGRPKDESKLQTQDFEKPPFTSNFPPGRVSKTKQQSLAE--MRTG  116

Query  1873  SFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLS------LNC  1712
             S    ++ +A  +  A  +S  E+     E +  G D  +    D  +SLS      ++C
Sbjct  117   STLSNSQSVASLDKKATKNSKGETR----EKESSGSDDGDEAYEDARDSLSRTESFFMSC  172

Query  1711  SIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPRLVKE-------  1553
             S+  LSG    +V+            R+FM+ RFL AAKA  + +E P+   +       
Sbjct  173   SVSGLSGWDEQEVQPFGSFSSDHQQGRNFMIDRFLLAAKA--MTSETPQYASKKAHIGQE  230

Query  1552  ----------------AKKYEPYVMSYYS-DYAGDVVTenedeendNMTIDQHKWSRKFW  1424
                               ++ P  + +Y+ D  G+   +           +   ++    
Sbjct  231   QQKQKKKEVNTESPCPINQHRPKALPHYTQDIDGEESDDCS---------EYENYTTTTC  281

Query  1423  KLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAYSGPIE  1244
              LFPR        LLNP PG++             V R+ RNA  G   K+  ++ G  +
Sbjct  282   GLFPRFC------LLNPMPGLRM------------VDRVPRNAAHGMQAKSAASHIGSSK  323

Query  1243  KQ  1238
             +Q
Sbjct  324   EQ  325



>emb|CDY58982.1| BnaA04g28680D [Brassica napus]
Length=535

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 97/360 (27%), Positives = 142/360 (39%), Gaps = 77/360 (21%)
 Frame = -1

Query  2239  KECVVMEKTKLNLSVPIISVRRI---NSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKS  2069
             K  ++ EK +L+ + P+IS+RR    +S  R  + V  K                 V KS
Sbjct  4     KSLMMEEKKQLDFNRPLISIRRPIQPDSKRRSSDSVTNK-----------IPPSPPVYKS  52

Query  2068  DCELSEVTKPVAVPFCWEQAPGKRRGENGGKVYP-CEDPSTMPRLPPGRKPDSRRFYSCE  1892
             D     V  P  VPF WE  PGK + E   ++     +   +P+LPPGR   +R      
Sbjct  53    DINSGPVRNPGTVPFQWEHKPGKPKDETKPELQSVVVEQHFVPKLPPGRIVKAREPEELV  112

Query  1891  RPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLS  1721
             R           +P    NH     S          +D +  D       D L   ES  
Sbjct  113   R-----------KPETRTNHVEDAKSC------SSWYDDDESDDTYLDATDTLSRSESFF  155

Query  1720  LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQP---------  1568
              NCS  ++SG QG+ VE     +     ++D MM RFLPAAKA  L +E P         
Sbjct  156   FNCS--NVSG-QGMLVEPF-GTLSSDRQTQDLMMGRFLPAAKA--LTSETPPHLARKPPK  209

Query  1567  ------RLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRL  1406
                   R+V   +K      + Y  +   V  E + + N  M       +     L P++
Sbjct  210   PEEPARRIVVVKEKQNKADQNPYRFHHSPVEEEEDGDTNSMM-------ASGVCGLLPQI  262

Query  1405  SVKTSLGLLNPFPG-------------MKSKTQTPASSST-NEVKRLTRNAPSGPLNKAR  1268
              +++S G+LNP P              M+SK Q P +++  NE  ++  N  S P  K R
Sbjct  263   CLRSSFGVLNPVPSVRRQAQRGVSVRRMRSKYQDPTTTTPCNENHKVKLNGSSTPEGKER  322



>ref|XP_009143799.1| PREDICTED: uncharacterized protein LOC103867477 isoform X2 [Brassica 
rapa]
Length=474

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 123/453 (27%), Positives = 185/453 (41%), Gaps = 79/453 (17%)
 Frame = -1

Query  1741  DVLESLSLNCSI-GDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQP-  1568
             D L++LSL  S+ G +   +     E  D       SRDFM++RFLPAAK+  +   QP 
Sbjct  65    DALDTLSLKQSVSGSIEATKPPMASEDPDQ------SRDFMLNRFLPAAKSMTMEQHQPQ  118

Query  1567  ---------------RLVKEA------KKYEPYVM-SYYSDYAGDVVTenedeendNMTI  1454
                            R +++       K+YE     SYY D   D  ++ +DEE      
Sbjct  119   YAMKRQPSPFMSEPVRQIRDILPAATPKRYEYNTTPSYYQDIGDDDTSDEDDEETSEY--  176

Query  1453  DQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNK  1274
                  SR+   + P+L     LG+L+   G+K K  +  +SS ++VK       S  + K
Sbjct  177   ----LSRRGCGMSPQL----CLGMLSSVHGLKEKPYSLRTSSHDQVK-------SSKVAK  221

Query  1273  ARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRN  1094
              +  +      QS   +   +  S A S      D   L+          ++G +SPYR+
Sbjct  222   LKSRF------QSVKKLALDKLGSRAQSPVHPSVDT-NLRTASVPSSPYRQTGCLSPYRS  274

Query  1093  VTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEK  914
             V  SS      GF G  +EAE ++ +  +   +      D     S + +S S S V+EK
Sbjct  275   VGNSSPL-HSAGFPGTRKEAEIMRANRLNKHIKNPKKSQDLLYPKSTRLDS-STSSVMEK  332

Query  913   TVYVDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPNQKRGSSTSRSS--  740
             T++VD+    KT+++                K LPE TS  P      +   S S SS  
Sbjct  333   TLHVDTDKNPKTSNV----------------KILPETTSEKPKAVLEHQAVESLSISSAI  376

Query  739   RENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPSIPS-----RGGHNDQTNQSPR  575
             ++    D               P PK PSESWL R LPS+ S     R   + Q      
Sbjct  377   KKMKAGDLDKNKSGCDLSPHDLPTPKKPSESWLLRNLPSVSSKISSRRYLFHPQKKDLKE  436

Query  574   ATNTATKREITVSSCSEHHCNSYYTEELIPYGS  476
              + + TK E  V +   H  +  Y+EEL+   S
Sbjct  437   NSTSVTKWETIVKTSCVHRDHIRYSEELVARSS  469



>ref|XP_009143798.1| PREDICTED: uncharacterized protein LOC103867477 isoform X1 [Brassica 
rapa]
Length=491

 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 123/453 (27%), Positives = 185/453 (41%), Gaps = 79/453 (17%)
 Frame = -1

Query  1741  DVLESLSLNCSI-GDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQP-  1568
             D L++LSL  S+ G +   +     E  D       SRDFM++RFLPAAK+  +   QP 
Sbjct  82    DALDTLSLKQSVSGSIEATKPPMASEDPDQ------SRDFMLNRFLPAAKSMTMEQHQPQ  135

Query  1567  ---------------RLVKEA------KKYEPYVM-SYYSDYAGDVVTenedeendNMTI  1454
                            R +++       K+YE     SYY D   D  ++ +DEE      
Sbjct  136   YAMKRQPSPFMSEPVRQIRDILPAATPKRYEYNTTPSYYQDIGDDDTSDEDDEETSEY--  193

Query  1453  DQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNK  1274
                  SR+   + P+L     LG+L+   G+K K  +  +SS ++VK       S  + K
Sbjct  194   ----LSRRGCGMSPQL----CLGMLSSVHGLKEKPYSLRTSSHDQVK-------SSKVAK  238

Query  1273  ARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRN  1094
              +  +      QS   +   +  S A S      D   L+          ++G +SPYR+
Sbjct  239   LKSRF------QSVKKLALDKLGSRAQSPVHPSVDT-NLRTASVPSSPYRQTGCLSPYRS  291

Query  1093  VTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEK  914
             V  SS      GF G  +EAE ++ +  +   +      D     S + +S S S V+EK
Sbjct  292   VGNSSPL-HSAGFPGTRKEAEIMRANRLNKHIKNPKKSQDLLYPKSTRLDS-STSSVMEK  349

Query  913   TVYVDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPNQKRGSSTSRSS--  740
             T++VD+    KT+++                K LPE TS  P      +   S S SS  
Sbjct  350   TLHVDTDKNPKTSNV----------------KILPETTSEKPKAVLEHQAVESLSISSAI  393

Query  739   RENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPSIPS-----RGGHNDQTNQSPR  575
             ++    D               P PK PSESWL R LPS+ S     R   + Q      
Sbjct  394   KKMKAGDLDKNKSGCDLSPHDLPTPKKPSESWLLRNLPSVSSKISSRRYLFHPQKKDLKE  453

Query  574   ATNTATKREITVSSCSEHHCNSYYTEELIPYGS  476
              + + TK E  V +   H  +  Y+EEL+   S
Sbjct  454   NSTSVTKWETIVKTSCVHRDHIRYSEELVARSS  486



>ref|XP_009141121.1| PREDICTED: uncharacterized protein LOC103865095 [Brassica rapa]
Length=535

 Score = 60.5 bits (145),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 98/360 (27%), Positives = 143/360 (40%), Gaps = 78/360 (22%)
 Frame = -1

Query  2236  ECVVME-KTKLNLSVPIISVRRI---NSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKS  2069
             E ++ME K +L+ + P+IS+RR    +S  R  + V  K                 V KS
Sbjct  4     ESLMMEEKKQLDFNRPLISIRRPIQPDSKRRSSDSVTNK-----------IPPSPPVYKS  52

Query  2068  DCELSEVTKPVAVPFCWEQAPGKRRGENGGKVYP-CEDPSTMPRLPPGRKPDSRRFYSCE  1892
             D     V  P  VPF WE  PGK + E   ++     +   +P+LPPGR   +R      
Sbjct  53    DINSGPVRNPGTVPFQWEHKPGKPKDETKPELQSVVVEQHFVPKLPPGRIVKAREPEELV  112

Query  1891  RPCHEDSFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVL---ESLS  1721
             R           +P    NH     S          +D +  D       D L   ES  
Sbjct  113   R-----------KPETRTNHVEDAKSC------SSWYDDDESDDTYLDATDTLSRSESFF  155

Query  1720  LNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQP---------  1568
              NCS  ++SG QG+ VE     +     ++D MM RFLPAAKA  L +E P         
Sbjct  156   FNCS--NVSG-QGMLVEPF-GTLSSDRQTQDLMMGRFLPAAKA--LTSETPPHLARKPPK  209

Query  1567  ------RLVKEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRL  1406
                   R+V   +K      + Y  +   V  E + + N  M       +     L P++
Sbjct  210   PEEPARRIVVVKEKQNKADQNPYRFHHSPVEEEEDGDTNSMM-------ASGVCGLLPQI  262

Query  1405  SVKTSLGLLNPFPG-------------MKSKTQTPASSST-NEVKRLTRNAPSGPLNKAR  1268
              +++S G+LNP P              M+SK Q P +++  NE  ++  N  S P  K R
Sbjct  263   CLRSSFGVLNPVPSVRRQAQRGVSVRRMRSKYQDPTTTTPCNENHKVKLNGSSTPEGKER  322



>emb|CDY63140.1| BnaCnng41430D [Brassica napus]
Length=489

 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 113/447 (25%), Positives = 181/447 (40%), Gaps = 69/447 (15%)
 Frame = -1

Query  1741  DVLESLSLNCSI-GDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPR  1565
             D L++LSL  S+ G +   +     +  D       SRDFM++RFLPAAK+  +  +QP+
Sbjct  82    DALDTLSLKQSVSGSIEATKPPMASQDPDQ------SRDFMLNRFLPAAKSMTMDQQQPQ  135

Query  1564  LVKEAKKYEPY-VMSYYSDYAGDVVTenedeendNMTIDQHK------------------  1442
                 A K +P   MS       D++     +  +  T   +                   
Sbjct  136   Y---AMKRQPSPFMSEPVRQIRDILPAATPKRYEYNTTPSYYHGLDDDTSDEDEDEASEY  192

Query  1441  WSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKA  1262
              SR+   + P+L     LG+L+   G+K K  +  +SS + VK       S  +++ +  
Sbjct  193   LSRRGCGMSPQLC----LGMLSSVHGLKEKPYSLRTSSHDHVK-------SSKVSQLKSR  241

Query  1261  YSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTS  1082
             +      QS   +   +  S A S      D   L+          ++G +SPYR+V  S
Sbjct  242   F------QSVKKLALDKLGSRAQSPVHPSVDT-NLRTASVPSSPYRQTGCLSPYRSVGNS  294

Query  1081  SRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYV  902
             S      GF G  +EAE ++ +  +   +      D     S + +S S S V+EKT++V
Sbjct  295   SPL-HSAGFPGTRKEAEIMRANRLNKHIKNPKKSQDLLYPKSTRLDS-STSSVLEKTLHV  352

Query  901   DSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPNQKRGSSTSRSSRENFKP  722
             D+    KTT++ +          PE   + PE     P    +    S   +   +N   
Sbjct  353   DTDKTPKTTNVKIL---------PETTSEEPEMAGKKPKAVDSLSISSGIKKMKADNLDK  403

Query  721   DYRSYSDVTsslspypplpkspSESWLWRTLPSIPS-----RGGHNDQTNQSPRATNTAT  557
             +    S +        P PK PSESWL R LPS+ S     R   + Q       + + T
Sbjct  404   NNCDRSPLA------LPTPKKPSESWLLRNLPSVSSKISSRRYLFHPQKKDLKENSTSVT  457

Query  556   KREITVSSCSEHHCNSYYTEELIPYGS  476
             K E  V +   H  +  Y+EEL+   S
Sbjct  458   KWETIVKTSCIHRDHIRYSEELVARSS  484



>ref|XP_006410559.1| hypothetical protein EUTSA_v10016475mg [Eutrema salsugineum]
 gb|ESQ52012.1| hypothetical protein EUTSA_v10016475mg [Eutrema salsugineum]
Length=546

 Score = 60.1 bits (144),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 87/327 (27%), Positives = 143/327 (44%), Gaps = 63/327 (19%)
 Frame = -1

Query  1741  DVLESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGD--SRDFMMSRFLPAAKAAVLVTEQP  1568
             D L++LSL  SI         +VE  +  +  S D  SRDFM++RFLPAAK+  +  + P
Sbjct  102   DALDTLSLKHSING-------NVEATKTPMPSSEDPQSRDFMLNRFLPAAKSMTVEQQPP  154

Query  1567  RLVKEAKK---YEPYVM----------------------SYYSDYAGDVVTenedeendN  1463
               +K       YEP                         SYY D     +   E +E+++
Sbjct  155   YALKRQAMPVMYEPIRQIRDILPAENRATPKRYEYNTTPSYYQD-----IDYEESDEDED  209

Query  1462  MTIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGP  1283
                     SR+   + P+L  K SLG+L+   G+K K  +  +SS ++VK       S  
Sbjct  210   DDEASEYLSRRGCGMSPQLCFKNSLGMLSSVHGLKEKPYSLRTSSHDQVK-------SSK  262

Query  1282  LNKARKAYSGPIEKQSYDAICKQRFRSGALS------GELCKADKRGLKAD---GQYPHG  1130
             + + +  +   ++K + D+I KQ+  S   S      G+        L+++      P  
Sbjct  263   VAQLKSRFQS-VKKLALDSIYKQKVGSRVQSPIHPSVGKKFNFGSEQLESNLTTASMPSS  321

Query  1129  GSRS-GAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSF  953
               R  G +SPYR+V   S    GT      +EAE ++ +  +     ++   D     S 
Sbjct  322   PYRQIGCMSPYRSVGNCSPLHPGTR-----KEAEIMRANRLNKHIRNNSKPQDLLYPKST  376

Query  952   KGESDSPSDVVEKTVYVDSVNYVKTTS  872
             + +  S S ++EKT+YVD+ N  KT++
Sbjct  377   RLDW-STSSIMEKTLYVDTENCPKTSN  402



>ref|XP_002879481.1| hypothetical protein ARALYDRAFT_321137 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55740.1| hypothetical protein ARALYDRAFT_321137 [Arabidopsis lyrata subsp. 
lyrata]
Length=523

 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 128/461 (28%), Positives = 203/461 (44%), Gaps = 65/461 (14%)
 Frame = -1

Query  1741  DVLESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGDSRD--FMMSRFLPAAKAAV------  1586
             D L++LSL  SI   SG  G+ VE     +KPS  S D  FM+ RFLPAAK+        
Sbjct  84    DALDTLSLKHSI---SG--GVVVEA----MKPSMPSEDPQFMLDRFLPAAKSMTVEQPSQ  134

Query  1585  ---------LVTEQPRLVKEAKKYEP------YVMSYYSDYAGDVVTenedeendNMTID  1451
                      L++E  R +++    E       Y  S+   Y  D+  E  +E++D+  + 
Sbjct  135   YAWKRQPLPLMSETMRQIRDIVPAENRATPTRYESSFTPSYYQDIDDEESEEDSDDDEVS  194

Query  1450  QHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKA  1271
             ++   R    + P++  K SLG+L+   G+K    +  +SS ++VK       S  + + 
Sbjct  195   EYLSKRGCGMMSPQICFKNSLGMLSSAHGLKETPYSLRTSSHDQVK-------SSKVAQL  247

Query  1270  RKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGS----------R  1121
             +  +   ++K + D   KQ+  S A S       K+      Q+    S          +
Sbjct  248   KSRFQS-VKKLALD--YKQKLGSLAQSPVHPSVGKKFNFGSEQHESNLSSASRPSSPYRQ  304

Query  1120  SGAISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGES  941
             +G +SPYR+V  SS      GF G  +EAE ++ +  +      +   +     S K ++
Sbjct  305   TGCMSPYRSVGNSSPLHPA-GFPGTRKEAEIMRANRLNKHIRNISKSQELLYPKSTK-QA  362

Query  940   DSPSDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPNQKRG  761
              S S  +EKT+YVD+ N  KT++ D  +S  + L  PE   + PE     P      K  
Sbjct  363   CSTSSAMEKTLYVDTENSPKTSN-DQGNSNVKNL--PETISEEPEMEGKKPKAAHELKAV  419

Query  760   SSTSRSS-RENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPSIPS-----RGGHN  599
              + + SS  +  K D    ++  S     PP PK PSESWL+  LPS+ S     R   +
Sbjct  420   ETLTISSGIKMVKADELEKNN--SGCDLSPPPPKKPSESWLFSNLPSVSSKIPSRRYLFH  477

Query  598   DQTNQSPRATNTATKREITVSSCSEHHCNSYYTEELIPYGS  476
              Q       + + TK E  V +   H  +  Y+EEL+   S
Sbjct  478   PQKKNVEENSISITKWETIVKTSYTHRDHIRYSEELVARSS  518



>gb|KHN27946.1| hypothetical protein glysoja_007678 [Glycine soja]
Length=553

 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 62/231 (27%), Positives = 103/231 (45%), Gaps = 23/231 (10%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +LNL+ P++SVRR +S +           ++   ++    +    P    EL+ V
Sbjct  6     LMEEKQLNLNQPLLSVRRFSSTLA-------SETDHKSKSQNSLARLPLPPAYKSELNSV  58

Query  2047  TKPVA--VPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHED  1874
              +  A  VPF WE+APG+ + E+  +    E P      PPGR   +++    E      
Sbjct  59    PERNAGNVPFVWEKAPGRPKDESKLQTQDFEKPPFTSNFPPGRVSKTKQQSLAE--MRTG  116

Query  1873  SFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLS------LNC  1712
             S    ++ +A  +  A   S  E+     E +  G D  +    D  +SLS      ++C
Sbjct  117   STLSNSQSVASLDKKATKHSKGETR----EKESSGSDDGDEAYEDARDSLSRTESFFMSC  172

Query  1711  SIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPRLV  1559
             S+  LSG    +V+            R+FM+ RFL AAKA  + +E P+  
Sbjct  173   SVSGLSGWDEQEVQPFGSFSSDHQQGRNFMIDRFLLAAKA--MTSETPQYA  221



>ref|XP_010469391.1| PREDICTED: uncharacterized protein LOC104749449 [Camelina sativa]
 ref|XP_010469392.1| PREDICTED: uncharacterized protein LOC104749449 [Camelina sativa]
Length=535

 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 122/460 (27%), Positives = 194/460 (42%), Gaps = 61/460 (13%)
 Frame = -1

Query  1741  DVLESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGDS--RDFMMSRFLPAAKAAV------  1586
             D L++LSL  SI  +        E  +  + PS D   R FM+ RFLPAAK+        
Sbjct  94    DALDTLSLKHSINGVG-------EGAKPPMMPSEDPQPRAFMLDRFLPAAKSMTVEQPTQ  146

Query  1585  ---------LVTEQPRLVKEA---------KKYEPYVMSYYSDYAGDVVTenedeendNM  1460
                      L++E  R +++          K+YE  V   Y  Y G    E+ +E++D+ 
Sbjct  147   YAWKRQPLPLMSEPMRQIRDIVPAENHATPKRYESVVSPSY--YQGIDYDEDSEEDSDDD  204

Query  1459  TIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTP----ASSSTNEVKRLTRNAP  1292
              + ++   R    + P++  K SLG+L+   G+K K  +      SS   ++K   ++  
Sbjct  205   EVSEYLSKRGCGMMSPQVCFKNSLGMLSSVHGLKEKPYSSHDQVKSSKVAQLKSRFQSVK  264

Query  1291  SGPLNKARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGA  1112
                L+   K   G I +        ++F  G+   E        L A  +      ++G 
Sbjct  265   KLALDYKHKL--GNIAQSPVHPSVGKKFNFGSEQLE------SNLSATSRTSSPYRQTGC  316

Query  1111  ISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSP  932
             +SPYR+V  SS      GF G  +EAE ++ +  +          +     S + +  + 
Sbjct  317   MSPYRSVGNSSPLHPA-GFPGTRKEAEIMRANRLNKHIRNIAKSQELLYPKSTRQDCSTK  375

Query  931   SDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQ--EPNQKRGS  758
             S V+EKT+YVD+ N  KT++ D  +S  + L  PE   + PE     P    E       
Sbjct  376   S-VMEKTLYVDTENSPKTSN-DHGNSNVKNL--PETISEEPEMEGKKPKAILELQAVETL  431

Query  757   STSRSSRENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPS----IPSRG--GHND  596
             S S + +     +    +         PP PK PS+SWL   LPS    IPSR    H+ 
Sbjct  432   SVSSAIKMGKADELEKNNSSCDLSPLAPPPPKKPSDSWLLSNLPSLTSKIPSRRYLFHSK  491

Query  595   QTNQSPRATNTATKREITVSSCSEHHCNSYYTEELIPYGS  476
             + N    +T + TK E  V +   H  +  Y+EEL+   S
Sbjct  492   KKNMEENST-SVTKWETIVKTSYTHRDHIRYSEELVARSS  530



>ref|XP_004513204.1| PREDICTED: uncharacterized protein LOC101492832 [Cicer arietinum]
Length=296

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 79/313 (25%), Positives = 125/313 (40%), Gaps = 58/313 (19%)
 Frame = -1

Query  1732  ESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKA-------------  1592
             ES S+NCS+  +SG    D ++          +R+FMM+RFLPAA A             
Sbjct  5     ESFSMNCSVSGVSGLDNFDAKK-FGTFSTDQQTREFMMNRFLPAANAMTIQPSQYSSKKQ  63

Query  1591  -AVLVTEQPR----LVKEAKKYEPYVMSYYSD---YAGDVVTenedeendNMTIDQHK-W  1439
               VLV +Q R    LV+ AKK  P V  + +D   Y G V  +  ++E D    D     
Sbjct  64    YVVLVEQQLRDINKLVQNAKK--PLVNKHTTDIIPYTGQVQDDESEDEGDVYDNDNSASM  121

Query  1438  SRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNKARKAY  1259
               K   L P L ++ SL LLNP   +           TN+   +   +P           
Sbjct  122   LSKGCGLLPNLHIRNSLSLLNPVAEV---------GKTNKSSHIRSFSPV----------  162

Query  1258  SGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSS  1079
               P  K++++AI K +  +     E+ +  K+      ++   G   G +SP+R    ++
Sbjct  163   --PAVKKAWEAIHKNKSSNVVAPPEMQEGKKKWSIESNRFGFSGELPGRLSPFRRSRAAA  220

Query  1078  RFS-----------EGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSP  932
                           +G   LG  +E E  K      +      +   P + + K  S   
Sbjct  221   AGISPCRSKPQSPFQGVKLLGDAKETEINKSGNLKFYSTGLGKVQGVPNQGA-KRSSYLG  279

Query  931   SDVVEKTVYVDSV  893
             S  +EKT+Y+D +
Sbjct  280   SLAIEKTLYIDII  292



>emb|CDY17227.1| BnaA05g09610D [Brassica napus]
Length=490

 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 121/453 (27%), Positives = 186/453 (41%), Gaps = 80/453 (18%)
 Frame = -1

Query  1741  DVLESLSLNCSI-GDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQP-  1568
             D L++LSL  S+ G +   +     E  D       SRDFM++RFLPAAK+  +  +QP 
Sbjct  82    DALDTLSLKQSVSGSIEATKRPMASEDPDQ------SRDFMLNRFLPAAKSMTMEQQQPQ  135

Query  1567  ---------------RLVKEA------KKYEPYVM-SYYSDYAGDVVTenedeendNMTI  1454
                            R +++       K+YE     SYY     D   E+++E ++ +  
Sbjct  136   YAMKRQPSPFVSEPVRQIRDILPAATPKRYEYNTTPSYYHGLDDDTSDEDDEEASEYL--  193

Query  1453  DQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASSSTNEVKRLTRNAPSGPLNK  1274
                  SR+   + P+L     LG+L+   G+K K  +  +SS ++VK       S  + K
Sbjct  194   -----SRRGCGMSPQLC----LGMLSSAHGLKEKPYSLRTSSHDQVK-------SSKVAK  237

Query  1273  ARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRN  1094
              +  +      QS   +   +  S A S      D   L+          ++G +SPYR+
Sbjct  238   LKSRF------QSVKKLALDKLGSRAQSPVHPSVDT-NLRTASVPSSPYRQTGCLSPYRS  290

Query  1093  VTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEK  914
             V  SS      GF G  +EAE ++ +  +          D     S + +S S S V+EK
Sbjct  291   VGNSSPL-HSAGFPGTRKEAEIMRANRLNKHIRNPKKSHDLLYPKSTRLDS-STSSVMEK  348

Query  913   TVYVDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQEPNQKRGSSTSRSS--  740
             T++VD+    KT+++                K LPE TS  P      +   S S SS  
Sbjct  349   TLHVDTDKNPKTSNV----------------KILPETTSEKPKAVLEHQAVESLSISSAI  392

Query  739   RENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPSIPS-----RGGHNDQTNQSPR  575
             ++    D               P PK PSESWL R LPS+ S     R   + Q      
Sbjct  393   KKMKAGDLDKNKSGCDLSPHDLPTPKKPSESWLLRNLPSVSSKISSRRYLFHPQKKDLKE  452

Query  574   ATNTATKREITVSSCSEHHCNSYYTEELIPYGS  476
              + + TK E  V +   H  +  Y+EEL+   S
Sbjct  453   NSTSVTKWETIVKTSCIHRDHIRYSEELVARSS  485



>gb|AAR99362.1| hypothetical protein At2g34170 [Arabidopsis thaliana]
 gb|AAV63888.1| hypothetical protein [Arabidopsis thaliana]
Length=422

 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 115/440 (26%), Positives = 184/440 (42%), Gaps = 70/440 (16%)
 Frame = -1

Query  1654  VKPSGDSRD--FMMSRFLPAAKAAVLVTEQP---------------------RLVKEAKK  1544
             +KPS  S D  FM+ RFLPAAK+  L  EQP                      +V    +
Sbjct  1     MKPSMPSEDPQFMLDRFLPAAKS--LTLEQPPQYSWKRQPLPLMSEPMRQIRDIVPAENR  58

Query  1543  YEP--YVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSVKTSLGLLNPF  1370
               P  Y  S+   Y  D+  E  +E++D+  + ++   R    + P++  K SLG+L+  
Sbjct  59    ATPTRYESSFTPSYYQDIDDEESEEDSDDDEVSEYLSKRGCGMMSPQICFKNSLGMLSSV  118

Query  1369  PGMKSK---TQTPA-----SSSTNEVKRLTRNAPSGPLNKARKAYSGPIEKQSYDAICKQ  1214
              G+K K    +TP+     SS   ++K   ++     L+  +K   G I +        +
Sbjct  119   NGLKEKPYSLRTPSHDQVKSSKVAQLKSRFQSVKKLALDYKQKL--GSIAQSPVHPSVGK  176

Query  1213  RFRSGALSGELCKADKRGLKADGQYPHGGSRSGAISPYRNVTTSSRFSEGTGFLGVPREA  1034
             +F  G+   E   +  R      Q       +G +SPYR+V  SS      GF G  +EA
Sbjct  177   KFNFGSEQHESKSSASRPSSPYRQ-------NGCMSPYRSVGNSSPL-HAAGFPGTRKEA  228

Query  1033  ENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPSDVVEKTVYVDSVNYVKTTSLDLCSS  854
             E ++ +  +      +   ++    S K +  S S  +EKT+YVDS N  +T++ +  S+
Sbjct  229   EVMRANRLNKHIRNISKSHESLYPKSTKQDC-STSSAMEKTLYVDSENSPRTSNENRSSN  287

Query  853   KPEGLMDPEEFKDLPERTSSNPNQEPNQKRG--------SSTSRSSRENFKPDYRSYSDV  698
                        K LPE  S  P  E  + +         + +  S  +  K D    ++ 
Sbjct  288   ----------VKKLPETISEEPEMEGKKPKAVRELKAVETLSISSGVKMMKADELGKNNS  337

Query  697   -TsslspypplpkspSESWLWRTLPSIPS-----RGGHNDQTNQSPRATNTATKREITVS  536
                     PP PK PSESWL+  LPS+ S     R   + Q       + + TK E  V 
Sbjct  338   GCDLSPLAPPPPKKPSESWLFSNLPSVSSKIPSPRYLFHPQKKNVEENSTSVTKWETIVK  397

Query  535   SCSEHHCNSYYTEELIPYGS  476
             +   H  +  Y+EEL+ + S
Sbjct  398   TSYTHRDHIRYSEELVAHSS  417



>ref|XP_010509787.1| PREDICTED: uncharacterized protein LOC104786146 [Camelina sativa]
Length=531

 Score = 56.6 bits (135),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 119/460 (26%), Positives = 193/460 (42%), Gaps = 73/460 (16%)
 Frame = -1

Query  1741  DVLESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAV--------  1586
             D L++LSL  SI +      +      +D +P    R FM+ RFLPAAK+          
Sbjct  94    DALDTLSLKHSISE-----AMKPPMPSEDPQP----RAFMLDRFLPAAKSMTVEQPTQYA  144

Query  1585  -------LVTEQPRLVKEA---------KKYEPYVMSYYSDYAGDVVTenedeendNMTI  1454
                    L++E  R +++           +YE  +   Y  Y G    E  ++++D+  +
Sbjct  145   WKRQPLPLMSEPMRQIRDIVPAENHATPNRYESMISPSY--YQGIDYDEESEDDSDDDEV  202

Query  1453  DQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTPASS----STNEVKRL-TRNAPS  1289
              ++   R    + P+L  K SLG+L+   G+K K   P SS     +++V +L +R    
Sbjct  203   SEYLSKRGCGMMSPQLCFKNSLGMLSSVHGLKEK---PYSSHDQVKSSKVAQLKSRFQSV  259

Query  1288  GPLNKARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAI  1109
               L    K   G I +        ++F  G+   E        L A  +      ++G +
Sbjct  260   KKLALDYKLKLGNIAQSPVHPSVGKKFNFGSEQLE------SNLSATSRPSSPYRQTGCM  313

Query  1108  SPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDSPS  929
             SPYR+V  SS      GF G  +EAE ++ +       ++ H+ +  +         +  
Sbjct  314   SPYRSVGNSSPLHPA-GFPGTRKEAEIMRAN------RLNKHIRNIAMSQELLYPKSTRQ  366

Query  928   D-----VVEKTVYVDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQ--EPNQ  770
             D     ++EKT+YVD+ N  KT++ D  +S  + L  PE   + PE     P    E   
Sbjct  367   DCSTKSIMEKTLYVDTENSPKTSN-DHGNSNVKNL--PETISEEPEMEGKKPKAILELQA  423

Query  769   KRGSSTSRSSRENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPS----IPSRG--  608
                 S S   +     +    ++        PP PK PS+SWL   LPS    IPSR   
Sbjct  424   VETLSVSSGIKTGKADELEKNNNGCDMSPLAPPPPKKPSDSWLLSNLPSLASKIPSRRYL  483

Query  607   GHNDQTNQSPRATNTATKREITVSSCSEHHCNSYYTEELI  488
              H+ + N    +T + TK E  V +   H  +  Y+EEL+
Sbjct  484   FHSKKKNMEENST-SVTKWETIVKTSYTHRDHIRYSEELV  522



>ref|XP_010413771.1| PREDICTED: uncharacterized protein LOC104700022 [Camelina sativa]
 ref|XP_010413772.1| PREDICTED: uncharacterized protein LOC104700022 [Camelina sativa]
Length=536

 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 119/457 (26%), Positives = 190/457 (42%), Gaps = 62/457 (14%)
 Frame = -1

Query  1741  DVLESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGDS--RDFMMSRFLPAAKAAV------  1586
             D L++LSL  SI  +        E  +  + PS D   R FM+ RFLPAAK+        
Sbjct  94    DALDTLSLKHSINGVG-------EGAKPPMMPSEDPQPRAFMLDRFLPAAKSMTVEQPPQ  146

Query  1585  ---------LVTEQPRLVKEA----------KKYEPYVMSYYSDYAGDVVTenedeendN  1463
                      L++E  R +++           K+YE  +   Y  Y G    E  +E++D+
Sbjct  147   YAWKRQPLPLMSEPMRQIRDIVPAEENRATPKRYESMISPSY--YQGIDYDEESEEDSDD  204

Query  1462  MTIDQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSK----TQTPASSSTNEVKRLTRNA  1295
               + ++   R    + P+L  K SLG+L+   G+K K         SS   ++K   ++ 
Sbjct  205   DEVSEYLSKRGCGMMSPQLCFKNSLGMLSSVHGLKEKPYYSHDQVKSSKVAQLKSRFQSV  264

Query  1294  PSGPLNKARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSG  1115
                 L+  +K   G I +        ++F  G+   E        L A  +      ++G
Sbjct  265   KKLALDYKQKL--GNIAQSPVHPSVGKKFNFGSEQLE------SNLSATSRPSSPYRQTG  316

Query  1114  AISPYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSSFREVDTHLWDTPIKSSFKGESDS  935
              +SPYR+V   S      GF G  +EAE ++ +  +          +     S + +  +
Sbjct  317   CMSPYRSVGNCSPLHPA-GFPGTRKEAEVMRANRLNKHIRNIAKSQELLYPKSTRQDCST  375

Query  934   PSDVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPNQ--EPNQKRG  761
              S V+EKT+YVD+ N  KT++ D  +S  +    PE   + PE     P    E      
Sbjct  376   KS-VMEKTLYVDTENSPKTSN-DHGNSNVKN--SPETISEEPEMEGKKPKAILELQAVEN  431

Query  760   SSTSRSSRENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPS----IPSRG--GHN  599
              S S + +     +    +         PP PK PS+SWL   LPS    IPSR    H+
Sbjct  432   LSVSSAIKMGKADELEKNNSGCDLSPLAPPPPKKPSDSWLLSNLPSLTSKIPSRRYLFHS  491

Query  598   DQTNQSPRATNTATKREITVSSCSEHHCNSYYTEELI  488
              + N    +T + TK E  V +   H  +  Y+EEL+
Sbjct  492   KKKNMEENST-SVTKWETIVKTSYTHRDHIRYSEELV  527



>ref|XP_006296401.1| hypothetical protein CARUB_v10025577mg [Capsella rubella]
 gb|EOA29299.1| hypothetical protein CARUB_v10025577mg [Capsella rubella]
Length=530

 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 122/455 (27%), Positives = 192/455 (42%), Gaps = 61/455 (13%)
 Frame = -1

Query  1741  DVLESLSLNCSIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAV--------  1586
             D L++LSL  SI  +   + L      +D +P    RDFM+ RFLPAAK+          
Sbjct  91    DALDTLSLKHSISGVG--EALKPPRPSEDPQP----RDFMLDRFLPAAKSMTVEQPPQYA  144

Query  1585  -------LVTEQPRLVKEA---------KKYEPYVMSYYSDYAGDVVTenedeendNMTI  1454
                    L++E  R +++           +YE  V   Y  Y G    E  +E++D+  +
Sbjct  145   WKRQPLPLMSEPMRQIRDIVPAENRATPTRYESMVSPSY--YQGIYDYEESEEDSDDDEV  202

Query  1453  DQHKWSRKFWKLFPRLSVKTSLGLLNPFPGMKSKTQTP----ASSSTNEVKRLTRNAPSG  1286
               +   R    + P+L  K SLG+L+   G+K K  +      SS   ++K   ++    
Sbjct  203   SDYLSKRGCGMMSPQLCFKNSLGMLSSVHGLKEKPYSSHDQVKSSKVAQLKSRFQSMKKL  262

Query  1285  PLNKARKAYSGPIEKQSYDAICKQRFRSGALSGELCKADKRGLKADGQYPHGGSRSGAIS  1106
              L+  +K   G I +        ++F  G  S +L        +    Y     ++G +S
Sbjct  263   ALDYKQKL--GNIAQSPVHPSIGKKFNFG--SEQLDSNVTSASRPSSPY----RQTGCMS  314

Query  1105  PYRNVTTSSRFSEGTGFLGVPREAENLKGSMFSS-FREVDTHLWDTPIKSSFKGESDSPS  929
             PYR+V  SS      GF G  +EAE ++ +  +   R +         KS+ K  S S S
Sbjct  315   PYRSVGNSSPL--HPGFPGTRKEAEIMRANRLNKHIRNITKSQELLYPKSTRKDCSTSSS  372

Query  928   DVVEKTVYVDSVNYVKTTSLDLCSSKPEGLMDPEEFKDLPERTSSNPN--QEPNQKRGSS  755
               +EKT+YVD+    KT++ D  +S  +    PE   + PE     P    E       S
Sbjct  373   --IEKTLYVDTERSPKTSN-DHGNSNVKNF--PETISEEPEMEGEKPKPILELQAVETLS  427

Query  754   TSRSSRENFKPDYRSYSDVTsslspypplpkspSESWLWRTLPS----IPSRGG--HNDQ  593
              S   +     +    +         PP P+ PS+SWL+ +LPS    IPSR    H  +
Sbjct  428   VSNGIKMAKADELEKTNSSCDLSPLAPPPPRKPSDSWLFSSLPSISSKIPSRRSLFHPQK  487

Query  592   TNQSPRATNTATKREITVSSCSEHHCNSYYTEELI  488
              N    +T + TK E  V +   H  +  Y+EEL+
Sbjct  488   KNIEENST-SVTKWETIVKTSYTHRDHIRYSEELV  521



>gb|KHN01240.1| hypothetical protein glysoja_008142 [Glycine soja]
Length=310

 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 76/323 (24%), Positives = 131/323 (41%), Gaps = 44/323 (14%)
 Frame = -1

Query  2227  VMEKTKLNLSVPIISVRRINSNVRHLEGVNRKNVEnpqpnrqqqrqPLCVPKSDCELSEV  2048
             +ME+ +LNL+ P++SVRR +S +           ++   +     +    P    EL+ V
Sbjct  6     LMEEKQLNLNQPLLSVRRFSSTLA-------SETDHKGKSDNSLARLPLPPAYKSELNSV  58

Query  2047  TKPVA--VPFCWEQAPGKRRGENGGKVYPCEDPSTMPRLPPGRKPDSRRFYSCERPCHED  1874
              +  A  VPF WE+A G+ + E+  +    E P      P GR   +++    E      
Sbjct  59    PEKNAGNVPFVWEKASGRPKDESKLQTQDFEKPPFTSNFPLGRVSKTKQQSLAE--TRTG  116

Query  1873  SFRFQTEPLALKNHAALMDSLVESMLGKGEFDVEGRDSRECTNPDVLESLS------LNC  1712
             S    ++ +A  +  A   S  E+     E +  G D  +    D  +SLS      ++C
Sbjct  117   STLSNSQSVASLDKKATKHSKGETR----EKESSGSDDGDEAYEDARDSLSRTKSFFMSC  172

Query  1711  SIGDLSGCQGLDVEEGRDDVKPSGDSRDFMMSRFLPAAKAAVLVTEQPRLV---------  1559
             S+ D SG    +V+            R+FM+ RFL  AKA  + +E P+           
Sbjct  173   SVSDFSGWDEQEVQPFGSFSSDHQQGRNFMIDRFLLTAKA--MTSESPQYASKKAHIGQE  230

Query  1558  ------KEAKKYEPYVMSYYSDYAGDVVTenedeendNMTIDQHKWSRKFWKLFPRLSVK  1397
                   KE     P  ++ +   A    T++ D E      +   ++ +   LFPR    
Sbjct  231   QQKQRKKEVNTESPCPINQHRPKALPHYTQDIDGEESYDCSEYENYTTRTCGLFPRFC--  288

Query  1396  TSLGLLNPFPGMKSKTQTPASSS  1328
                 LLNP  G++   + P +++
Sbjct  289   ----LLNPMSGLRMVDRVPTNAT  307



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7504903404848