BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23925_g1_i1 len=979 path=[1:0-978]

Length=979
                                                                      Score     E

ref|XP_002285717.1|  PREDICTED: purine permease 1                       364   3e-121   Vitis vinifera
gb|EYU21537.1|  hypothetical protein MIMGU_mgv1a018814mg                360   1e-119   
ref|XP_002285719.1|  PREDICTED: purine permease 1-like                  357   2e-118   Vitis vinifera
ref|XP_002285718.1|  PREDICTED: purine permease 1                       357   3e-118   Vitis vinifera
gb|KDP41439.1|  hypothetical protein JCGZ_15846                         356   7e-118   
ref|XP_002307351.2|  PURINE PERMEASE 1 family protein                   356   8e-118   Populus trichocarpa [western balsam poplar]
ref|XP_009615076.1|  PREDICTED: purine permease 3-like                  353   7e-117   
gb|EYU34537.1|  hypothetical protein MIMGU_mgv1a022801mg                353   8e-117   
gb|KHG22236.1|  Purine permease 1 -like protein                         349   4e-115   
ref|XP_011006371.1|  PREDICTED: purine permease 3                       349   5e-115   
emb|CDP19267.1|  unnamed protein product                                348   9e-115   
ref|XP_002513994.1|  purine transporter, putative                       347   2e-114   Ricinus communis
gb|KHG13700.1|  Purine permease 3 -like protein                         347   4e-114   
ref|XP_007018134.1|  Purine permease 3                                  345   1e-113   
ref|XP_004242795.1|  PREDICTED: purine permease 3-like                  345   2e-113   
ref|XP_006364706.1|  PREDICTED: purine permease 3-like                  342   2e-112   
ref|XP_004299691.1|  PREDICTED: purine permease 3-like                  340   3e-111   
ref|XP_004299692.1|  PREDICTED: purine permease 3-like                  338   9e-111   
ref|XP_010060063.1|  PREDICTED: purine permease 3-like isoform X1       337   2e-110   
ref|XP_008444876.1|  PREDICTED: purine permease 3-like                  337   3e-110   
ref|XP_009588639.1|  PREDICTED: purine permease 3-like                  336   4e-110   
ref|XP_009373503.1|  PREDICTED: purine permease 3-like                  337   5e-110   
ref|XP_008219368.1|  PREDICTED: purine permease 3-like                  336   9e-110   
ref|XP_008219366.1|  PREDICTED: purine permease 3-like                  335   1e-109   
ref|XP_004164781.1|  PREDICTED: purine permease 3-like                  335   1e-109   
ref|XP_007227615.1|  hypothetical protein PRUPE_ppa022492mg             335   2e-109   
ref|XP_004152619.1|  PREDICTED: purine permease 3-like                  335   2e-109   
ref|XP_004152618.1|  PREDICTED: purine permease 3-like                  335   2e-109   
ref|XP_009373619.1|  PREDICTED: purine permease 3-like                  335   2e-109   
emb|CDP01126.1|  unnamed protein product                                334   4e-109   
emb|CDP08377.1|  unnamed protein product                                334   4e-109   
ref|XP_008444875.1|  PREDICTED: purine permease 3-like                  334   6e-109   
ref|XP_007223326.1|  hypothetical protein PRUPE_ppa007339mg             333   9e-109   
gb|EYU21538.1|  hypothetical protein MIMGU_mgv1a020196mg                333   1e-108   
gb|KHG06856.1|  Purine permease 1 -like protein                         333   1e-108   
ref|XP_007018133.1|  Purine permease 3, putative                        334   2e-108   
ref|XP_006357925.1|  PREDICTED: purine permease 3-like                  329   1e-107   
ref|XP_008338896.1|  PREDICTED: purine permease 3-like                  331   1e-107   
ref|XP_010060067.1|  PREDICTED: purine permease 1-like                  325   8e-106   
ref|XP_006357923.1|  PREDICTED: purine permease 3-like                  323   2e-105   
ref|XP_004237961.1|  PREDICTED: purine permease 1-like                  325   3e-105   
ref|XP_010266597.1|  PREDICTED: purine permease 3-like                  322   2e-104   
gb|KCW66598.1|  hypothetical protein EUGRSUZ_F00392                     326   2e-104   
emb|CDY27947.1|  BnaCnng05320D                                          321   3e-104   
ref|XP_011072345.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...    321   3e-104   
ref|XP_006338103.1|  PREDICTED: purine permease 1-like                  321   4e-104   
gb|EYU38177.1|  hypothetical protein MIMGU_mgv1a023817mg                321   4e-104   
gb|EPS67422.1|  hypothetical protein M569_07351                         319   6e-104   
ref|XP_006366415.1|  PREDICTED: purine permease 3-like                  320   8e-104   
ref|XP_006433898.1|  hypothetical protein CICLE_v10001546mg             320   1e-103   
ref|XP_010939717.1|  PREDICTED: purine permease 3-like isoform X2       320   1e-103   
ref|XP_006472532.1|  PREDICTED: purine permease 1-like                  320   2e-103   
ref|XP_004490401.1|  PREDICTED: purine permease 1-like                  319   4e-103   
ref|XP_002893512.1|  ATPUP3                                             318   7e-103   
ref|XP_010064227.1|  PREDICTED: purine permease 3-like                  318   1e-102   
gb|AES73111.2|  purine permease-like protein                            317   2e-102   
ref|XP_004501676.1|  PREDICTED: purine permease 1-like isoform X1       317   2e-102   
ref|XP_010322002.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...    316   2e-102   
ref|XP_010538168.1|  PREDICTED: purine permease 1-like                  317   2e-102   
emb|CDX94595.1|  BnaC07g10630D                                          316   3e-102   
ref|XP_009766753.1|  PREDICTED: purine permease 3-like                  316   5e-102   
ref|XP_009102926.1|  PREDICTED: purine permease 3                       315   6e-102   
ref|XP_003602860.1|  Purine permease                                    317   1e-101   
ref|NP_174143.1|  purine permease 3                                     314   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002531513.1|  purine transporter, putative                       315   2e-101   Ricinus communis
emb|CDY17197.1|  BnaA05g09910D                                          314   2e-101   
ref|XP_010098679.1|  Purine permease 3                                  314   5e-101   
ref|XP_004252714.1|  PREDICTED: purine permease 3-like                  313   5e-101   
ref|XP_009765499.1|  PREDICTED: purine permease 1-like                  312   8e-101   
ref|XP_010060066.1|  PREDICTED: purine permease 1-like                  313   1e-100   
ref|XP_006357924.1|  PREDICTED: purine permease 3-like                  311   2e-100   
ref|XP_007042880.1|  Purine permease 3                                  313   2e-100   
ref|XP_008446590.1|  PREDICTED: purine permease 3-like                  311   3e-100   
ref|XP_006305203.1|  hypothetical protein CARUB_v10009570mg             311   3e-100   
gb|KDP40942.1|  hypothetical protein JCGZ_24941                         311   3e-100   
emb|CDY35722.1|  BnaC03g58430D                                          311   4e-100   
ref|XP_009611006.1|  PREDICTED: purine permease 1-like                  311   4e-100   
ref|XP_009609429.1|  PREDICTED: purine permease 3-like                  311   4e-100   
ref|XP_008812219.1|  PREDICTED: purine permease 3-like                  310   5e-100   
ref|XP_003522775.1|  PREDICTED: purine permease 1-like                  310   6e-100   
ref|XP_009109745.1|  PREDICTED: purine permease 1                       310   6e-100   
gb|EPS65699.1|  hypothetical protein M569_09078                         309   9e-100   
ref|XP_010939715.1|  PREDICTED: purine permease 3-like                  310   9e-100   
ref|XP_009143832.1|  PREDICTED: purine permease 2 isoform X1            310   1e-99    
ref|XP_006295883.1|  hypothetical protein CARUB_v10025013mg             309   1e-99    
ref|XP_008812221.1|  PREDICTED: purine permease 3-like                  309   3e-99    
emb|CDP11456.1|  unnamed protein product                                308   3e-99    
ref|XP_010460601.1|  PREDICTED: purine permease 1                       308   4e-99    
ref|XP_006410518.1|  hypothetical protein EUTSA_v10017788mg             308   6e-99    
ref|XP_009605309.1|  PREDICTED: purine permease 1-like                  307   9e-99    
ref|XP_009763953.1|  PREDICTED: purine permease 3-like                  307   1e-98    
ref|XP_010266586.1|  PREDICTED: purine permease 3-like                  308   1e-98    
ref|XP_004146629.1|  PREDICTED: purine permease 3-like                  306   2e-98    
ref|XP_007042882.1|  Purine permease 3 isoform 2                        306   2e-98    
gb|KGN64615.1|  hypothetical protein Csa_1G071290                       306   2e-98    
ref|XP_009598031.1|  PREDICTED: purine permease 1-like                  306   3e-98    
ref|XP_010244044.1|  PREDICTED: purine permease 1-like                  306   3e-98    
ref|XP_009109746.1|  PREDICTED: purine permease 1-like                  306   3e-98    
gb|AES73112.2|  purine permease-like protein                            306   4e-98    
ref|XP_010509839.1|  PREDICTED: purine permease 2-like                  305   4e-98    
ref|XP_009603730.1|  PREDICTED: purine permease 3-like                  305   4e-98    
gb|KDP40961.1|  hypothetical protein JCGZ_24960                         309   8e-98    
gb|ADP30798.1|  nicotine uptake permease 1                              305   8e-98    
ref|XP_010469434.1|  PREDICTED: purine permease 2-like                  305   8e-98    
ref|XP_009380886.1|  PREDICTED: purine permease 3-like                  305   8e-98    
ref|XP_010499327.1|  PREDICTED: purine permease 1-like isoform X1       305   9e-98    
ref|XP_010549316.1|  PREDICTED: purine permease 3                       304   1e-97    
gb|KFK44702.1|  hypothetical protein AALP_AA1G292000                    304   1e-97    
gb|AAF64547.1|AF078531_1  purine permease                               304   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|NP_174144.1|  purine permease 1                                     304   2e-97    Arabidopsis thaliana [mouse-ear cress]
emb|CDY29741.1|  BnaA01g19250D                                          304   2e-97    
ref|XP_009148632.1|  PREDICTED: purine permease 2-like                  304   3e-97    
ref|XP_006305220.1|  hypothetical protein CARUB_v10009586mg             303   3e-97    
ref|NP_973592.1|  purine permease 2                                     303   4e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009776518.1|  PREDICTED: purine permease 1-like                  302   7e-97    
ref|XP_009143833.1|  PREDICTED: purine permease 2 isoform X2            302   8e-97    
ref|XP_003615204.1|  Purine permease                                    302   9e-97    
ref|XP_007042881.1|  Purine permease 3 isoform 1                        301   1e-96    
gb|KFK44691.1|  hypothetical protein AALP_AA1G290900                    301   1e-96    
ref|XP_010478191.1|  PREDICTED: purine permease 1-like                  301   2e-96    
ref|XP_010413821.1|  PREDICTED: purine permease 2                       301   3e-96    
ref|XP_010413817.1|  PREDICTED: purine permease 2-like                  300   3e-96    
ref|XP_002893513.1|  hypothetical protein ARALYDRAFT_890360             301   4e-96    
emb|CDY12422.1|  BnaC08g09110D                                          301   4e-96    
ref|XP_009599635.1|  PREDICTED: purine permease 1-like                  300   9e-96    
ref|XP_010509840.1|  PREDICTED: purine permease 2-like                  300   1e-95    
ref|XP_009795252.1|  PREDICTED: purine permease 1-like                  299   2e-95    
ref|XP_010509841.1|  PREDICTED: purine permease 2-like                  298   2e-95    
ref|XP_009769306.1|  PREDICTED: purine permease 1-like                  298   2e-95    
ref|XP_004237962.1|  PREDICTED: purine permease 3-like                  298   3e-95    
ref|XP_010942638.1|  PREDICTED: purine permease 3-like isoform X2       298   3e-95    
ref|XP_009762239.1|  PREDICTED: purine permease 1-like                  298   4e-95    
ref|XP_008806390.1|  PREDICTED: purine permease 3-like                  298   5e-95    
ref|XP_002881298.1|  ATPUP2                                             298   5e-95    
ref|XP_010538169.1|  PREDICTED: purine permease 3-like                  297   6e-95    
ref|XP_010460596.1|  PREDICTED: purine permease 3                       297   7e-95    
emb|CDY16284.1|  BnaC01g23190D                                          298   7e-95    
ref|XP_010499329.1|  PREDICTED: purine permease 3-like                  297   1e-94    
ref|XP_006358992.1|  PREDICTED: purine permease 1-like                  296   2e-94    
ref|XP_010675382.1|  PREDICTED: purine permease 3-like                  297   2e-94    
ref|XP_006415682.1|  hypothetical protein EUTSA_v10008037mg             296   2e-94    
ref|XP_009621473.1|  PREDICTED: purine permease 3-like                  296   2e-94    
ref|XP_010942637.1|  PREDICTED: purine permease 3-like isoform X1       298   3e-94    
ref|XP_009770717.1|  PREDICTED: purine permease 1-like                  295   6e-94    
ref|XP_008667894.1|  PREDICTED: PUP1 isoform X1                         295   1e-93    
ref|NP_180931.2|  purine permease 2                                     294   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009783837.1|  PREDICTED: purine permease 3-like                  294   1e-93    
ref|XP_007136297.1|  hypothetical protein PHAVU_009G034400g             294   2e-93    
ref|XP_007141230.1|  hypothetical protein PHAVU_008G178300g             293   3e-93    
gb|AAC69140.1|  hypothetical protein                                    292   6e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004959530.1|  PREDICTED: purine permease 1-like                  293   8e-93    
ref|XP_006338102.1|  PREDICTED: purine permease 1-like                  291   2e-92    
ref|XP_010549318.1|  PREDICTED: purine permease 3-like                  288   2e-91    
gb|EAZ09425.1|  hypothetical protein OsI_31698                          289   2e-91    Oryza sativa Indica Group [Indian rice]
ref|NP_001063424.1|  Os09g0467300                                       289   3e-91    Oryza sativa Japonica Group [Japonica rice]
gb|EMT19524.1|  Purine permease 3                                       287   4e-91    
ref|NP_001147096.1|  PUP1                                               287   9e-91    Zea mays [maize]
ref|XP_010478189.1|  PREDICTED: purine permease 3-like                  286   2e-90    
ref|XP_003519187.1|  PREDICTED: purine permease 1-like                  285   2e-90    
dbj|BAK04933.1|  predicted protein                                      283   4e-89    
ref|XP_006661330.1|  PREDICTED: purine permease 3-like                  283   5e-89    
dbj|BAJ88843.1|  predicted protein                                      282   5e-88    
ref|XP_009113691.1|  PREDICTED: purine permease 1-like                  280   5e-88    
dbj|BAJ87663.1|  predicted protein                                      281   6e-88    
ref|XP_009401279.1|  PREDICTED: purine permease 1-like                  280   6e-88    
dbj|BAJ86755.1|  predicted protein                                      279   1e-87    
ref|XP_003578263.2|  PREDICTED: purine permease 3-like                  280   2e-87    
ref|NP_001063425.1|  Os09g0467400                                       278   2e-87    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ94351.1|  predicted protein                                      277   2e-86    
gb|EEC84724.1|  hypothetical protein OsI_31699                          276   2e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_010234593.1|  PREDICTED: purine permease 3-like isoform X1       276   3e-86    
ref|XP_006841262.1|  hypothetical protein AMTR_s00135p00100890          275   5e-86    
gb|EPS58788.1|  hypothetical protein M569_16026                         273   7e-86    
gb|KCW51603.1|  hypothetical protein EUGRSUZ_J01095                     271   2e-85    
dbj|BAD19737.1|  putative purine permease                               273   2e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010263028.1|  PREDICTED: purine permease 1-like                  270   3e-84    
ref|XP_004158055.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...    268   3e-84    
emb|CDP01096.1|  unnamed protein product                                270   3e-84    
ref|XP_006841259.1|  hypothetical protein AMTR_s00135p00097090          270   4e-84    
ref|XP_002462515.1|  hypothetical protein SORBIDRAFT_02g027100          269   8e-84    Sorghum bicolor [broomcorn]
ref|XP_004957086.1|  PREDICTED: purine permease 3-like                  267   5e-83    
ref|NP_001131978.1|  uncharacterized protein LOC100193377               267   6e-83    Zea mays [maize]
ref|XP_010263027.1|  PREDICTED: purine permease 3-like                  266   8e-83    
ref|XP_002462514.1|  hypothetical protein SORBIDRAFT_02g027090          263   4e-81    Sorghum bicolor [broomcorn]
ref|XP_008667169.1|  PREDICTED: uncharacterized protein LOC100193...    262   5e-81    
emb|CDP16579.1|  unnamed protein product                                258   1e-80    
gb|ABR16841.1|  unknown                                                 261   1e-80    Picea sitchensis
ref|XP_008652812.1|  PREDICTED: purine permease 3-like                  261   2e-80    
ref|XP_006841261.1|  hypothetical protein AMTR_s00135p00099660          259   5e-80    
ref|XP_003579811.2|  PREDICTED: purine permease 3-like                  255   2e-78    
gb|KFK31021.1|  hypothetical protein AALP_AA6G057800                    254   2e-78    
ref|XP_010234594.1|  PREDICTED: purine permease 3-like isoform X2       256   2e-78    
emb|CDX90135.1|  BnaA08g18490D                                          250   6e-77    
gb|EPS74474.1|  hypothetical protein M569_00285                         246   1e-75    
ref|XP_004959525.1|  PREDICTED: purine permease 3-like                  249   1e-75    
ref|XP_002301070.2|  hypothetical protein POPTR_0002s09980g             247   2e-75    Populus trichocarpa [western balsam poplar]
ref|XP_009631999.1|  PREDICTED: purine permease 1-like                  246   5e-75    
gb|EPS72255.1|  hypothetical protein M569_02503                         242   6e-75    
ref|XP_009762898.1|  PREDICTED: purine permease 3-like                  246   7e-75    
ref|XP_010247465.1|  PREDICTED: purine permease 3-like                  246   1e-74    
tpg|DAA61854.1|  TPA: hypothetical protein ZEAMMB73_233624              245   4e-74    
emb|CDY15687.1|  BnaA07g08580D                                          241   1e-73    
ref|XP_002513954.1|  purine transporter, putative                       242   2e-73    Ricinus communis
emb|CDY35721.1|  BnaC03g58420D                                          241   3e-73    
ref|XP_010926344.1|  PREDICTED: purine permease 3-like isoform X1       242   4e-73    
ref|XP_009801738.1|  PREDICTED: purine permease 1-like isoform X1       238   2e-72    
ref|XP_010098677.1|  Purine permease 3                                  236   5e-72    
ref|XP_004252530.1|  PREDICTED: purine permease 1-like                  238   1e-71    
ref|XP_006360267.1|  PREDICTED: purine permease 1-like                  236   6e-71    
ref|XP_010248452.1|  PREDICTED: purine permease 3-like                  231   1e-69    
ref|XP_006360266.1|  PREDICTED: purine permease 1-like                  228   9e-68    
ref|XP_010418647.1|  PREDICTED: purine permease 2-like                  224   1e-67    
ref|XP_011016754.1|  PREDICTED: purine permease 1-like                  224   1e-66    
gb|KCW66597.1|  hypothetical protein EUGRSUZ_F00391                     221   2e-66    
ref|XP_006661332.1|  PREDICTED: purine permease 3-like                  219   1e-65    
ref|XP_009801739.1|  PREDICTED: purine permease 1-like isoform X2       218   2e-65    
ref|XP_006415683.1|  hypothetical protein EUTSA_v10009673mg             218   2e-64    
ref|XP_009801740.1|  PREDICTED: purine permease 1-like isoform X3       214   3e-64    
gb|EEE69873.1|  hypothetical protein OsJ_29687                          214   9e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009789614.1|  PREDICTED: purine permease 1-like                  207   4e-61    
ref|XP_008795222.1|  PREDICTED: purine permease 3-like                  209   1e-60    
ref|XP_010939716.1|  PREDICTED: purine permease 1-like isoform X1       211   1e-60    
gb|EMS63809.1|  Purine permease 3                                       206   1e-60    
emb|CBI19192.3|  unnamed protein product                                206   5e-60    
ref|XP_003602861.1|  Purine permease                                    203   2e-59    
ref|XP_008779125.1|  PREDICTED: purine permease 1-like                  197   2e-57    
gb|KHN08969.1|  Purine permease 1                                       195   5e-57    
gb|EPS58881.1|  hypothetical protein M569_15932                         197   1e-56    
gb|ABR16480.1|  unknown                                                 197   5e-56    Picea sitchensis
ref|XP_002977418.1|  hypothetical protein SELMODRAFT_417454             197   9e-56    
dbj|BAG88745.1|  unnamed protein product                                194   1e-55    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661331.1|  PREDICTED: purine permease 3-like                  191   9e-55    
ref|XP_009380885.1|  PREDICTED: purine permease 1-like                  190   2e-54    
ref|XP_002977419.1|  hypothetical protein SELMODRAFT_417455             191   2e-53    
gb|EEE69876.1|  hypothetical protein OsJ_29691                          185   1e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004985414.1|  PREDICTED: purine permease 3-like                  187   3e-52    
emb|CDY72169.1|  BnaCnng76300D                                          184   3e-52    
emb|CDY46618.1|  BnaA09g27450D                                          181   2e-51    
ref|XP_002993859.1|  hypothetical protein SELMODRAFT_236829             183   4e-51    
ref|XP_002991403.1|  hypothetical protein SELMODRAFT_236291             182   1e-50    
ref|XP_002975003.1|  hypothetical protein SELMODRAFT_232471             181   2e-50    
gb|EEC84725.1|  hypothetical protein OsI_31703                          180   2e-50    Oryza sativa Indica Group [Indian rice]
gb|KHN08292.1|  Purine permease 1                                       176   2e-50    
gb|KEH37326.1|  triose-phosphate transporter family protein             181   2e-49    
ref|XP_006859063.1|  hypothetical protein AMTR_s00068p00197770          179   3e-49    
ref|XP_006826553.1|  hypothetical protein AMTR_s02825p00003100          175   7e-49    
ref|XP_002465736.1|  hypothetical protein SORBIDRAFT_01g044690          177   2e-48    Sorghum bicolor [broomcorn]
ref|XP_004959529.1|  PREDICTED: purine permease 2-like                  174   3e-48    
tpg|DAA40289.1|  TPA: hypothetical protein ZEAMMB73_258363              174   5e-48    
gb|EAZ09428.1|  hypothetical protein OsI_31702                          173   5e-48    Oryza sativa Indica Group [Indian rice]
ref|XP_004959528.1|  PREDICTED: purine permease 2-like                  172   2e-47    
ref|NP_001063426.2|  Os09g0467500                                       171   4e-47    Oryza sativa Japonica Group [Japonica rice]
gb|EYU34538.1|  hypothetical protein MIMGU_mgv1a019697mg                167   6e-47    
gb|EMT19334.1|  Purine permease 3                                       171   1e-46    
ref|XP_006373040.1|  hypothetical protein POPTR_0017s07610g             168   4e-46    
gb|KHN26582.1|  Putative purine permease 4                              169   2e-45    
ref|XP_007138880.1|  hypothetical protein PHAVU_009G245400g             170   2e-45    
emb|CDP05635.1|  unnamed protein product                                163   3e-45    
ref|XP_003534853.1|  PREDICTED: probable purine permease 4-like         169   6e-45    
ref|XP_002462516.1|  hypothetical protein SORBIDRAFT_02g027110          164   3e-44    Sorghum bicolor [broomcorn]
ref|XP_009759913.1|  PREDICTED: probable purine permease 4              166   6e-44    
gb|AGV54805.1|  purine permease 4-like protein                          163   8e-43    
ref|XP_007138881.1|  hypothetical protein PHAVU_009G245500g             162   2e-42    
dbj|BAJ96346.1|  predicted protein                                      161   3e-42    
gb|KHN21034.1|  Putative purine permease 9                              161   3e-42    
ref|XP_004959524.1|  PREDICTED: purine permease 2-like                  157   7e-42    
ref|XP_004248514.2|  PREDICTED: probable purine permease 4              159   1e-41    
ref|XP_011007507.1|  PREDICTED: probable purine permease 10             159   3e-41    
gb|EMS56378.1|  hypothetical protein TRIUR3_06439                       158   4e-41    
dbj|BAJ95836.1|  predicted protein                                      158   5e-41    
gb|KEH37325.1|  triose-phosphate transporter family protein             156   2e-40    
ref|XP_008651823.1|  PREDICTED: purine permease 3                       156   2e-40    
ref|NP_001049213.1|  Os03g0187800                                       156   3e-40    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006602851.1|  PREDICTED: probable purine permease 11-like ...    155   3e-40    
ref|XP_003551696.2|  PREDICTED: probable purine permease 11-like ...    155   3e-40    
gb|EAY88839.1|  hypothetical protein OsI_10311                          156   3e-40    Oryza sativa Indica Group [Indian rice]
ref|XP_008225353.1|  PREDICTED: probable purine permease 9              155   4e-40    
ref|XP_004985415.1|  PREDICTED: purine permease 3-like                  155   5e-40    
ref|XP_010941200.1|  PREDICTED: probable purine permease 11             154   1e-39    
gb|AFK45074.1|  unknown                                                 153   2e-39    
gb|KEH18591.1|  purine transporter, putative                            152   3e-39    
ref|XP_010247689.1|  PREDICTED: probable purine permease 11             153   3e-39    
gb|KHN47749.1|  Putative purine permease 4                              152   4e-39    
ref|XP_003547402.1|  PREDICTED: probable purine permease 4-like         152   4e-39    
gb|EPS58880.1|  hypothetical protein M569_15931                         145   4e-39    
ref|XP_009407088.1|  PREDICTED: probable purine permease 4              153   5e-39    
ref|XP_002263453.2|  PREDICTED: probable purine permease 4              152   5e-39    
ref|XP_004985416.1|  PREDICTED: purine permease 3-like                  152   5e-39    
gb|KEH18590.1|  purine transporter, putative                            152   6e-39    
gb|KEH18592.1|  purine transporter, putative                            152   6e-39    
ref|XP_007039598.1|  Drug/metabolite transporter superfamily protein    151   6e-39    
ref|XP_007211409.1|  hypothetical protein PRUPE_ppa006967mg             152   7e-39    
ref|XP_008460053.1|  PREDICTED: probable purine permease 11             152   7e-39    
ref|XP_004953494.1|  PREDICTED: probable purine permease 11-like        152   8e-39    
gb|ADN34099.1|  purine transmembrane transporter                        151   1e-38    
ref|XP_008450620.1|  PREDICTED: probable purine permease 11 isofo...    151   1e-38    
ref|XP_008677756.1|  PREDICTED: uncharacterized protein LOC100502...    151   2e-38    
ref|XP_002983502.1|  hypothetical protein SELMODRAFT_118529             150   2e-38    
ref|XP_002454455.1|  hypothetical protein SORBIDRAFT_04g031400          151   2e-38    
ref|XP_004488889.1|  PREDICTED: probable purine permease 5-like         150   3e-38    
ref|XP_002973993.1|  hypothetical protein SELMODRAFT_232165             149   4e-38    
gb|KGN46286.1|  hypothetical protein Csa_6G079800                       149   4e-38    
ref|XP_010056479.1|  PREDICTED: probable purine permease 11 isofo...    149   5e-38    
ref|XP_004488230.1|  PREDICTED: probable purine permease 4-like         149   5e-38    
gb|KDP45955.1|  hypothetical protein JCGZ_11858                         150   5e-38    
ref|XP_004160684.1|  PREDICTED: probable purine permease 11-like        149   5e-38    
ref|NP_001136854.1|  hypothetical protein                               150   6e-38    
ref|XP_004145022.1|  PREDICTED: probable purine permease 11-like        149   6e-38    
ref|NP_001241384.1|  uncharacterized protein LOC100819409               149   6e-38    
gb|AFK38153.1|  unknown                                                 149   6e-38    
gb|KGN66057.1|  hypothetical protein Csa_1G569340                       149   8e-38    
ref|XP_010098678.1|  Purine permease 1                                  150   9e-38    
ref|XP_007218138.1|  hypothetical protein PRUPE_ppa007245mg             149   1e-37    
ref|XP_008232299.1|  PREDICTED: probable purine permease 11 isofo...    149   1e-37    
ref|XP_010056475.1|  PREDICTED: probable purine permease 11 isofo...    149   1e-37    
ref|XP_007218139.1|  hypothetical protein PRUPE_ppa007245mg             148   1e-37    
ref|XP_010056477.1|  PREDICTED: probable purine permease 11 isofo...    149   2e-37    
ref|XP_006647707.1|  PREDICTED: probable purine permease 11-like        148   2e-37    
ref|XP_008232298.1|  PREDICTED: probable purine permease 11 isofo...    148   2e-37    
ref|XP_004979831.1|  PREDICTED: purine permease 3-like                  147   2e-37    
ref|XP_010055380.1|  PREDICTED: probable purine permease 11             148   2e-37    
ref|XP_004492883.1|  PREDICTED: probable purine permease 11-like ...    148   2e-37    
ref|XP_009400212.1|  PREDICTED: probable purine permease 11             148   2e-37    
ref|XP_004492882.1|  PREDICTED: probable purine permease 11-like ...    147   2e-37    
ref|XP_007025152.1|  Purine permease 10 isoform 1                       147   3e-37    
ref|XP_011018650.1|  PREDICTED: probable purine permease 11 isofo...    147   5e-37    
gb|KHN28447.1|  Putative purine permease 5                              146   5e-37    
ref|XP_011018648.1|  PREDICTED: probable purine permease 11 isofo...    147   5e-37    
ref|XP_003593723.1|  hypothetical protein MTR_2g015470                  147   6e-37    
ref|XP_006358606.1|  PREDICTED: probable purine permease 11-like        147   6e-37    
ref|XP_010100973.1|  hypothetical protein L484_010628                   147   6e-37    
gb|EYU35321.1|  hypothetical protein MIMGU_mgv1a008781mg                146   6e-37    
ref|XP_006662363.1|  PREDICTED: probable purine permease 11-like        147   7e-37    
ref|XP_006582088.1|  PREDICTED: probable purine permease 5-like i...    146   7e-37    
ref|XP_008677755.1|  PREDICTED: uncharacterized protein LOC100502...    148   8e-37    
ref|XP_003527168.1|  PREDICTED: probable purine permease 5-like i...    146   9e-37    
dbj|BAG93087.1|  unnamed protein product                                145   9e-37    
ref|XP_007138274.1|  hypothetical protein PHAVU_009G194800g             146   9e-37    
emb|CDP13405.1|  unnamed protein product                                146   9e-37    
ref|XP_008652813.1|  PREDICTED: purine permease 2-like                  144   9e-37    
ref|XP_010677220.1|  PREDICTED: probable purine permease 11             146   9e-37    
gb|KHN42588.1|  Putative purine permease 5                              145   1e-36    
ref|XP_002298513.2|  hypothetical protein POPTR_0001s34550g             146   1e-36    
ref|XP_008225352.1|  PREDICTED: probable purine permease 10             146   1e-36    
ref|XP_003550935.1|  PREDICTED: probable purine permease 11-like        146   1e-36    
ref|XP_006592598.1|  PREDICTED: probable purine permease 5-like i...    145   2e-36    
ref|XP_007214484.1|  hypothetical protein PRUPE_ppa020615mg             144   2e-36    
ref|XP_007155747.1|  hypothetical protein PHAVU_003G228300g             145   2e-36    
ref|XP_003541140.1|  PREDICTED: probable purine permease 5-like i...    145   2e-36    
ref|XP_003525599.1|  PREDICTED: probable purine permease 10-like        145   2e-36    
emb|CDP06315.1|  unnamed protein product                                145   3e-36    
ref|XP_010926345.1|  PREDICTED: purine permease 1-like isoform X2       142   3e-36    
ref|XP_006579668.1|  PREDICTED: probable purine permease 11-like        144   3e-36    
ref|XP_006436828.1|  hypothetical protein CICLE_v10031810mg             145   3e-36    
ref|XP_010058075.1|  PREDICTED: probable purine permease 4              145   4e-36    
ref|XP_010244043.1|  PREDICTED: purine permease 1-like                  138   4e-36    
ref|NP_001047783.1|  Os02g0689200                                       144   4e-36    
dbj|BAD07671.1|  putative purine permease                               144   5e-36    
ref|XP_009614957.1|  PREDICTED: probable purine permease 4              143   5e-36    
ref|XP_006453625.1|  hypothetical protein CICLE_v10008754mg             144   5e-36    
ref|XP_003533498.1|  PREDICTED: probable purine permease 4-like         144   6e-36    
ref|XP_004166556.1|  PREDICTED: LOW QUALITY PROTEIN: probable pur...    144   6e-36    
ref|XP_010680002.1|  PREDICTED: probable purine permease 11             144   6e-36    
ref|XP_010247691.1|  PREDICTED: probable purine permease 11 isofo...    144   6e-36    
ref|XP_009608566.1|  PREDICTED: probable purine permease 10 isofo...    144   6e-36    
dbj|BAJ95311.1|  predicted protein                                      144   7e-36    
ref|XP_009608565.1|  PREDICTED: probable purine permease 9 isofor...    144   7e-36    
gb|KDO59449.1|  hypothetical protein CISIN_1g017963mg                   144   7e-36    
ref|XP_008444266.1|  PREDICTED: probable purine permease 10             144   8e-36    
ref|XP_006841264.1|  hypothetical protein AMTR_s00135p00104240          141   8e-36    
ref|XP_004245857.1|  PREDICTED: probable purine permease 11             144   8e-36    
gb|EMT19164.1|  hypothetical protein F775_05921                         144   9e-36    
ref|XP_007025158.1|  Purine permease 10                                 144   9e-36    
ref|XP_009622283.1|  PREDICTED: probable purine permease 4 isofor...    144   9e-36    
gb|EPS62038.1|  hypothetical protein M569_12755                         142   1e-35    
ref|XP_006651115.1|  PREDICTED: purine permease 3-like                  143   1e-35    
ref|XP_009799236.1|  PREDICTED: probable purine permease 4              144   1e-35    
ref|XP_006354634.1|  PREDICTED: probable purine permease 11-like        143   1e-35    
ref|XP_004248513.1|  PREDICTED: probable purine permease 4              143   1e-35    
gb|EAZ24234.1|  hypothetical protein OsJ_07985                          144   1e-35    
ref|XP_006368464.1|  hypothetical protein POPTR_0001s03050g             143   1e-35    
ref|XP_010519027.1|  PREDICTED: probable purine permease 4              143   2e-35    
ref|XP_006473996.1|  PREDICTED: probable purine permease 5-like         142   2e-35    
ref|XP_007034137.1|  Purine permease 4                                  142   2e-35    
ref|XP_009782582.1|  PREDICTED: probable purine permease 10 isofo...    142   2e-35    
ref|XP_009766627.1|  PREDICTED: probable purine permease 11 isofo...    142   2e-35    
ref|XP_009766626.1|  PREDICTED: probable purine permease 11 isofo...    142   2e-35    
gb|KEH34049.1|  purine permease                                         142   3e-35    
ref|XP_006355607.1|  PREDICTED: probable purine permease 6-like i...    142   3e-35    
ref|XP_009782581.1|  PREDICTED: probable purine permease 10 isofo...    142   3e-35    
ref|XP_006602140.1|  PREDICTED: probable purine permease 9-like i...    142   3e-35    
gb|KHN31656.1|  Putative purine permease 9                              142   3e-35    
gb|KDO38040.1|  hypothetical protein CISIN_1g0167861mg                  142   3e-35    
ref|XP_002320858.2|  purine permease family protein                     142   3e-35    
ref|XP_010110511.1|  hypothetical protein L484_023343                   142   3e-35    
ref|XP_006355608.1|  PREDICTED: probable purine permease 6-like i...    142   3e-35    
ref|XP_010265596.1|  PREDICTED: probable purine permease 5              142   3e-35    
gb|KDP37934.1|  hypothetical protein JCGZ_04577                         142   4e-35    
ref|XP_011085269.1|  PREDICTED: probable purine permease 10             141   4e-35    
gb|AFK34280.1|  unknown                                                 142   5e-35    
ref|XP_004242601.1|  PREDICTED: probable purine permease 5 isofor...    140   6e-35    
ref|XP_006343643.1|  PREDICTED: probable purine permease 5-like         141   6e-35    
ref|XP_004151103.1|  PREDICTED: probable purine permease 9-like i...    141   6e-35    
ref|XP_003558629.1|  PREDICTED: purine permease 3-like                  141   7e-35    
ref|XP_006307602.1|  hypothetical protein CARUB_v10009226mg             142   7e-35    
ref|XP_006464375.1|  PREDICTED: probable purine permease 11-like ...    140   7e-35    
ref|XP_003551463.1|  PREDICTED: probable purine permease 9-like i...    142   7e-35    
ref|XP_003561966.2|  PREDICTED: purine permease 3-like                  141   8e-35    
ref|XP_004242599.1|  PREDICTED: probable purine permease 5 isofor...    140   8e-35    
ref|XP_006602139.1|  PREDICTED: probable purine permease 9-like i...    141   8e-35    
ref|XP_008225422.1|  PREDICTED: probable purine permease 9              141   9e-35    
ref|XP_010924628.1|  PREDICTED: probable purine permease 4              140   1e-34    
ref|XP_008450056.1|  PREDICTED: probable purine permease 10 isofo...    140   1e-34    
ref|XP_004233085.1|  PREDICTED: probable purine permease 10             140   1e-34    
gb|KDO85409.1|  hypothetical protein CISIN_1g0170172mg                  140   1e-34    
gb|KDP28910.1|  hypothetical protein JCGZ_14681                         140   1e-34    
ref|XP_009604158.1|  PREDICTED: probable purine permease 11 isofo...    140   1e-34    
ref|XP_009604157.1|  PREDICTED: probable purine permease 11 isofo...    140   1e-34    
ref|XP_009115035.1|  PREDICTED: probable purine permease 4              140   2e-34    
ref|XP_006464373.1|  PREDICTED: probable purine permease 11-like ...    140   2e-34    
ref|XP_009353822.1|  PREDICTED: probable purine permease 10             140   2e-34    
ref|XP_009115032.1|  PREDICTED: probable purine permease 4              140   2e-34    
ref|XP_006445484.1|  hypothetical protein CICLE_v10020615mg             140   2e-34    
gb|KHN40504.1|  Putative purine permease 11                             138   2e-34    
ref|XP_010052098.1|  PREDICTED: probable purine permease 9              140   2e-34    
ref|XP_010460900.1|  PREDICTED: probable purine permease 4              140   2e-34    
gb|EEC73811.1|  hypothetical protein OsI_08525                          140   2e-34    
ref|XP_008383566.1|  PREDICTED: probable purine permease 9              140   2e-34    
ref|XP_004151104.1|  PREDICTED: probable purine permease 9-like i...    139   2e-34    
ref|XP_010677223.1|  PREDICTED: probable purine permease 11             140   2e-34    
gb|KCW75957.1|  hypothetical protein EUGRSUZ_D00325                     140   2e-34    
gb|EEC85041.1|  hypothetical protein OsI_32358                          139   3e-34    
ref|XP_006445485.1|  hypothetical protein CICLE_v10020615mg             138   3e-34    
ref|XP_004307271.1|  PREDICTED: probable purine permease 11-like        140   3e-34    
ref|XP_009363284.1|  PREDICTED: probable purine permease 4              140   3e-34    
ref|XP_008371579.1|  PREDICTED: probable purine permease 10             139   3e-34    
ref|XP_011089061.1|  PREDICTED: probable purine permease 4              139   4e-34    
ref|XP_003570128.1|  PREDICTED: probable purine permease 11 isofo...    139   4e-34    
ref|XP_010908241.1|  PREDICTED: probable purine permease 5              139   4e-34    
ref|XP_004248515.2|  PREDICTED: probable purine permease 4              139   4e-34    
ref|XP_010235835.1|  PREDICTED: probable purine permease 11 isofo...    139   4e-34    
ref|XP_006445483.1|  hypothetical protein CICLE_v10020615mg             138   4e-34    
ref|XP_002890908.1|  hypothetical protein ARALYDRAFT_473325             139   4e-34    
ref|XP_008450060.1|  PREDICTED: probable purine permease 10 isofo...    138   4e-34    
ref|XP_002309345.2|  purine permease-related family protein             139   5e-34    
ref|XP_002462820.1|  hypothetical protein SORBIDRAFT_02g032510          138   5e-34    
gb|KHN26580.1|  Putative purine permease 4                              139   5e-34    
ref|XP_004488231.1|  PREDICTED: probable purine permease 4-like         139   5e-34    
ref|XP_007139692.1|  hypothetical protein PHAVU_008G051100g             139   6e-34    
ref|XP_009622284.1|  PREDICTED: probable purine permease 4 isofor...    139   6e-34    
ref|XP_010478523.1|  PREDICTED: probable purine permease 4 isofor...    139   6e-34    
ref|XP_004957612.1|  PREDICTED: probable purine permease 5-like         138   7e-34    
ref|NP_564365.1|  purine permease 4                                     138   8e-34    
ref|XP_002533991.1|  purine transporter, putative                       138   9e-34    
dbj|BAG92399.1|  unnamed protein product                                138   9e-34    
ref|XP_003534852.1|  PREDICTED: probable purine permease 4-like         138   1e-33    
gb|KDP38675.1|  hypothetical protein JCGZ_04028                         137   1e-33    
ref|XP_007213488.1|  hypothetical protein PRUPE_ppa022736mg             137   1e-33    
ref|XP_008799578.1|  PREDICTED: LOW QUALITY PROTEIN: probable pur...    137   1e-33    
ref|XP_008671258.1|  PREDICTED: probable purine permease 11             137   2e-33    
dbj|BAK08195.1|  predicted protein                                      137   2e-33    
ref|XP_008776064.1|  PREDICTED: probable purine permease 5              137   2e-33    
gb|KDO85410.1|  hypothetical protein CISIN_1g0170172mg                  136   2e-33    
ref|XP_008784692.1|  PREDICTED: probable purine permease 11             137   2e-33    
tpg|DAA37453.1|  TPA: hypothetical protein ZEAMMB73_016243              137   2e-33    
ref|XP_004229705.1|  PREDICTED: probable purine permease 11             137   2e-33    
gb|KFK41670.1|  hypothetical protein AALP_AA2G157700                    137   2e-33    
ref|NP_001151039.1|  ATPUP5                                             137   2e-33    
ref|XP_007213551.1|  hypothetical protein PRUPE_ppa018140mg             136   3e-33    
ref|XP_004246178.1|  PREDICTED: probable purine permease 11             137   3e-33    
ref|XP_006467517.1|  PREDICTED: probable purine permease 9-like         137   3e-33    
ref|XP_007146627.1|  hypothetical protein PHAVU_006G056200g             137   3e-33    
ref|XP_008229522.1|  PREDICTED: probable purine permease 11             136   4e-33    
ref|XP_006449636.1|  hypothetical protein CICLE_v10015531mg             136   4e-33    
ref|XP_009418739.1|  PREDICTED: probable purine permease 5 isofor...    135   5e-33    
ref|XP_008226019.1|  PREDICTED: probable purine permease 4              136   5e-33    
ref|XP_011096513.1|  PREDICTED: probable purine permease 9              136   5e-33    
ref|XP_009418731.1|  PREDICTED: probable purine permease 5 isofor...    135   6e-33    
ref|XP_003547401.1|  PREDICTED: probable purine permease 4-like         136   7e-33    
ref|XP_009594913.1|  PREDICTED: probable purine permease 5 isofor...    135   7e-33    
ref|XP_006415403.1|  hypothetical protein EUTSA_v10007839mg             135   7e-33    
ref|XP_009594912.1|  PREDICTED: probable purine permease 5 isofor...    135   9e-33    
ref|XP_008371936.1|  PREDICTED: probable purine permease 4              135   9e-33    
ref|XP_011083977.1|  PREDICTED: probable purine permease 5              135   9e-33    
ref|XP_008383506.1|  PREDICTED: probable purine permease 9              135   9e-33    
ref|XP_010499636.1|  PREDICTED: probable purine permease 4 isofor...    135   1e-32    
ref|XP_010260818.1|  PREDICTED: probable purine permease 4              135   1e-32    
ref|XP_002447964.1|  hypothetical protein SORBIDRAFT_06g018980          134   1e-32    
ref|XP_004295379.1|  PREDICTED: probable purine permease 9-like         134   1e-32    
gb|KHN47750.1|  Putative purine permease 4                              135   2e-32    
ref|XP_004498216.1|  PREDICTED: probable purine permease 9-like         135   2e-32    
ref|XP_010655638.1|  PREDICTED: probable purine permease 10 isofo...    134   2e-32    
ref|XP_002526505.1|  ATPUP11, putative                                  134   2e-32    
ref|XP_004293485.1|  PREDICTED: probable purine permease 9-like i...    134   2e-32    
ref|XP_004293484.1|  PREDICTED: probable purine permease 9-like i...    134   2e-32    
ref|XP_004508992.1|  PREDICTED: probable purine permease 10-like        135   2e-32    
ref|XP_010274633.1|  PREDICTED: probable purine permease 11             133   2e-32    
ref|XP_003580442.1|  PREDICTED: probable purine permease 11             134   2e-32    
ref|XP_002447006.1|  hypothetical protein SORBIDRAFT_06g026780          134   2e-32    
gb|EYU19429.1|  hypothetical protein MIMGU_mgv1a018240mg                134   2e-32    



>ref|XP_002285717.1| PREDICTED: purine permease 1 [Vitis vinifera]
 emb|CAN64392.1| hypothetical protein VITISV_015235 [Vitis vinifera]
Length=349

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 196/321 (61%), Positives = 251/321 (78%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            + MR   L+ N ++L+IGNCGGP+++RLYF+RGG R+WFS+WL+TA WP++ +PL+I+Y+
Sbjct  7    SNMRKALLVLNCVILSIGNCGGPMVMRLYFVRGGERIWFSSWLETAGWPLILVPLIITYI  66

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR   +   S+ K F M P LF++ A+IG+L G  +YLY YGVAKLPVSTS+LI++SQL
Sbjct  67   HRR---TKQGSHAKLFFMKPPLFVASAVIGVLTGFDDYLYAYGVAKLPVSTSALIIASQL  123

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAF LVKQ FT++SVN+I LL+ GA VL L   +DRPA ESNKEY LGFV+TL +
Sbjct  124  AFTAAFAFLLVKQKFTSYSVNAIFLLSIGAGVLALHTSSDRPANESNKEYYLGFVMTLAA  183

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG I+PLVEL Y KA   I Y LV+E QMV+   AT+FC+VGM +N+DFQ I REA+
Sbjct  184  AALYGFILPLVELTYKKAKQAITYSLVMEIQMVMCFFATVFCTVGMLVNNDFQAISREAK  243

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            E+ELG AKYY++V+ +GII+Q F +GA+GVI   SSL+  ++  VLLPVTE+LAVI F E
Sbjct  244  EYELGEAKYYLVVVWNGIIWQCFFLGAIGVIFSASSLVCGIVIAVLLPVTEILAVIFFQE  303

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQ EKGVSL L LWGFVSYF
Sbjct  304  KFQAEKGVSLALSLWGFVSYF  324



>gb|EYU21537.1| hypothetical protein MIMGU_mgv1a018814mg [Erythranthe guttata]
Length=354

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 194/319 (61%), Positives = 252/319 (79%), Gaps = 2/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+ +FL+ N I+LA+GNCGGPL++RLYF+ GG R+WFS+WL+T  WP++  PL++SY   
Sbjct  1    MKRVFLIINCIILAVGNCGGPLIMRLYFVHGGKRIWFSSWLETGGWPIILAPLIVSY--T  58

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RRRR+      + +LM P +F++ A+IG+L G  +YLY YGVAKLPVSTS+LIV+SQLAF
Sbjct  59   RRRRTAAAGKAELYLMKPRVFVAAAVIGVLTGFDDYLYAYGVAKLPVSTSALIVASQLAF  118

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA+FAF +VKQ FTA+SVN++VLLT GAVVLGL    DRP GES+KEY +GF+LT+ +AA
Sbjct  119  TAVFAFLMVKQEFTAYSVNAVVLLTLGAVVLGLHTSGDRPEGESSKEYMVGFLLTVAAAA  178

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG I+P VEL Y KA   + Y LVLE Q+V+ + AT FC+VGM +N+DFQ I REAR +
Sbjct  179  LYGFILPAVELTYKKAKQAVSYTLVLEMQLVMCVFATSFCTVGMLVNNDFQAIAREARAY  238

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG  KYYI+V+ S I++Q F +GA+GVI Y SSLLS ++ TVLLP TE+LA+I +HEKF
Sbjct  239  ELGETKYYIVVLWSAIVWQCFFLGAIGVIFYSSSLLSGIVITVLLPATEILAIIFYHEKF  298

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKG+SLFL LWGF+SYF
Sbjct  299  QAEKGLSLFLSLWGFISYF  317



>ref|XP_002285719.1| PREDICTED: purine permease 1-like [Vitis vinifera]
Length=351

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 194/321 (60%), Positives = 248/321 (77%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            + MR   L+ N ++L+IGNCGGPL++RLYF+ GG R+WFS+WL+T  WP++ +PL+I+Y+
Sbjct  9    SNMRKALLVLNCVILSIGNCGGPLVMRLYFVLGGERIWFSSWLETVGWPLILVPLIITYM  68

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR   +  DS+ K F M P LF++ A+IG+L G  +YLY YGVAKLPVSTS+LIV+SQL
Sbjct  69   HRR---TKQDSHAKLFFMKPPLFVASAVIGVLTGFDDYLYAYGVAKLPVSTSALIVASQL  125

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAF LVKQ FT++SVN+I LL+ GA VL L   +DRP  ESNKEY LGFV+TL +
Sbjct  126  AFTAAFAFLLVKQKFTSYSVNAIFLLSIGAGVLALHTSSDRPTNESNKEYYLGFVMTLAA  185

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG I+PLVEL Y K    I Y LV+E QMV+   AT+FC+VGM +N+DFQ I REA+
Sbjct  186  AALYGFILPLVELTYKKTKQAITYSLVMEIQMVMCFFATVFCTVGMLVNNDFQAISREAK  245

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            E+ELG AKYY++V+ +GII+Q F + ++GVI   SSL+  ++ TVLLPVTE+LAVI F E
Sbjct  246  EYELGEAKYYLVVVWNGIIWQCFFLVSIGVIFSASSLVCGIVITVLLPVTEILAVIFFRE  305

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQ EKGVSL L LWGFVSYF
Sbjct  306  KFQAEKGVSLALSLWGFVSYF  326



>ref|XP_002285718.1| PREDICTED: purine permease 1 [Vitis vinifera]
Length=351

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 192/321 (60%), Positives = 250/321 (78%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            +  R   L+ + ++L+IG+CGGPL++RLYF+RGG R+WFS+WL+TA WP++ +PL+I+Y+
Sbjct  9    SNTRKALLVLSCVILSIGHCGGPLVMRLYFVRGGERIWFSSWLETAGWPLILVPLIITYM  68

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR   +   S+ K F M P LF++ A+IG+L  L +YLY YGVAKLPVST +LI++SQL
Sbjct  69   HRR---TKQGSHAKLFFMKPPLFVASAVIGVLTALDDYLYAYGVAKLPVSTIALIIASQL  125

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAF LVKQ FT++SVN+I LL+ GA VL L   +DRPA ESNKEY LGF +TL +
Sbjct  126  AFTAAFAFLLVKQKFTSYSVNAIFLLSIGAGVLALHTSSDRPANESNKEYYLGFFMTLAA  185

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG I+PLVEL Y KA   I Y LV+E QMV+   AT FC+VGM +N+DFQ IPREA+
Sbjct  186  AALYGFILPLVELTYKKAKQAITYSLVMEIQMVMCFFATFFCTVGMLVNNDFQAIPREAK  245

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            E+ELG AKYY++V+ +GI++Q F +GA+GVI   SSL++ ++  VLLPVTE+LAVI FH+
Sbjct  246  EYELGEAKYYLVVVWNGIMWQCFYLGAIGVIFCASSLVAGIVLAVLLPVTEILAVIFFHD  305

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQ EKGVSL L LWGFVSYF
Sbjct  306  KFQAEKGVSLALSLWGFVSYF  326



>gb|KDP41439.1| hypothetical protein JCGZ_15846 [Jatropha curcas]
Length=359

 Score =   356 bits (914),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 194/320 (61%), Positives = 246/320 (77%), Gaps = 4/320 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            MR   L+ N ++L+IGNCGGPL++RLYF+ GG R+W S+WL+TA WP++FIPLLISY  R
Sbjct  15   MRRALLVLNCVILSIGNCGGPLIMRLYFIHGGKRVWLSSWLETAGWPIIFIPLLISYFHR  74

Query  778  rrrRSDVDSNT-KFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            R   S  D  T K F M P LF++   IG+L G  +YLY YGVA+LPVSTSSLI+++QLA
Sbjct  75   R---STTDPTTAKLFYMKPSLFLAATGIGILTGFDDYLYAYGVARLPVSTSSLIIATQLA  131

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTA FAF LVKQ FT++S+N++VLLT GA VL L   +DRP  ES KEY LGFV+TLG+A
Sbjct  132  FTAGFAFLLVKQKFTSYSINAVVLLTVGAGVLALHTSSDRPEHESKKEYNLGFVMTLGAA  191

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LYGLI+PLVEL Y KA   I Y LV+E QM++ L AT+ C+VGM +N+DF+VIPREA+E
Sbjct  192  VLYGLILPLVELTYRKAKQEISYTLVMEIQMIMCLFATVVCTVGMLVNNDFKVIPREAKE  251

Query  241  FELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEK  62
            FELG  KYY++++ S II+Q F +GA+G++   SSL S V+  VLLPVTE+LAVI + EK
Sbjct  252  FELGETKYYVIMVWSAIIWQCFFLGAIGIVFCASSLASGVVIAVLLPVTEILAVIFYQEK  311

Query  61   FQPEKGVSLFLCLWGFVSYF  2
            FQ EKGV+L L LWGF+SYF
Sbjct  312  FQAEKGVALALSLWGFLSYF  331



>ref|XP_002307351.2| PURINE PERMEASE 1 family protein [Populus trichocarpa]
 gb|EEE94347.2| PURINE PERMEASE 1 family protein [Populus trichocarpa]
Length=356

 Score =   356 bits (914),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 194/319 (61%), Positives = 245/319 (77%), Gaps = 4/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+   L+FN ++L+IGNCGGPL++RLYF+ GG R+W S WL+T  WP++ IPL ISY  R
Sbjct  13   MKKTLLIFNCLILSIGNCGGPLIMRLYFIHGGKRIWLSAWLETGGWPIILIPLAISYFHR  72

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
                   D  TK F M P LFI+ A+IG+L GL +YLY YGVA+LPVSTS+LI+++QLAF
Sbjct  73   ----RATDPTTKLFYMKPPLFIAAAIIGVLTGLDDYLYAYGVARLPVSTSALIIATQLAF  128

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FAF LVKQ FT++S+N++VLLT GA VL +  G+D+PA ES++EY LGF+LTL +AA
Sbjct  129  TAGFAFLLVKQKFTSYSINAVVLLTVGAGVLAMHTGSDKPAHESSREYILGFILTLVAAA  188

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG IMPLVEL Y K+   + Y LV+E QM++ L AT+FC+VGM IN DFQ IPREAR +
Sbjct  189  LYGFIMPLVELTYKKSRQEMNYTLVMEIQMIMCLLATVFCTVGMLINKDFQAIPREARNY  248

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG  KYY++++ S II+Q F +GA+GVI   SSLLS +I TVLLP TE+LAVI F EKF
Sbjct  249  ELGEVKYYVVMVWSAIIWQCFFLGAIGVIFCASSLLSGIIITVLLPATEILAVIFFQEKF  308

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGV+L L LWGFVSYF
Sbjct  309  QVEKGVALGLSLWGFVSYF  327



>ref|XP_009615076.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=353

 Score =   353 bits (907),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 201/321 (63%), Positives = 252/321 (79%), Gaps = 5/321 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
             +MR I L+ N ILLAIGNC GPL++RLYFL GG R+WFS+WLQT  WP++ IPL I+Y 
Sbjct  7    ERMRKILLVINCILLAIGNCCGPLIMRLYFLHGGNRIWFSSWLQTVGWPLILIPLAIAYF  66

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            +        ++  K FL+TP +F++ ++ G+L G+ NYLY YG +KLPVSTS+LI+++QL
Sbjct  67   Q-----RRENNIKKLFLITPRIFLASSVFGILTGVDNYLYAYGNSKLPVSTSTLILATQL  121

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA+FAFFLVKQ FTA S+N+IVLLT GAVVL LR+G+DRP GES+KEY LGFVLTL +
Sbjct  122  AFTAVFAFFLVKQKFTAHSINAIVLLTVGAVVLALRSGSDRPKGESSKEYILGFVLTLLA  181

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG +MP+VEL Y KA   I Y LVLE QMV+   A+ F +VGM IN+DF+ I  EAR
Sbjct  182  AALYGFVMPMVELTYIKATQTITYALVLEVQMVICCFASAFATVGMIINNDFKAISSEAR  241

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            +F LG  KYY +++ S II+QFF +GA+GVI Y SSLLS VI  VLLPVTE+LAVI+FHE
Sbjct  242  QFGLGEGKYYNVLVWSAIIWQFFFVGAIGVISYSSSLLSGVIIAVLLPVTEVLAVIIFHE  301

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQPEKGV+LFL +WGF+SYF
Sbjct  302  KFQPEKGVALFLSIWGFISYF  322



>gb|EYU34537.1| hypothetical protein MIMGU_mgv1a022801mg, partial [Erythranthe 
guttata]
Length=349

 Score =   353 bits (906),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 192/319 (60%), Positives = 249/319 (78%), Gaps = 2/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+ + L+ N I+LA+GNCGGPL++RLYF+ GG R+WFS+WL+T  WP++ +PLL+SY   
Sbjct  1    MKRVLLIINCIILAVGNCGGPLIMRLYFVHGGKRIWFSSWLETGGWPILLVPLLVSY--N  58

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RRRR+      + +LM P +F++ A+IG+L G  +YLY YGVAKLPVSTS+LI++SQLAF
Sbjct  59   RRRRTAASGKAELYLMKPRVFLAAAVIGVLTGFDDYLYAYGVAKLPVSTSALIIASQLAF  118

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FAF +VKQ FTA+SVNS+VLLT GAVVLGL    DRP GES+KEY +GF LT+ +AA
Sbjct  119  TAAFAFLMVKQEFTAYSVNSVVLLTLGAVVLGLHTNGDRPEGESSKEYMVGFFLTVAAAA  178

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            L G I+P VEL Y KA   + Y LVLE Q+V+ + AT FC++GM +N+DFQ I REAR +
Sbjct  179  LCGFILPAVELTYKKAKQAVSYTLVLEMQLVMCVFATSFCTLGMLVNNDFQAIAREARAY  238

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG  KYYI+V+ S I++Q F +GA+GVI Y SSLLS ++ TVLLP TE+LA+I +HEKF
Sbjct  239  ELGETKYYIVVLWSAIVWQCFFLGAIGVIFYSSSLLSGIVITVLLPATEILAIIFYHEKF  298

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKG+SLFL LWGF+SYF
Sbjct  299  QAEKGLSLFLSLWGFISYF  317



>gb|KHG22236.1| Purine permease 1 -like protein [Gossypium arboreum]
Length=357

 Score =   349 bits (896),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 195/319 (61%), Positives = 246/319 (77%), Gaps = 1/319 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            +R   L+ N I+L+IGNCGGPL+ RLYF+ GG R+WFS+WLQTA  P++ +P+  +Y+ R
Sbjct  9    IRKALLVINCIILSIGNCGGPLITRLYFIHGGNRIWFSSWLQTAGCPIILLPIACAYVHR  68

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
             R  +D  S  K F M   LFI+  ++G+L GL NY Y+YG+++LPVSTSSLI++SQLAF
Sbjct  69   SRT-ADPTSENKVFCMERPLFIAAIVLGILSGLDNYFYSYGLSRLPVSTSSLIIASQLAF  127

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FAF LVKQ FTA+S+N++ LLT GA VL L + +DRPA ESNKEY LGFV+TL +AA
Sbjct  128  TAGFAFLLVKQKFTAYSINAVFLLTIGAGVLALHSSSDRPANESNKEYILGFVMTLAAAA  187

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG I+PLVEL Y KA   I Y LV+E Q+V+ L AT FC+VGM +N+DF+VI REAREF
Sbjct  188  LYGFILPLVELTYKKAKQEISYALVMEIQLVMCLVATAFCTVGMLVNNDFKVIGREAREF  247

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG  KYYI+ I S II+QFF +GA+GV+   SSLLS V+ +VLLPVTE+LAV  F+EKF
Sbjct  248  ELGETKYYIVAIFSAIIWQFFFLGAIGVVFCASSLLSGVVISVLLPVTEILAVFFFNEKF  307

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGVSL L LWGF+SYF
Sbjct  308  QAEKGVSLALSLWGFLSYF  326



>ref|XP_011006371.1| PREDICTED: purine permease 3 [Populus euphratica]
Length=356

 Score =   349 bits (895),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 188/319 (59%), Positives = 244/319 (76%), Gaps = 4/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+   L+FN ++L+IGNCGGPL++RLYF+ GG R+W S WL+T  WP++ IP+ +SY  R
Sbjct  13   MKKALLIFNCLVLSIGNCGGPLIMRLYFIHGGKRVWLSAWLETGGWPIILIPIALSYFHR  72

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
                   D  T+ F M P LFI+ A IG+L GL +YLY YGVA+LPVSTS+LI+++QLAF
Sbjct  73   ----RATDPTTRLFYMKPPLFIAAATIGVLTGLDDYLYAYGVARLPVSTSALIIATQLAF  128

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FAF LVKQ FT++S+N++VLLT GA VL +  G+D+PA ES++EY LGF++TL +AA
Sbjct  129  TAGFAFLLVKQKFTSYSINAVVLLTVGAGVLAMHTGSDKPAHESSREYILGFIMTLVAAA  188

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYGLI+PLVEL Y K+   + Y LV+E QMV+ L AT+FC+VGM IN DFQ IPREAR F
Sbjct  189  LYGLILPLVELTYKKSRQEMNYTLVMEIQMVMCLLATVFCTVGMLINKDFQAIPREARNF  248

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG  KYY++++ S II+Q F +GA+GVI   SSLLS ++ + LLP TE+L+VI F EKF
Sbjct  249  ELGEVKYYVVLVWSAIIWQCFFLGAIGVIFSASSLLSGILISALLPATEILSVIFFQEKF  308

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGV+L L LWGFVSYF
Sbjct  309  QAEKGVALGLSLWGFVSYF  327



>emb|CDP19267.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   348 bits (893),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 190/319 (60%), Positives = 247/319 (77%), Gaps = 1/319 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M  I L+ N I+LAIGNCG PLL+RLYF++GG R+W  +W+QTAAWP++FIPLLISY  R
Sbjct  1    MGKILLVINCIILAIGNCGTPLLIRLYFVKGGQRIWLPSWIQTAAWPIIFIPLLISYFHR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            ++     + ++K  +M   +FI+ A+IGLL GL NYLY YG+A+LPVST+++I+++QL F
Sbjct  61   QKTDPRAE-DSKLIIMKYPVFIATAVIGLLTGLDNYLYAYGIARLPVSTAAIIIAAQLVF  119

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
             A FAF LVKQ FTA+SVN+++LLT G+ VLGL   +DRP GESNK Y LGF++TL +AA
Sbjct  120  VAFFAFLLVKQKFTAYSVNAVILLTVGSGVLGLHTSSDRPKGESNKLYVLGFIMTLAAAA  179

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYGLI+P+VEL+Y KA   I Y LVLE Q+++   AT+FC+VGM IN DFQ I REAR +
Sbjct  180  LYGLILPMVELMYMKAKQVITYSLVLEIQLIMCFFATVFCTVGMLINKDFQAIAREARAY  239

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG  KYY++++ S I+ Q F +GA+GVI   SSL+S +I  V LPVTELLAVI F+EKF
Sbjct  240  ELGEMKYYVVLVSSAIVSQCFFLGAIGVIFCASSLVSGIIIAVSLPVTELLAVIFFNEKF  299

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGV+LFL LWGF+SYF
Sbjct  300  QAEKGVALFLSLWGFISYF  318



>ref|XP_002513994.1| purine transporter, putative [Ricinus communis]
 gb|EEF48577.1| purine transporter, putative [Ricinus communis]
Length=356

 Score =   347 bits (891),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 192/318 (60%), Positives = 240/318 (75%), Gaps = 4/318 (1%)
 Frame = -1

Query  955  RTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrr  776
            +   L+ N ILL+IGNCGGPL++RLYF+ GG R+W S+WL+T  WP++ IPL ISYL R 
Sbjct  15   KRALLILNCILLSIGNCGGPLIMRLYFIHGGKRVWLSSWLETGGWPILLIPLFISYLHR-  73

Query  775  rrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaft  596
                  +  TK F M P LF++   IG+L GL +YLY YGVA+LPVSTSSLI+++QLAFT
Sbjct  74   ---RSTNPPTKLFYMKPRLFLAATFIGVLTGLDDYLYAYGVARLPVSTSSLIIATQLAFT  130

Query  595  alfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAAL  416
            A FAF LVKQ FT+FS+N++VLLTAGA VL L   +DRP  ES K+Y LGFV+TL +AAL
Sbjct  131  AAFAFLLVKQKFTSFSINAVVLLTAGAGVLALHTSSDRPGHESTKQYALGFVMTLVAAAL  190

Query  415  YGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFE  236
            YG I+PLVEL Y K+   I Y LV+E QMV+ L AT+FC++GM +N DF VIPREAREF 
Sbjct  191  YGFILPLVELTYKKSKQEISYTLVMEIQMVMCLFATIFCTIGMLVNKDFNVIPREAREFG  250

Query  235  LGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQ  56
            LG  KYY++++ S II+Q F +GA+GVI   SSLLS ++  VLLPVTE+LAVI + E FQ
Sbjct  251  LGETKYYVILVWSAIIWQCFFLGAIGVIFCASSLLSGILIAVLLPVTEVLAVIFYQENFQ  310

Query  55   PEKGVSLFLCLWGFVSYF  2
             EKGV+L L LWGFVSYF
Sbjct  311  AEKGVALALSLWGFVSYF  328



>gb|KHG13700.1| Purine permease 3 -like protein [Gossypium arboreum]
 gb|KHG19122.1| Purine permease 3 -like protein [Gossypium arboreum]
Length=358

 Score =   347 bits (889),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 187/319 (59%), Positives = 242/319 (76%), Gaps = 2/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            MR   L+ N I+L+IGNC GPL++RLYF+ GG R+WFS+WL+T  WP++  P  I+ +  
Sbjct  14   MRKALLVINCIILSIGNCAGPLMMRLYFIHGGKRVWFSSWLETGGWPIILFP--IACVHF  71

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
             R R+   S  K F M P LFI+ A+IG+L GL +YLY YGVA+LPVSTSSLI++SQLAF
Sbjct  72   YRSRTQPSSENKLFFMKPHLFIAAAVIGILTGLDDYLYAYGVARLPVSTSSLIIASQLAF  131

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FAF LVKQ FT++S+N++ LLT G+ VL +   +DRPA ESN+EY LGF++T+G++A
Sbjct  132  TAGFAFVLVKQKFTSYSINAVFLLTIGSGVLAMHTSSDRPANESNREYVLGFLMTVGASA  191

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG I+PLVEL Y KA   I Y LV+E QMV+ L AT  C++GM +N+DF+VI REARE+
Sbjct  192  LYGFILPLVELTYKKAKQEISYALVMEIQMVMCLFATGVCTIGMLVNNDFKVIRREAREY  251

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG  KYYI+ ICS +I+Q F +GA+GVI   SSLLS +I  VLLPVTE+LAVI ++E F
Sbjct  252  ELGETKYYIVAICSAMIWQCFFLGAIGVIFCASSLLSGIIIAVLLPVTEILAVIFYNESF  311

Query  58   QPEKGVSLFLCLWGFVSYF  2
              EKGV+L L LWGF+SYF
Sbjct  312  HAEKGVALALSLWGFLSYF  330



>ref|XP_007018134.1| Purine permease 3 [Theobroma cacao]
 gb|EOY15359.1| Purine permease 3 [Theobroma cacao]
Length=356

 Score =   345 bits (885),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 190/321 (59%), Positives = 242/321 (75%), Gaps = 2/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            + MR   L+ N  +LAIGNCGGPL++RLYF+ GG R+WFS+WL+T  WP++  P+  +YL
Sbjct  10   SSMRRALLVINCFVLAIGNCGGPLMMRLYFIHGGKRVWFSSWLETGGWPIILFPIAWAYL  69

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RRR  +   S  KFF M P LFI+ A+IG+L G  +YLY YGVA+LPVSTSSLI+++QL
Sbjct  70   HRRR--TQPTSRNKFFFMKPPLFIASAVIGILTGFDDYLYAYGVARLPVSTSSLIIAAQL  127

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAF LVKQ FT++S+N++ LLT GA VL L   +DRP  ESNKEY +GF++T+ +
Sbjct  128  AFTAGFAFLLVKQKFTSYSINAVFLLTIGAGVLALNTSSDRPENESNKEYVMGFLMTIAA  187

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A LYG I+PLVEL+Y KA   I Y LV+E QMV+ L AT+ C+VGM +N+DF+VI REAR
Sbjct  188  AVLYGFILPLVELMYKKAKQEISYALVMEIQMVMCLFATVLCTVGMLVNNDFKVISREAR  247

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            EF LG  KYY++ I S II+Q F +GA+GVI   SSL+S ++  VLLPVTE+LAVI   E
Sbjct  248  EFGLGETKYYVVAISSAIIWQGFFLGAIGVIFCASSLVSGIMIAVLLPVTEILAVIFLKE  307

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQ EKGV+L L LWGFVSYF
Sbjct  308  KFQAEKGVALALSLWGFVSYF  328



>ref|XP_004242795.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=367

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 191/331 (58%), Positives = 243/331 (73%), Gaps = 11/331 (3%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISY-  788
            ++ +   L  N ILLAIGNCGGPL+ RLYFL+GG R+W S+WL+T  WP+V IPL  SY 
Sbjct  8    SRTKKFLLAINCILLAIGNCGGPLITRLYFLKGGERIWLSSWLETVGWPIVLIPLSFSYF  67

Query  787  ----------LrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPV  638
                      +      +D D+N KF LMTP +F++   IG+L G  NYLY YGVAKLPV
Sbjct  68   NRRREFRGKMILSTSTDNDNDNNAKFILMTPRIFVASIGIGILTGFDNYLYAYGVAKLPV  127

Query  637  STSSLIVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKE  458
            STS+L+++SQLAFTA FAF LVKQ FT++S+NSI LLT GAVVL L A  DRP GES KE
Sbjct  128  STSALLIASQLAFTAGFAFLLVKQKFTSYSINSIFLLTLGAVVLALHANGDRPNGESRKE  187

Query  457  YGLGFVLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFIN  278
            Y LGF++TLG+AALYGLI+PL EL+Y KA   I Y LV+E Q V  + +T+ C++GM IN
Sbjct  188  YILGFIMTLGAAALYGLILPLFELLYKKAKQGITYTLVMEIQAVYCIFSTVVCTIGMIIN  247

Query  277  HDFQVIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPV  98
             DFQ + REA+ FELG A+YYI++I S I++Q F +GA+GVI + SSL+S ++ TVLLPV
Sbjct  248  KDFQAMSREAKSFELGEARYYIVIIWSAILWQCFFLGAIGVIYFSSSLVSGILITVLLPV  307

Query  97   TELLAVILFHEKFQPEKGVSLFLCLWGFVSY  5
            TE+L V+ + EKF PEKGVSL L +WGF+SY
Sbjct  308  TEILGVVFYGEKFTPEKGVSLVLSIWGFISY  338



>ref|XP_006364706.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=362

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 192/326 (59%), Positives = 245/326 (75%), Gaps = 6/326 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            ++ +   L+ N I+LAIGNCGGPL+ RLYFL+GG R+W S+WL+T  WP+V IPL  SY 
Sbjct  8    SRRKNFLLIINCIILAIGNCGGPLITRLYFLKGGERIWLSSWLETVGWPIVLIPLSFSYF  67

Query  784  rrr-----rrRSDVDSN-TKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSL  623
             RR     +  S +D+N TK  LMTP +F++   IG+L G  NYLY YGVAKLPVSTS+L
Sbjct  68   NRRREFQGKMLSTIDNNNTKLILMTPRIFVASIGIGVLTGFDNYLYAYGVAKLPVSTSAL  127

Query  622  IVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGF  443
            +++SQLAFTA FAF LVKQ FT++S+NSI LLT GAVVL L A  DRP GES KEY LGF
Sbjct  128  LIASQLAFTAAFAFLLVKQKFTSYSINSIFLLTFGAVVLALHAKGDRPNGESKKEYVLGF  187

Query  442  VLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQV  263
            ++TLG+AALYGLI+PL EL+Y KA   I Y LV+E Q V  + +T+ C++GM IN DFQ 
Sbjct  188  IMTLGAAALYGLILPLFELMYKKAKQGITYTLVMEIQAVSCIFSTVVCTIGMIINKDFQA  247

Query  262  IPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLA  83
            + REA+ FELG A+YYI++I S II+Q F +GA+GVI   SSL+S ++ TVLLP+TE+L 
Sbjct  248  MSREAKSFELGEARYYIVIIWSAIIWQCFFLGAIGVIYSSSSLVSGILITVLLPITEILG  307

Query  82   VILFHEKFQPEKGVSLFLCLWGFVSY  5
            V+ + EKF PEKGVSL L +WGF+SY
Sbjct  308  VVFYGEKFTPEKGVSLVLSIWGFISY  333



>ref|XP_004299691.1| PREDICTED: purine permease 3-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 184/304 (61%), Positives = 240/304 (79%), Gaps = 0/304 (0%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFFL  734
            G CGGPL++RLYF+ GG R+W S+ L+T  WPV+ +P+ I+Y  RR+ ++  D  TK F 
Sbjct  31   GTCGGPLIMRLYFIHGGKRVWLSSMLETGGWPVILVPIAIAYYHRRKNQAPTDPPTKLFF  90

Query  733  MTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTA  554
            M   LF++ A+IG+L GL +YLY YGVA+LPVSTS+LI+++QLAFTALFAF LVKQ FT+
Sbjct  91   MKLPLFVASAVIGVLTGLDDYLYAYGVARLPVSTSALIIAAQLAFTALFAFILVKQKFTS  150

Query  553  FSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNK  374
            +S+N++VLLT GA VLGL   +DRP GESN +Y LGFV+T+ +AALYG ++PLVEL+Y K
Sbjct  151  YSINAVVLLTVGAAVLGLNTSSDRPKGESNAQYMLGFVMTVAAAALYGFVLPLVELMYKK  210

Query  373  ANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICSG  194
            A   I Y LVLE QMV+SL AT+FC+VGM +N+DF+VIPREAR+FELG   YY++++ S 
Sbjct  211  AKQNITYALVLEIQMVMSLFATIFCTVGMLVNNDFKVIPREARKFELGETTYYVVLVVSA  270

Query  193  IIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGF  14
            I++Q F +GA+G+I   SSLLS ++  VLLPVTE+ AVI +HEKFQ EKGVSL L LWGF
Sbjct  271  IVWQTFFLGAIGLIFCASSLLSGIVIAVLLPVTEIFAVIFYHEKFQAEKGVSLALSLWGF  330

Query  13   VSYF  2
            VSYF
Sbjct  331  VSYF  334



>ref|XP_004299692.1| PREDICTED: purine permease 3-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   338 bits (868),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 239/306 (78%), Gaps = 0/306 (0%)
 Frame = -1

Query  919  AIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKF  740
            +IG CGGPL++RLYF+ GG RLW S+ L+T  WPV+ +P+ I+Y  RR+ ++  D  TK 
Sbjct  29   SIGTCGGPLIMRLYFIHGGKRLWLSSMLETGGWPVILVPIAIAYYHRRKNQAPTDPPTKL  88

Query  739  FLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHF  560
            F M   LF++ A+IG+L GL +YLY YGVA+LP+ST SLI++S L FTALFAF LVKQ F
Sbjct  89   FFMKLPLFVASAVIGVLTGLDDYLYAYGVARLPLSTLSLIIASHLVFTALFAFILVKQKF  148

Query  559  TAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIY  380
            T++S+N++VLLT GA VLGL   +DRP GESN +Y LGFV+T+ +AALYG ++PLVEL+Y
Sbjct  149  TSYSINAVVLLTVGAAVLGLNTSSDRPKGESNAQYMLGFVMTVAAAALYGFVLPLVELMY  208

Query  379  NKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVIC  200
             KA   I Y LVLE QMV+SL AT+FC+VGM +N+DF+VIPREAR+FELG   YY++++ 
Sbjct  209  KKAKQNITYALVLEIQMVMSLFATIFCTVGMLVNNDFKVIPREARKFELGETTYYVVLVV  268

Query  199  SGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLW  20
            S I++Q F +GA+G+I   SSLLS ++  VLLPVTE+ AVI +HEKFQ EKGVSL L LW
Sbjct  269  SAIVWQAFFLGAIGLIFCASSLLSGIVIAVLLPVTEIFAVIFYHEKFQAEKGVSLALSLW  328

Query  19   GFVSYF  2
            GFVSYF
Sbjct  329  GFVSYF  334



>ref|XP_010060063.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis]
 ref|XP_010060064.1| PREDICTED: purine permease 3-like isoform X2 [Eucalyptus grandis]
 ref|XP_010060065.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis]
 gb|KCW66595.1| hypothetical protein EUGRSUZ_F00389 [Eucalyptus grandis]
Length=360

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 184/321 (57%), Positives = 238/321 (74%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              ++ + L  N  +LA+G CGGPL++RLYFL GG R+W S+WL+T  WP++FIPL ++Y 
Sbjct  11   KTLKLVLLAINCAMLALGTCGGPLIMRLYFLHGGKRVWLSSWLETGGWPIIFIPLAVAYF  70

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            RRR   +    + +  LM P LF + A+IG+L GL +YLY YGVA+LPVSTS+L++++QL
Sbjct  71   RRR---AAEGPSARLILMDPFLFAAAAVIGVLTGLDDYLYAYGVARLPVSTSALLIATQL  127

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAF LV+Q FT++SVNS+ LLT GA VL +   +DRPAGES  EY  GF +TLG+
Sbjct  128  AFTAGFAFLLVRQLFTSYSVNSVFLLTMGAGVLAMHTSSDRPAGESKGEYYAGFFMTLGA  187

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG ++PLVEL Y KA   + Y LVLEFQ+V+   AT F +VGM +N DFQ IP EAR
Sbjct  188  AALYGFVLPLVELTYKKAKQTVTYSLVLEFQLVMCFFATAFNTVGMLVNKDFQAIPEEAR  247

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
             F LG  +YY++++ SGII+QFF +GA+GVI Y SSL S ++  VLLP+TE+L VI FHE
Sbjct  248  NFTLGETRYYVVLVWSGIIWQFFFLGAIGVIHYASSLFSGIMIAVLLPITEILGVICFHE  307

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQ EK VSL L LWGFVSYF
Sbjct  308  KFQVEKAVSLVLSLWGFVSYF  328



>ref|XP_008444876.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=359

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 238/318 (75%), Gaps = 0/318 (0%)
 Frame = -1

Query  955  RTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrr  776
            + + L FN+IL+++GNCGGPL+LRLYF+ GG R+W S+WL +  WP++ IPL ISY+ RR
Sbjct  11   KKVLLAFNSILMSVGNCGGPLILRLYFIHGGNRVWLSSWLFSGGWPIILIPLAISYIHRR  70

Query  775  rrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaft  596
            R  +        F+  P L    A+IG L GL NYL+ YG+A+LPVSTSSLI++SQLAFT
Sbjct  71   RTATAGSKTKLIFMREPLLLFGSAVIGALTGLDNYLFAYGMARLPVSTSSLIIASQLAFT  130

Query  595  alfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAAL  416
            A FA+ LVKQ FT+++VNS+VLLT G  +L L +  DRPAGESN EY  GF++TLG+A L
Sbjct  131  AGFAYLLVKQKFTSYTVNSVVLLTMGGAILALHSSGDRPAGESNGEYIAGFLMTLGAAVL  190

Query  415  YGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFE  236
            YGLI+PL+EL+Y K    + Y L+LE Q+V++++ T+ C++GM IN+DFQ IPRE REF 
Sbjct  191  YGLILPLIELMYKKTKQSLTYTLILEIQLVMAISGTVLCTIGMLINNDFQAIPREGREFG  250

Query  235  LGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQ  56
            LG  KYY++++ S +I+Q F IGA+GVI Y SSL S ++  +LLP  E+LAVI F EKFQ
Sbjct  251  LGNTKYYVVLVMSCVIWQCFFIGAVGVIFYSSSLFSGIVIALLLPAVEILAVIFFREKFQ  310

Query  55   PEKGVSLFLCLWGFVSYF  2
             EKGVSL L LWGFVSYF
Sbjct  311  AEKGVSLALNLWGFVSYF  328



>ref|XP_009588639.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=356

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 195/333 (59%), Positives = 246/333 (74%), Gaps = 12/333 (4%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            +KM+   L+ N I LAIGNCGGPL+ RLYF++GG R+W S+WLQT+AWP++ IPL ISY 
Sbjct  7    SKMKKFLLVMNCIFLAIGNCGGPLISRLYFIKGGKRIWLSSWLQTSAWPIILIPLAISYF  66

Query  784  rrrrrRSDVDSN------------TKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLP  641
             R + +  + +             TKF LMTP +FI+   +G+L G+ NYL  YGVAKLP
Sbjct  67   NRCKSQGKISTTVENNNNNDNNNNTKFILMTPRIFIAAVGMGILSGIDNYLSAYGVAKLP  126

Query  640  VSTSSLIVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNK  461
            VSTS+L+++SQLAFTA FAF LVKQ F+A+S+NSI LLT GAVVL L A +DRP GES K
Sbjct  127  VSTSALLIASQLAFTAGFAFLLVKQKFSAYSINSIYLLTLGAVVLALHAKSDRPKGESKK  186

Query  460  EYGLGFVLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFI  281
            EY LGFVLTLG+AALYGLI+PL EL+Y KA   I Y LVLE Q V    AT+ C++GM I
Sbjct  187  EYILGFVLTLGAAALYGLILPLFELLYKKAKQTITYTLVLEIQAVYCFFATVVCTIGMII  246

Query  280  NHDFQVIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLP  101
            N DFQ + REA+ FELG  +YYI+++ S II+Q F +GA+GV+   SSL+S ++ TVLLP
Sbjct  247  NKDFQAMSREAKAFELGEGRYYIVIVWSAIIWQCFFLGAIGVVYSSSSLVSAILITVLLP  306

Query  100  VTELLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            VTE+LAVI + EKF  EKGVSL L +WGF+SYF
Sbjct  307  VTEVLAVIFYGEKFTAEKGVSLALSMWGFISYF  339



>ref|XP_009373503.1| PREDICTED: purine permease 3-like [Pyrus x bretschneideri]
Length=378

 Score =   337 bits (864),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 183/319 (57%), Positives = 244/319 (76%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+ + L+ +  LL+IG CGGPL++RLYF+ GG  +W S+WLQT  WP++FIP+ I Y  R
Sbjct  13   MKKLLLVISCTLLSIGTCGGPLVMRLYFIHGGKHIWLSSWLQTGGWPIIFIPIAIGYYHR  72

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            R+       +TK F M   LF++ A+IG+L GL +YLY YGVA+LPVSTS+LI++ QLAF
Sbjct  73   RKTEG---PSTKLFFMKLPLFMASAVIGVLTGLDDYLYAYGVARLPVSTSALIIAGQLAF  129

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TALFAF LVKQ FT+FS+N++VLLT G+ VLGL   +DRP GESNKEY  GF + + +A+
Sbjct  130  TALFAFILVKQKFTSFSMNAVVLLTMGSAVLGLTISSDRPEGESNKEYIAGFFMMVAAAS  189

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG ++PL+EL Y +A   + Y LVLE Q V+ L ATLFC+VGM IN+DF+VIPREAR+F
Sbjct  190  LYGFVLPLIELTYKRAKQTVTYALVLEIQSVMCLFATLFCTVGMLINNDFKVIPREARKF  249

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            +LG  +YY++++ S  ++Q F +GA+G+I   SSLLS ++  VLLP+TE+LAVI +HEKF
Sbjct  250  DLGETRYYLVLVLSATVWQAFFLGAIGIIFCASSLLSGIVIAVLLPITEILAVIFYHEKF  309

Query  58   QPEKGVSLFLCLWGFVSYF  2
            QPEKGVSL L +WGFVSYF
Sbjct  310  QPEKGVSLALSVWGFVSYF  328



>ref|XP_008219368.1| PREDICTED: purine permease 3-like [Prunus mume]
Length=370

 Score =   336 bits (861),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 183/319 (57%), Positives = 243/319 (76%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++   L+ + ++L+IG CGGPL++RLYF+ GG R+W S+WL+T  WP++FIP+ ++Y   
Sbjct  15   LKRALLILSCVILSIGACGGPLIMRLYFIHGGKRVWLSSWLETGGWPIIFIPIALAY---  71

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
              RR+    +TK F M   LFI+ A+IGLL GL +YLY YGVA+LPVST++LI ++ L F
Sbjct  72   YHRRTTEGPSTKLFFMKLPLFIASAVIGLLTGLDDYLYAYGVARLPVSTAALITAAHLVF  131

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TALFAF LVKQ FT++S+N + LLT GA VLGL    DRP GES+K+Y  GF++T  SAA
Sbjct  132  TALFAFLLVKQKFTSYSINGVFLLTIGAAVLGLNTSADRPKGESDKQYIAGFMMTFSSAA  191

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG ++PLVEL Y KA   I Y LVLE Q+V+ L AT+FC+VGM IN+DF+VIPREAR F
Sbjct  192  LYGFVLPLVELTYKKAKQTITYALVLEIQLVMCLFATIFCTVGMLINNDFKVIPREARNF  251

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG ++YY++++ S I++Q F +GA+G+I   SSLLS ++  VLLPVTE+LAVI +HEKF
Sbjct  252  ELGESRYYVVLVFSAIVWQGFFLGAIGIIFCASSLLSGIVIAVLLPVTEILAVIFYHEKF  311

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGV+L L LWGFVSYF
Sbjct  312  QAEKGVALALSLWGFVSYF  330



>ref|XP_008219366.1| PREDICTED: purine permease 3-like [Prunus mume]
Length=368

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 185/319 (58%), Positives = 245/319 (77%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++   L+ + +LL+IG CGGPL++RLYF+ GG R+W S+WL+T  WP++FIP+ ++Y   
Sbjct  13   LKRALLILSCVLLSIGTCGGPLIMRLYFIHGGNRVWLSSWLETGGWPIIFIPIALAY---  69

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
              RR+    +TK F M   LFI+ A+IGL+ GL +YLY YGVA+LPVSTS+LI+++QLAF
Sbjct  70   YHRRTTEGPSTKLFFMKLPLFIASAVIGLITGLDDYLYAYGVARLPVSTSALIIAAQLAF  129

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TALFAF LVKQ FT++S N++VLLT GA VLGL    DRP GES+K+Y  GF++T+ +AA
Sbjct  130  TALFAFLLVKQKFTSYSTNAVVLLTIGAAVLGLNTSADRPKGESDKQYIAGFLMTVAAAA  189

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG ++PLVEL Y KA   I Y LVLE QMV+ L AT+FC+VGM I++DF+VIPREAR F
Sbjct  190  LYGFVLPLVELTYKKAKQTITYALVLEIQMVMCLFATIFCTVGMLIDNDFKVIPREARNF  249

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG   YY++++ S I++Q F +GA+GVI   SSLLS ++  VLLP+TE+LAVI +HEKF
Sbjct  250  GLGEGTYYVVLVLSAIVWQTFFLGAIGVIFCASSLLSGIVIAVLLPITEILAVIFYHEKF  309

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGV+L L LWGFVSYF
Sbjct  310  QAEKGVALALSLWGFVSYF  328



>ref|XP_004164781.1| PREDICTED: purine permease 3-like [Cucumis sativus]
Length=371

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 241/319 (76%), Gaps = 0/319 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++ + L FN+IL++IGNCGGPL+LRLYF+ GG R+W S+WL T  WP++ +PL ISY+ R
Sbjct  23   LQRVLLAFNSILMSIGNCGGPLILRLYFIHGGNRVWLSSWLFTGGWPIILLPLAISYIHR  82

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RR  +D       F+  P L +  A++G+L G+ NYL+ YG+A+LPVSTSSLI++SQLAF
Sbjct  83   RRTATDGSKTKLIFMREPLLLLGSAVVGVLTGVDNYLFAYGMARLPVSTSSLIIASQLAF  142

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FA+ LVKQ FT+++VN++VLLT G  +L L +  DRP GE+N EY  GF++TLG+A 
Sbjct  143  TAGFAYLLVKQKFTSYTVNAVVLLTMGGAILALHSSGDRPEGETNGEYIAGFLMTLGAAV  202

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYGLI+PL+EL+Y K    + Y L+LE Q+V++++ TL C++GM IN+DFQ I RE REF
Sbjct  203  LYGLILPLIELMYKKTKQRLTYTLILEIQLVMAISGTLVCTIGMLINNDFQAIAREGREF  262

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG+ KYY++++ S II+Q F IGA+GVI Y SSL S ++  +LLP  E+LAV+ F EKF
Sbjct  263  GLGSTKYYVVLVMSCIIWQCFFIGAVGVIFYSSSLFSGIVIALLLPAVEILAVVFFREKF  322

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGVSL L LWGFVSYF
Sbjct  323  QVEKGVSLALNLWGFVSYF  341



>ref|XP_007227615.1| hypothetical protein PRUPE_ppa022492mg [Prunus persica]
 gb|EMJ28814.1| hypothetical protein PRUPE_ppa022492mg [Prunus persica]
Length=368

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 184/319 (58%), Positives = 242/319 (76%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++   L+ + + L+IG CGGPL++RLYF+ GG R+W S+WL+T  WP++FIP+ ++Y   
Sbjct  13   LKRALLILSCVFLSIGACGGPLIMRLYFIHGGKRVWLSSWLETGGWPIIFIPIALAY---  69

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
              RR+    +TK F M   LFI+ A+IGLL GL +YLY YGVA+LPVST++LI ++ L F
Sbjct  70   YHRRTTEGPSTKLFFMKLPLFIASAVIGLLTGLDDYLYAYGVARLPVSTAALITAAHLVF  129

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TALFAF LVKQ FT++S+N + LLT GA VLGL    DRP GES+K+Y  GF++TL SAA
Sbjct  130  TALFAFLLVKQKFTSYSINCVFLLTIGAAVLGLNTSADRPKGESDKQYIAGFMMTLSSAA  189

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG ++PLVEL Y KA   I Y LVLE Q+V+ L AT+FC+VGM IN+DF+VIPREAR F
Sbjct  190  LYGFVLPLVELTYKKAKQTITYALVLEIQLVMCLFATIFCTVGMLINNDFKVIPREARNF  249

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG  +YY++++ S I++Q F +GA+G+I   SSLLS ++  VLLPVTE+LAVI +HEKF
Sbjct  250  ELGERRYYVVLVFSAIVWQGFFLGAIGIIFCASSLLSGIVIAVLLPVTEILAVIFYHEKF  309

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGV+L L LWGFVSYF
Sbjct  310  QAEKGVALALSLWGFVSYF  328



>ref|XP_004152619.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 gb|KGN62723.1| hypothetical protein Csa_2G369740 [Cucumis sativus]
Length=371

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 241/319 (76%), Gaps = 0/319 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++ + L FN+IL++IGNCGGPL+LRLYF+ GG R+W S+WL T  WP++ +PL ISY+ R
Sbjct  23   LQRVLLAFNSILMSIGNCGGPLILRLYFIHGGNRVWLSSWLFTGGWPIILLPLAISYIHR  82

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RR  +D       F+  P L +  A++G+L G+ NYL+ YG+A+LPVSTSSLI++SQLAF
Sbjct  83   RRTATDGTKTKLIFMREPLLLLGSAVVGVLTGVDNYLFAYGMARLPVSTSSLIIASQLAF  142

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FA+ LVKQ FT+++VN++VLLT G  +L L +  DRP GE+N EY  GF++TLG+A 
Sbjct  143  TAGFAYLLVKQKFTSYTVNAVVLLTMGGAILALHSSGDRPEGETNGEYIAGFLMTLGAAV  202

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYGLI+PL+EL+Y K    + Y L+LE Q+V++++ TL C++GM IN+DFQ I RE REF
Sbjct  203  LYGLILPLIELMYKKTKQRLTYTLILEIQLVMAISGTLVCTIGMLINNDFQAIAREGREF  262

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG+ KYY++++ S II+Q F IGA+GVI Y SSL S ++  +LLP  E+LAV+ F EKF
Sbjct  263  GLGSTKYYVVLVMSCIIWQCFFIGAVGVIFYSSSLFSGIVIALLLPAVEILAVVFFREKF  322

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGVSL L LWGFVSYF
Sbjct  323  QVEKGVSLALNLWGFVSYF  341



>ref|XP_004152618.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 ref|XP_004174047.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 gb|KGN62722.1| hypothetical protein Csa_2G369730 [Cucumis sativus]
Length=363

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 185/323 (57%), Positives = 245/323 (76%), Gaps = 4/323 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++   L+FN  LLA+GNCGGPL++RLYF+ GG R+W S+ L+T  WP++FIPLLISY+ R
Sbjct  13   VKRTLLIFNCCLLAVGNCGGPLIMRLYFVHGGKRVWLSSCLETGGWPIIFIPLLISYIHR  72

Query  778  rrrR----SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSS  611
            RR      S   ++ +F  M P LF++ A IG+L G  +YLY YGVA+LPVSTS+LI++ 
Sbjct  73   RRLAALDPSGSPNSAQFIFMKPRLFLASAFIGILTGFDDYLYAYGVARLPVSTSALIIAC  132

Query  610  QlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTL  431
            QLAFTA FAF LVKQ FT++S+N++VLLT G  VL L    DRPAGESNK+Y  GF++T+
Sbjct  133  QLAFTAGFAFLLVKQKFTSYSINAVVLLTIGGAVLALHTSGDRPAGESNKDYIAGFLMTV  192

Query  430  GSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPRE  251
             +A +YG ++PLVEL Y KA   I Y LVLEFQ+++SL AT+ C++GM IN+DFQVIPRE
Sbjct  193  AAAVVYGFVLPLVELTYKKARQQITYTLVLEFQLIMSLFATIVCAIGMLINNDFQVIPRE  252

Query  250  AREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILF  71
            A  F LG  +YY++++ S I++Q F +GA+GVI   SSL S ++  VLLPVTE+LAVI+F
Sbjct  253  AEAFGLGKFRYYLVLVLSAILWQGFFLGAIGVIFSSSSLFSGIVIAVLLPVTEILAVIIF  312

Query  70   HEKFQPEKGVSLFLCLWGFVSYF  2
            +E+FQ EKGVSL L LWGF+SYF
Sbjct  313  NERFQAEKGVSLALNLWGFLSYF  335



>ref|XP_009373619.1| PREDICTED: purine permease 3-like [Pyrus x bretschneideri]
Length=380

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 185/319 (58%), Positives = 247/319 (77%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+ + L+ +  LL++G CGGPL++RLYF+ GG R+W S+WL+T  WP++FIP+ ++Y  R
Sbjct  15   MKNVLLIISCALLSVGTCGGPLVMRLYFIHGGKRVWLSSWLETGGWPIIFIPIAMAYCYR  74

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            R+       +TK FLM   LF + A+IG+L GL +YLY YGVA+LP+STS+LI++S LAF
Sbjct  75   RKTEG---PSTKLFLMKLPLFTASAVIGILTGLDDYLYAYGVARLPISTSALILASHLAF  131

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TALFAF LVKQ FT FS+N+IVLLT GAVVLGL   +DRP GESNKEY  GF +T+ +AA
Sbjct  132  TALFAFILVKQKFTLFSINAIVLLTIGAVVLGLNTSSDRPEGESNKEYIAGFFMTVAAAA  191

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG ++PL+EL Y KA   I Y LVLE Q+V+ L ATLFC+VGM I++DF+VIPREAR+F
Sbjct  192  LYGFVLPLIELTYKKAKQTITYALVLEVQLVMCLFATLFCTVGMIIDNDFKVIPREARKF  251

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            +LG  +YY++++ S I++Q F +GA+G+I   SSLLS ++   L+PVT++LAVI +HEKF
Sbjct  252  DLGETRYYVVLVFSAILWQGFFLGAIGIIFCASSLLSGIVIASLIPVTQILAVIFYHEKF  311

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGVSL L LWGF+SYF
Sbjct  312  QAEKGVSLALSLWGFISYF  330



>emb|CDP01126.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   334 bits (856),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 185/314 (59%), Positives = 242/314 (77%), Gaps = 3/314 (1%)
 Frame = -1

Query  943  LLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRS  764
            L+ N ++LAIGNCGGP+++RLYF++GG R+W S+WLQT  +P++ IPLLISY  RR+   
Sbjct  14   LVVNCLILAIGNCGGPIIMRLYFVKGGKRIWLSSWLQTVGFPIIAIPLLISYFHRRKTEG  73

Query  763  DVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfa  584
                NTK  LM   LFI+ A +GL+ G+ +YLY YG+A+LPVSTSS+I++SQLAFTA+FA
Sbjct  74   P---NTKLVLMKYPLFIAAAAVGLVTGIDDYLYAYGMARLPVSTSSIIIASQLAFTAVFA  130

Query  583  ffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLI  404
            F LVKQ FTA+SVN++VLLT GA VL + + +DRP GES K Y LGF++T+ +A LYG I
Sbjct  131  FLLVKQKFTAYSVNAVVLLTVGAGVLAMHSSSDRPKGESTKMYVLGFLMTVAAAVLYGFI  190

Query  403  MPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAA  224
            +P+VEL+Y KA   I Y LVLE Q+V+ L AT+FC+VGM    DFQ + REAR + LG A
Sbjct  191  LPVVELMYLKAKQAITYTLVLEIQLVMCLFATVFCTVGMIAKKDFQAMAREARAYALGEA  250

Query  223  KYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKG  44
            +YY++V  S +I+QFF +G +GVI   SSLLS ++  VLLPVTE++AVI+F EKFQ EKG
Sbjct  251  EYYLVVTWSAVIWQFFFLGVIGVIFCASSLLSAIMIAVLLPVTEVIAVIVFQEKFQAEKG  310

Query  43   VSLFLCLWGFVSYF  2
            V+LFL LWGFVSYF
Sbjct  311  VALFLSLWGFVSYF  324



>emb|CDP08377.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   334 bits (856),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 182/321 (57%), Positives = 239/321 (74%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            + +R I L+ +  +LAIGNCGGP+++RLYF++GG R+W S+WL+T  WP+ FIPL ISY 
Sbjct  7    STLRKILLVLSCFMLAIGNCGGPIIMRLYFVKGGKRIWLSSWLETGGWPITFIPLTISYF  66

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR+       NTK   M   +FI+ A+IGLL GL +YLY YG A+LPVST+++IV++ L
Sbjct  67   HRRKTEGP---NTKLIQMKCPVFIATAVIGLLTGLDDYLYAYGFARLPVSTATIIVATHL  123

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
             FTA FAF LVKQ FTA+SVN+IVLL+ G+ VL +   +DRP GES K Y LGF++TL +
Sbjct  124  GFTAFFAFLLVKQKFTAYSVNAIVLLSVGSGVLAMHTSSDRPKGESTKLYVLGFIMTLAA  183

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYGL++P+VEL+Y KA   I Y L+LE  +V+   AT+FC+VGM +N DFQ +PREA+
Sbjct  184  AALYGLVLPMVELMYIKAKQAITYTLLLEINLVMCFFATVFCTVGMLVNRDFQAMPREAK  243

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
             +ELG AKYY++V  + II+QFF +G +GVI   SSLLS +I   LLPVT  +AV+ F E
Sbjct  244  AYELGEAKYYVVVTWNAIIWQFFFLGVIGVIFCASSLLSAIIIASLLPVTGAIAVVAFDE  303

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KF PEKGV+LFL LWGFVSYF
Sbjct  304  KFPPEKGVALFLSLWGFVSYF  324



>ref|XP_008444875.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=365

 Score =   334 bits (856),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 246/325 (76%), Gaps = 4/325 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            + ++   L+FN  LLA+GNCGGPL++RLYF+ GG R+W S++L+T  WP++FIPLLISY+
Sbjct  13   SAVKRTLLIFNCFLLAVGNCGGPLVMRLYFVHGGNRVWLSSFLETGGWPIIFIPLLISYI  72

Query  784  rrrrrR----SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIV  617
            RRRR      S    +++   M P LF++ A+IG+L G  +YLY YGVA+LPVSTS+LI+
Sbjct  73   RRRRLAALDPSGSADSSQIIFMKPRLFLASAVIGILTGFDDYLYAYGVARLPVSTSALII  132

Query  616  SSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVL  437
            + QLAFTA FAF LVKQ FT++S+N++VLLT G  VL L    DRPAGESNK+Y  GF++
Sbjct  133  ACQLAFTAGFAFLLVKQKFTSYSINAVVLLTIGGAVLALHTSGDRPAGESNKDYIAGFLM  192

Query  436  TLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIP  257
            T+ +A +YG I+PLVEL Y KA   I Y LVLE+Q+++SL AT+ C +GM IN+DFQVIP
Sbjct  193  TVAAAVVYGFILPLVELTYKKARQQITYTLVLEYQLIMSLFATIVCVIGMLINNDFQVIP  252

Query  256  REAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVI  77
            REA  F LG  +YY++++ S I++Q F +GA+GVI   SSL S ++  VLLPVTE+LAVI
Sbjct  253  REAETFGLGKFRYYLVLVLSAILWQGFFLGAIGVIFSSSSLFSGIVIAVLLPVTEILAVI  312

Query  76   LFHEKFQPEKGVSLFLCLWGFVSYF  2
            +F+EKFQ EK VSL L LWGFVSYF
Sbjct  313  IFNEKFQAEKAVSLALNLWGFVSYF  337



>ref|XP_007223326.1| hypothetical protein PRUPE_ppa007339mg [Prunus persica]
 gb|EMJ24525.1| hypothetical protein PRUPE_ppa007339mg [Prunus persica]
Length=372

 Score =   333 bits (855),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 185/319 (58%), Positives = 244/319 (76%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++   L+ + +LL+IG CGGPL++RLYF+ GG R+W S+WL+T  WP++FIP+ ++Y   
Sbjct  13   LKRALLILSCVLLSIGTCGGPLIMRLYFIHGGKRVWLSSWLETGGWPIIFIPIALAY---  69

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
              RR+    +TK F +   LFI+ A+IGL+ GL +YLY YGVA+LPVSTSSLI+++QLAF
Sbjct  70   YHRRTTEGPSTKLFFIKLPLFIASAVIGLITGLDDYLYAYGVARLPVSTSSLIIAAQLAF  129

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TALFAF LVKQ FT++S N++VLLT GA VLGL    DRP GES+KEY  GF++T+ +AA
Sbjct  130  TALFAFLLVKQKFTSYSTNAVVLLTIGAAVLGLNTNADRPKGESDKEYIAGFLMTVAAAA  189

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG ++PLVEL Y KA   I Y LVLE QMV+ L AT+FC+VGM IN+DF+VI REAR F
Sbjct  190  LYGFVLPLVELTYKKAKQTITYALVLEIQMVMCLFATIFCTVGMLINNDFKVILREARNF  249

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG   YY++++ S I++Q F +GA+G+I   SSLLS ++  VLLP+TE+LAVI +HEKF
Sbjct  250  GLGKGTYYVVLVLSAIVWQTFFLGAIGIIFCASSLLSGIVIAVLLPITEILAVIFYHEKF  309

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGV+L L LWGFVSYF
Sbjct  310  QAEKGVALALSLWGFVSYF  328



>gb|EYU21538.1| hypothetical protein MIMGU_mgv1a020196mg [Erythranthe guttata]
Length=353

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 184/320 (58%), Positives = 247/320 (77%), Gaps = 1/320 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+T FL+ N ++LA+GNCGGPL++RLYF+RGG R+WFS+WL+T  WP++ IPL+ +Y+RR
Sbjct  1    MKTTFLIMNGVILAVGNCGGPLIMRLYFIRGGERIWFSSWLETGGWPIILIPLIAAYIRR  60

Query  778  r-rrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            R    +  D   K  LM P LF + ++IG+L GL +YLY  GVAKLP+ST++L+ ++ L 
Sbjct  61   RRSTTAAADGAAKLILMKPRLFSAASVIGILTGLDDYLYAKGVAKLPISTAALLAATHLV  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTA FAF LVKQ FTA+SVN++VLLT G VVLGL    DRP GES KEY +GF++ L +A
Sbjct  121  FTAAFAFLLVKQKFTAYSVNAVVLLTVGTVVLGLHTSGDRPEGESEKEYVVGFIMALSAA  180

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
            ALYGLI+P+VEL+Y KA   + Y L++E Q+V+   ATLFC+VGM IN+DFQ I REA+E
Sbjct  181  ALYGLILPVVELMYKKAKQALTYTLIMEIQLVICFFATLFCTVGMLINNDFQAISREAKE  240

Query  241  FELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEK  62
            +ELG  KYY++VI S II+Q F +G +GVI Y SSLLS +I TV +P+T++L V +++EK
Sbjct  241  YELGEMKYYLVVIWSAIIWQLFFLGVVGVIFYSSSLLSGIIITVTIPITQILGVFIYNEK  300

Query  61   FQPEKGVSLFLCLWGFVSYF  2
            FQ EKG++LFL LWGF+SYF
Sbjct  301  FQAEKGIALFLSLWGFISYF  320



>gb|KHG06856.1| Purine permease 1 -like protein [Gossypium arboreum]
Length=374

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 182/319 (57%), Positives = 240/319 (75%), Gaps = 1/319 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            MR   L+ N I+L+IGNCG PL++RLYF+ GG R+WF +WL+TA  P+  +P+  +Y+ R
Sbjct  26   MRKALLVINCIILSIGNCGSPLIMRLYFIHGGNRIWFLSWLETAGCPITLLPIACAYMHR  85

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
             R         +F++  P LF++  ++G++ GL NY Y+YG+++LPVSTSSLI++SQLAF
Sbjct  86   SRTADPTSGKKRFYMERP-LFLAAIVLGIITGLDNYFYSYGLSRLPVSTSSLIIASQLAF  144

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FAF LVKQ FTA+S+N++ LLT GA VL L + +DRP  ESNKEY LGFV+TL +AA
Sbjct  145  TAGFAFLLVKQKFTAYSINAVFLLTIGAGVLALHSSSDRPENESNKEYILGFVMTLAAAA  204

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG ++PLVEL Y KA   I Y LV+E Q+V+ L AT FC+VGM +N+DF+VI +EAREF
Sbjct  205  LYGFVLPLVELTYKKAKQEISYALVMEIQLVMCLVATGFCTVGMLVNNDFKVIGKEAREF  264

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG  KYY++VI + II Q F +GA+GV+   SS+LS V+  VLLPVTE+LA+  F+EKF
Sbjct  265  ELGETKYYVVVIFTAIINQCFFLGAIGVVFCASSMLSGVVIAVLLPVTEILAIFSFNEKF  324

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGVSL L LWGFVSYF
Sbjct  325  QAEKGVSLALSLWGFVSYF  343



>ref|XP_007018133.1| Purine permease 3, putative [Theobroma cacao]
 gb|EOY15358.1| Purine permease 3, putative [Theobroma cacao]
Length=410

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 184/319 (58%), Positives = 241/319 (76%), Gaps = 2/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            MR   L+ N I+LAIG CGGPLL+R YF+ GG R WFS+WL T  WP++  P+  +Y+ R
Sbjct  1    MRKALLVINGIVLAIGKCGGPLLMRAYFIHGGKRFWFSSWLTTGGWPIILFPIACAYMYR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RR  ++  S  K FLM P LF++ A+IG+L G+ +YLY+YGVA LPVST S++++SQLAF
Sbjct  61   RR--TEPTSKNKLFLMRPPLFVASAVIGILTGVDDYLYSYGVALLPVSTCSIVIASQLAF  118

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FAF LVKQ FT++SVN++ LLT GA VL LRA +DRP  ESN++Y LGF++TL +AA
Sbjct  119  TAAFAFILVKQKFTSYSVNAVFLLTVGAGVLALRASSDRPDTESNRKYALGFIMTLAAAA  178

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG ++PLVEL+Y K    + Y LV+E +MV  L AT FC+VGM +N+DF+VIPREAREF
Sbjct  179  LYGFVLPLVELMYKKTKQEMSYALVMEIEMVNCLFATGFCTVGMLVNNDFKVIPREAREF  238

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            +LG  KYY++ I S I++QFF +GA GVI   SSL+S +I  V+LPV E+LAVI + E F
Sbjct  239  DLGETKYYVVAIWSAIMWQFFFLGATGVIFCASSLVSGIIIAVVLPVIEILAVIFYKENF  298

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGV+L L +WGF+SYF
Sbjct  299  QAEKGVALALSVWGFISYF  317


 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFFL  734
            GNCGGP L+R YF+ GG R WFS+WL T  WP++  P+  +Y+   R R++  S  K FL
Sbjct  319  GNCGGPFLMRAYFIHGGKRFWFSSWLTTGGWPIILFPIACAYM--YRCRTEPTSKNKLFL  376

Query  733  MTPCLFISGALIGLLVGLMNYLYTYGVAKLPVST  632
            M P LFI+ A+IG+L G+ +YLY YGVA LPVST
Sbjct  377  MKPPLFIASAVIGILTGVDDYLYAYGVALLPVST  410



>ref|XP_006357925.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=343

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 183/319 (57%), Positives = 234/319 (73%), Gaps = 4/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M  +FL+ N I+L IG CG PL++RLYF++GG R+W S WLQT AWP+ FIPL ISYL R
Sbjct  1    MNKVFLIINCIILTIGTCGAPLIMRLYFIKGGKRIWLSCWLQTVAWPINFIPLAISYLYR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
                 + ++++K  LMTP +F++   IG+L GL NY Y+YGVAKLPVST+ L++S+QLAF
Sbjct  61   ----RNNNNSSKLILMTPRIFMATIGIGILQGLSNYFYSYGVAKLPVSTNGLLISTQLAF  116

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
             A FAF +VK   T++S+NS+ LLT GAVVL L +G DRP GE+NKEY LGF++TL SAA
Sbjct  117  IAFFAFIIVKLKLTSYSINSVFLLTIGAVVLALHSGGDRPEGETNKEYILGFIMTLASAA  176

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            L GLI PLVELIY KA   I Y  VLEFQ V    AT+F ++GM IN+DFQ I  EA+ F
Sbjct  177  LTGLIFPLVELIYKKAQQAITYTFVLEFQTVYCFVATVFSTIGMVINNDFQAISGEAKAF  236

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG  +YY+++IC  I+ QF+ +G +GVI   SSL+S ++ T LLPV E+LAV L+ EKF
Sbjct  237  ELGEGRYYVVIICIAIVLQFYFLGTIGVIYSASSLVSGILATFLLPVNEVLAVFLYSEKF  296

Query  58   QPEKGVSLFLCLWGFVSYF  2
              EKG+SL L LWGF SYF
Sbjct  297  SAEKGISLALSLWGFASYF  315



>ref|XP_008338896.1| PREDICTED: purine permease 3-like [Malus domestica]
Length=378

 Score =   331 bits (848),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 183/319 (57%), Positives = 246/319 (77%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+ + L+ +  LL+IG CGGPL++RLYF+ GG R+W S+WL+T  WP++FIP+ ++Y  R
Sbjct  15   MKNVLLIISCALLSIGTCGGPLVMRLYFIHGGKRVWLSSWLETGGWPIIFIPIAMAYCYR  74

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            R+       +TK F M   LF + A+IG+L GL +YLY YGVA+LP+STS+LI++S LAF
Sbjct  75   RKTEG---PSTKLFFMKLPLFTASAVIGVLTGLDDYLYAYGVARLPISTSALILASHLAF  131

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TALFAF LVKQ FT+FS+N+IVLLT GAVVLGL   +DRP GESNKEY  GF +T+ +AA
Sbjct  132  TALFAFILVKQKFTSFSINAIVLLTIGAVVLGLNTSSDRPEGESNKEYIAGFFMTVAAAA  191

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG ++PL+EL Y KA   I Y LVLE Q+V+ L ATLFC+VGM I++DF+VIP+EAR+F
Sbjct  192  LYGFVLPLIELTYKKAKQTITYALVLEVQLVMCLFATLFCTVGMLIDNDFKVIPKEARKF  251

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            +LG  +YY++++ S I++Q F +GA+G+I   SSLLS ++   L+PVT++LAVI +HEKF
Sbjct  252  DLGETRYYVVLVFSAILWQGFFLGAIGIIFCASSLLSGIVIASLIPVTQILAVIFYHEKF  311

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGVSL L LWGF+ YF
Sbjct  312  QAEKGVSLALSLWGFIFYF  330



>ref|XP_010060067.1| PREDICTED: purine permease 1-like [Eucalyptus grandis]
Length=360

 Score =   325 bits (834),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 180/319 (56%), Positives = 233/319 (73%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++ +FL+ N I+L++G CG PL++RLYF+RGGAR+W  +WL+  AWP++ +PL  +Y   
Sbjct  13   LKRLFLVLNCIMLSVGTCGSPLIMRLYFVRGGARMWLVSWLEMGAWPMLLVPLGAAY---  69

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
             RRRS      +  LM   LF + A IG+L+GL NY Y YGV +LPVSTS+L++++QLAF
Sbjct  70   SRRRSAEGPTARLVLMDRFLFAAAAGIGVLLGLDNYFYAYGVGRLPVSTSALLIATQLAF  129

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FAF LV+Q FT+ S+NSI LLT GA VL +   +DRPAGES   Y  GF +TLG+AA
Sbjct  130  TAGFAFLLVRQRFTSCSINSIFLLTIGAGVLSMHTSSDRPAGESKGAYFTGFFMTLGAAA  189

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYGL++PLVEL+Y KA   + Y LVLE Q+V+   AT FC+V M +N DFQ IPREAR +
Sbjct  190  LYGLVLPLVELMYKKAKQAVTYSLVLEIQLVMCFFATAFCTVAMLVNKDFQAIPREARNY  249

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG A+YY++++ + II QFF +GA+GVI Y SSL S VI   LLP TE+LAVI F EKF
Sbjct  250  ELGEARYYVVLVWTAIINQFFFLGAIGVIFYASSLFSAVIIATLLPFTEILAVICFQEKF  309

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGV+L L LWGF SYF
Sbjct  310  QAEKGVALALSLWGFASYF  328



>ref|XP_006357923.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=341

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 232/319 (73%), Gaps = 4/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+ + L+ N I+LA+G CGGPL++RLYF++GG R+W S+WLQTAAWP+ FIPL+ISY  R
Sbjct  1    MKKVLLVINCIILAVGTCGGPLVMRLYFIKGGKRIWLSSWLQTAAWPINFIPLVISYFYR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
                   +S TK  LMTP +F++   IG+L G  NY Y YG+ KLPVSTS L+ ++QLAF
Sbjct  61   ----RKNNSTTKLILMTPRIFMATIGIGILQGFTNYFYAYGIGKLPVSTSGLLFATQLAF  116

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FAF +VK  FT +SVNS+ LLT GAVVL LR+G D+P GE  KEY LGFV+TL SAA
Sbjct  117  TAFFAFLIVKLKFTPYSVNSVFLLTTGAVVLALRSGGDQPEGEPRKEYILGFVMTLASAA  176

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            L GLI PLVELIY K    I Y  VLEFQ +    AT+  ++GM IN DFQ I REA+ F
Sbjct  177  LTGLIFPLVELIYKKTQQTITYTFVLEFQTLYCFVATVLATIGMIINKDFQAISREAKTF  236

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG  KYYI++I S II QF+ +G++GVI   SSL+  ++ +VLLP+TE+LAV L+ EKF
Sbjct  237  ELGEDKYYIVIIWSAIILQFYFLGSIGVIYSASSLVCGILLSVLLPLTEVLAVFLYGEKF  296

Query  58   QPEKGVSLFLCLWGFVSYF  2
              EKGVSL L LWGF SYF
Sbjct  297  NAEKGVSLALSLWGFASYF  315



>ref|XP_004237961.1| PREDICTED: purine permease 1-like [Solanum lycopersicum]
Length=374

 Score =   325 bits (832),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 187/322 (58%), Positives = 242/322 (75%), Gaps = 4/322 (1%)
 Frame = -1

Query  964  NKMRT-IFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISY  788
            +KM+  IFL+FN I+L+IGNCGGPL+ RLYF+ GG R+W  + LQT   PV+ IPL I+Y
Sbjct  19   SKMKKLIFLIFNIIMLSIGNCGGPLISRLYFIHGGQRIWIPSVLQTVGCPVILIPLAIAY  78

Query  787  LrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
             +RR+ +       K   +T   FI+ A +G++VGL  YL ++G AKLPVSTS+LI ++Q
Sbjct  79   FQRRKIQGP---EAKIVFITRQEFIASAGVGIIVGLDGYLNSWGPAKLPVSTSTLINATQ  135

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            LAFTALFA  +VKQ  TA+S NS+VLL AGA  L LRA  DRPAGES K+Y LGFV+T  
Sbjct  136  LAFTALFAVLIVKQKLTAYSTNSVVLLIAGAATLALRANGDRPAGESAKDYMLGFVMTFV  195

Query  427  SAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREA  248
             A LYGL++PL+ELIY K+   + YI VLE QMV+ ++AT+FC++GM IN DFQ IPREA
Sbjct  196  GAVLYGLMLPLIELIYMKSKQAVTYITVLEIQMVLGISATVFCTIGMIINKDFQAIPREA  255

Query  247  REFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFH  68
             ++ +G +KYY++++   II+QF L+G +GVI Y SSLLS +I   LLPVTE+LAVILFH
Sbjct  256  SQYTIGESKYYMVLVLCAIIWQFALMGLVGVIFYSSSLLSGIIGAFLLPVTEVLAVILFH  315

Query  67   EKFQPEKGVSLFLCLWGFVSYF  2
            EKFQ EKGV++FL LWGFVSYF
Sbjct  316  EKFQAEKGVAIFLALWGFVSYF  337



>ref|XP_010266597.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=369

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 172/305 (56%), Positives = 241/305 (79%), Gaps = 1/305 (0%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISY-LrrrrrRSDVDSNTKFF  737
            GNCGGPLL+RLYFL GG R+WFS+WL+TA WP++ +PLL SY  RR + + +   +T+ F
Sbjct  42   GNCGGPLLIRLYFLHGGKRIWFSSWLETAGWPILLLPLLFSYSYRRSQDQGEERGSTRLF  101

Query  736  LMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFT  557
            L+ P LF + A++G++ GL +YLY YG+++LPVSTS+LI S+QL FTA+FAFFLV+Q FT
Sbjct  102  LIKPRLFAASAILGIITGLDDYLYAYGLSRLPVSTSALIASTQLIFTAIFAFFLVRQTFT  161

Query  556  AFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYN  377
            ++S+NSIV+LT GA+V+ L  G+DRP+ ESN +Y  GF +T+G++ALYGL++PLVEL Y 
Sbjct  162  SYSINSIVMLTIGALVMALHTGSDRPSNESNTQYYTGFFMTIGASALYGLVLPLVELTYK  221

Query  376  KANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICS  197
            K+N  I Y LV+E Q+V+S+ AT FCS+GM +N+DF+ IP++A E+E+G AKYY++++ S
Sbjct  222  KSNQLITYSLVIEMQLVISIFATAFCSLGMLVNNDFKSIPKDASEYEIGEAKYYLVIVWS  281

Query  196  GIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWG  17
             I++Q F +G +GVI  GSS+L  +I   ++PVTE+LAVI   EKF+ EKG+SL LCLWG
Sbjct  282  AILWQLFFLGLVGVIFCGSSMLGGIIIAAVIPVTEILAVIFCREKFKAEKGISLALCLWG  341

Query  16   FVSYF  2
            F SYF
Sbjct  342  FTSYF  346



>gb|KCW66598.1| hypothetical protein EUGRSUZ_F00392 [Eucalyptus grandis]
Length=480

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 180/319 (56%), Positives = 233/319 (73%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++ +FL+ N I+L++G CG PL++RLYF+RGGAR+W  +WL+  AWP++ +PL  +Y   
Sbjct  133  LKRLFLVLNCIMLSVGTCGSPLIMRLYFVRGGARMWLVSWLEMGAWPMLLVPLGAAY---  189

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
             RRRS      +  LM   LF + A IG+L+GL NY Y YGV +LPVSTS+L++++QLAF
Sbjct  190  SRRRSAEGPTARLVLMDRFLFAAAAGIGVLLGLDNYFYAYGVGRLPVSTSALLIATQLAF  249

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FAF LV+Q FT+ S+NSI LLT GA VL +   +DRPAGES   Y  GF +TLG+AA
Sbjct  250  TAGFAFLLVRQRFTSCSINSIFLLTIGAGVLSMHTSSDRPAGESKGAYFTGFFMTLGAAA  309

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYGL++PLVEL+Y KA   + Y LVLE Q+V+   AT FC+V M +N DFQ IPREAR +
Sbjct  310  LYGLVLPLVELMYKKAKQAVTYSLVLEIQLVMCFFATAFCTVAMLVNKDFQAIPREARNY  369

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG A+YY++++ + II QFF +GA+GVI Y SSL S VI   LLP TE+LAVI F EKF
Sbjct  370  ELGEARYYVVLVWTAIINQFFFLGAIGVIFYASSLFSAVIIATLLPFTEILAVICFQEKF  429

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGV+L L LWGF SYF
Sbjct  430  QAEKGVALALSLWGFASYF  448



>emb|CDY27947.1| BnaCnng05320D [Brassica napus]
Length=349

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 242/321 (75%), Gaps = 1/321 (0%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
            KM+T+ ++ N I+LAIGNCGGPL+ RLYF  GG R+WFS++LQT+  P++ +PLLIS+L 
Sbjct  2    KMKTVLVIINCIILAIGNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLISFLT  61

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            R R++   D+ T  FL+ P LF++  + GLL+G  NYLY YG+A LPVSTSSLI+SSQLA
Sbjct  62   RHRKQEQEDTKTTLFLIKPPLFLASVVFGLLIGFDNYLYAYGLAYLPVSTSSLIISSQLA  121

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTALFAFF+VKQ FT F++N++VLLT GA  L L A  D+   E+ KEY +GF +T+ +A
Sbjct  122  FTALFAFFMVKQRFTPFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFAMTVAAA  181

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LY  ++PLVEL Y KA+  I Y LVLE Q+V+ + AT FC VGM  + DF+ + REARE
Sbjct  182  VLYAFVLPLVELTYKKASQRISYTLVLEMQLVLCVVATCFCLVGMLADGDFKELRREARE  241

Query  241  FELGAAKYYILVIC-SGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            F+LG +KYY +V+  + +I+Q F +G++G+I   SSL+S V+ + LLP+TE+LAV+ F E
Sbjct  242  FKLGGSKYYCVVVAFTAVIWQGFFLGSIGMIFCASSLVSGVLISTLLPLTEVLAVLFFRE  301

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQ EKGVSLFL LWGFVSYF
Sbjct  302  KFQAEKGVSLFLSLWGFVSYF  322



>ref|XP_011072345.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Sesamum 
indicum]
Length=341

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 229/318 (72%), Gaps = 22/318 (7%)
 Frame = -1

Query  955  RTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrr  776
            + IFL+ N I+LAIGNCGGPL++RLYF+ GG R+WFS+WL+T  WPV+ IPL++SY    
Sbjct  10   KRIFLIINCIILAIGNCGGPLIMRLYFIHGGKRIWFSSWLETGGWPVILIPLIVSY----  65

Query  775  rrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaft  596
             RR   +   K  LM P LF++ A+IG+L G  +YLY YGVAKLPVSTSSLI++SQLAFT
Sbjct  66   TRRRRPNPGAKLILMKPRLFVAAAVIGILTGFDDYLYAYGVAKLPVSTSSLIIASQLAFT  125

Query  595  alfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAAL  416
            A+FA+FLVKQ FTA+S+N++VLLT                        +GF  T  +AAL
Sbjct  126  AVFAYFLVKQKFTAYSINAVVLLTV------------------GAAVXVGFFRTGAAAAL  167

Query  415  YGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFE  236
            YGLI+P+VE  Y KA  P+ Y LV+E Q+V+   AT+ C+VGM IN DFQ I REA+ F 
Sbjct  168  YGLILPVVEYTYKKAKQPVTYTLVMEIQLVMCFFATVVCTVGMIINKDFQAIGREAKGFG  227

Query  235  LGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQ  56
            LG A+YYI+V  S II+Q F +GA+GVI Y SSLLS ++ +VLLP TE+LAVI +HEKFQ
Sbjct  228  LGEARYYIVVGWSAIIWQCFFLGAIGVIFYASSLLSGILISVLLPATEVLAVIFYHEKFQ  287

Query  55   PEKGVSLFLCLWGFVSYF  2
             EKGVSLFL LWGF+SYF
Sbjct  288  AEKGVSLFLSLWGFISYF  305



>ref|XP_006338103.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=354

 Score =   321 bits (823),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 238/318 (75%), Gaps = 3/318 (1%)
 Frame = -1

Query  955  RTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrr  776
            + IFL+FN I+L+IGNCGGPL+ RLYF+ GG R+W  + LQT   P++ IPL I+Y +RR
Sbjct  3    KLIFLIFNIIMLSIGNCGGPLISRLYFIHGGQRIWIPSVLQTVGCPIILIPLAIAYFQRR  62

Query  775  rrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaft  596
            + +       K   +T   FI+ A +G++VGL  YL ++G AKLPVSTS+LI ++QLAFT
Sbjct  63   KIQGP---EAKIVFITRQEFIASAGVGIIVGLDGYLNSWGPAKLPVSTSTLINATQLAFT  119

Query  595  alfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAAL  416
            ALFA  +VKQ  TA+S NS+VLL AGA  L LRA  DRPAGES K+Y LGFV+T   A L
Sbjct  120  ALFAVLIVKQKLTAYSTNSVVLLIAGAATLALRANGDRPAGESAKDYMLGFVMTFIGAVL  179

Query  415  YGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFE  236
            YGL++PL+ELIY KA   + Y  VLE QMV+ ++AT+FC++GM IN DFQ IPREA ++ 
Sbjct  180  YGLMLPLIELIYMKAKQTVTYTTVLEIQMVLGISATVFCTIGMIINKDFQAIPREASQYA  239

Query  235  LGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQ  56
            +G +KYY++++   II+QF L+G +GVI Y SSLLS +I   LLPVTE+LAVILFHEKFQ
Sbjct  240  IGESKYYMVLVWCAIIWQFALLGLVGVIFYSSSLLSGIIGAFLLPVTEVLAVILFHEKFQ  299

Query  55   PEKGVSLFLCLWGFVSYF  2
             EKGV++FL LWGFVSYF
Sbjct  300  AEKGVAIFLALWGFVSYF  317



>gb|EYU38177.1| hypothetical protein MIMGU_mgv1a023817mg [Erythranthe guttata]
Length=357

 Score =   321 bits (823),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 183/324 (56%), Positives = 243/324 (75%), Gaps = 5/324 (2%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+T FL+ N ++LA+GN GGPL++RLYF+RGG R+WFS+WL+T  WP++ IPLL +Y+ R
Sbjct  1    MKTTFLIMNGVILAVGNSGGPLIMRLYFIRGGKRIWFSSWLETGGWPIILIPLLAAYISR  60

Query  778  rrrRS-----DVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVS  614
            RRRR        D   K FLM P LF + + IG+L GL +YLY  GVA+LP+ST++L+ +
Sbjct  61   RRRRRRSTTTAADGAAKLFLMKPRLFSAASAIGILTGLDDYLYAKGVAELPISTAALLAA  120

Query  613  SQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLT  434
            + L FTA FAF LVKQ FTA+SVN++VLLT G VVLGL    DRP GES KEY +GF + 
Sbjct  121  THLVFTAAFAFLLVKQKFTAYSVNAVVLLTVGTVVLGLHTSGDRPEGESEKEYVVGFFMA  180

Query  433  LGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPR  254
            L +A LYG I+P+VEL+Y KA   + Y L++E Q+V+   ATLFC+VGM IN+DFQ I R
Sbjct  181  LSAAGLYGFILPVVELMYKKAKQALTYTLIMEIQLVICFFATLFCTVGMLINNDFQAISR  240

Query  253  EAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVIL  74
            EA+E+ELG  KYY++VI S II+Q F +G +GVI Y SSLL  +I TV +P+T++L V +
Sbjct  241  EAKEYELGEMKYYLVVIWSAIIWQLFFLGVVGVIFYSSSLLCAIIITVTIPITQILGVFI  300

Query  73   FHEKFQPEKGVSLFLCLWGFVSYF  2
            ++EKFQ EKG++LFL LWGF+SYF
Sbjct  301  YNEKFQAEKGIALFLSLWGFISYF  324



>gb|EPS67422.1| hypothetical protein M569_07351, partial [Genlisea aurea]
Length=319

 Score =   319 bits (818),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 179/319 (56%), Positives = 231/319 (72%), Gaps = 5/319 (2%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            MR IFL+ N  LL +G+C GPL++RLYF RGG R+WFS+WL++A +P++ IPL+ SY   
Sbjct  1    MRMIFLIMNAALLTVGSCAGPLIMRLYFTRGGNRIWFSSWLESAGFPIILIPLIYSYCA-  59

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
                      +    M P L  + A++G+L GL NYLY YGVAKLPVSTSSLI++SQL F
Sbjct  60   ----GRGTHPSGIISMNPKLCSAAAVVGVLAGLDNYLYAYGVAKLPVSTSSLIIASQLGF  115

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA+FA+ +VKQ FTAFS+N++VLLT  A +L L +  DRP GESN +Y  GFVLTL +AA
Sbjct  116  TAVFAYLIVKQKFTAFSINAVVLLTVAAGILALHSNGDRPKGESNGDYYTGFVLTLAAAA  175

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYGL++PLVEL Y K    + Y  VL+FQ V+   ATL C++GM ++ DF  IP EAR F
Sbjct  176  LYGLMLPLVELAYAKTGQDLNYDAVLKFQFVLGFFATLACTIGMAVSGDFPAIPTEARGF  235

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            +LG  +YY +V+ S II+Q F +G +GVI Y S+LLS V+ +VLLP TE+LAV+ F EKF
Sbjct  236  QLGEGRYYAVVVSSAIIWQCFFLGNIGVIFYSSALLSGVLISVLLPPTEILAVLFFREKF  295

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKGVSLFL L+GFVSYF
Sbjct  296  QAEKGVSLFLSLFGFVSYF  314



>ref|XP_006366415.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=355

 Score =   320 bits (821),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 241/320 (75%), Gaps = 3/320 (1%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
             MR   L+ N +LL++G CGGPL++RLYF+ GG RLWF++WLQT  WP+  IPL+I Y  
Sbjct  10   NMRRFLLIINCLLLSVGVCGGPLMMRLYFVEGGLRLWFNSWLQTGGWPLTIIPLVILYFY  69

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            RR       S+TKF+ +TP +FI+  +IG+  G+  YLY++G +KLPVSTSSL++++QLA
Sbjct  70   RR---KTKGSDTKFYYITPRIFIASFIIGVFTGVDAYLYSWGGSKLPVSTSSLLIAAQLA  126

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTA+ ++F+ K  FT++S+N++VLLT GAV+LG+R+  DRP G ++KEY +GF++TL +A
Sbjct  127  FTAIGSYFIAKIKFTSYSINAVVLLTLGAVLLGMRSNGDRPEGVTSKEYVIGFIMTLLAA  186

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
            ALYGLI+P +ELIY KA   I   LVLE QMV++ AAT FC++GM  N DFQ I REA+ 
Sbjct  187  ALYGLILPCIELIYLKAKQAITATLVLEIQMVMAFAATAFCTIGMIANKDFQAISREAKH  246

Query  241  FELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEK  62
            F LG  +YYI+VI S II+Q F +GA+GVI   SSL+S V+  VLLP+TE+L VI F EK
Sbjct  247  FNLGEGRYYIVVIWSAIIWQCFFVGAVGVIYLSSSLMSGVMIAVLLPITEVLGVIFFDEK  306

Query  61   FQPEKGVSLFLCLWGFVSYF  2
            F  EKG+SLFL LWGFVSYF
Sbjct  307  FSAEKGLSLFLSLWGFVSYF  326



>ref|XP_006433898.1| hypothetical protein CICLE_v10001546mg [Citrus clementina]
 gb|ESR47138.1| hypothetical protein CICLE_v10001546mg [Citrus clementina]
Length=371

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 183/316 (58%), Positives = 230/316 (73%), Gaps = 12/316 (4%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVD-------  755
            GNC GPL++RLYFL GG R+WFS+WL+ A  PV+ IP+ +SYL+RRR  +  D       
Sbjct  30   GNCAGPLIMRLYFLHGGKRIWFSSWLEAAGCPVILIPITVSYLQRRRSSTTTDHESSTSS  89

Query  754  -----SNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftal  590
                  N K  LM P +F + A+IG+L GL NYLY YGVA+LPVSTSSLI++SQLAFTA 
Sbjct  90   QPSNNDNNKLILMRPPVFFASAIIGILTGLDNYLYAYGVARLPVSTSSLIIASQLAFTAA  149

Query  589  faffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYG  410
            FAF LVKQ  T++S+N++ LLT GAVVLGL    DRP  ES ++Y +GF++T+G+A LYG
Sbjct  150  FAFLLVKQKLTSYSLNAVFLLTLGAVVLGLHTNGDRPHNESARQYLVGFLMTVGAAVLYG  209

Query  409  LIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELG  230
             ++PL+EL Y +A   I Y LVLE QMV+ L ATL C+VGM +N DFQ I +EAR + LG
Sbjct  210  FVLPLMELTYKRARQEITYALVLEIQMVMCLFATLVCTVGMVVNKDFQAIGKEARAYTLG  269

Query  229  AAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPE  50
              KYY +V+ S +I+Q F +GA+GVI  GSSLLS +I  VLLPVTE+LAVI + EKFQ E
Sbjct  270  EGKYYAVVVASALIWQCFFLGAIGVIYCGSSLLSAIIIAVLLPVTEILAVIFYKEKFQAE  329

Query  49   KGVSLFLCLWGFVSYF  2
            KGVSL L LWGF SYF
Sbjct  330  KGVSLALSLWGFASYF  345



>ref|XP_010939717.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
Length=362

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 183/321 (57%), Positives = 236/321 (74%), Gaps = 2/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              +R   +  N  ++ IG   GPLLLRLYFL+GG R W S+WLQT  WP++FIPL ISY 
Sbjct  20   KHLRWFLMALNFTIMVIGTAVGPLLLRLYFLKGGTRKWLSSWLQTGGWPLLFIPLAISY-  78

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
               R R       K +LMTP LF++  ++GLLVGL ++LY YG++ LPVSTSS+++SSQL
Sbjct  79   -AHRCRCGGGRPIKLYLMTPPLFLACTVLGLLVGLDDFLYAYGLSYLPVSTSSILISSQL  137

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
             FTALFAFF+VKQ FT+FSVN++VLL+ GAV+LGL A  DRP GESN +Y LGF +TL +
Sbjct  138  GFTALFAFFMVKQKFTSFSVNAVVLLSIGAVILGLHASGDRPKGESNTQYYLGFFMTLAA  197

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A LYG I+PLVEL Y KA   + Y LV+E Q+ +   AT+FC+VGM +N DF VIPREAR
Sbjct  198  AVLYGFILPLVELTYAKAKQVVSYTLVIEMQLAMGFFATVFCTVGMLVNGDFHVIPREAR  257

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            EFELG A YY+L++ S I++QF  +G +G I YGS+LL+ +I  VL+PV+++LAV+ FHE
Sbjct  258  EFELGEATYYVLLVWSAILWQFVFLGTVGAIFYGSALLAGIIMAVLVPVSQVLAVVFFHE  317

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
             F  EKGV+L L LWGF SYF
Sbjct  318  PFSAEKGVALALALWGFASYF  338



>ref|XP_006472532.1| PREDICTED: purine permease 1-like [Citrus sinensis]
 gb|KDO81081.1| hypothetical protein CISIN_1g017456mg [Citrus sinensis]
Length=371

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/316 (58%), Positives = 231/316 (73%), Gaps = 12/316 (4%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVD-------  755
            GNC GPL++RLYFL GG R+WFS+WL+TA  PV+ IP+ +SYL+RRR  +  D       
Sbjct  30   GNCAGPLIMRLYFLHGGKRIWFSSWLETAGCPVILIPITVSYLQRRRSGTTTDHESSTSS  89

Query  754  -----SNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftal  590
                  + K  LM P +F + A+IG+L GL NYLY YGVA+LPVSTSSLI++SQLAFTA 
Sbjct  90   QPSNNDDNKLILMRPPVFFASAIIGILTGLDNYLYAYGVARLPVSTSSLIIASQLAFTAA  149

Query  589  faffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYG  410
            FAF LVKQ  T++S+N++ LLT GAVVLGL    DRP  ES ++Y +GF++T+G+A LYG
Sbjct  150  FAFLLVKQKLTSYSLNAVFLLTLGAVVLGLHTNGDRPDNESARQYLVGFLMTIGAAVLYG  209

Query  409  LIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELG  230
             ++PL+EL Y +A   I Y LVLE QMV+ L ATL C+VGM +N DFQ I +EAR + LG
Sbjct  210  FVLPLMELTYKRARQEITYALVLEIQMVMCLFATLVCTVGMVVNKDFQAIGKEARAYTLG  269

Query  229  AAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPE  50
              KYY +V+ S +I+Q F +GA+GVI  GSSLLS +I  VLLPVTE+LAVI + EKFQ E
Sbjct  270  EGKYYAVVVASALIWQCFFLGAIGVIYCGSSLLSAIIIAVLLPVTEILAVIFYKEKFQAE  329

Query  49   KGVSLFLCLWGFVSYF  2
            KGVSL L LWGF SYF
Sbjct  330  KGVSLALSLWGFASYF  345



>ref|XP_004490401.1| PREDICTED: purine permease 1-like [Cicer arietinum]
Length=361

 Score =   319 bits (817),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 179/321 (56%), Positives = 236/321 (74%), Gaps = 0/321 (0%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              M+ + L+ N+ILLAIG CGGPL++RLYF+ GG R W S++L+T+ +P++ +PL IS++
Sbjct  16   RNMKKLLLVINSILLAIGTCGGPLVMRLYFIHGGKRAWLSSFLETSGFPIILLPLTISHI  75

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
              R    + +SN  F  M P LF+  A+IG+L GL +YLY  G+A+LPVSTSSLI SS L
Sbjct  76   HHRYHNRNCNSNRNFISMKPPLFLFSAIIGILTGLDDYLYACGIARLPVSTSSLIQSSHL  135

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA+FAF LV+  FTA+SVN IVLLT G+VVL +R+      GES  EY +GFV+ L S
Sbjct  136  AFTAVFAFILVRHKFTAYSVNCIVLLTLGSVVLAVRSNGGGGDGESRGEYVIGFVMILSS  195

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG ++PL+EL+Y K    + Y LV+E Q V+   ATLFC +GM I+ DF+VIPREAR
Sbjct  196  AALYGFVLPLMELVYKKTKQVVTYSLVMEIQFVMCFFATLFCILGMIIDKDFKVIPREAR  255

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            EF LG  KYY++++CS I++QFF +GA+GVI Y SSLLS +I    LPVTE++AVI++ E
Sbjct  256  EFNLGETKYYVVLVCSAIMWQFFFLGAIGVIFYASSLLSGIIIAAFLPVTEIMAVIVYKE  315

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
             F  EKGV+L L LWGFVSYF
Sbjct  316  NFHAEKGVALVLSLWGFVSYF  336



>ref|XP_002893512.1| ATPUP3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69771.1| ATPUP3 [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score =   318 bits (814),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 175/319 (55%), Positives = 243/319 (76%), Gaps = 1/319 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M  + ++ N I+LAIGNCGGPL++RLYF  GG R+WFST+L+TA +PV+FIPLL SY+ R
Sbjct  1    MVKVLVIINCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIAR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RR  ++V  +T FFL+ P L I    IG+L G  NYLY YG+A LPVST++LI++SQLAF
Sbjct  61   RRS-NNVGDDTSFFLIKPRLLIVAVFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAF  119

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
             A+F+FF+VK  FT F++N++VLLT GA VLG+    D+P  E++K+Y +GF++T+ +A 
Sbjct  120  IAIFSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYIIGFLMTVAAAV  179

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            +Y  I+PLVEL Y KA  P+ Y LVLEFQ+++   A++   +GMFI  DF+ +P+EAREF
Sbjct  180  MYAFILPLVELAYQKARQPMSYTLVLEFQLILCFLASIVSVIGMFIAGDFKALPKEAREF  239

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            +LG A +Y++ + S II+Q F +GA+G+I   SSL+S ++ +VLLP+TE+LAVI +HEKF
Sbjct  240  KLGEALFYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKF  299

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKG+SL L LWGFVSYF
Sbjct  300  QAEKGLSLALSLWGFVSYF  318



>ref|XP_010064227.1| PREDICTED: purine permease 3-like [Eucalyptus grandis]
 gb|KCW66596.1| hypothetical protein EUGRSUZ_F00390 [Eucalyptus grandis]
Length=379

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 177/321 (55%), Positives = 237/321 (74%), Gaps = 7/321 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              ++ I L  N  +L++ +C GPLL+RLYF+ GGA +W S+WL+T  WP++FIPL ++Y 
Sbjct  11   KTLKLILLALNCAMLSL-SCAGPLLMRLYFIHGGASVWLSSWLETGGWPIIFIPLAVAYF  69

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            RRR   +    + +  LM P LF++ A+IG+L GL +YLY+YGVA+LPVSTS+L++++QL
Sbjct  70   RRR---ASEGPSARLVLMDPFLFVAAAVIGVLTGLDDYLYSYGVARLPVSTSALLIATQL  126

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAF LV+Q FT++S   I LLT GA VL +   +DRPAGES   Y  GF +TLG+
Sbjct  127  AFTAGFAFLLVRQLFTSYS---IFLLTIGAGVLAMHTSSDRPAGESKGAYYAGFFMTLGA  183

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYGL++PLVEL Y KA   + Y LVLE Q+V+   AT FC++GM +N DFQ IPREAR
Sbjct  184  AALYGLVLPLVELTYKKAKQAVTYSLVLEIQLVMCFFATAFCTIGMLVNKDFQAIPREAR  243

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
             F LG A+YY++++ + I++QFF +GA+GVI Y SSL S ++  +L+PVTE+L VI FHE
Sbjct  244  NFGLGEAQYYVVLVSNAIVWQFFFLGAIGVIFYASSLFSGIMIAILIPVTEILGVICFHE  303

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQ EKGVSL L LWGF SYF
Sbjct  304  KFQAEKGVSLALSLWGFASYF  324



>gb|AES73111.2| purine permease-like protein [Medicago truncatula]
Length=371

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 179/335 (53%), Positives = 243/335 (73%), Gaps = 9/335 (3%)
 Frame = -1

Query  979  QRI*CNKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPL  800
            Q++   KM    L+ N ++LA+GN GGPL++RLYF+ GG R+W S  L+TA +P++ IPL
Sbjct  7    QQVAKKKMNKFLLIVNCLILALGNSGGPLIMRLYFIHGGQRVWLSACLETAGFPLMLIPL  66

Query  799  LISYLrr-rrrRSDVDSNT--------KFFLMTPCLFISGALIGLLVGLMNYLYTYGVAK  647
             ISY++R R R   + SNT            M P +F + A +G+L GL +YLY YGVA+
Sbjct  67   TISYIQRFRHRHKPLPSNTISIASEKQNIISMKPPIFFAAAFVGILTGLDDYLYAYGVAR  126

Query  646  LPVSTSSLIVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGES  467
            LPVSTSSLI++SQL FTA FAF LVKQ FTAF+VN++ LLT GA VL +   +DRPAG S
Sbjct  127  LPVSTSSLIIASQLGFTAFFAFLLVKQKFTAFTVNAVFLLTVGAGVLAMHTSSDRPAGVS  186

Query  466  NKEYGLGFVLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGM  287
             K+Y +GF  T+ ++ALYG ++P VEL+Y K   PI Y LV+EFQ V+ + AT+FC++GM
Sbjct  187  AKQYAIGFSTTVAASALYGFVLPAVELVYKKIKQPITYSLVMEFQFVMCMFATIFCTIGM  246

Query  286  FINHDFQVIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVL  107
             IN+DF++IPREAR F LG + YY++++ + I++Q F +GA+GV+   SSLLS ++  VL
Sbjct  247  IINNDFKMIPREARNFGLGESIYYVVLVLNAIMWQAFFLGAIGVVFCASSLLSGILIAVL  306

Query  106  LPVTELLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            LP+TE+LAV+ + EKFQ EKGVSL L LWGFVSYF
Sbjct  307  LPLTEVLAVVFYKEKFQAEKGVSLVLSLWGFVSYF  341



>ref|XP_004501676.1| PREDICTED: purine permease 1-like isoform X1 [Cicer arietinum]
 ref|XP_004501677.1| PREDICTED: purine permease 1-like isoform X2 [Cicer arietinum]
Length=367

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 177/326 (54%), Positives = 241/326 (74%), Gaps = 5/326 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
             KM+ I L+ N  +LA+GN GGPL++RLYF+ GG R+W S++L+TA +P++ +PL +SY+
Sbjct  11   RKMKRILLIINCFILALGNSGGPLIMRLYFIHGGNRVWLSSFLETAGFPLMLLPLTVSYI  70

Query  784  rrrrrRSDVDSNTK-----FFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLI  620
            +RRR      + T+        M P LF++ A IG++ GL +YLY YGVA+LPVSTS+LI
Sbjct  71   KRRRLHRRNAATTESGKLNLISMKPPLFLAVAFIGIITGLDDYLYAYGVARLPVSTSALI  130

Query  619  VSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFV  440
            ++SQL FTA+FAF LVKQ FTAFS+N++VLLT GA VL +    DRP GES K+Y +GF+
Sbjct  131  IASQLGFTAVFAFLLVKQKFTAFSINAVVLLTIGAGVLAMHTSGDRPNGESTKQYVIGFI  190

Query  439  LTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVI  260
             T+ +AALYG ++PL+EL+Y K   P+ Y LV+E Q V+ + ATLFC+VGM +N+DF+VI
Sbjct  191  TTVAAAALYGFVLPLIELVYKKTKQPLTYSLVMEIQFVMCMFATLFCAVGMIVNNDFKVI  250

Query  259  PREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAV  80
            PREA+ F LG   YY +++ S I++Q F +GA+GVI   SSLLS ++  VLLP+TE+LAV
Sbjct  251  PREAKIFGLGEKTYYFVLVVSAIMWQAFFLGAVGVIFCASSLLSGILIAVLLPLTEVLAV  310

Query  79   ILFHEKFQPEKGVSLFLCLWGFVSYF  2
            I + E FQ EK VSL L LWGFVSYF
Sbjct  311  IFYKEHFQAEKAVSLILSLWGFVSYF  336



>ref|XP_010322002.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Solanum 
lycopersicum]
Length=346

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 238/319 (75%), Gaps = 2/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+ + L+ N I+LA+G CGGPL++RLYF++GG R+W S+WLQTAAWP+ FIPL+ISY  R
Sbjct  1    MKKVLLVINCIILAVGTCGGPLIMRLYFIKGGKRIWLSSWLQTAAWPINFIPLVISYFYR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            R+  ++ ++++K  LMTP +F++   IG+L G  NY Y YGVAKLPVSTS L+ ++QLAF
Sbjct  61   RK--NNNNNSSKLILMTPRVFMATIGIGILQGFTNYFYAYGVAKLPVSTSGLLFATQLAF  118

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FAF +VK  FT +SVNS+ LLT GAVVL LR+G D+P GE  K+Y LGF +TL SAA
Sbjct  119  TAFFAFLIVKLKFTPYSVNSVFLLTIGAVVLALRSGGDQPEGEXKKKYVLGFGMTLASAA  178

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            L GLI PLVELIY KA   I Y  VLEFQ +    AT+  ++GM IN DFQ I RE + F
Sbjct  179  LTGLIFPLVELIYKKAQQTITYTFVLEFQTLYCFVATVLATIGMIINEDFQAISREVKTF  238

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG  KYYI++I S II QF+ +G++GVI   SSL+S ++ +VLLP+TE+LAV L+ EKF
Sbjct  239  ELGEDKYYIVIIWSAIILQFYFLGSIGVIYSASSLVSGILISVLLPITEVLAVFLYGEKF  298

Query  58   QPEKGVSLFLCLWGFVSYF  2
              EKGVSL L LWGF SYF
Sbjct  299  NAEKGVSLALSLWGFASYF  317



>ref|XP_010538168.1| PREDICTED: purine permease 1-like [Tarenaya hassleriana]
Length=359

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/328 (57%), Positives = 238/328 (73%), Gaps = 9/328 (3%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M    ++ N I LAIGNCGGPL++RLYF  GG R+W S++L+TA +P++FIPL  S+L+R
Sbjct  1    MEKALVIINCIFLAIGNCGGPLMMRLYFNNGGKRVWLSSFLETAGFPIIFIPLFSSFLKR  60

Query  778  rrrRSD---------VDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSS  626
             R R+           D  T+FFLM P LF +   IG++ GL NYLY YG+A LPVSTSS
Sbjct  61   NRNRTSCIITSSSSSSDEKTRFFLMRPRLFAASGFIGIITGLDNYLYAYGLAFLPVSTSS  120

Query  625  LIVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLG  446
            LI++SQLAFTALFAF LVKQ FT FSVN++VLLT GA VL L  G D+P+ ES K+Y LG
Sbjct  121  LIIASQLAFTALFAFLLVKQKFTPFSVNAVVLLTVGAGVLALHTGGDKPSNESQKDYMLG  180

Query  445  FVLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ  266
            FVLT+ +A LY  I+P +EL Y KA   + + LVLE QMV+ L A++FC VGM I+ DF+
Sbjct  181  FVLTVAAAVLYAFILPFIELTYKKARQEMSFTLVLEVQMVMCLFASVFCLVGMLISDDFK  240

Query  265  VIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELL  86
             IPREAR F LG   YY+++  + II+Q F +GA+GVI   SSL+S V+ +VLLP+TE+L
Sbjct  241  AIPREARSFGLGERVYYVVIAFTAIIWQGFFLGAIGVIFCASSLVSGVLISVLLPLTEVL  300

Query  85   AVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            AV+ F E+FQ EKGVSL L LWGFVSYF
Sbjct  301  AVVCFKERFQAEKGVSLVLSLWGFVSYF  328



>emb|CDX94595.1| BnaC07g10630D [Brassica napus]
Length=349

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 172/319 (54%), Positives = 239/319 (75%), Gaps = 0/319 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M    ++ N I+LAIGNCGGPL++RLYF  GG R+WFST+L+TA +P++FIPL  SYL R
Sbjct  1    MARALVIINCIILAIGNCGGPLIMRLYFNNGGHRIWFSTFLETAGFPIIFIPLFFSYLNR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RR  S+   NT+FFL+ P L ++  LIG+L G  NYLY YG+A LPVST++LI++SQLAF
Sbjct  61   RRSNSNEGENTRFFLIKPRLLMAAILIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAF  120

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
             A+F++F+V   FT F++N++VLLT GA VLG+    D+P  E++K+Y +GF++T+ +A 
Sbjct  121  IAIFSYFMVSHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYMVGFLVTVAAAV  180

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            +Y  ++PLVEL Y KA  P+ Y LVLE QM++   A+L   +GM I  DF+ +P EAREF
Sbjct  181  MYAFLLPLVELAYQKAKQPMSYTLVLEVQMILCFLASLVSLIGMLIAGDFKALPNEAREF  240

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            +LG A +Y++ + S II+Q F +GA+G+I   SSL+S ++ +VLLP+TE+LAVI +HEKF
Sbjct  241  KLGEAMFYVVAVLSAIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIFYHEKF  300

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKG+SL L LWGFVSYF
Sbjct  301  QKEKGLSLALSLWGFVSYF  319



>ref|XP_009766753.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=358

 Score =   316 bits (809),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 235/325 (72%), Gaps = 4/325 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            +KM+ + L+ N I+LA+G CG PLL+RLYF++GG R+W STWLQT AWP+ FIPL ISY 
Sbjct  7    SKMKKVLLVINCIILAVGTCGTPLLMRLYFIKGGNRIWLSTWLQTVAWPINFIPLAISYF  66

Query  784  rrrrrRSDVDSNT----KFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIV  617
             RR+   + D N     K  LMTP +F++   IG+L G  NY Y YG AKLPVSTS L+ 
Sbjct  67   YRRKININNDINNNNNMKVILMTPRIFVATIGIGVLQGFANYFYAYGTAKLPVSTSGLLF  126

Query  616  SSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVL  437
            ++QLAFTA FAF +VK  FT++SVN++ LLT GAV+L L +G D+P GE  KEY LGF++
Sbjct  127  ATQLAFTAGFAFLIVKLKFTSYSVNAVFLLTVGAVLLALHSGGDQPEGEPKKEYILGFIM  186

Query  436  TLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIP  257
            TL +AAL GLI PLVELIY KA+  I Y LVLEFQ V    AT+  ++GM IN DFQ I 
Sbjct  187  TLAAAALSGLIFPLVELIYKKAHQAITYTLVLEFQTVYCFVATIVATIGMIINKDFQAIS  246

Query  256  REAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVI  77
             EA+ FELG  +YY L+I S II QF+ +G +GVI   SSL+S ++ +VLLP+TE+LAV 
Sbjct  247  TEAKAFELGEGRYYNLIIWSAIILQFYFLGTIGVIYSASSLVSGILISVLLPITEVLAVF  306

Query  76   LFHEKFQPEKGVSLFLCLWGFVSYF  2
            ++ EKF  EKGVSL L LWGF+SYF
Sbjct  307  IYGEKFSAEKGVSLALSLWGFLSYF  331



>ref|XP_009102926.1| PREDICTED: purine permease 3 [Brassica rapa]
 ref|XP_009102927.1| PREDICTED: purine permease 3 [Brassica rapa]
 emb|CDX94594.1| BnaC07g10640D [Brassica napus]
Length=349

 Score =   315 bits (808),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 172/319 (54%), Positives = 239/319 (75%), Gaps = 0/319 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M    ++ N I+LAIGNCGGPL++RLYF  GG R+WFST+L+TA +P++FIPL  SYL R
Sbjct  1    MARALVIINCIILAIGNCGGPLIMRLYFNNGGHRIWFSTFLETAGFPIIFIPLFFSYLNR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RR  ++   NT+FFL+ P L ++  LIG+L G  NYLY YG+A LPVST++LI++SQLAF
Sbjct  61   RRSNNNEGENTRFFLIKPRLLMAAILIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAF  120

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
             A+F++F+V   FT F++N++VLLT GA VLG+    D+P  E++K+Y +GF++T+ +A 
Sbjct  121  IAIFSYFMVSHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYMVGFLVTVAAAV  180

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            +Y  ++PLVEL Y KA  P+ Y LVLE QM++   A+L   VGM I  DF+ +P EAREF
Sbjct  181  MYAFLLPLVELAYQKAKQPMSYTLVLEVQMILCFLASLVSLVGMLIAGDFKALPNEAREF  240

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            +LG A +Y++ + S II+Q F +GA+G+I   SSL+S ++ +VLLP+TE+LAVI +HEKF
Sbjct  241  KLGEAMFYVVAVLSAIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIFYHEKF  300

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKG+SL L LWGFVSYF
Sbjct  301  QKEKGLSLALSLWGFVSYF  319



>ref|XP_003602860.1| Purine permease [Medicago truncatula]
Length=440

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 179/335 (53%), Positives = 243/335 (73%), Gaps = 9/335 (3%)
 Frame = -1

Query  979  QRI*CNKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPL  800
            Q++   KM    L+ N ++LA+GN GGPL++RLYF+ GG R+W S  L+TA +P++ IPL
Sbjct  7    QQVAKKKMNKFLLIVNCLILALGNSGGPLIMRLYFIHGGQRVWLSACLETAGFPLMLIPL  66

Query  799  LISYLrr-rrrRSDVDSNT--------KFFLMTPCLFISGALIGLLVGLMNYLYTYGVAK  647
             ISY++R R R   + SNT            M P +F + A +G+L GL +YLY YGVA+
Sbjct  67   TISYIQRFRHRHKPLPSNTISIASEKQNIISMKPPIFFAAAFVGILTGLDDYLYAYGVAR  126

Query  646  LPVSTSSLIVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGES  467
            LPVSTSSLI++SQL FTA FAF LVKQ FTAF+VN++ LLT GA VL +   +DRPAG S
Sbjct  127  LPVSTSSLIIASQLGFTAFFAFLLVKQKFTAFTVNAVFLLTVGAGVLAMHTSSDRPAGVS  186

Query  466  NKEYGLGFVLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGM  287
             K+Y +GF  T+ ++ALYG ++P VEL+Y K   PI Y LV+EFQ V+ + AT+FC++GM
Sbjct  187  AKQYAIGFSTTVAASALYGFVLPAVELVYKKIKQPITYSLVMEFQFVMCMFATIFCTIGM  246

Query  286  FINHDFQVIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVL  107
             IN+DF++IPREAR F LG + YY++++ + I++Q F +GA+GV+   SSLLS ++  VL
Sbjct  247  IINNDFKMIPREARNFGLGESIYYVVLVLNAIMWQAFFLGAIGVVFCASSLLSGILIAVL  306

Query  106  LPVTELLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            LP+TE+LAV+ + EKFQ EKGVSL L LWGFVSYF
Sbjct  307  LPLTEVLAVVFYKEKFQAEKGVSLVLSLWGFVSYF  341



>ref|NP_174143.1| purine permease 3 [Arabidopsis thaliana]
 sp|Q9FZ95.1|PUP3_ARATH RecName: Full=Purine permease 3; Short=AtPUP3 [Arabidopsis thaliana]
 gb|AAF98433.1|AC021044_12 Similar to purine permease [Arabidopsis thaliana]
 gb|AEE30933.1| purine permease 3 [Arabidopsis thaliana]
Length=351

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 174/319 (55%), Positives = 243/319 (76%), Gaps = 1/319 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M    ++ N I+LAIGNCGGPL++RLYF  GG R+WFST+L+TA +PV+FIPLL SY+ R
Sbjct  1    MVKALVIINCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYITR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RR  ++V  +T FFL+ P L I+  ++G+L G  NYLY YG+A LPVST++LI++SQLAF
Sbjct  61   RRS-NNVGDSTSFFLIKPRLLIAAVIVGILSGFDNYLYAYGIAYLPVSTAALIIASQLAF  119

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
             A+F+FF+VK  FT F++N++VLLT GA VLG+    D+P  E++K+Y  GF++T+ +A 
Sbjct  120  IAIFSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYITGFLITVAAAV  179

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            +Y  I+PLVEL Y KA   + Y LVLEFQ+++ L A++   +GMFI  DF+ +P+EAREF
Sbjct  180  MYAFILPLVELAYQKAKQTMSYTLVLEFQLILCLLASIVSVIGMFIAGDFKALPKEAREF  239

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            +LG A +Y++ + S II+Q F +GA+G+I   SSL+S ++ +VLLP+TE+LAVI +HEKF
Sbjct  240  KLGEALFYVVAVFSAIIWQGFFLGAIGLIFSTSSLVSGIMISVLLPITEVLAVIFYHEKF  299

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKG+SL L LWGFVSYF
Sbjct  300  QAEKGLSLALSLWGFVSYF  318



>ref|XP_002531513.1| purine transporter, putative [Ricinus communis]
 gb|EEF30867.1| purine transporter, putative [Ricinus communis]
Length=380

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 177/322 (55%), Positives = 235/322 (73%), Gaps = 3/322 (1%)
 Frame = -1

Query  967  CNKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISY  788
             + +    L+ N  +LAIGNCGGPL+ RLYFL+GG  +W S++LQTA WP +  PL +SY
Sbjct  43   SSTLNKFLLIVNGTMLAIGNCGGPLIQRLYFLKGGKGVWISSFLQTAGWPFIIFPLFVSY  102

Query  787  LrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
            + RR   S    +TK + +TP LFI+ A+IG+L GL ++L  YGV+ LPVSTS+LI+++Q
Sbjct  103  IHRR---SKNAGSTKLYYITPRLFIACAVIGVLTGLDDFLAAYGVSLLPVSTSALIIATQ  159

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            L FTA FA+ LVKQ FT F+VN+I LL+ GAVVL L A +DRP  E+N +Y  GF +TLG
Sbjct  160  LGFTAGFAYVLVKQKFTPFTVNAIFLLSIGAVVLVLHASSDRPPHETNGQYLSGFFMTLG  219

Query  427  SAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREA  248
            ++ALYG ++PL+EL Y KAN  I Y LV+E Q+V+S  AT FC+ GM ++ DF  IPREA
Sbjct  220  ASALYGFVLPLIELTYKKANQTITYTLVMEMQLVISFFATAFCTTGMLLHKDFAAIPREA  279

Query  247  REFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFH  68
             EFELG AKYY++++ + I +Q F +GA+GV+  GSSLLS +I   LLPVTE LAV  +H
Sbjct  280  SEFELGKAKYYVVLMVNAIFWQLFFMGAVGVVFCGSSLLSGIIIATLLPVTETLAVFFYH  339

Query  67   EKFQPEKGVSLFLCLWGFVSYF  2
            EKF+ EKG+SL L LWGF+ YF
Sbjct  340  EKFRVEKGISLVLSLWGFMFYF  361



>emb|CDY17197.1| BnaA05g09910D [Brassica napus]
Length=351

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 179/322 (56%), Positives = 241/322 (75%), Gaps = 2/322 (1%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
            KM+T+ ++ N I+LAIGNCGGPL+ RLYF  GG R+WFS++LQT+  P++ +PLL S+L 
Sbjct  2    KMKTVLVIINCIILAIGNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFLT  61

Query  781  rrrrRSDVDS-NTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            R R++ + +   T  FL+ P LF++  ++GLL+G  NYLY YG+A LPVSTSSLI+SSQL
Sbjct  62   RHRQQQEQEEPKTTLFLIKPPLFLASVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQL  121

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAFF+VKQ FT F++N++VLLT GA  L L A  D+   E+ KEY +GFV+T+ +
Sbjct  122  AFTAFFAFFMVKQRFTPFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFVMTVAA  181

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A LY  ++PLVEL Y KA+  I Y LVLE Q+V+   AT FC VGM  + DF+ + REAR
Sbjct  182  AVLYAFVLPLVELAYKKASQRISYTLVLEMQLVLCFVATCFCLVGMLADGDFKELGREAR  241

Query  244  EFELGAAKYYILVIC-SGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFH  68
            EF+LG +K+Y LV+  + +I+Q F +G++G+I   SSL+S V+ + LLP+TE+LAV+ F 
Sbjct  242  EFKLGGSKHYCLVVAFTAVIWQGFFLGSIGMIFCASSLVSGVLISALLPLTEVLAVLFFK  301

Query  67   EKFQPEKGVSLFLCLWGFVSYF  2
            EKFQ EKGVSLFL LWGFVSYF
Sbjct  302  EKFQAEKGVSLFLSLWGFVSYF  323



>ref|XP_010098679.1| Purine permease 3 [Morus notabilis]
 gb|EXB75582.1| Purine permease 3 [Morus notabilis]
Length=377

 Score =   314 bits (804),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 230/321 (72%), Gaps = 4/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
             + +   L+ N I+L IGNCGGPL++RLYF+ GG R+W S+ LQT  WP++ +P   S+ 
Sbjct  25   RQAQKALLVLNIIILGIGNCGGPLIMRLYFINGGKRVWLSSCLQTVGWPIILLPAAFSF-  83

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
                RR   +   KFF + P L ++ A++G+L GL  Y YTYGVA+LPVST++LI +SQL
Sbjct  84   ---YRRRRQNPAAKFFEIKPFLILAFAVVGILTGLNAYSYTYGVARLPVSTAALITASQL  140

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FA+ LVKQ FTA+S+N++ LLTAG  VL L    DRP GES+KEY +GF++++G+
Sbjct  141  AFTAAFAYLLVKQKFTAYSLNAVALLTAGGAVLALHTSGDRPEGESSKEYLMGFLMSVGA  200

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A +YG I+PL+EL Y KA   + Y LVLE QMV+   AT FC VGM IN DFQ +PREA+
Sbjct  201  ALIYGFILPLMELAYKKAKQELTYSLVLEVQMVMCFFATAFCIVGMIINKDFQAVPREAK  260

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            +FELG  KYY++++CS II+Q F +GA+GV+   SSLLS ++  VLLPVTE+  VI + E
Sbjct  261  KFELGETKYYVVLVCSAIIWQGFFLGAVGVVYCASSLLSGIVIAVLLPVTEVFGVIFYKE  320

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
             F  EKG+SL L LWGF SYF
Sbjct  321  SFPAEKGLSLVLSLWGFASYF  341



>ref|XP_004252714.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=356

 Score =   313 bits (802),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 177/320 (55%), Positives = 240/320 (75%), Gaps = 3/320 (1%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
             M+   L+ N +LL++G CGGPL++RLYF+ GG R+WF++WLQT  WP+  IPL+I Y  
Sbjct  11   NMKRFLLIINCLLLSVGVCGGPLMMRLYFVEGGLRIWFNSWLQTGGWPLTIIPLVILYFY  70

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            RR+      S+TK +  TP +FI+  +IG+  G   YLY++G +KLPVSTSSL++++QLA
Sbjct  71   RRKIEG---SDTKLYYTTPRIFIASFVIGIFTGFDAYLYSWGGSKLPVSTSSLLIAAQLA  127

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTA+ A+F+VK  FT++S+N++VLLT GAV+LG+R+  DRP G ++KEY +GF++TL +A
Sbjct  128  FTAIGAYFIVKIKFTSYSINAVVLLTLGAVLLGIRSNGDRPEGVTSKEYVIGFIMTLLAA  187

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
            ALYGLI+P +EL+Y KA   I   LVLE QMV+  A+T FC++GM  N DFQ I RE ++
Sbjct  188  ALYGLILPCIELMYLKAKQAITATLVLEIQMVMCFASTAFCTIGMIANKDFQAISRETKK  247

Query  241  FELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEK  62
            F LG A+YYI+VI S II+Q F +GA+GVI   SSL+S V+  VLLP+TE+L VI F EK
Sbjct  248  FNLGEARYYIVVIWSAIIWQCFFVGAVGVIYLSSSLMSGVLIAVLLPITEILGVIFFDEK  307

Query  61   FQPEKGVSLFLCLWGFVSYF  2
            F  EKG+SLFL LWGFVSYF
Sbjct  308  FSSEKGLSLFLSLWGFVSYF  327



>ref|XP_009765499.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   312 bits (800),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 179/321 (56%), Positives = 244/321 (76%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              MR I LL N ++LA+G CGGPL++RLY++ GG+R+WFS+WLQTA WP   IPL I Y 
Sbjct  8    TTMRKILLLINCLVLAVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILYF  67

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR+  S   S+ K + +TP +FI+  +IG++ G+ ++LY++G +KLPVSTSSL++++QL
Sbjct  68   YRRKTES---SSAKLYFITPRIFIASFIIGIVTGVDDFLYSWGGSKLPVSTSSLLLAAQL  124

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA+ AFF+VK  FT +S+N++VLLT GAV+LG+R+  DRP G ++K Y LGF++TL +
Sbjct  125  AFTAIGAFFIVKLKFTPYSINAVVLLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTLLA  184

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG+I+P +ELIY KA   I   LVLE QMV+  AAT+FC+VGM  N+DFQ I REA+
Sbjct  185  AALYGVILPCIELIYLKAKQAITATLVLEIQMVMCFAATVFCTVGMIANNDFQAISREAK  244

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            +F LG A+YY ++I + II+Q F +G +GVI   SSL+S V+  VLLPVTE+LAV+ F E
Sbjct  245  QFNLGEARYYTVIIWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRE  304

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
             F  EKG++LFL LWGFVSYF
Sbjct  305  NFSGEKGLALFLSLWGFVSYF  325



>ref|XP_010060066.1| PREDICTED: purine permease 1-like [Eucalyptus grandis]
Length=367

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 172/321 (54%), Positives = 231/321 (72%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
               + + L  N  +L++G CGGPLL+RLY+L GG+ +W S+WL+T  WP +F+ L ++YL
Sbjct  29   ETQKPLLLALNCAMLSLGTCGGPLLMRLYYLYGGSGVWLSSWLETGGWPAIFLALAVAYL  88

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            RRR   S    + +  LM P LF + A++G+L GL +YLY YGVA+LP STS+L++++QL
Sbjct  89   RRR---SAEGPSARLVLMDPFLFAASAVVGVLTGLDDYLYAYGVARLPASTSALLIATQL  145

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAF LV+Q FT++S+NS+ LLT  A VL L A +DRPAGES++EY  GF +TLG+
Sbjct  146  AFTAGFAFLLVRQQFTSYSINSVYLLTVAAGVLALNASSDRPAGESDQEYYAGFFMTLGA  205

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG ++PLVEL Y KA   + Y LVLE Q+V+   AT FC+VGM +N DFQ IP EA+
Sbjct  206  AALYGFVLPLVELTYKKAKQAVTYSLVLEIQLVMCFFATAFCTVGMLVNKDFQAIPTEAK  265

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
             +ELG A YY++++ + I +QFF +G +GVI   SSL S ++  VLLPVTE+LA+I F E
Sbjct  266  NYELGEALYYVVLVGNAIAWQFFFLGVIGVIFCASSLFSGIMIAVLLPVTEILAIICFRE  325

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
             FQ  KGVSL L LWG  SYF
Sbjct  326  TFQAAKGVSLALSLWGLASYF  346



>ref|XP_006357924.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=355

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 182/321 (57%), Positives = 238/321 (74%), Gaps = 4/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            ++M+ I L+ N+I LA+G CG PL++RLYF++GG R+W S WLQT AWP+  IPL ISYL
Sbjct  11   SRMKKILLIINSIFLAVGICGAPLIIRLYFIKGGKRIWLSCWLQTVAWPINLIPLAISYL  70

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             R     + ++++K  LMTP +F++   IG+L G  NY Y YGVA+LPVSTS L+ S+QL
Sbjct  71   YR----RNNNNSSKLILMTPHIFMATIGIGILQGFSNYSYAYGVAELPVSTSGLLCSTQL  126

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAF +V+  FT++SVNS+ LLT GAV+L L +G DRP GES K Y LGF++TL +
Sbjct  127  AFTAFFAFIIVRLKFTSYSVNSVFLLTIGAVILALHSGGDRPEGESKKLYILGFIMTLAA  186

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AAL GLI PLVELIY KA   I Y  VLEFQ+V    ATLF ++GM IN+DFQ I  EA+
Sbjct  187  AALAGLIFPLVELIYKKAQQAITYTFVLEFQIVYCFVATLFSTIGMIINNDFQAISGEAK  246

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
             FELG  +YY+++I S II+QF+ +G++GVI   SSL+  ++ +VLLP+TE+LAVIL+ E
Sbjct  247  TFELGEGRYYVVIILSAIIWQFYSLGSIGVIYSASSLVCGILISVLLPLTEVLAVILYRE  306

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
             F  EKG+SL L LWGFVSYF
Sbjct  307  NFSAEKGISLALSLWGFVSYF  327



>ref|XP_007042880.1| Purine permease 3 [Theobroma cacao]
 gb|EOX98711.1| Purine permease 3 [Theobroma cacao]
Length=419

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 176/319 (55%), Positives = 239/319 (75%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++   L+ N  LLA+GN GGPL++RLYFL+GG  +W S+ L+TA WP + +PL  SYL R
Sbjct  86   LKRSLLVLNCALLALGNVGGPLIMRLYFLKGGKGVWTSSCLETAGWPFMVMPLTFSYLYR  145

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RR+       T+ F + P LF+  A++GLL G+ ++LY YGVA+LPVSTS+LI+S+QLAF
Sbjct  146  RRKEGPA---TELFFIKPPLFLVSAVVGLLTGVDDFLYAYGVARLPVSTSALIISTQLAF  202

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FAF LVKQ FT+F++NS+ LLT GAVVL L+  +DRPA ESN++Y LGF +TL ++ 
Sbjct  203  TAAFAFLLVKQKFTSFTINSVFLLTVGAVVLALQTSSDRPANESNRQYYLGFFMTLAASM  262

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG ++P +EL Y KA   I Y LV+E QMV+S +AT+FC++GM  + +F+ IPREA +F
Sbjct  263  LYGFVLPAIELTYKKAKQTITYSLVMEMQMVMSFSATVFCTIGMLFHKEFEAIPREASKF  322

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG + YY++++ S I++QFF +GA+GVI  GSSLLS +I   LLPVTE LAV+ FHEKF
Sbjct  323  ELGQSTYYLVILLSAILWQFFFMGAVGVIFSGSSLLSGIIIAALLPVTESLAVLFFHEKF  382

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EK +S+ L LWG +SYF
Sbjct  383  QVEKAISVVLSLWGSLSYF  401



>ref|XP_008446590.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=366

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 180/327 (55%), Positives = 239/327 (73%), Gaps = 8/327 (2%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            MR   L+FN  LLA+G CGGPL++RLYFL GG R+W S++LQT   P++FIPLLISY+ R
Sbjct  11   MRRPLLVFNCFLLAVGTCGGPLIMRLYFLHGGNRVWLSSFLQTGGCPIIFIPLLISYIHR  70

Query  778  rrrR--------SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSL  623
            RRR         S+  ++T+   M P LF++ ++IG++ G +++LY YGVA+LPVSTS+L
Sbjct  71   RRRPRAQYSLNPSEPTNSTEMIFMKPRLFLASSVIGIITGFVDFLYAYGVAQLPVSTSAL  130

Query  622  IVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGF  443
            I + QLAFTA FAF+LVKQ FT +S+N++VL+TAG  +L L    DR AGE+N++Y  GF
Sbjct  131  IRACQLAFTAGFAFWLVKQKFTPYSINAVVLVTAGGAILALHTSGDRRAGEANRDYIAGF  190

Query  442  VLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQV  263
            + T+ +A +YG I+PLVEL Y +A   I Y LVLE Q  +SL ATL C++ M IN+DFQV
Sbjct  191  LTTVAAAVVYGFILPLVELSYKRARQQITYTLVLEVQFFMSLFATLVCTIAMVINNDFQV  250

Query  262  IPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLA  83
            IP EA  F LG AKYY++++ S II+Q F +G +GVI   SS  S ++  VLLPVTE+LA
Sbjct  251  IPTEAEAFGLGKAKYYVILVLSAIIWQSFFLGVVGVIFCSSSFFSEIVIAVLLPVTEILA  310

Query  82   VILFHEKFQPEKGVSLFLCLWGFVSYF  2
            VI+F+EKFQ EK +SL L LWGFVSYF
Sbjct  311  VIIFNEKFQAEKTISLILNLWGFVSYF  337



>ref|XP_006305203.1| hypothetical protein CARUB_v10009570mg [Capsella rubella]
 gb|EOA38101.1| hypothetical protein CARUB_v10009570mg [Capsella rubella]
Length=355

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 187/323 (58%), Positives = 238/323 (74%), Gaps = 4/323 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+   L+ N I+LAIG CGGPLL RLY+  GG R+WF ++L TA +P++ IPL +S+L R
Sbjct  1    MKYGLLIINCIILAIGTCGGPLLTRLYYNNGGKRIWFMSFLSTAGFPIILIPLFVSFLNR  60

Query  778  rrrRSDVDSN---TKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
            RR      +N   T+ FLM   LF++  +IGLL GL NYLY+YG+A LPVSTSSLIV +Q
Sbjct  61   RRCNRKNVANAAKTELFLMETPLFVASIVIGLLSGLDNYLYSYGLAYLPVSTSSLIVGTQ  120

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            LAF ALF+F LVKQ FT FS+N++VLLT G  +L L +  D+PA ES++EY +GF++TL 
Sbjct  121  LAFNALFSFLLVKQKFTPFSINAVVLLTVGTGILALHSDGDKPANESHREYVIGFLMTLI  180

Query  427  SAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREA  248
            +A LY  I+PLVEL Y KA   I + LVLE QMV+ LAAT FC VGMFI  DF+VI +EA
Sbjct  181  AAVLYAFILPLVELTYKKARQEITFQLVLEIQMVMCLAATGFCVVGMFIVGDFKVIAKEA  240

Query  247  REFELGAAK-YYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILF  71
            REF++G    YY L++ +GII Q F +GA+GV+   SSL S V+ +VLLPVTE+LAV+ F
Sbjct  241  REFKIGGPVFYYALIVITGIIMQGFSLGAIGVVFCASSLASGVLISVLLPVTEVLAVVCF  300

Query  70   HEKFQPEKGVSLFLCLWGFVSYF  2
             EKFQ EKGVSLFL +WGFVSYF
Sbjct  301  REKFQAEKGVSLFLSMWGFVSYF  323



>gb|KDP40942.1| hypothetical protein JCGZ_24941 [Jatropha curcas]
Length=355

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 232/311 (75%), Gaps = 3/311 (1%)
 Frame = -1

Query  934  NTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVD  755
            N  +LAIGNCGGPL+ RLYFL GG  +W S++LQTA WP+V  PL++SY+ RR   S+  
Sbjct  29   NGAMLAIGNCGGPLIQRLYFLEGGKAVWISSFLQTAGWPLVLFPLIVSYMYRR---SNKG  85

Query  754  SNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffL  575
            S TK   ++P LF++ A+IGLL GL ++L  YGV+ LPVSTS+LI+++QL FTA FA+ L
Sbjct  86   SRTKLIYISPRLFLACAVIGLLTGLDDFLAAYGVSLLPVSTSALIIATQLGFTAGFAYIL  145

Query  574  VKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPL  395
            VKQ FT F++N+I LL+ GAVVL + A +DRP  E+ ++Y LGF +TLG++ALYG ++PL
Sbjct  146  VKQKFTPFTINAIFLLSIGAVVLVIHASSDRPDHETTEKYLLGFFMTLGASALYGFVLPL  205

Query  394  VELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYY  215
            +EL Y KA   I Y LV+E Q+V+S  AT FC++GM ++ DF+ IPREA EFELG  KYY
Sbjct  206  IELTYKKAKQTITYTLVMEMQIVISFFATGFCAIGMLLHKDFEAIPREASEFELGRVKYY  265

Query  214  ILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSL  35
            ++ + + + +Q F +GA+GV+  GSSLLS +I   LLPVTE L V+ +HEKF  EKG+SL
Sbjct  266  VVNVFTAVFWQLFFMGAVGVVFCGSSLLSGIIIATLLPVTESLGVMFYHEKFHFEKGISL  325

Query  34   FLCLWGFVSYF  2
             L LWGF+SYF
Sbjct  326  VLSLWGFISYF  336



>emb|CDY35722.1| BnaC03g58430D [Brassica napus]
Length=354

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 186/323 (58%), Positives = 238/323 (74%), Gaps = 4/323 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+   ++ N ++L IG CGGPLL RLY+  GG R+WF ++L TA +PV+ IPL  S+L R
Sbjct  1    MKNGLIIINCVILTIGTCGGPLLTRLYYTNGGKRIWFMSFLSTAGFPVILIPLFFSFLSR  60

Query  778  r---rrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
            R   R  S+    TK  LM   LFI+  +IGLL GL NYLY YG+A LPVSTSSLI+ +Q
Sbjct  61   RNHNRNNSETAEKTKLILMETPLFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQ  120

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            LAF ALFAFF+VKQ FT FS+N++VLLT G VVL L +  D+PA E++KEY +GF++T+ 
Sbjct  121  LAFNALFAFFMVKQKFTPFSINAVVLLTVGIVVLALHSNGDKPANETHKEYVVGFLMTVI  180

Query  427  SAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREA  248
            +A LY  I+PLVE  Y KA   I + LVLE QMV+ +AAT FC VGM I+ DF+VI REA
Sbjct  181  AAVLYAFILPLVEFTYKKARQEITFPLVLEIQMVMCIAATCFCVVGMIIDGDFKVISREA  240

Query  247  REFEL-GAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILF  71
            REF++ G+A YY L++ +GI++Q F +GA+GV+   SSL S V+ +VLLPVTE+LAVI F
Sbjct  241  REFKIGGSAFYYTLIVITGIVWQGFFLGAIGVVFCASSLASGVLISVLLPVTEVLAVICF  300

Query  70   HEKFQPEKGVSLFLCLWGFVSYF  2
             EKFQ EKGVSLFL +WGFVSYF
Sbjct  301  REKFQAEKGVSLFLSIWGFVSYF  323



>ref|XP_009611006.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 175/321 (55%), Positives = 243/321 (76%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              MR I L+ N ++LA+G CGGPL++RLY++ GG+R+W S+WLQTA WP+  IPL I Y 
Sbjct  8    TNMRRILLVINCLILAVGICGGPLMMRLYYVEGGSRVWLSSWLQTAGWPLTLIPLAILYF  67

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR+      SN KF+ +TP +FI+  +IG++ GL ++LY++G +KLPVSTSSL++++QL
Sbjct  68   YRRKVEG---SNAKFYFITPRIFIASFVIGVVTGLDDFLYSWGGSKLPVSTSSLLLAAQL  124

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFT++ AFF+VK  FT +S+N+++LLT GAV+LG+R+  DRP G ++K Y LGF++TL +
Sbjct  125  AFTSVGAFFIVKLKFTPYSINAVILLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTLLA  184

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG+I+P +ELIY KA   I   LVLE QMV+  AAT FC+VGM  N+DFQ + REA+
Sbjct  185  AALYGVILPCIELIYLKAKQVITATLVLEIQMVMCFAATAFCTVGMIANNDFQAMSREAK  244

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            +F LG A+YY +++ + II+Q F +G +GVI   SSL+S V+  VLLPVTE+LAV+ F E
Sbjct  245  QFNLGEARYYTVIVWTSIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRE  304

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
             F  EKG++LFL LWGFVSYF
Sbjct  305  NFSGEKGLALFLSLWGFVSYF  325



>ref|XP_009609429.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=359

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 184/326 (56%), Positives = 233/326 (71%), Gaps = 5/326 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            +KM+ + L+ N I+LA+G CG PLLLRLYF++GG R+W STWLQT AWP+ FIPL ISY 
Sbjct  7    SKMKKVLLVINCIILAVGTCGTPLLLRLYFIKGGNRIWLSTWLQTVAWPINFIPLAISYF  66

Query  784  rrrrrRSDVDSNT-----KFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLI  620
             RR+   + D N      K  LMTP +F +   IG+L G  NY Y+YG AK+PVSTS L+
Sbjct  67   YRRKININNDINNNNDNIKVILMTPRIFAATIGIGVLQGFANYFYSYGSAKVPVSTSGLL  126

Query  619  VSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFV  440
             ++QLAFTA FAF +VK  FT++SVN++ LLT GAV+L L +G D+P GE  KEY LGF+
Sbjct  127  FATQLAFTAGFAFLIVKLKFTSYSVNAVFLLTVGAVLLALHSGGDQPEGEPKKEYILGFI  186

Query  439  LTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVI  260
            + L +AAL GLI PLVELIY KA+  I Y LVLEFQ V    AT+  ++GM IN DFQ I
Sbjct  187  MILAAAALTGLIFPLVELIYKKAHQAITYTLVLEFQTVYCFVATIVATIGMIINKDFQAI  246

Query  259  PREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAV  80
              EA+EFELG  +YY L+I   II QF+ +G +GVI   SSL+S ++ +VLLP+TE+LAV
Sbjct  247  STEAKEFELGEGRYYNLIIWGAIILQFYFLGTIGVIYSASSLVSGILISVLLPITEVLAV  306

Query  79   ILFHEKFQPEKGVSLFLCLWGFVSYF  2
              + EKF  EKGVSL L LWGF+SYF
Sbjct  307  FFYGEKFSAEKGVSLALSLWGFLSYF  332



>ref|XP_008812219.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
 ref|XP_008812222.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=357

 Score =   310 bits (795),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 175/322 (54%), Positives = 234/322 (73%), Gaps = 6/322 (2%)
 Frame = -1

Query  967  CNKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISY  788
               +R   +  N  ++ IG  GGPLLLRLYFL+GG+R W S+WL+T  WP++FIPL ISY
Sbjct  18   SKHLRWFLMALNFAIMVIGTTGGPLLLRLYFLKGGSRKWLSSWLETGGWPLLFIPLAISY  77

Query  787  LrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
                  R      TK +LMTP LF++  ++GLLVGL ++LY YG++ LPVST+S++VS+ 
Sbjct  78   ----AHRRGGGGPTKLYLMTPPLFLACTVLGLLVGLDDFLYAYGMSCLPVSTASILVSTH  133

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            L FTALFAF +VKQ FT+FS N++VLL+ GAV+LGL A  DRP GESN  Y LGF +TL 
Sbjct  134  LGFTALFAFLIVKQKFTSFSTNAVVLLSIGAVILGLHASGDRPKGESNTLYYLGFAMTLA  193

Query  427  SAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREA  248
            +A LYG+++PLVEL Y KA   + Y LV+E Q+V+   AT+FC+VGM +N DFQ IP+EA
Sbjct  194  AAMLYGVVLPLVELTYAKAKQVVSYTLVMEMQLVMGFFATVFCTVGMLVNKDFQAIPKEA  253

Query  247  REFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFH  68
            R+F LG  +YY+L++ S +++QFF +G +G I YGS+LL+ +I   ++PVTE+LAVILFH
Sbjct  254  RDFGLGEVRYYVLLVWSALMWQFFYLGTVGAIFYGSALLAGIIIAAMIPVTEVLAVILFH  313

Query  67   EKFQPEKGVSLFLCLWGFVSYF  2
            E F   KGV+  L LWGF SYF
Sbjct  314  EPFSGGKGVA--LALWGFASYF  333



>ref|XP_003522775.1| PREDICTED: purine permease 1-like [Glycine max]
Length=357

 Score =   310 bits (795),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 227/305 (74%), Gaps = 0/305 (0%)
 Frame = -1

Query  916  IGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFF  737
            IG  GGPL++RLYFL GG R+W S++L+TA +P++ +PL +SY RRRR  +   S  K  
Sbjct  27   IGTSGGPLVMRLYFLHGGHRVWLSSFLETAGFPLMLLPLAVSYFRRRRTAAAGTSKPKLI  86

Query  736  LMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFT  557
             M P L  + A IG+L GL +YLY YGVA+LPVSTS+LI+++QL FTA FAF LV+Q FT
Sbjct  87   SMKPPLLAASAFIGILTGLDDYLYAYGVARLPVSTSALIIATQLGFTAFFAFLLVRQKFT  146

Query  556  AFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYN  377
            A+SVN++VLLT GA VL L    DRP GES KEY +GFV+T+ +AALYG I+PLVEL+Y 
Sbjct  147  AYSVNAVVLLTVGAGVLALHTSGDRPPGESVKEYVMGFVMTVIAAALYGFILPLVELVYK  206

Query  376  KANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICS  197
            K   P+ Y LV+E Q V+  +ATLFC +GM IN+DF+VIPREA++FE G   YY +++ S
Sbjct  207  KIKQPLTYSLVMEIQFVMCFSATLFCLLGMIINNDFKVIPREAKKFEHGEGSYYAVLVGS  266

Query  196  GIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWG  17
             I++Q F +GA+GVI   SSL S ++  VLLPVTE+LAVI + EKFQ EKGVSL L LWG
Sbjct  267  AILWQAFFLGAIGVIFCASSLFSGILIAVLLPVTEVLAVIFYKEKFQAEKGVSLLLSLWG  326

Query  16   FVSYF  2
             VSYF
Sbjct  327  MVSYF  331



>ref|XP_009109745.1| PREDICTED: purine permease 1 [Brassica rapa]
 emb|CDX90136.1| BnaA08g18480D [Brassica napus]
Length=352

 Score =   310 bits (795),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 185/321 (58%), Positives = 238/321 (74%), Gaps = 2/321 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+   ++ + ++L IG CGGPLL RLY+  GG R+WF ++L TA +PV+ +PL  S+L R
Sbjct  1    MKNGLIIISCVILTIGTCGGPLLTRLYYTNGGKRIWFMSFLSTAGFPVILVPLFFSFLSR  60

Query  778  rrrR-SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            R R  S+     K  LM   LFI+  +IGLL GL NYLY YG+A LPVSTSSLI+ +QLA
Sbjct  61   RNRNNSETAEKPKLILMETPLFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLA  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            F ALFAFF+VKQ FT FS+N++VLLT G VVL L +  D+PA E++KEY +GF++T+ +A
Sbjct  121  FNALFAFFMVKQKFTPFSINAVVLLTVGIVVLALHSSGDKPANETHKEYVVGFLMTVIAA  180

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LY  I+PLVEL Y KA   I + LVLE QMV+ LAAT FC VGM I+ DF+VI REARE
Sbjct  181  VLYAFILPLVELTYKKARQEITFPLVLEIQMVMCLAATCFCVVGMIIDGDFKVISREARE  240

Query  241  FEL-GAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            F++ G+A YY L++ +GI++Q F +GA+GV+   SSL S V+ +VLLPVTE+LAVI F E
Sbjct  241  FKIGGSAFYYTLIMITGIVWQGFFLGAIGVVFCASSLASAVLISVLLPVTEVLAVICFRE  300

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQ EKGVSLFL +WGFVSYF
Sbjct  301  KFQAEKGVSLFLSIWGFVSYF  321



>gb|EPS65699.1| hypothetical protein M569_09078, partial [Genlisea aurea]
Length=327

 Score =   309 bits (791),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 173/314 (55%), Positives = 234/314 (75%), Gaps = 4/314 (1%)
 Frame = -1

Query  943  LLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRS  764
            L+ N +LLA+G C GP+++RLYF+ GG+ +WFS+W +T  WPV+F+PL+ISYLRR     
Sbjct  1    LVLNCLLLAVGGCAGPMVMRLYFIHGGSLVWFSSWQETGGWPVIFVPLVISYLRRL----  56

Query  763  DVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfa  584
              ++N    L+   LF++ A+IG+L G+ NY+Y +G+ KLPVSTSSL++++QLAFTALF 
Sbjct  57   TAEANAAPVLINLRLFLAAAVIGVLTGVDNYIYAFGLEKLPVSTSSLVIATQLAFTALFG  116

Query  583  ffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLI  404
            F +VK  FTA+S+N++VLLT GA VL + A  DRPAGES   Y LGF LTLG+AALYG +
Sbjct  117  FLIVKLRFTAYSINAVVLLTVGAAVLAISASGDRPAGESRGAYWLGFFLTLGAAALYGFV  176

Query  403  MPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAA  224
            +PLVEL Y KAN  + Y LV+E Q+V+   AT FC+VGMF N +FQ I RE RE++LG+A
Sbjct  177  LPLVELAYRKANLEMTYTLVMEVQLVMCFFATAFCTVGMFFNKEFQKIRREEREYKLGSA  236

Query  223  KYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKG  44
             YY++V+ S + +Q F +GA+GVI Y SSL+S +I  + +PV ELL VI + EKF  +KG
Sbjct  237  TYYVVVVLSCLAWQGFFLGAIGVIHYSSSLVSGIIIAITIPVNELLGVIFYGEKFGSQKG  296

Query  43   VSLFLCLWGFVSYF  2
            VSL L LWGF+SYF
Sbjct  297  VSLGLSLWGFLSYF  310



>ref|XP_010939715.1| PREDICTED: purine permease 3-like [Elaeis guineensis]
Length=362

 Score =   310 bits (794),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 182/321 (57%), Positives = 235/321 (73%), Gaps = 2/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              +R   +  N  ++ IG    PLLLRLYFL+GG R W S+WLQT  WP++FIPL+ISY 
Sbjct  20   KHLRWFLMALNFTIMVIGTAVSPLLLRLYFLKGGTRKWLSSWLQTGGWPLLFIPLVISY-  78

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
               RRR      TK +L+TP LF+S  ++G LVGL ++LY YG++ LPVSTSS+++S+QL
Sbjct  79   -AHRRRCGGGRPTKLYLITPPLFLSCTVLGFLVGLDDFLYAYGMSYLPVSTSSILISTQL  137

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
             FTALFAFF+VKQ FT+FSVN++VLL+ GAV+LGL A  DRP GESN  Y  GF +TL +
Sbjct  138  GFTALFAFFIVKQKFTSFSVNAVVLLSIGAVILGLHASGDRPKGESNTLYYWGFFMTLAA  197

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A LYG I+PLVEL Y KA   + Y LV+E Q+V+   AT+FC+VGM +N+DF  IPREA+
Sbjct  198  AVLYGFILPLVELTYAKAKQVVSYTLVIEMQLVMGFFATVFCTVGMLVNNDFHAIPREAQ  257

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            E ELG  +YY L+I S I++QFF +G +G I YGS+LL+ +I  VL+PVTE+LAV+ FHE
Sbjct  258  ECELGELRYYELLIWSAILWQFFFLGTVGAIFYGSALLAGIIMAVLIPVTEVLAVVFFHE  317

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
             F   KGV+L L LWGFVSYF
Sbjct  318  PFSGGKGVALALALWGFVSYF  338



>ref|XP_009143832.1| PREDICTED: purine permease 2 isoform X1 [Brassica rapa]
Length=351

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 241/322 (75%), Gaps = 2/322 (1%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
            KM+T+ ++ N I+LAIGNCGGPL+ RLYF  GG R+WFS++LQT+  P++ +PLL S+L 
Sbjct  2    KMKTVLVIINCIILAIGNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFLT  61

Query  781  rrrrRSDVDS-NTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            R R++ + +   T  FL+ P LF++  ++GLL+G  NYLY YG+A LPVSTSSLI+SSQL
Sbjct  62   RHRQQQEQEEPKTTLFLIKPPLFLASVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQL  121

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTALFAFF+VKQ FT F++N++VLLT GA  L L A  D+   E+ KEY +GFV+T+ +
Sbjct  122  AFTALFAFFMVKQRFTPFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFVMTVAA  181

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A LY  ++PLVEL Y KA+  I Y LVLE Q+V+ + AT  C VGM  + DF+ + REAR
Sbjct  182  AVLYAFVLPLVELAYKKASQRISYTLVLEMQLVLCVVATCLCLVGMLADGDFKELGREAR  241

Query  244  EFELGAAKYYILVIC-SGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFH  68
            EF+LG +K+Y LV+  + +I+Q F +G++G+I   SSL+S V+ + LLP+TE+LAV+ F 
Sbjct  242  EFKLGGSKHYCLVVAFTAVIWQGFFLGSIGMIFCASSLVSGVLISALLPLTEVLAVLFFK  301

Query  67   EKFQPEKGVSLFLCLWGFVSYF  2
            EKFQ  KGVSLFL LWGFVSYF
Sbjct  302  EKFQAAKGVSLFLSLWGFVSYF  323



>ref|XP_006295883.1| hypothetical protein CARUB_v10025013mg [Capsella rubella]
 gb|EOA28781.1| hypothetical protein CARUB_v10025013mg [Capsella rubella]
Length=349

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 241/320 (75%), Gaps = 2/320 (1%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
            KM+T+ ++ N + LAIGNCGGPL++RLYF  GG R+WFS++LQT  +P++  PLL S+LR
Sbjct  3    KMKTVLVIVNCVFLAIGNCGGPLMIRLYFHNGGERIWFSSFLQTVGFPLILFPLLFSFLR  62

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            RRR   +    T FFLM P LFI+  ++GLL+G  NYLY+YG+A LPVST+SLI+S+QL 
Sbjct  63   RRRL--EEQEKTSFFLMKPRLFIASVVVGLLMGFDNYLYSYGLAYLPVSTASLIISAQLG  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTALFAFF+VKQ FT F++N+IVLLT GAVVL L + +D+ A E++KEY +GF++ +G+A
Sbjct  121  FTALFAFFMVKQKFTPFTINAIVLLTVGAVVLALNSESDKLANETHKEYVVGFLMVVGAA  180

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LY  I+PLVEL Y K+   I Y LVLEFQMV+   AT FC VGM    DF+VI REAR 
Sbjct  181  LLYAFILPLVELTYKKSRQRITYTLVLEFQMVLCFVATCFCLVGMLAAGDFKVIAREARG  240

Query  241  FELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEK  62
            F+LG + YY++++ + +I+Q F +GA+G+I   SSL+S ++ + LLPVT +LAVI F EK
Sbjct  241  FKLGESLYYVVIVFTAVIWQAFFVGAIGLIFCASSLVSGIMISALLPVTVILAVICFREK  300

Query  61   FQPEKGVSLFLCLWGFVSYF  2
            FQ  KGV+L L LWG VSYF
Sbjct  301  FQAGKGVALALSLWGSVSYF  320



>ref|XP_008812221.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=361

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 177/322 (55%), Positives = 231/322 (72%), Gaps = 2/322 (1%)
 Frame = -1

Query  967  CNKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISY  788
               +R   +  N  ++ IG+   PLLLRLYFL+GG+R W S WLQT  WP++FIPL ISY
Sbjct  18   SKHLRWFLMALNFAIMVIGSTVSPLLLRLYFLKGGSRKWLSGWLQTGGWPLIFIPLAISY  77

Query  787  LrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
                RR       TK +LMTP LF++  ++GLL+GL +YLY YG++ LPVSTSS+++S+Q
Sbjct  78   --AHRRGGGGGGGTKLYLMTPPLFLACTVLGLLIGLDDYLYAYGMSYLPVSTSSILISTQ  135

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            L FTALFAFF+VKQ FT+FS N++VLL+ GAV+LGL A  DRP GESN  Y LGF +TL 
Sbjct  136  LGFTALFAFFIVKQKFTSFSTNAVVLLSIGAVMLGLHASGDRPEGESNTLYYLGFAMTLA  195

Query  427  SAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREA  248
            +A LY  I+PLVEL Y KA   + Y LV+E Q+V+   AT+FC+VGM ++ DFQ I REA
Sbjct  196  AAVLYAFILPLVELTYAKAKQVVSYTLVMEMQLVMGFFATVFCTVGMLVSKDFQAISREA  255

Query  247  REFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFH  68
            R+F LG  +YY+L++ S I++QFF +G +G I YGS+LL+ +I  VL+PV E+LAVI FH
Sbjct  256  RDFVLGEVRYYVLLVWSAILWQFFFLGTVGAIFYGSALLAGIIIAVLIPVAEVLAVIFFH  315

Query  67   EKFQPEKGVSLFLCLWGFVSYF  2
            E F   KGV+L L LWG  SYF
Sbjct  316  ESFSGGKGVALVLALWGLASYF  337



>emb|CDP11456.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   308 bits (789),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 237/321 (74%), Gaps = 1/321 (0%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            N  R + L+ + IL+ +G CGGPL++RLYFL GG R+W + WLQTAAWP++ IPL+ SY 
Sbjct  8    NPTRKLLLMLSIILVTVGACGGPLIMRLYFLHGGKRIWLTGWLQTAAWPLILIPLVASYC  67

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR++  +  S TK  L+     ISG +IG LVGL N+LY++GV  LPVST+SLI+++QL
Sbjct  68   NRRKK-PEGGSPTKLVLIDLRTLISGVIIGCLVGLTNHLYSFGVGHLPVSTNSLILATQL  126

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
             FTA  AF LV Q F A++VN+IVLLT G+VVL + AG++RP GE NK Y LGF+LTL +
Sbjct  127  VFTAFSAFILVGQKFNAYTVNAIVLLTLGSVVLAIHAGSERPKGEKNKMYVLGFILTLAA  186

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AAL G ++PL+EL Y KA   I Y LV+EFQ VV ++AT+F +VGM +N+DF+ I +EAR
Sbjct  187  AALSGCLLPLIELTYMKAKQAISYTLVMEFQSVVCISATVFSTVGMLVNNDFKEISQEAR  246

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            E++LG  KYY++++   I++Q F +G  G+I   SSL S ++   LLP+TE+LAVI +HE
Sbjct  247  EYQLGETKYYLVLVWCAIVWQCFTVGFTGIIFCASSLFSGIMLAALLPITEVLAVIFYHE  306

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQ EKG++L L LWGF+S+F
Sbjct  307  KFQAEKGIALALSLWGFISHF  327



>ref|XP_010460601.1| PREDICTED: purine permease 1 [Camelina sativa]
Length=354

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 185/321 (58%), Positives = 239/321 (74%), Gaps = 2/321 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+   L+ N I+L IG CGGPLL RLY+  GG R+WF ++L TA  P++ IPLL+S+L R
Sbjct  1    MKYGLLIINCIILTIGTCGGPLLTRLYYNNGGKRIWFMSFLSTAGCPIILIPLLVSFLNR  60

Query  778  rrrRSDVD-SNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            R+R    + + T+ FLM   LF++  +IGLL+GL NYLY YG+A LPVSTSSLI+ +QLA
Sbjct  61   RKRNKAENVAKTELFLMETPLFVASIVIGLLIGLDNYLYAYGLAYLPVSTSSLIIGTQLA  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            F ALFAF LVKQ FT FSVN++VLLT G  +L L +  D+PA ES+KEY +GF++T+ +A
Sbjct  121  FNALFAFLLVKQKFTPFSVNAVVLLTVGTGILALHSDGDKPANESHKEYVVGFLMTVIAA  180

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LY  I+PLVEL Y KA   I + LVLE QMV+ L+AT FC VGMFI  DF+VI +EARE
Sbjct  181  VLYAFILPLVELTYKKARQEITFPLVLEIQMVMCLSATCFCVVGMFIVGDFKVIAKEARE  240

Query  241  FEL-GAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            F++ G+A YY L++ +GII+Q F +GA+G++   SSL S V+ +VLLPVTE+LAV+ F E
Sbjct  241  FKIGGSAFYYALIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFRE  300

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQ EK VSL L LWGFVSYF
Sbjct  301  KFQAEKCVSLLLSLWGFVSYF  321



>ref|XP_006410518.1| hypothetical protein EUTSA_v10017788mg [Eutrema salsugineum]
 gb|ESQ51971.1| hypothetical protein EUTSA_v10017788mg [Eutrema salsugineum]
Length=372

 Score =   308 bits (790),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 184/324 (57%), Positives = 245/324 (76%), Gaps = 3/324 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
             KM+T  ++ N ILLAIGNCGGPL+ RLY+  GG R+WFS++LQTA  P++F+PLL S+L
Sbjct  19   KKMKTALVIINCILLAIGNCGGPLITRLYYRNGGKRIWFSSFLQTAGCPIIFLPLLFSFL  78

Query  784  rrrrrRSDVD--SNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSS  611
            RRRRRR + +  + T FFL+ P LF +  +IGLL G  NYLY+YG+A LPVST+SLI+SS
Sbjct  79   RRRRRRKEEEEEAKTPFFLIKPPLFFASVVIGLLTGFDNYLYSYGLAYLPVSTASLIISS  138

Query  610  QlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTL  431
            QLAFTALFAFF+VKQ FT F +N++VLLT GA +L L    D+ A E++KEY +GF++T+
Sbjct  139  QLAFTALFAFFMVKQKFTPFVINAVVLLTLGAGILALHTDGDKLAKETHKEYVVGFLMTV  198

Query  430  GSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPRE  251
             +A LY  I+PLVEL Y KA   I Y LVLE QMV+   AT FC VGM  + DF+VI +E
Sbjct  199  AAAILYAFILPLVELTYKKARQQISYTLVLEIQMVLCFVATCFCLVGMLADGDFKVIAKE  258

Query  250  AREFELGAAKYY-ILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVIL  74
            AR+F+ G + YY ++V+ + II+Q F +G++G+I   SSL+S ++ + LLP+TE+LAV+ 
Sbjct  259  ARDFKHGGSSYYTVVVVFTAIIWQGFFLGSIGIIFCASSLVSGILISALLPLTEVLAVLC  318

Query  73   FHEKFQPEKGVSLFLCLWGFVSYF  2
            F EKFQ EKG+SLFL LWGF+SYF
Sbjct  319  FREKFQAEKGLSLFLSLWGFLSYF  342



>ref|XP_009605309.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score =   307 bits (786),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 176/321 (55%), Positives = 238/321 (74%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
             KMR I LL N ++LA+G CGGPL++RLY++ GG+R+W S+WLQT  WP+  IPL I Y 
Sbjct  8    TKMRRILLLVNCLILAVGVCGGPLMMRLYYVGGGSRVWLSSWLQTGGWPLTLIPLAILYF  67

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR       +N KF L+TP +FI   +IG+  G+ N+LY++G +KLPVSTSSL++++QL
Sbjct  68   YRR---KSEGANAKFCLITPQIFIVSFVIGVGTGIDNFLYSWGGSKLPVSTSSLLLAAQL  124

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
             FTA+ AFF+VK  FT +S+N+++LLT GAV+LG+R+  D+P G ++K Y LGF++TL +
Sbjct  125  GFTAVGAFFIVKLKFTPYSINAVILLTVGAVLLGIRSNGDKPEGVTSKAYVLGFIMTLLA  184

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG+I+P +ELIY KA   I   LVLE Q+V+  AAT FC++GM  N DFQ I REA 
Sbjct  185  AALYGVILPSIELIYLKAKQAITVTLVLEIQIVMCFAATAFCTIGMVANKDFQAISREAN  244

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            +F L  A+YY +++ + II+Q F +GA+GVI   S+L+S VI  VLLPVTE+LA++ F E
Sbjct  245  QFNLEEARYYTVIVWTAIIWQCFFVGAVGVIYCSSALMSGVIIAVLLPVTEVLAIVFFSE  304

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KF  EKGVSLFL LWGFVSYF
Sbjct  305  KFSGEKGVSLFLSLWGFVSYF  325



>ref|XP_009763953.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
 gb|ADP30799.1| nicotine uptake permease 2 [Nicotiana tabacum]
Length=352

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 243/319 (76%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            MR I LL + ++LA+G CGGPL++RLY++ GG+R+W S+WLQT  WP+ FIPL   Y  R
Sbjct  10   MRRILLLISCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTFIPLAFLYYYR  69

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            R+      SN KF+LMTP +FI+  +IG+  GL ++LY++G +KLPVSTSSL++++QLAF
Sbjct  70   RKIEG---SNAKFYLMTPRIFIAAFVIGIATGLDDFLYSWGGSKLPVSTSSLLLAAQLAF  126

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA+ AFF+VK   + FS+N++VLLT GAV+LG+R+  DRP G ++KEY +GF++TL +AA
Sbjct  127  TAVGAFFIVKLKLSPFSINAVVLLTVGAVLLGIRSNGDRPEGVTSKEYIIGFMMTLLAAA  186

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG+I+P +ELIY KA   I   LVLE QM++S AAT FC+VGM  N DFQ + REA++F
Sbjct  187  LYGVILPCIELIYMKAKQAITATLVLEIQMIMSFAATAFCTVGMIANKDFQAMSREAKQF  246

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG A+YY +++C+  I++ F +G +GVI   SSL+S V+  VLLPVTE+LAVI F EKF
Sbjct  247  NLGEARYYTVIVCTAAIWECFFVGIIGVIYCSSSLMSGVMIAVLLPVTEVLAVIFFKEKF  306

Query  58   QPEKGVSLFLCLWGFVSYF  2
              EKG++LFL LWGFVSYF
Sbjct  307  SGEKGLALFLSLWGFVSYF  325



>ref|XP_010266586.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=373

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 169/304 (56%), Positives = 225/304 (74%), Gaps = 2/304 (1%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFFL  734
            G  GGPLL+RLYF RGG R+W S+WL+T  WP+   PLL SYL RR +  +     + F 
Sbjct  44   GESGGPLLMRLYFNRGGNRIWLSSWLETGGWPIFLFPLLFSYLHRRSKLGE--QGARLFF  101

Query  733  MTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTA  554
            M P LF++ A +GLL GL++YLY YG+++LPVST SLI SSQLAF ALF+F LV+Q FT 
Sbjct  102  MKPRLFVASASLGLLTGLVDYLYAYGMSRLPVSTISLINSSQLAFNALFSFLLVRQRFTP  161

Query  553  FSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNK  374
            FS+NS+VLLT GA+VLGL + +DRP  E+  +Y +GF +++G+A LYGL++P+VE  Y +
Sbjct  162  FSINSVVLLTIGAIVLGLHSSSDRPKDEAKDQYYMGFFVSIGAAVLYGLLLPMVEFTYKR  221

Query  373  ANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICSG  194
            A   I Y LV+E QMV+S+ AT FC+VGM +N DF+ I  EARE ELG  KYY++++CS 
Sbjct  222  AKQAITYPLVMEIQMVMSIFATAFCTVGMLVNKDFKAIGSEAREHELGVVKYYVVLVCSA  281

Query  193  IIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGF  14
            I +QFF +GA+GVI Y SSL++ + +  LLP+ E+LAVI + EKF+ EKG+SL L LWGF
Sbjct  282  IFWQFFYLGAVGVIFYASSLVAGITSATLLPILEILAVIFYKEKFKGEKGISLTLALWGF  341

Query  13   VSYF  2
             SYF
Sbjct  342  TSYF  345



>ref|XP_004146629.1| PREDICTED: purine permease 3-like [Cucumis sativus]
Length=355

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 183/325 (56%), Positives = 239/325 (74%), Gaps = 6/325 (2%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            MR   L+FN  LLA+G CGGPLL+RLYFL GG R+W ST+L+T   P++FIPLLISY+ R
Sbjct  1    MRRTLLVFNCFLLAVGTCGGPLLMRLYFLHGGNRVWLSTFLETGGCPIIFIPLLISYIHR  60

Query  778  rrrR------SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIV  617
            RRRR      S+  ++T+   M   LF++  +IG++ G +++LY YGVA++PVSTS+LI 
Sbjct  61   RRRRAHSLNPSESTNSTEMIFMKSRLFLASGVIGIITGFVDFLYAYGVARIPVSTSALIR  120

Query  616  SSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVL  437
            + QLAFTA FAF+LVKQ FTA+S+NS+VL+TAG  +L L    DR AGESN+EY  GF+ 
Sbjct  121  ACQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILALHTSGDRRAGESNREYIEGFLT  180

Query  436  TLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIP  257
            T+ ++ +YG I+PLVEL Y KA   I Y LVLE Q+++SL ATL CS+ M IN+DFQ+I 
Sbjct  181  TVAASVVYGFILPLVELTYKKARQQITYTLVLEVQLIMSLFATLVCSIAMLINNDFQMIA  240

Query  256  REAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVI  77
             EA  F LG AKYY++++ S II+Q F +G +GVI   SS  S +I  VLLPVTE+LAV+
Sbjct  241  MEAEAFGLGKAKYYVILVLSAIIWQGFFLGVIGVIFSSSSFFSGIIIAVLLPVTEILAVV  300

Query  76   LFHEKFQPEKGVSLFLCLWGFVSYF  2
             F+EKFQ EK +SL L LWGFVSYF
Sbjct  301  TFNEKFQAEKTISLILNLWGFVSYF  325



>ref|XP_007042882.1| Purine permease 3 isoform 2 [Theobroma cacao]
 gb|EOX98713.1| Purine permease 3 isoform 2 [Theobroma cacao]
Length=338

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 170/319 (53%), Positives = 231/319 (72%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++   L+ N  LLA GN GGPL+++LYFL+GG  +W S+ L+TA WP + +PL  SYL R
Sbjct  5    LKRSLLVLNCALLAFGNVGGPLIMKLYFLKGGKGVWTSSCLETAGWPFMVMPLTFSYLYR  64

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            R         T+ F + P LF++ A+IGLL G+ ++LY YGVA+LPVST +LI+S+QLAF
Sbjct  65   R---RKEGPGTELFFIKPPLFLASAVIGLLTGVDDFLYAYGVARLPVSTLALIISTQLAF  121

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            T  FAF LVKQ FT+F++NS+ LL  GAVVL L   +D PA ESN++Y  GF +TL ++A
Sbjct  122  TVAFAFLLVKQKFTSFTINSVFLLNIGAVVLALHTSSDHPANESNRQYCSGFFMTLAASA  181

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG ++P +EL Y KA   I Y LV+E QMV+S +AT+FC++GM  + + + IPREA +F
Sbjct  182  LYGFVLPAIELTYKKAKQTISYSLVIEMQMVMSFSATVFCTIGMLFHKEVEAIPREASKF  241

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG + YY++++ S I++QFF +GA+GVI  GSSLLS +I   LLPVTE LAV+ FHEKF
Sbjct  242  ELGQSTYYLVILLSAILWQFFFMGAVGVIFSGSSLLSGIIIAALLPVTESLAVLFFHEKF  301

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EK +S+ L LWG +SYF
Sbjct  302  QVEKAISVVLSLWGSLSYF  320



>gb|KGN64615.1| hypothetical protein Csa_1G071290 [Cucumis sativus]
Length=366

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 183/325 (56%), Positives = 239/325 (74%), Gaps = 6/325 (2%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            MR   L+FN  LLA+G CGGPLL+RLYFL GG R+W ST+L+T   P++FIPLLISY+ R
Sbjct  12   MRRTLLVFNCFLLAVGTCGGPLLMRLYFLHGGNRVWLSTFLETGGCPIIFIPLLISYIHR  71

Query  778  rrrR------SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIV  617
            RRRR      S+  ++T+   M   LF++  +IG++ G +++LY YGVA++PVSTS+LI 
Sbjct  72   RRRRAHSLNPSESTNSTEMIFMKSRLFLASGVIGIITGFVDFLYAYGVARIPVSTSALIR  131

Query  616  SSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVL  437
            + QLAFTA FAF+LVKQ FTA+S+NS+VL+TAG  +L L    DR AGESN+EY  GF+ 
Sbjct  132  ACQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILALHTSGDRRAGESNREYIEGFLT  191

Query  436  TLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIP  257
            T+ ++ +YG I+PLVEL Y KA   I Y LVLE Q+++SL ATL CS+ M IN+DFQ+I 
Sbjct  192  TVAASVVYGFILPLVELTYKKARQQITYTLVLEVQLIMSLFATLVCSIAMLINNDFQMIA  251

Query  256  REAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVI  77
             EA  F LG AKYY++++ S II+Q F +G +GVI   SS  S +I  VLLPVTE+LAV+
Sbjct  252  MEAEAFGLGKAKYYVILVLSAIIWQGFFLGVIGVIFSSSSFFSGIIIAVLLPVTEILAVV  311

Query  76   LFHEKFQPEKGVSLFLCLWGFVSYF  2
             F+EKFQ EK +SL L LWGFVSYF
Sbjct  312  TFNEKFQAEKTISLILNLWGFVSYF  336



>ref|XP_009598031.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=353

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 241/321 (75%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              MR I LL + ++LA+G CGGPL++RLY++ GG+R+W S+WLQT  WP+  IPL I Y 
Sbjct  8    TNMRRILLLISCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTLIPLAILY-  66

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
                RR    SN KF+LMTP +FI+  +IG+  GL ++LY++G +KLPVSTSSL++++QL
Sbjct  67   --YYRRKTEGSNAKFYLMTPRIFIASFIIGVATGLDDFLYSWGGSKLPVSTSSLLLAAQL  124

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA+ AFF+VK   + FS+N++VLLT GAV+LG+R+  DRP G ++KEY +GF++TL +
Sbjct  125  AFTAVGAFFIVKLKLSPFSINAVVLLTVGAVLLGIRSNGDRPEGVTSKEYIIGFMMTLLA  184

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG+I+P +ELIY KA   I   LVLE QM++S AAT FC+VGM  N DFQ + REA+
Sbjct  185  AALYGVILPCIELIYMKAKQAITSTLVLEIQMIMSFAATAFCTVGMIANKDFQAMSREAK  244

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            +F LG A+YY +++C+  I+Q F +G +GVI   SSL+S V+  VLLPVTE+LAVI F E
Sbjct  245  QFNLGEARYYTVIVCTAAIWQCFFVGIIGVIYCSSSLMSGVMIAVLLPVTEVLAVIFFKE  304

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
             F  EKG++LFL LWGFVSYF
Sbjct  305  NFSGEKGLALFLSLWGFVSYF  325



>ref|XP_010244044.1| PREDICTED: purine permease 1-like [Nelumbo nucifera]
Length=357

 Score =   306 bits (784),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 235/321 (73%), Gaps = 2/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              ++   +  N  LLA+G CGGPLLLR YF+ GG R+W S+WL+T  WP+   PL + YL
Sbjct  16   KPLQKTLIFLNFTLLALGFCGGPLLLRQYFVXGGRRIWLSSWLETGGWPLFLFPLFVFYL  75

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            +RRRR+ + ++  +   M P LF++ A +G+L G+++Y Y YG+++LP ST++LI S+QL
Sbjct  76   QRRRRKGNQEA--RLLSMKPLLFVASAFLGILTGMIDYCYAYGMSRLPASTTALIGSTQL  133

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AF A+F+F +V+Q FT++S+N++VLLT GA+VLGL A  DRP  ES+ +Y +G  +TLG 
Sbjct  134  AFNAVFSFIIVRQRFTSYSINAVVLLTIGAIVLGLHASKDRPEKESSHQYYVGLFMTLGE  193

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG ++P VEL Y KA   I Y LV+E QMV+S+ ATLFC+VGM +N DFQ I REAR
Sbjct  194  AALYGFLLPXVELTYKKAKQAITYPLVMEIQMVMSIFATLFCTVGMIVNKDFQAISREAR  253

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            E+ELGA KYY++++   I +QF+ +GA+GV+   SSL+  + + VLLPV E+LAV+LF E
Sbjct  254  EYELGAVKYYVVLVWCAIFWQFYYLGAIGVVFVASSLVGGITSAVLLPVLEILAVVLFRE  313

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KF  EKG++L L LWGF SYF
Sbjct  314  KFTAEKGIALVLSLWGFTSYF  334



>ref|XP_009109746.1| PREDICTED: purine permease 1-like [Brassica rapa]
Length=356

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 230/323 (71%), Gaps = 4/323 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+   L+   I LAIG CGGPLL RLY+ +GG+R+WF ++L TA  P++ IPL +S+LRR
Sbjct  2    MKNGLLIIVCIFLAIGTCGGPLLTRLYYTKGGSRIWFMSFLATAGCPIILIPLYVSFLRR  61

Query  778  rrrR---SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
              R    S+     K F+M   LFI+  +IGLL+GL NYLY YG+A LPVSTSSLIV +Q
Sbjct  62   SNRNHNNSETAEKAKVFVMETPLFIASIVIGLLIGLDNYLYAYGLAYLPVSTSSLIVGTQ  121

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            LAF A+F+F +VKQ FT FS+N++VLLT G  +L L    DRPAG S KEY +GF+LTL 
Sbjct  122  LAFNAIFSFLMVKQKFTPFSINAVVLLTVGTGILALHTDRDRPAGVSKKEYVVGFLLTLI  181

Query  427  SAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREA  248
            +A LY  +MPLVEL Y K    I + LVLE QMV+ +A+T FC VGM +  DF  IPREA
Sbjct  182  AAVLYAFLMPLVELTYKKVRQEITFTLVLEMQMVMCVASTCFCLVGMVVKGDFVAIPREA  241

Query  247  REFELGAAK-YYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILF  71
            REF +G++  YY L++  GI++Q F +GALGV+   SSL S V  +VLLPVTE+LAV+ F
Sbjct  242  REFMIGSSLFYYTLIVVIGIVWQCFFLGALGVVYCASSLASGVFVSVLLPVTEVLAVVCF  301

Query  70   HEKFQPEKGVSLFLCLWGFVSYF  2
             EKFQ EKGV+L L LWGFVSYF
Sbjct  302  REKFQAEKGVALLLSLWGFVSYF  324



>gb|AES73112.2| purine permease-like protein [Medicago truncatula]
Length=370

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 170/330 (52%), Positives = 232/330 (70%), Gaps = 9/330 (3%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
             KM+   L+ N ++L++G C  PL++RLYF+ GG R+W S +LQTA +P++ IPL ISY+
Sbjct  11   KKMKRFLLVVNCLILSLGTCSAPLIMRLYFIHGGQRVWLSAFLQTAGFPLMLIPLAISYI  70

Query  784  rrr---------rrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVST  632
            +R             S          M P +F + A IG+L GL +YL+ YGVA+LPVST
Sbjct  71   KRHRLHHHPPPLTTISIAPEKLNIISMKPPIFFAAAFIGILTGLDDYLFAYGVARLPVST  130

Query  631  SSLIVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYG  452
            S+LI++SQL FTA FAF +VK+ FTAF+VN++VLLT GA VL +   +DRPAG S K+Y 
Sbjct  131  SALIIASQLGFTAFFAFLIVKEKFTAFTVNAVVLLTVGAGVLAMHTSSDRPAGVSAKQYW  190

Query  451  LGFVLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHD  272
            + F  T+ ++ALYG I+P VEL+Y K   P+ Y  V+EFQ V  + ATLFC++GM  N+D
Sbjct  191  ISFSTTVAASALYGFILPSVELVYKKIKQPVTYSFVMEFQFVTCMFATLFCAIGMIANND  250

Query  271  FQVIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTE  92
            F+VIP+EAR F LG + YY++++ S I++Q F +GA+GVI   SSLLS ++  VLLP+TE
Sbjct  251  FKVIPKEARNFGLGESTYYVVLVVSAIMWQAFFLGAIGVIFCASSLLSGILIAVLLPLTE  310

Query  91   LLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            +LAV+ + EKFQ EKGVSL L LWGFVSYF
Sbjct  311  VLAVVFYKEKFQAEKGVSLVLSLWGFVSYF  340



>ref|XP_010509839.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=351

 Score =   305 bits (782),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 178/320 (56%), Positives = 240/320 (75%), Gaps = 2/320 (1%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
            KM  + ++ N I LAIGNCGGPL++RLYF  GGAR+WFS++LQT   P++  PLL S+LR
Sbjct  4    KMNNVRVIINCIFLAIGNCGGPLMMRLYFHNGGARIWFSSFLQTVGCPLIIFPLLFSFLR  63

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            RRR   +    T  FLM P LFI+  ++GLL+G  NYLY+YG+A +PVST+SLI+S+QL 
Sbjct  64   RRRL--EEQEKTSLFLMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLG  121

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTALFAFF+VKQ FT F++N+IVLLT GAVVL + + +D+ A +++KEY + F++T+G+A
Sbjct  122  FTALFAFFMVKQKFTPFTINAIVLLTVGAVVLAINSDSDKLANDTHKEYVVAFLMTVGAA  181

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LY  I+PLVEL Y K+   + Y LVLEFQMV+   AT FC VGM +  DF+VI REAR+
Sbjct  182  LLYAFILPLVELSYKKSRQRVTYTLVLEFQMVLCFVATCFCFVGMLVAGDFKVIAREARD  241

Query  241  FELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEK  62
            F+LG + YY++V+ + +I+Q F +GA+G+I   SSL+S ++ + LLPVT +LAVI F EK
Sbjct  242  FKLGESLYYVVVVFTAVIWQAFFVGAIGLIFCASSLVSGIMVSALLPVTVVLAVICFQEK  301

Query  61   FQPEKGVSLFLCLWGFVSYF  2
            FQ  KGV+L L LWG VSYF
Sbjct  302  FQAGKGVALALSLWGSVSYF  321



>ref|XP_009603730.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=352

 Score =   305 bits (782),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 182/321 (57%), Positives = 244/321 (76%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              MR I LL N ++LA+G CGGPL++RLY++ GG+R+W S+WLQTA WP+  IPL I Y 
Sbjct  8    TNMRRILLLINCLILAVGICGGPLMMRLYYVEGGSRVWLSSWLQTAGWPLTLIPLAILYF  67

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR+      SN KF+ +TP +FI+  +IGL+ GL ++LY++G +KLPVSTSSL++++QL
Sbjct  68   YRRKIEG---SNAKFYFITPRIFIASFIIGLVTGLDDFLYSWGGSKLPVSTSSLLLAAQL  124

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA+ AFF+VK  FT +S+N++VLLT GAV+LG+R+  DRP G ++K Y LGF++TL +
Sbjct  125  AFTAVGAFFIVKLKFTPYSINAVVLLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTLLA  184

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG+I+P +ELIY KA   I   LVLE QMV+  AAT FC+VGM IN+DFQ I REA+
Sbjct  185  AALYGVILPCIELIYLKAKQAITATLVLEIQMVMCFAATAFCTVGMIINNDFQAISREAK  244

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            +F LG A+YY +VI + II+Q F +G +GVI   SSL+S V+  VLLPVTE+LAV+ + E
Sbjct  245  QFNLGEARYYTVVIWTAIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFYRE  304

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
             F  EKG++LFL LWGFVSYF
Sbjct  305  NFSGEKGLALFLSLWGFVSYF  325



>gb|KDP40961.1| hypothetical protein JCGZ_24960 [Jatropha curcas]
Length=472

 Score =   309 bits (791),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 171/311 (55%), Positives = 231/311 (74%), Gaps = 3/311 (1%)
 Frame = -1

Query  934  NTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVD  755
            N  +LAIGNCGGPL+ RLYFL+GG  +W S++LQTA WP+V  PL++SY+ RR   S+  
Sbjct  146  NGAMLAIGNCGGPLIQRLYFLKGGKAVWISSFLQTAGWPLVLFPLIVSYMYRR---SNKG  202

Query  754  SNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffL  575
            S TK   ++P LF++ A+IGLL GL ++L  YGV+ LPVSTS+LI+++QL FTA FA+ L
Sbjct  203  SRTKLIYISPRLFLACAVIGLLTGLDDFLTAYGVSLLPVSTSALIIATQLGFTAGFAYIL  262

Query  574  VKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPL  395
            VKQ FT F++N+I LL+ GAVVL + A +DRP  E+ ++Y LGF +TLG++ALYG ++PL
Sbjct  263  VKQKFTPFTINAIFLLSIGAVVLVIHASSDRPDHETTEKYLLGFFMTLGASALYGFVLPL  322

Query  394  VELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYY  215
            +EL Y KA   I Y LV+E Q+V+S  AT FC++GM ++ DF+ IPREA EFELG  KYY
Sbjct  323  IELTYKKAKQTITYTLVMEMQVVISFFATAFCAIGMLLHKDFEAIPREASEFELGRLKYY  382

Query  214  ILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSL  35
            ++ + + + +Q F +GA+GV+   SSLLS +I   LLPVTE L V+ +HEKF  EK +SL
Sbjct  383  VVNVFTAVFWQLFFMGAVGVVFCDSSLLSGIIIATLLPVTESLGVMFYHEKFHFEKAISL  442

Query  34   FLCLWGFVSYF  2
             L LWGFVSYF
Sbjct  443  VLSLWGFVSYF  453



>gb|ADP30798.1| nicotine uptake permease 1 [Nicotiana tabacum]
Length=353

 Score =   305 bits (780),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 177/321 (55%), Positives = 241/321 (75%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              MR I LL + ++LA+G CGGPL++RLY++ GG+R+W S+WLQT  WP+  IPL I Y 
Sbjct  8    TNMRRILLLISCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTLIPLAILY-  66

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
                RR    SN KF+LMTP +FI+  +IG+  GL ++LY++G +KLPVSTSSL++++QL
Sbjct  67   --YYRRKTEGSNAKFYLMTPRIFIASFVIGVATGLDDFLYSWGGSKLPVSTSSLLLAAQL  124

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA+ AFF+VK   + FS+N++VLLT GAV+LG+R+  DRP G ++KEY +GF++TL +
Sbjct  125  AFTAVGAFFIVKLKLSPFSINAVVLLTVGAVLLGIRSNGDRPEGVTSKEYIIGFMMTLLA  184

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG+I+P +ELIY KA   I   LVLE QM++S AAT FC+VGM  N DFQ + REA+
Sbjct  185  AALYGVILPCIELIYMKAKQAITSTLVLEIQMIMSFAATAFCTVGMIANKDFQAMSREAK  244

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            +F +G A+YY +++C+  I+Q F +G +GVI   SSL+S V+  VLLPVTE+LAVI F E
Sbjct  245  QFNVGEARYYTVIVCTAAIWQCFFVGIIGVIYCSSSLMSGVMIAVLLPVTEVLAVIFFKE  304

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
             F  EKG++LFL LWGFVSYF
Sbjct  305  NFSGEKGLALFLSLWGFVSYF  325



>ref|XP_010469434.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=350

 Score =   305 bits (780),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 178/320 (56%), Positives = 241/320 (75%), Gaps = 2/320 (1%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
            KM+++ ++ N + LAIGNCGGPL++RLYF  GG R+WFS++LQT   P++  PLL S+LR
Sbjct  3    KMKSVRVIINCMFLAIGNCGGPLMMRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLR  62

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            RRR        T  FLM P LFI+  + GLL+G  NYLY+YG+A +PVST+SLI+S+QL 
Sbjct  63   RRRLVEQ--EKTSLFLMKPPLFIASVVAGLLMGFDNYLYSYGLAYIPVSTASLIISAQLG  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTALFAFF+V+Q FT F++N+IVLLT GAVVL + + +D+ A E++KEY +GF++T+G+A
Sbjct  121  FTALFAFFMVRQKFTPFTINAIVLLTVGAVVLAINSDSDKLANETHKEYVVGFLMTVGAA  180

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LY  I+PLVEL Y K+   + Y LVLEFQMV+  AAT FC VGM +  DF+VI REAR+
Sbjct  181  LLYAFILPLVELSYKKSRQGVTYTLVLEFQMVLCFAATCFCLVGMLVAGDFKVIAREARD  240

Query  241  FELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEK  62
            F+LG + YY++V+ + +I+Q F +GA+G+I   SSL+S ++ + LLPVT +LAVI F EK
Sbjct  241  FKLGESLYYVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEK  300

Query  61   FQPEKGVSLFLCLWGFVSYF  2
            FQ  KGV+L L LWG VSYF
Sbjct  301  FQAGKGVALALSLWGSVSYF  320



>ref|XP_009380886.1| PREDICTED: purine permease 3-like [Musa acuminata subsp. malaccensis]
Length=365

 Score =   305 bits (781),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 172/321 (54%), Positives = 234/321 (73%), Gaps = 3/321 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            +R   ++ N +L+A+GN G PLLLRLY+  GG R W S+WL+TA WP +F+PLLI+YL R
Sbjct  23   LRRALIVLNCVLMALGNTGSPLLLRLYYRSGGKRQWLSSWLETAGWPFIFVPLLITYLHR  82

Query  778  rrrRSDVDSN---TKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
            RRR      N   TK F +TP LF++ A IGL+ G  ++LY YG++ LPVSTSSL++S+Q
Sbjct  83   RRRCQLRPGNCHPTKLFFITPRLFLACAFIGLITGFDDFLYAYGLSFLPVSTSSLLISTQ  142

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            LAFTA FAF +VKQ FT +S+NS+ LLT GAVVLGL   +DRP   +  +Y LGF+LTLG
Sbjct  143  LAFTAFFAFLIVKQKFTPYSINSVALLTVGAVVLGLHVSSDRPDNVTRGQYHLGFILTLG  202

Query  427  SAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREA  248
            +AALYGLI+PLVEL+Y+K+   I Y LV+E Q+V+   AT FC+VGM +N DFQ IPREA
Sbjct  203  AAALYGLILPLVELMYSKSKQAITYTLVMEMQLVMGFFATAFCTVGMLVNKDFQAIPREA  262

Query  247  REFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFH  68
            R FELG  +YY++++ S + +QFF +G +G+I   ++LL+ ++  + +PVTE+L V+ F 
Sbjct  263  RHFELGEFRYYVVLVWSAVFWQFFFLGTVGIIFCVNTLLAGILIALFIPVTEVLGVVFFK  322

Query  67   EKFQPEKGVSLFLCLWGFVSY  5
            E F  EKG++L L LWG  SY
Sbjct  323  ENFSSEKGIALVLSLWGLASY  343



>ref|XP_010499327.1| PREDICTED: purine permease 1-like isoform X1 [Camelina sativa]
 ref|XP_010499328.1| PREDICTED: purine permease 1-like isoform X2 [Camelina sativa]
Length=354

 Score =   305 bits (780),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 236/321 (74%), Gaps = 2/321 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+   L+ N I+L IG CGGPLL RLY+  GG R+WF ++L TA  P++ IPLL S+L R
Sbjct  1    MKYGLLIINCIILTIGTCGGPLLTRLYYNNGGKRIWFMSFLSTAGCPIILIPLLFSFLNR  60

Query  778  rrrRSDVD-SNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            R R    + + T+ FLM   LFI+  +IGLL+GL NYLY YG+A L VSTSSLI+ +QLA
Sbjct  61   RNRNKAENVAKTELFLMETPLFIASIVIGLLIGLDNYLYAYGLAYLQVSTSSLIIGTQLA  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            F ALFAF LVKQ FT FSVN++VLLT G  +L L +  D PA ES+KEY +GF++T+ +A
Sbjct  121  FNALFAFLLVKQKFTPFSVNAVVLLTVGTGILALHSDGDLPANESHKEYVVGFLMTVIAA  180

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LY  I+PLVEL Y KA   I + LVLE QMV+ L+AT FC VGMFI  DF+VI +EARE
Sbjct  181  VLYAFILPLVELTYKKARQEITFPLVLEIQMVMCLSATCFCVVGMFIVGDFKVIAKEARE  240

Query  241  FEL-GAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            F++ G+A YY L++ +GII+Q F +GA+G++   SSL S V+ +VLLPVTE+LAV+ F E
Sbjct  241  FKIRGSAFYYALIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFRE  300

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQ EKGVSL L LWGFVSYF
Sbjct  301  KFQAEKGVSLLLSLWGFVSYF  321



>ref|XP_010549316.1| PREDICTED: purine permease 3 [Tarenaya hassleriana]
Length=340

 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 172/319 (54%), Positives = 234/319 (73%), Gaps = 4/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M T  ++ N I+LAIGNCGGPL++RLYF  GG R+WFS++L+TA +PV+ +PLL  YL+R
Sbjct  1    MATAMVIINCIILAIGNCGGPLIMRLYFNNGGNRIWFSSFLETAGFPVILLPLLFFYLQR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
                   D+ T FFLM P L ++  ++G+L G  NYLY YG+A LPVST++LI++SQLAF
Sbjct  61   ----RRTDTKTSFFLMKPRLLMASIIVGVLSGFDNYLYAYGLAFLPVSTAALIIASQLAF  116

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
             A+F+FF+VK  FT F++N++VLLT GA VLG+    D+P  ES+K+Y +GF++  G+A 
Sbjct  117  IAVFSFFMVKHKFTHFTINAVVLLTIGAAVLGMHTEADKPVEESHKQYVMGFIMAAGAAI  176

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            +Y  I+PLVEL Y KA  PI Y LVLE QMV+   A+  C  GM+   DF+ +P EA  F
Sbjct  177  MYAFILPLVELSYRKARQPITYTLVLEVQMVLCFFASCVCIGGMYFAGDFKALPVEADNF  236

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            +LG + +Y++VI S II+Q F +GA+G+I   SSL+S ++ +VLLP+TE+LAVI+FHEKF
Sbjct  237  KLGTSMFYLVVIFSAIIWQGFFLGAIGLIFSASSLVSGIMISVLLPITEVLAVIIFHEKF  296

Query  58   QPEKGVSLFLCLWGFVSYF  2
             PEK VSL L LWGFVSYF
Sbjct  297  PPEKAVSLVLSLWGFVSYF  315



>gb|KFK44702.1| hypothetical protein AALP_AA1G292000 [Arabis alpina]
Length=354

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 180/322 (56%), Positives = 233/322 (72%), Gaps = 3/322 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+   L+ N I L IG CGGPLL RLY+  GG R+WF ++L TA +PV+ IPLL S+L R
Sbjct  1    MKNGLLIINCIFLVIGTCGGPLLTRLYYTNGGKRIWFMSFLSTAGFPVILIPLLFSFLHR  60

Query  778  rrrRSDVDSNTK--FFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            R R    ++  K    LM   LFI+  +IGLL GL NYLY YG+A LPVSTSSLI+ +QL
Sbjct  61   RNRTETTENAKKEGIILMETPLFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQL  120

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AF ALFAF +VKQ FT FS+N++VLLT G  +L L +  D+PA ES KEY +GF++T+ +
Sbjct  121  AFNALFAFLMVKQKFTPFSINAVVLLTVGIGILALHSDGDKPAHESRKEYVIGFLMTVVA  180

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A LY  I+PLVEL Y KA   I + LVLE Q+V+ +A ++FC VGM I+ DF+VI REAR
Sbjct  181  AVLYAFILPLVELTYKKARQEITFTLVLEMQLVMCIAGSVFCLVGMIIDGDFKVIAREAR  240

Query  244  EFELGAAK-YYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFH  68
            EF++G +  YY L++ +GII+Q F +GA+G++   SSL S V+ +VLLPVTE+LAV+ F 
Sbjct  241  EFKIGGSMFYYSLIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFR  300

Query  67   EKFQPEKGVSLFLCLWGFVSYF  2
            EKFQ EKGV+L L LWGFVSYF
Sbjct  301  EKFQAEKGVALLLSLWGFVSYF  322



>gb|AAF64547.1|AF078531_1 purine permease [Arabidopsis thaliana]
Length=356

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 181/310 (58%), Positives = 228/310 (74%), Gaps = 6/310 (2%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrR-----SDVDSN  749
            G CGGPLL RLYF  GG R+WF ++L TA +P++ IPLL+S+L RRR       ++    
Sbjct  16   GTCGGPLLTRLYFTNGGKRIWFMSFLSTAGFPIILIPLLVSFLSRRRGNRNPNNAENKRK  75

Query  748  TKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVK  569
            TK FLM   LFI+  +IGLL GL NYLY+YG+A LPVSTSSLI+ +QLAF ALFAF LVK
Sbjct  76   TKLFLMETPLFIASIVIGLLTGLDNYLYSYGLAYLPVSTSSLIIGTQLAFNALFAFLLVK  135

Query  568  QHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVE  389
            Q FT FS+N++VLLT G  +L L +  D+PA ES KEY +GF++T+ +A LY  I+PLVE
Sbjct  136  QKFTPFSINAVVLLTVGIGILALHSDGDKPAKESKKEYVVGFLMTVVAALLYAFILPLVE  195

Query  388  LIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAK-YYI  212
            L Y KA   I + LVLE QMV+ LAAT FC +GMFI  DF+VI REAREF++G +  YY 
Sbjct  196  LTYKKARQEITFPLVLEIQMVMCLAATFFCVIGMFIVGDFKVIAREAREFKIGGSVFYYA  255

Query  211  LVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLF  32
            L++ +GII+Q F +GA+G++   SSL S V+ +VLLPVTE+ AV+ F EKFQ EKGVSL 
Sbjct  256  LIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVFAVVCFREKFQAEKGVSLL  315

Query  31   LCLWGFVSYF  2
            L LWGFVSYF
Sbjct  316  LSLWGFVSYF  325



>ref|NP_174144.1| purine permease 1 [Arabidopsis thaliana]
 sp|Q9FZ96.1|PUP1_ARATH RecName: Full=Purine permease 1; Short=AtPUP1 [Arabidopsis thaliana]
 gb|AAF98432.1|AC021044_11 purine permease [Arabidopsis thaliana]
 dbj|BAC42317.1| putative purine permease [Arabidopsis thaliana]
 gb|AAO63924.1| putative purine permease [Arabidopsis thaliana]
 gb|AEE30934.1| purine permease 1 [Arabidopsis thaliana]
Length=356

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 181/310 (58%), Positives = 228/310 (74%), Gaps = 6/310 (2%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrR-----SDVDSN  749
            G CGGPLL RLYF  GG R+WF ++L TA +P++ IPLL+S+L RRR       ++    
Sbjct  16   GTCGGPLLTRLYFTNGGKRIWFMSFLSTAGFPIILIPLLVSFLSRRRSNRNPNNAENKRK  75

Query  748  TKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVK  569
            TK FLM   LFI+  +IGLL GL NYLY+YG+A LPVSTSSLI+ +QLAF ALFAF LVK
Sbjct  76   TKLFLMETPLFIASIVIGLLTGLDNYLYSYGLAYLPVSTSSLIIGTQLAFNALFAFLLVK  135

Query  568  QHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVE  389
            Q FT FS+N++VLLT G  +L L +  D+PA ES KEY +GF++T+ +A LY  I+PLVE
Sbjct  136  QKFTPFSINAVVLLTVGIGILALHSDGDKPAKESKKEYVVGFLMTVVAALLYAFILPLVE  195

Query  388  LIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAK-YYI  212
            L Y KA   I + LVLE QMV+ LAAT FC +GMFI  DF+VI REAREF++G +  YY 
Sbjct  196  LTYKKARQEITFPLVLEIQMVMCLAATFFCVIGMFIVGDFKVIAREAREFKIGGSVFYYA  255

Query  211  LVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLF  32
            L++ +GII+Q F +GA+G++   SSL S V+ +VLLPVTE+ AV+ F EKFQ EKGVSL 
Sbjct  256  LIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVFAVVCFREKFQAEKGVSLL  315

Query  31   LCLWGFVSYF  2
            L LWGFVSYF
Sbjct  316  LSLWGFVSYF  325



>emb|CDY29741.1| BnaA01g19250D [Brassica napus]
Length=377

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 234/322 (73%), Gaps = 5/322 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
             KM+T  ++ N I+LAIGNCGGPL+ RLYF  GG R+WFS++LQTA  P++  PLL S+ 
Sbjct  31   KKMKTGLVMINCIILAIGNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPIILFPLLFSF-  89

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
               R R    + T FFL+ P LF++  +IGLL G+ NYLY YG+A LPVSTSSL++SSQL
Sbjct  90   ---RLRRKEATTTPFFLIKPPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSQL  146

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAFF+VKQ FT F +N++VLLT GA +L L    D+ A E++KEY +GF++TL +
Sbjct  147  AFTAFFAFFMVKQKFTPFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFLMTLAA  206

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A LY  ++PLVEL Y KA   I Y LVLE QMV+   AT FC VGM  + DF+ + REAR
Sbjct  207  AILYAFVLPLVELTYKKARKRISYTLVLEMQMVLCFGATCFCLVGMLADGDFKELAREAR  266

Query  244  EFELGAAK-YYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFH  68
            +F+LG +  YY++V+ + II+Q F +G++G+I   SSL+S ++   LLP+TE+LAV  F 
Sbjct  267  DFKLGRSTYYYVVVVFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFFR  326

Query  67   EKFQPEKGVSLFLCLWGFVSYF  2
            EKFQ EKG+SLFL LWGFVSYF
Sbjct  327  EKFQAEKGLSLFLSLWGFVSYF  348



>ref|XP_009148632.1| PREDICTED: purine permease 2-like [Brassica rapa]
Length=376

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 234/322 (73%), Gaps = 5/322 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
             KM+T  ++ N I+LAIGNCGGPL+ RLYF  GG R+WFS++LQTA  P++  PLL S+ 
Sbjct  30   KKMKTGLVIINCIILAIGNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPIILFPLLFSF-  88

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
               R R    + T FFL+ P LF++  +IGLL G+ NYLY YG+A LPVSTSSL++SSQL
Sbjct  89   ---RLRRKEATTTPFFLIKPPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSQL  145

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAFF+VKQ FT F +N++VLLT GA +L L    D+ A E++KEY +GF++TL +
Sbjct  146  AFTAFFAFFMVKQKFTPFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFLMTLAA  205

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A LY  ++PLVEL Y KA   I Y LVLE QMV+   AT FC VGM  + DF+ + REAR
Sbjct  206  AILYAFVLPLVELTYKKARKRISYTLVLEMQMVLCFVATCFCLVGMLADGDFKELAREAR  265

Query  244  EFELGAAK-YYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFH  68
            +F+LG +  YY++V+ + II+Q F +G++G+I   SSL+S ++   LLP+TE+LAV  F 
Sbjct  266  DFKLGRSTYYYVVVVFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFFR  325

Query  67   EKFQPEKGVSLFLCLWGFVSYF  2
            EKFQ EKG+SLFL LWGFVSYF
Sbjct  326  EKFQAEKGLSLFLSLWGFVSYF  347



>ref|XP_006305220.1| hypothetical protein CARUB_v10009586mg [Capsella rubella]
 gb|EOA38118.1| hypothetical protein CARUB_v10009586mg [Capsella rubella]
Length=351

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 173/319 (54%), Positives = 237/319 (74%), Gaps = 1/319 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M    ++   I+LAIGNCGGPL++RLYF  GG R+WFST+L+TA +PV+FIPLL SY+ R
Sbjct  1    MVKALVIITCIILAIGNCGGPLIMRLYFNNGGQRIWFSTFLETAGFPVIFIPLLFSYIHR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RR  ++    T FFL+ P L  +   IG+L G  NYLY YG+A LPVST++LI++SQLAF
Sbjct  61   RRN-NNGSEPTSFFLIKPRLLGAAIFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAF  119

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
             A+F+FF+VK  FT F++N++VLLT GA VLG+    D+PA E+ K+Y  GF++T+ +A 
Sbjct  120  IAIFSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDKPAHETRKQYVTGFLMTVAAAV  179

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            +Y LI+PLVEL Y KA  P+ Y LVLE QMV+   A++   +GM I  DF+ +P+EA+EF
Sbjct  180  MYSLILPLVELAYQKAKQPMSYTLVLEVQMVLCFLASIVSLIGMSIAGDFKALPKEAKEF  239

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            +LG A +Y++ + S II+Q F +GA+G+I   SSL+S ++ +VLLP+TE+LAVI +HEKF
Sbjct  240  KLGEAVFYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKF  299

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKG+SL L LWGFVSYF
Sbjct  300  QAEKGLSLALSLWGFVSYF  318



>ref|NP_973592.1| purine permease 2 [Arabidopsis thaliana]
 gb|AEC08879.1| purine permease 2 [Arabidopsis thaliana]
Length=347

 Score =   303 bits (775),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 184/320 (58%), Positives = 244/320 (76%), Gaps = 1/320 (0%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
            KM+T+ ++ N I LAIGNCGGPL++RLYF  GG R+WF ++LQT   P++F PLL+S+LR
Sbjct  2    KMKTVLVIINCIFLAIGNCGGPLMMRLYFQNGGERIWFPSFLQTVGCPLIFFPLLLSFLR  61

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            RRR   + ++ T FFLM P LFI+  ++GLLVG  NYLY+YG+A +PVST+SLI+S+QL 
Sbjct  62   RRRCLEEQET-TPFFLMKPPLFIAAIVVGLLVGFDNYLYSYGLAYIPVSTASLIISAQLG  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTALFAFF+VKQ FT F++N+IVLLT GAVVL L + +D+ A E++KEY +GF++TLG+A
Sbjct  121  FTALFAFFMVKQKFTPFTINAIVLLTGGAVVLALNSDSDKLANETHKEYVVGFIMTLGAA  180

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LYG I+PLVEL Y K+   I Y L LEFQMV+  AAT  C VGM    DF+VI  EAR+
Sbjct  181  LLYGFILPLVELSYKKSGQRITYTLALEFQMVLCFAATCVCLVGMLAAGDFKVIAGEARD  240

Query  241  FELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEK  62
            F+LG + YY++++ + II+Q F +GA+G+I   SSL+S ++ + LLPVT +LAVI F EK
Sbjct  241  FKLGESLYYVVIVFTAIIWQAFFVGAIGLIFCASSLVSGIMVSALLPVTVILAVICFQEK  300

Query  61   FQPEKGVSLFLCLWGFVSYF  2
            FQ  KGV+L L LWG VSYF
Sbjct  301  FQAGKGVALALSLWGSVSYF  320



>ref|XP_009776518.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 171/306 (56%), Positives = 234/306 (76%), Gaps = 3/306 (1%)
 Frame = -1

Query  919  AIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKF  740
            A+G CGGPL++RLY++ GG+R+WFS+WLQTA WP   IPL I Y  RR      DSN K 
Sbjct  23   AVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILYFYRR---KTEDSNAKL  79

Query  739  FLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHF  560
            + +TP +FI+  +IG++ G+ ++LY++G +KLPVSTSSL++++QLAFTA+ AFF+VK  F
Sbjct  80   YFITPRIFIASFVIGVVTGVDDFLYSWGGSKLPVSTSSLLLAAQLAFTAIGAFFIVKLKF  139

Query  559  TAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIY  380
            T +S+N++VLLT GAV+LG+R+  DRP G ++K Y LGF++TL +AALYG+I+P +ELIY
Sbjct  140  TPYSINAVVLLTVGAVLLGVRSNGDRPEGVTSKSYILGFMMTLLAAALYGVILPCIELIY  199

Query  379  NKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVIC  200
             KA   I   LVLE QMV+  AAT+FC++GM  N+DFQ I REA++F LG A+YY +++ 
Sbjct  200  LKAKQAITATLVLEIQMVMCFAATVFCTIGMIANNDFQAISREAKQFNLGEARYYTVIVW  259

Query  199  SGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLW  20
            + II+Q F +G +GVI   SSL+S V+  VLLPVTE+LAV+ F E F  EKG++LFL LW
Sbjct  260  TTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENFSGEKGLALFLSLW  319

Query  19   GFVSYF  2
            GFVSYF
Sbjct  320  GFVSYF  325



>ref|XP_009143833.1| PREDICTED: purine permease 2 isoform X2 [Brassica rapa]
Length=362

 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 179/333 (54%), Positives = 241/333 (72%), Gaps = 13/333 (4%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
            KM+T+ ++ N I+LAIGNCGGPL+ RLYF  GG R+WFS++LQT+  P++ +PLL S+L 
Sbjct  2    KMKTVLVIINCIILAIGNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFLT  61

Query  781  rrrrRSDVDS-NTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            R R++ + +   T  FL+ P LF++  ++GLL+G  NYLY YG+A LPVSTSSLI+SSQL
Sbjct  62   RHRQQQEQEEPKTTLFLIKPPLFLASVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQL  121

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTALFAFF+VKQ FT F++N++VLLT GA  L L A  D+   E+ KEY +GFV+T+ +
Sbjct  122  AFTALFAFFMVKQRFTPFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFVMTVAA  181

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDF--------  269
            A LY  ++PLVEL Y KA+  I Y LVLE Q+V+ + AT  C VGM  + DF        
Sbjct  182  AVLYAFVLPLVELAYKKASQRISYTLVLEMQLVLCVVATCLCLVGMLADGDFKNQEFDFL  241

Query  268  ---QVIPREAREFELGAAKYYILVIC-SGIIFQFFLIGALGVICYGSSLLSVVINTVLLP  101
               Q + REAREF+LG +K+Y LV+  + +I+Q F +G++G+I   SSL+S V+ + LLP
Sbjct  242  FTVQELGREAREFKLGGSKHYCLVVAFTAVIWQGFFLGSIGMIFCASSLVSGVLISALLP  301

Query  100  VTELLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            +TE+LAV+ F EKFQ  KGVSLFL LWGFVSYF
Sbjct  302  LTEVLAVLFFKEKFQAAKGVSLFLSLWGFVSYF  334



>ref|XP_003615204.1| Purine permease [Medicago truncatula]
 gb|AES98162.1| purine permease [Medicago truncatula]
Length=364

 Score =   302 bits (774),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 234/308 (76%), Gaps = 4/308 (1%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTK---  743
            G CGGPL++RLYF+ GG R+W S++L+T+A+P++ IPL IS++  R R  + + N     
Sbjct  32   GTCGGPLVMRLYFIHGGKRVWLSSFLETSAFPIILIPLTISHVHNRYRYQNPNGNNNNNN  91

Query  742  FFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQH  563
            F  M P LFI+ A+IG+L GL +YLY  G+ +LPVSTSSLI SS LAFTA+FAFFLVK  
Sbjct  92   FVSMKPPLFIASAVIGVLTGLDDYLYACGIKRLPVSTSSLIQSSHLAFTAVFAFFLVKHK  151

Query  562  FTAFSVNSIvlltagavvlglraGN-DRPAGESNKEYGLGFVLTLGSAALYGLIMPLVEL  386
            FTA+SVNSIVLLT G+VVL L +   DR  GES K+Y +GFV+ L SAALYG ++PL+EL
Sbjct  152  FTAYSVNSIVLLTLGSVVLALNSDGGDRLVGESTKDYVIGFVMILASAALYGFVLPLLEL  211

Query  385  IYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILV  206
            +Y K+   I Y LV+E Q+V+   ATLFC VGM I++DF+VIPREAR+F+LG  KYY+++
Sbjct  212  VYKKSKQVITYSLVMEIQLVMCFFATLFCVVGMIIDNDFKVIPREARDFKLGETKYYVVL  271

Query  205  ICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLC  26
            + S I++QFF +GA+GVI   SSLLS +I    LP+TE+LAVI++ EKFQ EKGV+L L 
Sbjct  272  VWSAIMWQFFFLGAIGVIFCASSLLSGIIIAAFLPITEILAVIVYKEKFQAEKGVALVLS  331

Query  25   LWGFVSYF  2
            LWGFVSYF
Sbjct  332  LWGFVSYF  339



>ref|XP_007042881.1| Purine permease 3 isoform 1 [Theobroma cacao]
 gb|EOX98712.1| Purine permease 3 isoform 1 [Theobroma cacao]
Length=338

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 169/319 (53%), Positives = 230/319 (72%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++   L+ N  LLA GN GGPL+++LYFL+GG  +W S+ L+TA WP + +PL  SYL R
Sbjct  5    LKRSLLVLNCALLAFGNVGGPLIMKLYFLKGGKGVWTSSCLETAGWPFMVMPLTFSYLYR  64

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            R         T+ F + P LF++ A+IGLL G+ ++LY YGVA+LPVST +LI+S+QLAF
Sbjct  65   R---RKEGPGTELFFIKPPLFLASAVIGLLTGVDDFLYAYGVARLPVSTLALIISTQLAF  121

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            T  FAF LVKQ FT+F++NS+ LL  GAVVL L   +D PA ESN++Y  GF +TL ++A
Sbjct  122  TVAFAFLLVKQKFTSFTINSVFLLNIGAVVLALHTSSDHPANESNRQYCSGFFMTLAASA  181

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG ++P +EL Y KA   I Y LV+E QMV+S +AT+FC++GM  + + + IPREA +F
Sbjct  182  LYGFVLPAIELTYKKAKQTISYSLVIEMQMVMSFSATVFCTIGMLFHKEVEAIPREASKF  241

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG + YY++++ S I++QFF +GA+GVI  GSSLLS +I   LLPVTE LAV+ FHEKF
Sbjct  242  ELGQSTYYLVILLSAILWQFFFMGAVGVIFSGSSLLSGIIIAALLPVTESLAVLFFHEKF  301

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EK +S+ L L G +SYF
Sbjct  302  QVEKAISVVLSLLGSLSYF  320



>gb|KFK44691.1| hypothetical protein AALP_AA1G290900 [Arabis alpina]
Length=351

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 170/316 (54%), Positives = 236/316 (75%), Gaps = 2/316 (1%)
 Frame = -1

Query  943  LLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRS  764
            ++ N I+LAIGNCGGPL++RLYF  GG R+WFS++L+TA +PV+ IPL  SYL R RR +
Sbjct  7    VIINCIILAIGNCGGPLIMRLYFNNGGKRIWFSSFLETAGFPVILIPLFFSYLNRLRRNN  66

Query  763  --DVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftal  590
                  N  FFL+ P L  +  L+G+L G  NYLY YG+A LPVST++LI++SQLAF A+
Sbjct  67   NNGTSENISFFLIKPRLLFAAVLVGVLSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAI  126

Query  589  faffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYG  410
            F++F+V   FT +++N++VLLT GA VLG+    D+P  E++K+Y +GF++T+ +A +Y 
Sbjct  127  FSYFMVNHKFTPYTINAVVLLTVGAAVLGMHTETDKPVHETHKQYVIGFLMTVAAAVMYA  186

Query  409  LIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELG  230
             I+PLVEL Y KA  P+ Y LVLE Q+V+ L A+L   +GMFI  DF+ +P EAREF+LG
Sbjct  187  FILPLVELAYQKAKQPMSYTLVLEVQLVLCLFASLVSLIGMFIAGDFKALPIEAREFKLG  246

Query  229  AAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPE  50
             A +Y++V+ S II+Q F +GA+G+I   SSL+S ++ +VLLP+TE+LAVI +HEKFQ E
Sbjct  247  EALFYVVVVFSAIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIFYHEKFQAE  306

Query  49   KGVSLFLCLWGFVSYF  2
            KG+SL L LWGFVSYF
Sbjct  307  KGLSLALSLWGFVSYF  322



>ref|XP_010478191.1| PREDICTED: purine permease 1-like [Camelina sativa]
Length=354

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 235/321 (73%), Gaps = 2/321 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+   L+ N I+L IG CGGPLL RLY+  GG R+WF ++L TA  P++ IPLL S+L R
Sbjct  1    MKYGLLIINCIILTIGTCGGPLLTRLYYNNGGKRIWFMSFLSTAGCPIILIPLLFSFLNR  60

Query  778  rrrRSDVD-SNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            R R    + + T+ FLM   LFI+  +IGLL+GL NYLY YG+  LPVSTSSLI+ +QLA
Sbjct  61   RNRNKAENVAKTELFLMETPLFIASTVIGLLIGLDNYLYAYGLRYLPVSTSSLIIGTQLA  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            F ALFAF LVKQ FT FS+N++VLLT G  +L L +  D+PA ES++EY +GF++T+ +A
Sbjct  121  FNALFAFLLVKQKFTPFSINAVVLLTVGTGILALHSDGDKPANESHREYVVGFLMTVIAA  180

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LY  I+PLVEL Y KA   I + LVLE QMV+ L+AT FC VGMFI  DF+VI +EARE
Sbjct  181  VLYAFILPLVELTYKKARQEITFPLVLEIQMVMCLSATCFCVVGMFIVGDFKVIAKEARE  240

Query  241  FEL-GAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            F++ G+A YY L++ +GII+Q F +GA+G++   SSL S V+ +VLLP+TE+LAV+ F E
Sbjct  241  FKIGGSAFYYALIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPMTEVLAVVCFRE  300

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQ EK  SL L LWGFVSYF
Sbjct  301  KFQAEKCASLLLSLWGFVSYF  321



>ref|XP_010413821.1| PREDICTED: purine permease 2 [Camelina sativa]
Length=351

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 239/323 (74%), Gaps = 5/323 (2%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
            KM+++ ++ N I LAIG+CGGPL+LRLYF  GG R+WFS++LQT   P++  PLL S+L 
Sbjct  4    KMKSVRVIINCIFLAIGSCGGPLMLRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLS  63

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            RRR   +    T  FLM P LFI+  ++GLL+G  NYLY+YG+A +PVST+SLI+S+QL 
Sbjct  64   RRRL--EEQEKTSLFLMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLG  121

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTALFAFF+VKQ FT F++N+IVLLT GAVVL   + +D+ A E++KEY +GF++T G+A
Sbjct  122  FTALFAFFMVKQKFTPFTINAIVLLTVGAVVLAFNSDSDKLANETHKEYVVGFLMTAGAA  181

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LY  I+PLVEL Y K+   + Y LVLEFQMV+   AT FC VGM  + DF+VI REARE
Sbjct  182  LLYAFILPLVELAYKKSRQRVTYTLVLEFQMVLCFVATCFCLVGMLASGDFKVIAREARE  241

Query  241  ---FELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILF  71
               F+LG + YY++V+ + +I+Q F +GA+G+I   SSL+S ++ + LLPVT +LAVI F
Sbjct  242  ARDFKLGESLYYVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICF  301

Query  70   HEKFQPEKGVSLFLCLWGFVSYF  2
             EKFQ  KGV+L L LWG VSYF
Sbjct  302  QEKFQAGKGVALALSLWGSVSYF  324



>ref|XP_010413817.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=349

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 237/320 (74%), Gaps = 2/320 (1%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
            KM+++ ++ N I LAIGNCGGPL++RLYF  GG R+WFS++LQT   P++  PLL S+LR
Sbjct  2    KMKSVRVIINCIFLAIGNCGGPLMMRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLR  61

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            RRR        T  FLM P LFI+  + GLL+G  NYLY+YG+A +PVST+SLI+S+QL 
Sbjct  62   RRRLVKQ--EKTSLFLMKPPLFIASVVAGLLMGFDNYLYSYGLAYIPVSTASLIISAQLG  119

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTALFAF +VKQ FT F++N+IVLLT  AVVL + + + + A E++KEY +GF++T+G+A
Sbjct  120  FTALFAFCMVKQKFTPFTINAIVLLTLSAVVLAINSDSYKLANETHKEYVVGFLMTVGAA  179

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LY  I+PLVEL Y K+   + Y LVLEFQMV+   AT FC VGM +  DF+VI REAR+
Sbjct  180  LLYAFILPLVELSYKKSRQGVTYTLVLEFQMVLCFVATCFCLVGMLVAGDFKVIAREARD  239

Query  241  FELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEK  62
            F+LG + YY++V+ + +I+Q F +GA+G+I   SSL+S ++ + LLPVT +LAVI F EK
Sbjct  240  FKLGESLYYVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEK  299

Query  61   FQPEKGVSLFLCLWGFVSYF  2
            FQ  KG++L L LWG VSYF
Sbjct  300  FQAGKGIALTLSLWGSVSYF  319



>ref|XP_002893513.1| hypothetical protein ARALYDRAFT_890360 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69772.1| hypothetical protein ARALYDRAFT_890360 [Arabidopsis lyrata subsp. 
lyrata]
Length=356

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 230/310 (74%), Gaps = 6/310 (2%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrR-----SDVDSN  749
            G CGGPLL RLYF  GG R+WF ++LQTA  P++ +PL+ S+LRRRR       ++    
Sbjct  16   GTCGGPLLTRLYFTNGGKRIWFMSFLQTAGCPIILLPLVASFLRRRRSNRNSNNAENTPK  75

Query  748  TKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVK  569
            TK FLM   LFI+  +IGLL GL NYLY+YG+A LPVSTSSLI+ +QLAF ALFAF LVK
Sbjct  76   TKIFLMETPLFIASIVIGLLTGLDNYLYSYGLAYLPVSTSSLIIGTQLAFNALFAFLLVK  135

Query  568  QHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVE  389
            Q FT FS+N++VLLT G  +L L +  D+PA ES+K+Y +GF++T+ +A LY  I+PLVE
Sbjct  136  QKFTPFSINAVVLLTVGTGILALHSDGDKPANESHKQYVIGFLMTVVAAVLYAFILPLVE  195

Query  388  LIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAK-YYI  212
            L Y KA   I + LV E QMV+ +AATLFC VGMFI  DF+VI REAREF++G +  YY 
Sbjct  196  LTYKKARQEITFPLVFEIQMVMCVAATLFCLVGMFIVGDFKVIAREAREFKIGGSVFYYA  255

Query  211  LVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLF  32
            L++ +GI++Q F +GA+G++   SSL S V+ +VLLPVTE+LAV+ F EKFQ EKGVSL 
Sbjct  256  LIVITGIVWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQAEKGVSLL  315

Query  31   LCLWGFVSYF  2
            L LWGFVSYF
Sbjct  316  LSLWGFVSYF  325



>emb|CDY12422.1| BnaC08g09110D [Brassica napus]
Length=376

 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 176/323 (54%), Positives = 233/323 (72%), Gaps = 6/323 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
             KM+T  ++ N I+LAIGNCGGPL+ RLYF  GG R+WFS++LQTA  P++  PLL S+ 
Sbjct  31   KKMKTGLVMINCIILAIGNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPIILFPLLFSF-  89

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
               R R    + T FFL+ P LF++  +IGLL G+ NYLY YG+A LPVSTSSL++SSQL
Sbjct  90   ---RLRRKEATTTPFFLIKPPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSQL  146

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAFF+VKQ FT F +N++VLLT GA +L L    D+ A E++KEY +GF++TL +
Sbjct  147  AFTAFFAFFMVKQKFTPFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFLMTLAA  206

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A LY  ++PLVEL Y KA   I Y LVLE Q+V+   AT FC VGM  + DF+ + REAR
Sbjct  207  AILYAFVLPLVELTYKKARQRISYTLVLEMQLVLCFVATCFCLVGMLADGDFKELAREAR  266

Query  244  EFELGAAK--YYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILF  71
            +F+LG +   YY++V+ + II+Q F +G++G+I   SSL+S ++   LLP+TE+LAV  F
Sbjct  267  DFKLGGSTTYYYVVVVFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFF  326

Query  70   HEKFQPEKGVSLFLCLWGFVSYF  2
             EKFQ EK +SLFL LWGFVSYF
Sbjct  327  REKFQAEKSISLFLSLWGFVSYF  349



>ref|XP_009599635.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score =   300 bits (767),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 241/319 (76%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            MR I LL N ++LA+G CGGPL++RLY++ GG+R+WFS+WLQTA WP   IPL I Y  R
Sbjct  10   MRRILLLINCLILAVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILYFYR  69

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            R        N K++L+TP +FI+  +IG++ GL ++LY++G +KLPVSTSSL++++QLAF
Sbjct  70   R---KTEGINAKYYLITPRIFIASFIIGVVTGLDDFLYSWGGSKLPVSTSSLLLAAQLAF  126

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA+ AFF+VK  FT +S+N++VLLT G V+LG+R+  DRP G ++K Y LGF++TL +AA
Sbjct  127  TAVGAFFIVKLKFTPYSINAVVLLTVGVVLLGVRSNGDRPEGVTSKAYILGFMMTLLAAA  186

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG+I+P +ELIY KA   I   LVLE QMV+  AAT FC+VGM  N+DFQ I REA++F
Sbjct  187  LYGVILPCIELIYLKAKQAITATLVLEIQMVMCFAATAFCTVGMIANNDFQAISREAKQF  246

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG A+YY +++ + II+Q F +G +GVI   SSL+S V+  VLLPVTE+LAV+ F E F
Sbjct  247  NLGEARYYTVIVWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENF  306

Query  58   QPEKGVSLFLCLWGFVSYF  2
              EKG++LFL LWGFVSYF
Sbjct  307  SGEKGLALFLSLWGFVSYF  325



>ref|XP_010509840.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=380

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 178/317 (56%), Positives = 239/317 (75%), Gaps = 2/317 (1%)
 Frame = -1

Query  952  TIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrr  773
            ++ L+ N+I LAIG+CGGPL++RLYF  GGAR+WFS++LQT   P++  PLL S+LRRRR
Sbjct  36   SVRLIVNSIFLAIGDCGGPLMMRLYFHNGGARIWFSSFLQTVGCPLILFPLLFSFLRRRR  95

Query  772  rRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlafta  593
               +    T  FLM P LFI+  ++GLLVG  NYLY+YG+A +PVST SLI+S+QL FTA
Sbjct  96   L--EEQEKTSLFLMKPPLFIASVVVGLLVGFDNYLYSYGLAYIPVSTESLIISAQLGFTA  153

Query  592  lfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALY  413
            LFAFF+VKQ  T F++N+IVLLT GAVVL + + +D+ A E++KEY +GF++T+G+A LY
Sbjct  154  LFAFFMVKQKITPFTINAIVLLTVGAVVLAINSDSDKLANETHKEYVVGFLMTVGAALLY  213

Query  412  GLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFEL  233
              I+PLVEL Y K+   + Y LVLEFQMV+   AT FC VGM +  DF+VI REAR+F+L
Sbjct  214  AFILPLVELSYKKSCQRVTYTLVLEFQMVLCFVATCFCLVGMLVAGDFKVIAREARDFKL  273

Query  232  GAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQP  53
            G + YY++V+ + +I+Q F +GA+G+I   SSL+S ++ + LLPVT +LAVI F EKFQ 
Sbjct  274  GESLYYVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQA  333

Query  52   EKGVSLFLCLWGFVSYF  2
             KGV+L L LWG VSYF
Sbjct  334  GKGVALALSLWGSVSYF  350



>ref|XP_009795252.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 181/319 (57%), Positives = 242/319 (76%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            MR I LL N ++LAIG CGGPL++RLY++ GG+R+WFS+WLQTA WP  FIPL I Y  R
Sbjct  10   MRRILLLINCLILAIGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTFIPLAILYFNR  69

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            R        N K++L+TP +FI+  +IG + GL ++LY++G +KLPVSTSSL++++QLAF
Sbjct  70   R---KTEGINAKYYLITPRIFIASFIIGFVTGLDDFLYSWGGSKLPVSTSSLLLAAQLAF  126

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA+ AFF+VK  FT +S+N++VLLT GAV+LG+R+  DRP G ++K Y +GF++TL +AA
Sbjct  127  TAIGAFFIVKLKFTPYSINAVVLLTLGAVLLGVRSNGDRPEGVTSKAYIIGFMMTLLAAA  186

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG+I+P +ELIY KA   I   LVLE QMV+  AAT FC+VGM  N+DFQ I REA++F
Sbjct  187  LYGVILPCIELIYLKAKQAITATLVLEIQMVMCFAATAFCTVGMIANNDFQAISREAKQF  246

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG A+YY +V+ + II+Q F +G +GVI   SSL+S V+  VLLPVTE+LAV+ F E F
Sbjct  247  NLGEARYYTVVVWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENF  306

Query  58   QPEKGVSLFLCLWGFVSYF  2
              EKG++LFL LWGFVSYF
Sbjct  307  SGEKGLALFLSLWGFVSYF  325



>ref|XP_010509841.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=347

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 236/314 (75%), Gaps = 2/314 (1%)
 Frame = -1

Query  943  LLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRS  764
            ++ N I LAIG+CGGPL+LRLYF  GGAR+WFS++LQT   P++  PLL S+LRRR    
Sbjct  6    VIINFIFLAIGSCGGPLMLRLYFHNGGARIWFSSFLQTVGCPLILFPLLFSFLRRRCL--  63

Query  763  DVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfa  584
            +    T  FLM P LFI+  ++GLL+G  NYLY+YG+A +PVST++LI+S+QL FTALFA
Sbjct  64   EEQETTSLFLMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTAALIISAQLGFTALFA  123

Query  583  ffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLI  404
            FF+VKQ FT F++N+IVLLT GAVVL + + +D+ A E++KEY +GF++T G+A LY  I
Sbjct  124  FFMVKQKFTPFTINAIVLLTVGAVVLAINSDSDKLANETHKEYVVGFLMTAGAALLYAFI  183

Query  403  MPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAA  224
            +PLVEL Y K+   + Y LVLEFQMV+   AT FC VGM  + DF+VI REAR+F+LG +
Sbjct  184  LPLVELAYKKSRQRVTYTLVLEFQMVLCFVATCFCLVGMLASGDFKVIAREARDFKLGES  243

Query  223  KYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKG  44
             YY++V+ + +I+Q F +GA+G+I   SSL+S ++ + LLPVT +LAVI F EKFQ  KG
Sbjct  244  LYYVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKG  303

Query  43   VSLFLCLWGFVSYF  2
            V+L L LWG VSYF
Sbjct  304  VALALSLWGSVSYF  317



>ref|XP_009769306.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 176/319 (55%), Positives = 242/319 (76%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            MR I LL N ++LA+G CGGPL++RLY++ GG+R+WFS+WLQTA WP   IPL I Y  R
Sbjct  10   MRRILLLINCLILAVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPLAILYFYR  69

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            R       SN K + +TP +FI+  +IG++ G+ ++LY++G +KLPVSTSSL++++QLAF
Sbjct  70   R---KTEGSNAKLYFITPRIFIASFVIGVVTGVDDFLYSWGGSKLPVSTSSLLLAAQLAF  126

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA+ AFF+VK  FT +S+N++VLLT GAV+LG+R+  DRP G ++K Y LGF++TL +AA
Sbjct  127  TAIGAFFIVKLKFTPYSINAVVLLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMTLLAAA  186

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG+I+P +ELIY KA   I   LVLE QMV+  AAT+FC++GM  N+DFQ I +EA++F
Sbjct  187  LYGVILPCIELIYLKAKQAITATLVLEIQMVMCFAATVFCTIGMIANNDFQAISKEAKQF  246

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG A+YY +++ + II+Q F +G +GVI   SSL+S V+  VLLPVTE+LAV+ F E F
Sbjct  247  NLGEARYYTVIVWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRENF  306

Query  58   QPEKGVSLFLCLWGFVSYF  2
              EKG++LFL LWGFVSYF
Sbjct  307  SGEKGLALFLSLWGFVSYF  325



>ref|XP_004237962.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=355

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 177/321 (55%), Positives = 235/321 (73%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            +K R   L+ N I L IG CGGPL+ RLYFL GG R+W S+WL    WP+V I L+I+Y 
Sbjct  6    SKWRKFILVLNCITLGIGYCGGPLISRLYFLHGGQRIWLSSWLACIGWPIVLIVLVIAYF  65

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             R + +    S+T FF +T   F S A +G+LVGL  YLY +G AKLPVSTS++I ++QL
Sbjct  66   YRLKTQG---SDTNFFCITRQEFTSSAALGILVGLAGYLYAWGPAKLPVSTSTVIYAAQL  122

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
             FT +FAF +VKQ  T++SVN++VLL  GA  L LRA +DRP GES K+Y LGFV+TL +
Sbjct  123  GFTVVFAFLIVKQKLTSYSVNAVVLLIVGAGTLALRAESDRPEGESTKQYVLGFVMTLLA  182

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AA  GL +PL+ELIY KA   + YI++LE QM++++ A+ FC+VGM +N DFQVI REAR
Sbjct  183  AASTGLALPLLELIYIKAKKDVTYIMILEIQMILNIFASAFCTVGMIVNKDFQVISREAR  242

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            EFELG AKYY+++I S II+Q   +G +GV+ YGSSLL  ++  +LLP+TELL V+L+HE
Sbjct  243  EFELGKAKYYLVLIWSAIIWQLSTLGIVGVVQYGSSLLCGILIALLLPLTELLGVVLYHE  302

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
             F+  KG+++FL LWGFVSYF
Sbjct  303  TFEVTKGLAIFLSLWGFVSYF  323



>ref|XP_010942638.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
 ref|XP_010942639.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
Length=365

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 228/320 (71%), Gaps = 0/320 (0%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              ++   ++ N +LL +G+ GGPLL RLYF  GG R W ++WL+T  WP++ +PL ISYL
Sbjct  19   KALKRALVVLNCLLLFVGDTGGPLLSRLYFRHGGHRQWLASWLETGGWPLILLPLFISYL  78

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RRR  SD    TK F +TP LF++ A++GLL G  ++LY YG++ LPVSTS++++S+QL
Sbjct  79   YRRRLASDHHHPTKLFFLTPRLFLACAVLGLLTGTDDFLYAYGLSFLPVSTSAILISTQL  138

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAF +VKQ FT +S+NSI LL+ GAV+LGL   +DRP   S  +Y +GF LTLG+
Sbjct  139  AFTAFFAFLIVKQKFTPYSINSIALLSVGAVILGLHTSSDRPDNVSQGQYLMGFFLTLGT  198

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYGL++PLVEL Y KA+  I Y LV+E Q+V+   AT FC++GM +N DF+ I REAR
Sbjct  199  AALYGLVLPLVELTYRKASQVITYTLVMEMQLVMGFFATAFCTIGMLVNKDFEAIQREAR  258

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            ++ LG  KYY++++   I++Q F +G +GVI   ++LL+ +I  VL+PV EL   I  HE
Sbjct  259  QYGLGEVKYYVVLVWCAILWQCFFLGTVGVIFCVNTLLAGIIIAVLIPVIELFGAIFLHE  318

Query  64   KFQPEKGVSLFLCLWGFVSY  5
            KF  EKGVSL LCLWG  SY
Sbjct  319  KFTSEKGVSLALCLWGLASY  338



>ref|XP_009762239.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   298 bits (762),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 176/321 (55%), Positives = 241/321 (75%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
             KMR I LL N ++LA+G CGGPL++RLY++ GG+R+WFS+WLQT  WP+  IPL I Y 
Sbjct  8    TKMRRILLLINCLILAVGVCGGPLMMRLYYVGGGSRVWFSSWLQTGGWPLTLIPLAILYF  67

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR       ++ K  L+TP +FI+  ++G+  G+ ++LY++G +KLPVSTSSL++++QL
Sbjct  68   YRR---KSKGADAKVCLITPQIFIASFVLGVGTGIDDFLYSWGGSKLPVSTSSLLLAAQL  124

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
             FTA+ AFF+VK  FT +S+N+++LLT GAV+LG+R+  D+PAG ++K Y LGF++TL +
Sbjct  125  GFTAVGAFFIVKLKFTPYSINAVILLTVGAVLLGIRSNGDKPAGVTSKAYVLGFIMTLLA  184

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG+I+P +ELIY KA   I   LVLE QMV+  AAT FC++GM  N DFQ I REA 
Sbjct  185  AALYGIILPSIELIYLKAKQAITVTLVLEIQMVMCFAATTFCTIGMVANKDFQAISREAI  244

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            +F LG A+YY ++I + I++Q F +GA+GVI   S+L+S VI  VLLPVTE+LA++ F E
Sbjct  245  QFNLGEARYYTVIIWTAILWQCFFVGAVGVIYCSSALMSGVIIAVLLPVTEVLAIVFFSE  304

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KF  EKGVSLFL LWGFVSYF
Sbjct  305  KFSGEKGVSLFLSLWGFVSYF  325



>ref|XP_008806390.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=367

 Score =   298 bits (763),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 175/321 (55%), Positives = 235/321 (73%), Gaps = 3/321 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++   ++ N +LL++GN GGPLL R+YF  GG R W S+WL+T  WP++ +PL ISYL R
Sbjct  21   LKRALVVLNCLLLSVGNTGGPLLSRVYFRHGGHRQWLSSWLETGGWPLILLPLSISYLYR  80

Query  778  rrrRSDVDSN---TKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
            RRRR   D++   TK F +TP LF++ A++GLL+G+ ++LY YG++ LPVSTS+L++SSQ
Sbjct  81   RRRRLAPDNHHHPTKLFFLTPRLFLACAVLGLLIGVDDFLYAYGLSFLPVSTSALLISSQ  140

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            LAFTA FAF +VKQ FT +S+NS+ LLT GAV+LGL   +DRP   S  +Y  GF LTLG
Sbjct  141  LAFTASFAFLIVKQKFTPYSINSVALLTVGAVMLGLHTSSDRPDNVSEGQYLTGFFLTLG  200

Query  427  SAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREA  248
            +AALYGLI+PLVEL Y KA   I Y LV+E Q+V+   AT  C++GM +N DF+VIPREA
Sbjct  201  TAALYGLILPLVELTYRKARQVITYTLVMEMQLVMGFFATALCTIGMLVNKDFEVIPREA  260

Query  247  REFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFH  68
            R++ LG  KYY++++ S I++Q F +G +GVI   ++LL+ +I  V +PV EL A IL H
Sbjct  261  RQYGLGEVKYYMVLVWSAILWQCFFLGTVGVIFCVNTLLAGIIIAVFIPVIELFAAILLH  320

Query  67   EKFQPEKGVSLFLCLWGFVSY  5
            EKF  EKGVSL LCLWG  SY
Sbjct  321  EKFTSEKGVSLALCLWGLASY  341



>ref|XP_002881298.1| ATPUP2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57557.1| ATPUP2 [Arabidopsis lyrata subsp. lyrata]
Length=358

 Score =   298 bits (762),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 180/331 (54%), Positives = 239/331 (72%), Gaps = 12/331 (4%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
            KM+T+ ++ N I LAIGNCGGPL++RLYF  GG R+WFS++LQT   P++  PLL S++R
Sbjct  2    KMKTVLVIINCIFLAIGNCGGPLMMRLYFSNGGQRIWFSSFLQTVGCPLIIFPLLFSFIR  61

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            R R   D    T FFLM P LFI+  L+GLL+G  NYLY+YG+A +PVST+SLI+S+QL 
Sbjct  62   RLRCL-DEQEKTPFFLMKPPLFIAAILVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLG  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTALFAFF+VKQ FT F++N++VLLT GAVVL L + +D+ A E++KEY +GF++T+G+A
Sbjct  121  FTALFAFFMVKQKFTPFTINAVVLLTVGAVVLALNSDSDKLANETHKEYVVGFLMTIGAA  180

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ--------  266
             LY  I+PLVEL Y K+   I Y L LEFQMV+   AT FC VGM    DF+        
Sbjct  181  LLYAFILPLVELTYKKSCQRITYTLALEFQMVLCFFATCFCLVGMLAAGDFKVKHALFIF  240

Query  265  ---VIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVT  95
               VI  EAR+F+LG + YY++V+ + +I+Q F +GA+G+I   SSL+S ++ + LLPVT
Sbjct  241  KNRVIAGEARDFKLGESLYYVVVVFTAVIWQAFFVGAIGLIFCASSLVSGIMISALLPVT  300

Query  94   ELLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
             +LAVI F EKFQ  KGV+L L LWG VSYF
Sbjct  301  VILAVICFQEKFQAGKGVALALSLWGSVSYF  331



>ref|XP_010538169.1| PREDICTED: purine permease 3-like [Tarenaya hassleriana]
Length=346

 Score =   297 bits (760),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 173/313 (55%), Positives = 230/313 (73%), Gaps = 1/313 (0%)
 Frame = -1

Query  940  LFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSD  761
            + N ILL IGNCGGPL+ RLY+  GG R+W S+ L+T  +P++ IPL    L  R+R+ +
Sbjct  7    IINCILLGIGNCGGPLMSRLYYNNGGQRIWLSSLLETGGFPIMSIPLFFC-LLDRKRKRN  65

Query  760  VDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaf  581
             D  T+  LM P LF + A+ GLL G+ +Y+Y YG++ LPVST+SLI++SQLAFTA FAF
Sbjct  66   RDEKTRLILMKPRLFAAAAVAGLLTGVDDYIYAYGLSFLPVSTASLIIASQLAFTAFFAF  125

Query  580  fLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIM  401
            FLVKQ FT FS+N+IVLLT GA VL L    D P  E++K+Y  GF+LT+G+A LY  ++
Sbjct  126  FLVKQKFTPFSINAIVLLTLGAGVLALHTAGDVPPNETHKQYITGFLLTIGAAVLYAFVL  185

Query  400  PLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAK  221
            PLVEL Y KAN PI Y LVLEFQ V+   ATLFC+ G+FI+ DF++IP EA+ F+LG   
Sbjct  186  PLVELSYKKANQPITYTLVLEFQFVMCFFATLFCATGLFISGDFKMIPAEAKTFKLGETL  245

Query  220  YYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGV  41
            YY++++ + +++Q F +GA+GVI   SSL+S ++  VLLP+TE+LAV+ F EKFQ EKGV
Sbjct  246  YYVVIVFASMMWQCFFLGAIGVIFCASSLVSGILIAVLLPLTEILAVVFFGEKFQAEKGV  305

Query  40   SLFLCLWGFVSYF  2
            SL L LWGF SYF
Sbjct  306  SLVLSLWGFASYF  318



>ref|XP_010460596.1| PREDICTED: purine permease 3 [Camelina sativa]
Length=353

 Score =   297 bits (761),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 172/319 (54%), Positives = 240/319 (75%), Gaps = 0/319 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M    ++ N I+LAIGNCGGPL++RLYF  GG R+WFST+L+TA +PV+FIPLL SY+ R
Sbjct  1    MAKALVIINCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIHR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RR  +  ++ T FFL+ P L  +  +IG+L G  NYLY YG+A LPVST++LI++SQLAF
Sbjct  61   RRNNNGGENATSFFLIKPRLLGAAIVIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAF  120

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
             A+F+FF+VK  FT F++N++VLLT GA VLG+    DRP  E++K+Y +GF++T+ +A 
Sbjct  121  IAIFSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDRPVHETHKQYVIGFLVTVAAAV  180

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            +Y  I+PLVEL Y KA  P+ Y LVLE QM++   A++   +GM I  DF+ +P+EA+EF
Sbjct  181  VYAFILPLVELAYQKAKQPLSYTLVLEVQMILCFLASIVSLIGMSIAGDFKALPKEAKEF  240

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            +LG A +Y++ + S II+Q F +GA+G+I   SSL+S ++ +VLLP+TE+LAVI +HEKF
Sbjct  241  KLGEALFYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKF  300

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKG+SL L LWGFVSYF
Sbjct  301  QAEKGLSLALSLWGFVSYF  319



>emb|CDY16284.1| BnaC01g23190D [Brassica napus]
Length=377

 Score =   298 bits (763),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 176/323 (54%), Positives = 232/323 (72%), Gaps = 7/323 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
             KM+T  ++ N I+LAIGNCGGPL+ RLYF  GG R+WFS++LQTA  P +  PLL S+L
Sbjct  33   KKMKTGLVIINCIILAIGNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPSILFPLLFSFL  92

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            RR+       + T FFL+ P LF++  +IGLL G+ NYLY YG+A LPVSTSSL++SS L
Sbjct  93   RRKEA-----TTTPFFLIKPPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSHL  147

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAFF+VKQ FT F +N++VLLT GA +L L    D+ A E++KEY +GF +TL +
Sbjct  148  AFTAFFAFFMVKQKFTPFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFFMTLAA  207

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A LY  ++PLVEL Y KA   I Y LVLE Q+V+   AT FC VGM  + DF+ + REAR
Sbjct  208  AILYAFVLPLVELTYKKARQRISYTLVLEMQLVLCFVATCFCLVGMLADGDFKELAREAR  267

Query  244  EFELGAAK--YYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILF  71
            +F+LG +   YY++V+ + II+Q F +G++G+I   SSL+S ++   LLP+TE+LAV  F
Sbjct  268  DFKLGGSTTYYYVVVVFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFF  327

Query  70   HEKFQPEKGVSLFLCLWGFVSYF  2
             EKFQ EK +SLFL LWGFVSYF
Sbjct  328  REKFQAEKSISLFLSLWGFVSYF  350



>ref|XP_010499329.1| PREDICTED: purine permease 3-like [Camelina sativa]
 ref|XP_010499330.1| PREDICTED: purine permease 3-like [Camelina sativa]
Length=355

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 171/319 (54%), Positives = 237/319 (74%), Gaps = 0/319 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M    ++ N I+LAIGNCGGPL++RLYF  GG R+WFST+L+TA +PV+FIPLL SY+ R
Sbjct  1    MAKALVIINCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIHR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            R+  +  ++ T FFL+ P L  +   IG+L G  NYLY YG+A LPVST++LI++SQLA 
Sbjct  61   RKNNNGGENATSFFLIKPRLLGAAIFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAC  120

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
             A+F+FF+VK  FT F++N++VLLT GA VLG+    DRP  E++K+Y LGF++T+ +A 
Sbjct  121  IAIFSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDRPVHETHKQYVLGFLVTVAAAV  180

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            +Y  I+PLVEL Y KA  P+ Y LVLE QM++   A++   +GM I  DF+ +P+EA+EF
Sbjct  181  VYAFILPLVELAYQKAKQPLSYTLVLEVQMILCFLASIVSLIGMSIAGDFKALPKEAKEF  240

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            +LG   YY++ + S II+Q F +GA+G+I   SSL+S ++ +VLLP+TE+LAVI +HEKF
Sbjct  241  KLGEVLYYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKF  300

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKG+SL L LWGFVSYF
Sbjct  301  QAEKGLSLALSLWGFVSYF  319



>ref|XP_006358992.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=358

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 230/321 (72%), Gaps = 3/321 (1%)
 Frame = -1

Query  961  KMRT-IFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            KM+    L+ N I+ +IGNCGGPL+ RLYF+ GG R+W S+WLQT A P++ IPL ISY 
Sbjct  11   KMKKFTLLILNIIMFSIGNCGGPLISRLYFIHGGQRIWLSSWLQTIACPLILIPLSISYF  70

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR+  S   +  + F +T    I    +G++ GL  Y  ++G AKLPVSTSSLI ++QL
Sbjct  71   HRRKIESP--ATARIFSLTRREIIGSTGVGIIAGLDGYFISWGPAKLPVSTSSLINATQL  128

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTALFA  LVKQ  T +S  S+ LL AGA  L LR   DRPAG S KEY +GFV+T+  
Sbjct  129  AFTALFAVLLVKQKLTVYSKLSVFLLIAGAATLALRGKGDRPAGVSVKEYVIGFVMTVMG  188

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A  +GL++ L+ELIY KA   I Y +VLE Q+++ ++AT+FC++GM IN+DFQ IP+EA 
Sbjct  189  AVCFGLMVSLIELIYIKAKNAISYTMVLEIQLIIGVSATVFCTIGMIINNDFQAIPKEAS  248

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            E+E+G AKYY++++   II+Q  L+G +GVI Y SSLLS +I   LLPVTE+LA++LFHE
Sbjct  249  EYEIGEAKYYLVLVWCAIIWQLALMGLVGVIFYSSSLLSGIIGAFLLPVTEILAIVLFHE  308

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQ EKGV++FL L GFVSYF
Sbjct  309  KFQVEKGVAIFLALCGFVSYF  329



>ref|XP_010675382.1| PREDICTED: purine permease 3-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 167/322 (52%), Positives = 230/322 (71%), Gaps = 5/322 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
             KM+ + L+ N  +LAIG   GPL++RLY++ GG  +W S+WL+T  WPV+ +PLL++Y 
Sbjct  46   TKMKKLLLILNCFMLAIGISAGPLIMRLYYIHGGKSIWLSSWLETGGWPVMILPLLVAYF  105

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            RR       D   K F +    F   A++GL+ G  +Y Y YGV  +PVSTSSLI+++QL
Sbjct  106  RR----RRTDPEAKLFYIKANTFCYAAIVGLVAGSADYCYAYGVKHIPVSTSSLILATQL  161

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA+FAF LV+Q FTAFSVN++ LLT GA+VL L AGNDRPAGES  +Y +GF  TL S
Sbjct  162  AFTAVFAFILVRQKFTAFSVNAVALLTFGAIVLALHAGNDRPAGESKAQYFVGFFFTLAS  221

Query  424  AALYGLIMPLVELIYNK-ANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREA  248
            +AL+ L++P++EL Y +  +T + Y LV+E Q+V+S +AT  C+VGM  + D++   RE 
Sbjct  222  SALFALMLPMIELTYRRVKHTAVNYSLVMEIQLVLSFSATALCTVGMLASGDYKGYAREV  281

Query  247  REFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFH  68
            +E++LG A Y++++I S I++QFF +GA GVI YGSSLLS +I  V LP+TE+ A+  +H
Sbjct  282  QEYKLGNAMYFVVLIISAIVWQFFYLGAAGVIYYGSSLLSGIIIAVALPITEIAAIFFYH  341

Query  67   EKFQPEKGVSLFLCLWGFVSYF  2
            EKFQ EKGVSL L LWGF SYF
Sbjct  342  EKFQVEKGVSLVLSLWGFFSYF  363



>ref|XP_006415682.1| hypothetical protein EUTSA_v10008037mg [Eutrema salsugineum]
 gb|ESQ34035.1| hypothetical protein EUTSA_v10008037mg [Eutrema salsugineum]
Length=356

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 225/310 (73%), Gaps = 6/310 (2%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRS-----DVDSN  749
            G CGGPLL RLY+  GG R+WF + L TA  P++ IPL  S+L R R        +    
Sbjct  16   GTCGGPLLTRLYYNNGGKRIWFMSSLSTAGCPIILIPLFFSFLSRHRSNRNRNNSENAEK  75

Query  748  TKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVK  569
            TK FLM   LFI+  +IGLL GL NYLY YG+A LPVSTSSLI+ +QLAF ALFAFF+VK
Sbjct  76   TKIFLMETPLFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNALFAFFMVK  135

Query  568  QHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVE  389
            Q FT FS+N++VLLT G  +L L +  D+PA ES+KEY +GF++T+ +A LY  I+PLVE
Sbjct  136  QKFTPFSINAVVLLTVGTGILALHSDGDKPAKESHKEYVVGFLMTVIAAVLYAFILPLVE  195

Query  388  LIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFEL-GAAKYYI  212
            L Y KA   I + LVLE QMV+ LAAT FC VGM I+ DF+VI REAREF++ G+A YY 
Sbjct  196  LTYKKARQEITFTLVLEIQMVMCLAATCFCLVGMLIDGDFKVIAREAREFKIGGSAFYYT  255

Query  211  LVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLF  32
            L++ +GII+Q F +GA+G++   SSL S V+ +VLLPVTE+LAV+ F EKFQ +KGV+L 
Sbjct  256  LIVMTGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQADKGVALL  315

Query  31   LCLWGFVSYF  2
            L LWGFVSYF
Sbjct  316  LSLWGFVSYF  325



>ref|XP_009621473.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=353

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 174/319 (55%), Positives = 242/319 (76%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            MR I LL N ++LA+G CGGPL++RLY++ GG+R+W S+WLQT  WP+  +PL + YL R
Sbjct  10   MRRILLLINCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTLVPLALLYLYR  69

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            R+ +     + KF+ +TP +FI+  +IG+  G+ ++LY++G +KLPVSTSSL++++QLAF
Sbjct  70   RKIKGP---DAKFYFITPRIFIASFIIGIATGVDDFLYSWGGSKLPVSTSSLLLAAQLAF  126

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA+ AFF+VK  FT +S N++VLLT GA++LG+RA  DRP G ++K Y LGF++TL +AA
Sbjct  127  TAIGAFFIVKLKFTPYSTNAVVLLTVGAILLGIRANGDRPEGVTSKAYILGFIMTLLAAA  186

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            LYG+I+P +EL+Y KA   I   LVLE QMV+  AAT FC+VGM  N DFQ + REA++F
Sbjct  187  LYGVILPCIELMYLKAKQAITATLVLEIQMVMCFAATAFCTVGMIANKDFQAMSREAKQF  246

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG A+YY +++ + II+Q F +G +GVI   SSL+S V+  VLLPVTE+LAVI F+EKF
Sbjct  247  NLGEARYYTVIVWTAIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVIFFNEKF  306

Query  58   QPEKGVSLFLCLWGFVSYF  2
              EKG++LFL LWGFVSYF
Sbjct  307  SGEKGLALFLSLWGFVSYF  325



>ref|XP_010942637.1| PREDICTED: purine permease 3-like isoform X1 [Elaeis guineensis]
Length=448

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 228/320 (71%), Gaps = 0/320 (0%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              ++   ++ N +LL +G+ GGPLL RLYF  GG R W ++WL+T  WP++ +PL ISYL
Sbjct  102  KALKRALVVLNCLLLFVGDTGGPLLSRLYFRHGGHRQWLASWLETGGWPLILLPLFISYL  161

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RRR  SD    TK F +TP LF++ A++GLL G  ++LY YG++ LPVSTS++++S+QL
Sbjct  162  YRRRLASDHHHPTKLFFLTPRLFLACAVLGLLTGTDDFLYAYGLSFLPVSTSAILISTQL  221

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAF +VKQ FT +S+NSI LL+ GAV+LGL   +DRP   S  +Y +GF LTLG+
Sbjct  222  AFTAFFAFLIVKQKFTPYSINSIALLSVGAVILGLHTSSDRPDNVSQGQYLMGFFLTLGT  281

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYGL++PLVEL Y KA+  I Y LV+E Q+V+   AT FC++GM +N DF+ I REAR
Sbjct  282  AALYGLVLPLVELTYRKASQVITYTLVMEMQLVMGFFATAFCTIGMLVNKDFEAIQREAR  341

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            ++ LG  KYY++++   I++Q F +G +GVI   ++LL+ +I  VL+PV EL   I  HE
Sbjct  342  QYGLGEVKYYVVLVWCAILWQCFFLGTVGVIFCVNTLLAGIIIAVLIPVIELFGAIFLHE  401

Query  64   KFQPEKGVSLFLCLWGFVSY  5
            KF  EKGVSL LCLWG  SY
Sbjct  402  KFTSEKGVSLALCLWGLASY  421



>ref|XP_009770717.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=350

 Score =   295 bits (754),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 172/321 (54%), Positives = 244/321 (76%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              MR I LL N ++LA+  CGGPL++RLY++ GG+R+WFS+WLQTA WP+  IPL+I Y 
Sbjct  8    TTMRRILLLINCLILAVDICGGPLMMRLYYVEGGSRIWFSSWLQTAGWPITLIPLVILYF  67

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             R+       +N K++L+TP +FI+  +IG++ GL ++LY++G +KLPVSTSSL++++QL
Sbjct  68   YRQ---KTEGTNAKYYLITPRIFIASFIIGVVTGLDDFLYSWGGSKLPVSTSSLLLAAQL  124

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA+ AFF+VK  FT +S+N++VLLT GAV+LG+R+  DRP G ++K Y +GF++TL +
Sbjct  125  AFTAIGAFFIVKLKFTPYSINAVVLLTLGAVLLGVRSNGDRPEGVTSKAYIIGFMMTLLA  184

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG+I+P +ELIY KA   I   LVLE QMV+  AAT FC+VGM +N++F+ I REA+
Sbjct  185  AALYGVILPCIELIYLKAKQAITATLVLEIQMVMCFAATAFCTVGMIVNNNFKAISREAK  244

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            +F LG A+YY +++ + I++  F +G +GVI   SSL+S V+  VLLPVTE+LAV+ F E
Sbjct  245  QFNLGEARYYTVIVWTTIVWLCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFRE  304

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
             F  EKG++LFLCLWGFVS F
Sbjct  305  NFLVEKGLALFLCLWGFVSCF  325



>ref|XP_008667894.1| PREDICTED: PUP1 isoform X1 [Zea mays]
 tpg|DAA40285.1| TPA: PUP1 [Zea mays]
Length=387

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 175/326 (54%), Positives = 230/326 (71%), Gaps = 5/326 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              +R   L+ N +L+ +G+ GGPL LR YFL GGAR W S  LQTA +P++ +PL +S+ 
Sbjct  37   RTLRNPLLVVNFVLMVVGSAGGPLFLRAYFLHGGARKWLSALLQTAGFPLLLVPLCVSFS  96

Query  784  rrrrrRSD-VDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
            RRRRRR D   +   FFLMTP L  + A IGL+ GL + LY YG+A LPVSTSS+++S+Q
Sbjct  97   RRRRRRDDGAPAKAPFFLMTPRLLAASAAIGLMTGLDDLLYAYGLAYLPVSTSSILISTQ  156

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            LAFTA FA  LV+Q FTAFSVN++ LL+AGA +LG+ AG DRPAG S  +YG GF +TLG
Sbjct  157  LAFTAAFALLLVRQRFTAFSVNAVALLSAGAAMLGMNAGGDRPAGVSPAQYGAGFAMTLG  216

Query  427  SAALYGLIMPLVEL----IYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVI  260
            +AALYGL++P +EL            + Y LV+E Q+V+ L AT+F +VGM  NHD   I
Sbjct  217  AAALYGLLLPAMELSQAQARAGTAAAVTYTLVIEMQLVIGLTATVFSAVGMLANHDLHAI  276

Query  259  PREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAV  80
            P EAREF+LG + YY+L+  S   +Q F +G +G + +GS+LL+ V+ TVL+PVTE+LAV
Sbjct  277  PGEAREFDLGRSGYYLLLAGSAATYQCFFLGTIGAVFFGSALLAGVVMTVLIPVTEVLAV  336

Query  79   ILFHEKFQPEKGVSLFLCLWGFVSYF  2
            + FHE F   KGV+L L LWGFVSYF
Sbjct  337  VFFHEPFNGTKGVALALSLWGFVSYF  362



>ref|NP_180931.2| purine permease 2 [Arabidopsis thaliana]
 sp|Q94GB1.1|PUP2_ARATH RecName: Full=Purine permease 2; Short=AtPUP2 [Arabidopsis thaliana]
 gb|AAK61813.1|AF078532_1 putative purine permease [Arabidopsis thaliana]
 gb|AEC08880.1| purine permease 2 [Arabidopsis thaliana]
Length=358

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 184/331 (56%), Positives = 244/331 (74%), Gaps = 12/331 (4%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
            KM+T+ ++ N I LAIGNCGGPL++RLYF  GG R+WF ++LQT   P++F PLL+S+LR
Sbjct  2    KMKTVLVIINCIFLAIGNCGGPLMMRLYFQNGGERIWFPSFLQTVGCPLIFFPLLLSFLR  61

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            RRR   + ++ T FFLM P LFI+  ++GLLVG  NYLY+YG+A +PVST+SLI+S+QL 
Sbjct  62   RRRCLEEQET-TPFFLMKPPLFIAAIVVGLLVGFDNYLYSYGLAYIPVSTASLIISAQLG  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTALFAFF+VKQ FT F++N+IVLLT GAVVL L + +D+ A E++KEY +GF++TLG+A
Sbjct  121  FTALFAFFMVKQKFTPFTINAIVLLTGGAVVLALNSDSDKLANETHKEYVVGFIMTLGAA  180

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ--------  266
             LYG I+PLVEL Y K+   I Y L LEFQMV+  AAT  C VGM    DF+        
Sbjct  181  LLYGFILPLVELSYKKSGQRITYTLALEFQMVLCFAATCVCLVGMLAAGDFKVKHALFIF  240

Query  265  ---VIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVT  95
               VI  EAR+F+LG + YY++++ + II+Q F +GA+G+I   SSL+S ++ + LLPVT
Sbjct  241  KNRVIAGEARDFKLGESLYYVVIVFTAIIWQAFFVGAIGLIFCASSLVSGIMVSALLPVT  300

Query  94   ELLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
             +LAVI F EKFQ  KGV+L L LWG VSYF
Sbjct  301  VILAVICFQEKFQAGKGVALALSLWGSVSYF  331



>ref|XP_009783837.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=353

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 240/321 (75%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              MR I LL N ++LA+G CGGPL++RLY++ GG+R+W S+WLQT  WP+  +PL I YL
Sbjct  8    TNMRRILLLINCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTIVPLAILYL  67

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR+       + KF+ +TP +F++  +IG+  G+ ++LY++G +KLPVSTSSL++++QL
Sbjct  68   YRRKIEGP---DAKFYFITPRIFVASFIIGIATGVDDFLYSWGGSKLPVSTSSLLLAAQL  124

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA+ AFF+VK   T +S N++VLLT GAV+LG+RA  DRP G ++K Y LGF++TL +
Sbjct  125  AFTAIGAFFIVKLKLTPYSTNAVVLLTVGAVLLGIRANGDRPEGVTSKAYILGFIMTLLA  184

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AALYG+I+P +EL+Y KA   I   LVLE QMV+  AAT FC+VGM  N DFQ + REA+
Sbjct  185  AALYGIILPCIELMYLKAKQSITATLVLEIQMVMCFAATAFCTVGMIANKDFQAMSREAK  244

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            +F LG A+YY +++ + II+Q F +G +GVI   SSL+S V+  VLLPVTE+LAV+ F+E
Sbjct  245  QFNLGEARYYTVIVWTAIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVFFNE  304

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KF  EKG++LFL LWGFVSYF
Sbjct  305  KFSGEKGLALFLSLWGFVSYF  325



>ref|XP_007136297.1| hypothetical protein PHAVU_009G034400g [Phaseolus vulgaris]
 gb|ESW08291.1| hypothetical protein PHAVU_009G034400g [Phaseolus vulgaris]
Length=366

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 229/307 (75%), Gaps = 1/307 (0%)
 Frame = -1

Query  919  AIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrr-rRSDVDSNTK  743
            A+G  GGPL++RLYFLRGG R+W S +L+TA +P++  PL++SYLRRRR   +   +  +
Sbjct  26   AVGTTGGPLVMRLYFLRGGNRVWLSCFLETAGFPLMVPPLILSYLRRRRGAVAAGTAKPR  85

Query  742  FFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQH  563
               M   L  + A IG+L GL +YLY YGVA+LPVSTS+LI+++QL FTA FAF LV+Q 
Sbjct  86   LVSMNIPLLAASAFIGVLTGLDDYLYAYGVARLPVSTSALIIATQLGFTAFFAFLLVRQK  145

Query  562  FTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELI  383
            FT++SVN++VLLT GAVVL L A  DRP GES K Y +GFV+T+ +AALYG ++PLVEL+
Sbjct  146  FTSYSVNAVVLLTIGAVVLALHASGDRPHGESVKAYVMGFVMTVIAAALYGFVLPLVELV  205

Query  382  YNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVI  203
            Y K   PI Y LV+E Q V+  +ATLFC +GM +N+DF+ IP EA++F+ G   YY +++
Sbjct  206  YKKCKQPITYSLVMEIQFVLCFSATLFCGIGMIVNNDFKAIPIEAKKFKHGEVNYYTVLV  265

Query  202  CSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCL  23
             S I++Q F +GA+GVI   SSLLS ++  VLLPVTE+LAVIL+ EKF+ EKGVSL L L
Sbjct  266  ASAILWQAFFLGAIGVIFCASSLLSGILIAVLLPVTEVLAVILYREKFKAEKGVSLLLSL  325

Query  22   WGFVSYF  2
            WG VSYF
Sbjct  326  WGMVSYF  332



>ref|XP_007141230.1| hypothetical protein PHAVU_008G178300g [Phaseolus vulgaris]
 gb|ESW13224.1| hypothetical protein PHAVU_008G178300g [Phaseolus vulgaris]
Length=344

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 230/306 (75%), Gaps = 3/306 (1%)
 Frame = -1

Query  919  AIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKF  740
            A+G  GGPL++RLYF+ GG R+W S++L+TAA+P++ IPL IS+L R    S      K 
Sbjct  14   AMGTSGGPLVMRLYFIHGGNRIWLSSFLETAAFPLILIPLTISHLHRT---SHHSPKPKL  70

Query  739  FLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHF  560
              +   LF++ A+IG+L GL +YLY  G+A+LPVSTSSLI +S LAFTA+FAF LVK  F
Sbjct  71   VSIKLPLFLASAVIGILTGLDDYLYACGIARLPVSTSSLIQASHLAFTAVFAFLLVKHRF  130

Query  559  TAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIY  380
            TA+SVN+IVLLT  AVVL LR+G DRP+GES ++Y +GFV+ L +AALYG ++PL+EL+Y
Sbjct  131  TAYSVNAIVLLTVAAVVLALRSGGDRPSGESTRQYVIGFVMILAAAALYGFVLPLMELVY  190

Query  379  NKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVIC  200
             ++   + Y LV+E Q V+   ATLFC++GM IN+DF+VI REA++++LG  KYY++++ 
Sbjct  191  KRSKQRVTYSLVMEIQFVMCFFATLFCTIGMLINNDFKVIWREAKDYKLGETKYYVVLVG  250

Query  199  SGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLW  20
            S I++QFF +GA+GVI   SSL S +I    LPVTE+L VI++ E F+ EKGV+L L LW
Sbjct  251  SAIMWQFFFLGAIGVIFCSSSLFSGIIIAAFLPVTEVLGVIVYKENFEAEKGVALLLSLW  310

Query  19   GFVSYF  2
            GFVSYF
Sbjct  311  GFVSYF  316



>gb|AAC69140.1| hypothetical protein [Arabidopsis thaliana]
Length=356

 Score =   292 bits (748),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 183/330 (55%), Positives = 243/330 (74%), Gaps = 12/330 (4%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+T+ ++ N I LAIGNCGGPL++RLYF  GG R+WF ++LQT   P++F PLL+S+LRR
Sbjct  1    MKTVLVIINCIFLAIGNCGGPLMMRLYFQNGGERIWFPSFLQTVGCPLIFFPLLLSFLRR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RR   + ++ T FFLM P LFI+  ++GLLVG  NYLY+YG+A +PVST+SLI+S+QL F
Sbjct  61   RRCLEEQET-TPFFLMKPPLFIAAIVVGLLVGFDNYLYSYGLAYIPVSTASLIISAQLGF  119

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TALFAFF+VKQ FT F++N+IVLLT GAVVL L + +D+ A E++KEY +GF++TLG+A 
Sbjct  120  TALFAFFMVKQKFTPFTINAIVLLTGGAVVLALNSDSDKLANETHKEYVVGFIMTLGAAL  179

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ---------  266
            LYG I+PLVEL Y K+   I Y L LEFQMV+  AAT  C VGM    DF+         
Sbjct  180  LYGFILPLVELSYKKSGQRITYTLALEFQMVLCFAATCVCLVGMLAAGDFKVKHALFIFK  239

Query  265  --VIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTE  92
              VI  EAR+F+LG + YY++++ + II+Q F +GA+G+I   SSL+S ++ + LLPVT 
Sbjct  240  NRVIAGEARDFKLGESLYYVVIVFTAIIWQAFFVGAIGLIFCASSLVSGIMVSALLPVTV  299

Query  91   LLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            +LAVI F EKFQ  KGV+L L LWG VSYF
Sbjct  300  ILAVICFQEKFQAGKGVALALSLWGSVSYF  329



>ref|XP_004959530.1| PREDICTED: purine permease 1-like [Setaria italica]
Length=378

 Score =   293 bits (749),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 228/324 (70%), Gaps = 9/324 (3%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            +R   L+ N +L+ +G  GGPL LR YFL GGAR W S +LQTA +P++ +PL +S+   
Sbjct  33   LRNPLLVVNFVLMVVGTAGGPLFLRAYFLHGGARKWLSAFLQTAGFPLLLVPLCVSF---  89

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
              RR      T FFLMTP L ++ A IGL+ GL + LYTYG+A LPVSTSS+++S+QLAF
Sbjct  90   -SRRKKAAGGTPFFLMTPRLLVASAGIGLMTGLDDLLYTYGLAYLPVSTSSILISTQLAF  148

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA FA  LV+Q FTA SVN++VLL+ GA +LG+ AG DRPAG S  +Y  GF +TLG+AA
Sbjct  149  TAAFALLLVRQRFTASSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYSAGFAMTLGAAA  208

Query  418  LYGLIMPLVELIYNK-----ANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPR  254
            L+GL++P++EL   +        P+ Y LV+E Q+V+ L AT+F +VGM +N+DF  IP 
Sbjct  209  LFGLVLPVMELSQARHAARPGAAPVTYTLVIEMQLVIGLTATIFTAVGMLVNNDFHAIPE  268

Query  253  EAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVIL  74
            EAR+F  G + YY+L+  S   +Q F +G +G I +GS+LL+ VI TVL+PVTE+LAV+L
Sbjct  269  EARQFGFGRSGYYLLLAGSAATYQCFFLGTIGAIFFGSALLAGVIMTVLIPVTEVLAVML  328

Query  73   FHEKFQPEKGVSLFLCLWGFVSYF  2
            F E F   KGV+L L LWGFVSYF
Sbjct  329  FSEPFNGTKGVALALSLWGFVSYF  352



>ref|XP_006338102.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=352

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 231/321 (72%), Gaps = 3/321 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            +K R   L+ N I L IG CGGP++ RLYFL GG R+W S+WL    WP++ I L+I+Y 
Sbjct  6    SKWRKFILVLNCIALGIGYCGGPVISRLYFLHGGQRIWLSSWLACIGWPIILIVLIIAYF  65

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             R        S+  F  +T   F S A +G+LVGL  YLYT+G AKLPVSTS++I ++QL
Sbjct  66   YRL---KTQGSDINFLCITLQEFTSSAALGILVGLAGYLYTWGPAKLPVSTSTVIYAAQL  122

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
             FT +FAF +VKQ  TA+SVN++VLL  GA  L LRA +DRP GES K+Y LGFV+TL +
Sbjct  123  GFTVIFAFLIVKQKLTAYSVNAVVLLIVGAGTLALRAESDRPEGESTKQYVLGFVMTLLA  182

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AA  GL +PL+ELIY +A   + YI++LE QM++++ A+ FC+VGM +N DFQ I REA 
Sbjct  183  AASTGLALPLLELIYIRAKKNVTYIMILEIQMILNIFASAFCTVGMIVNKDFQAISREAS  242

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            +FELG AKYY++++ S II+QF  +G +GV+ YGSSLL  ++  +LLP+TELL VIL+HE
Sbjct  243  QFELGKAKYYLVLVWSAIIWQFSTLGIVGVVQYGSSLLCGILIALLLPLTELLGVILYHE  302

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
             FQ  KG+++FL LWGFVSYF
Sbjct  303  TFQVTKGLAIFLSLWGFVSYF  323



>ref|XP_010549318.1| PREDICTED: purine permease 3-like [Tarenaya hassleriana]
Length=347

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 171/320 (53%), Positives = 229/320 (72%), Gaps = 1/320 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M    ++ N +LL IGNCGGPL+ RLY+  GG  +W S++L+T  +P++ IPLL  +L R
Sbjct  1    MGKALVILNCVLLGIGNCGGPLMSRLYYNNGGKSVWLSSFLETGGFPLMLIPLLFCFLNR  60

Query  778  rrrRS-DVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            RR    + D N    LM P LF+  A+ GLL G+ +Y+Y YG++ LPVST+SLI++SQLA
Sbjct  61   RRNHGRNSDGNAGVILMKPRLFMGAAVSGLLTGVDDYIYAYGLSFLPVSTASLIIASQLA  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTA FAFFLVKQ FT FS+N+IVLLT GA VL L   +D PA E+ K+Y  GFVLT+G+A
Sbjct  121  FTAFFAFFLVKQKFTPFSINAIVLLTLGAGVLALHTASDIPANETKKQYVTGFVLTVGAA  180

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LY  ++PL+EL Y KA   I Y +VLEFQ V+   ATLFC  GM I+ DF++IP+EA  
Sbjct  181  VLYAFVLPLIELSYKKARQTISYDVVLEFQFVMCFFATLFCFAGMLISGDFKMIPKEAET  240

Query  241  FELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEK  62
            F+LG + YY++++ + +++Q F +GA+GVI   SSL+S ++  VLLPVTE+LAV+ +HE 
Sbjct  241  FQLGPSLYYVVLVGASLMWQCFFLGAIGVIFCASSLVSGILIAVLLPVTEVLAVVFYHET  300

Query  61   FQPEKGVSLFLCLWGFVSYF  2
            F  EKGVSL L LWGF SYF
Sbjct  301  FSSEKGVSLVLSLWGFASYF  320



>gb|EAZ09425.1| hypothetical protein OsI_31698 [Oryza sativa Indica Group]
Length=388

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 175/328 (53%), Positives = 229/328 (70%), Gaps = 10/328 (3%)
 Frame = -1

Query  955  RTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrr  776
            R+  L+ N +L+ +G+  GPLLLR YFLRGG R W S+ LQTA WP++  PL  SY  RR
Sbjct  34   RSPLLVVNFVLMVVGSACGPLLLRAYFLRGGNRKWLSSLLQTAGWPLLLAPLCFSYSSRR  93

Query  775  rrRSDVDSN-------TKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIV  617
            RRR   D         T  FLMTP L ++ A++GL+ G+ + LY YG+A LPVSTSS+++
Sbjct  94   RRREVEDDGAGAGAAATPLFLMTPRLLVASAVVGLMTGVDDLLYAYGLAYLPVSTSSILI  153

Query  616  SSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVL  437
            S+QLAFTA FA  LV+Q FTAFSVN++VLL+ GA +LG+ AG DRPAG S  +Y  GF +
Sbjct  154  STQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYCAGFAM  213

Query  436  TLGSAALYGLIMPLVELI---YNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ  266
            TL +AALYGL++P++EL    +  A   + Y LV+E Q+V+   AT F +VGM +N+DF 
Sbjct  214  TLAAAALYGLVLPVMELSQAHHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVNNDFH  273

Query  265  VIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELL  86
             IP EA EF LG A YY+L+  S  ++Q F +G +G I YGS+LL+ VI TVL+PVTE+L
Sbjct  274  AIPGEAHEFGLGQAGYYLLLAGSAAMYQCFFLGTIGAIFYGSALLAGVIMTVLIPVTEVL  333

Query  85   AVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            AV+ FHE F   KGV+L L LWGFVSYF
Sbjct  334  AVMFFHEPFNGTKGVALALSLWGFVSYF  361



>ref|NP_001063424.1| Os09g0467300 [Oryza sativa Japonica Group]
 dbj|BAD17524.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAD19735.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAF25338.1| Os09g0467300 [Oryza sativa Japonica Group]
Length=390

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 175/328 (53%), Positives = 229/328 (70%), Gaps = 10/328 (3%)
 Frame = -1

Query  955  RTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrr  776
            R+  L+ N +L+ +G+  GPLLLR YFLRGG R W S+ LQTA WP++  PL  SY  RR
Sbjct  36   RSPLLVVNFVLMVVGSACGPLLLRAYFLRGGNRKWLSSLLQTAGWPLLLAPLCFSYSSRR  95

Query  775  rrRSDVDSN-------TKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIV  617
            RRR   D         T  FLMTP L ++ A++GL+ G+ + LY YG+A LPVSTSS+++
Sbjct  96   RRREVEDDGAGAGAAATPLFLMTPRLLVASAVVGLMTGVDDLLYAYGLAYLPVSTSSILI  155

Query  616  SSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVL  437
            S+QLAFTA FA  LV+Q FTAFSVN++VLL+ GA +LG+ AG DRPAG S  +Y  GF +
Sbjct  156  STQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYCAGFAM  215

Query  436  TLGSAALYGLIMPLVELI---YNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ  266
            TL +AALYGL++P++EL    +  A   + Y LV+E Q+V+   AT F +VGM +N+DF 
Sbjct  216  TLAAAALYGLVLPVMELSQAHHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVNNDFH  275

Query  265  VIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELL  86
             IP EA EF LG A YY+L+  S  ++Q F +G +G I YGS+LL+ VI TVL+PVTE+L
Sbjct  276  AIPGEAHEFGLGQAGYYLLLAGSAAMYQCFFLGTIGAIFYGSALLAGVIMTVLIPVTEVL  335

Query  85   AVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            AV+ FHE F   KGV+L L LWGFVSYF
Sbjct  336  AVMFFHEPFNGTKGVALALSLWGFVSYF  363



>gb|EMT19524.1| Purine permease 3 [Aegilops tauschii]
Length=333

 Score =   287 bits (734),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 168/310 (54%), Positives = 218/310 (70%), Gaps = 4/310 (1%)
 Frame = -1

Query  922  LAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTK  743
            + +G+  GPLLLR  FL GG R W S+ LQ A WP++  PL  S+L RRR   D  S T 
Sbjct  1    MVVGSAFGPLLLRASFLHGGPRKWLSSLLQPAGWPLLLAPLSASFLSRRRSNKDGSSATP  60

Query  742  FFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQH  563
             FLM+P L  +   +GL  GL + LY YG+A LPVSTSS+++S+QLAFTA FA  LV+Q 
Sbjct  61   LFLMSPRLLAATVAVGLRTGLDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLLVRQR  120

Query  562  FTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELI  383
            FTAFSVN++VLL+ GA +LG+ AG DRPAG +  +Y  GF +TLG+AALYGL++P++EL 
Sbjct  121  FTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVTRAQYYAGFGMTLGAAALYGLMLPVMELS  180

Query  382  YNKANTPIG----YILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYY  215
              +     G    YILV+E Q+V+   AT F ++GM +N+DF  IPREAREF LG   YY
Sbjct  181  QARHAARTGAAVTYILVMEMQIVIGFTATAFSAIGMLVNNDFHAIPREAREFGLGQIGYY  240

Query  214  ILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSL  35
            +L+  S I++QFF +G +G I YGS+LL+ VI TVL+PVTE+LAV+ FHE F   KGV+L
Sbjct  241  LLLAASAIVYQFFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVLFFHEPFNGTKGVAL  300

Query  34   FLCLWGFVSY  5
             L LWGFVSY
Sbjct  301  ALSLWGFVSY  310



>ref|NP_001147096.1| PUP1 [Zea mays]
 gb|ACG25423.1| PUP1 [Zea mays]
Length=373

 Score =   287 bits (735),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 170/331 (51%), Positives = 225/331 (68%), Gaps = 9/331 (3%)
 Frame = -1

Query  967  CNKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISY  788
               +R   L+ N +L+ +G+ GGPL LR YFL GGAR W S  LQTA +P++ +PL +S+
Sbjct  19   TRTLRNPLLVVNFVLMVVGSAGGPLFLRAYFLHGGARKWLSALLQTAGFPLLLVPLCVSF  78

Query  787  -----LrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSL  623
                  R RR      +   FFLMTP L  + A IGL+ GL + LY YG+A LPVSTSS+
Sbjct  79   SRRRRRRPRRPDDGAPAMAPFFLMTPRLLAASAAIGLMTGLDDLLYAYGLAYLPVSTSSI  138

Query  622  IVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGF  443
            ++S+QLAFTA FA  LV+Q FTAFSVN++ LL+AGA +LG+ AG DRPAG S  +YG GF
Sbjct  139  LISTQLAFTAAFALLLVRQRFTAFSVNAVALLSAGAAMLGMNAGGDRPAGVSPAQYGAGF  198

Query  442  VLTLGSAALYGLIMPLVEL----IYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINH  275
             +TLG+AALYGL++  +EL            + Y LV+E Q+V+ L AT+F +VGM  NH
Sbjct  199  AMTLGAAALYGLLLHAMELSQAQARAGTAAAVTYTLVIEMQLVIGLTATVFSAVGMLANH  258

Query  274  DFQVIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVT  95
            D   IP EAREF+LG + YY+L+  S   +Q F +G +G + +GS+LL+ V+ TVL+PVT
Sbjct  259  DLHAIPGEAREFDLGRSGYYLLLAGSAATYQCFFLGTIGAVFFGSALLAGVVMTVLIPVT  318

Query  94   ELLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            E+LAV+ FHE F   KGV+L L LWGFVSYF
Sbjct  319  EVLAVVFFHEPFNGTKGVALALSLWGFVSYF  349



>ref|XP_010478189.1| PREDICTED: purine permease 3-like [Camelina sativa]
Length=345

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 169/319 (53%), Positives = 236/319 (74%), Gaps = 2/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M    ++ N I+LAIGNCGGPL++RLYF  GG R+WFST+L+TA +PV+FIPLL SY+ R
Sbjct  1    MAKALVIINCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIHR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RR  +  ++ T FFL+ P L  +   IG+L G  NYLY YG+A LPVST++LI++SQLAF
Sbjct  61   RRNNNGGENATSFFLIKPRLLGAAIFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAF  120

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
             A+F+FF+VK  FT F++N++VLLT GA VLG+    D+P  E++K+Y  GF++T+ +A 
Sbjct  121  IAIFSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYVTGFLVTVAAAV  180

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            +Y  I+PLVEL Y KA  P+ Y LVL  QM++   A++   +GM I  DF+ +P+EA+EF
Sbjct  181  VYAFILPLVELAYQKAKQPLSYTLVL--QMILCFLASIVSLIGMSIAGDFKALPKEAKEF  238

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            +LG   +Y++ + S II+Q F +GA+G+I   SSL+S ++ +VLLP+TE+LAVI +HEKF
Sbjct  239  KLGEVLFYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKF  298

Query  58   QPEKGVSLFLCLWGFVSYF  2
            Q EKG+SL L LWGFVSYF
Sbjct  299  QAEKGLSLALSLWGFVSYF  317



>ref|XP_003519187.1| PREDICTED: purine permease 1-like [Glycine max]
Length=344

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 167/306 (55%), Positives = 226/306 (74%), Gaps = 4/306 (1%)
 Frame = -1

Query  919  AIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKF  740
            A G  GG L++RLYF+ GG R+W S++L+TAA+P++    ++  +     +     ++  
Sbjct  15   ATGTSGGALVMRLYFIHGGKRIWLSSFLETAAFPII----ILPIIISYIHKRRRHRSSAL  70

Query  739  FLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHF  560
              + P LF++ ALIGLL GL +YLY  GVA+LPVST SLI +S LAFTA+FAF LV+  F
Sbjct  71   ISIKPPLFLASALIGLLTGLDDYLYACGVARLPVSTFSLIQASHLAFTAVFAFLLVRHRF  130

Query  559  TAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIY  380
            T +SVNS+VLLT  AVVL LR+  DRPAGES+++Y +GFV+ L +AALYG ++PL+EL+Y
Sbjct  131  TPYSVNSVVLLTVAAVVLALRSSGDRPAGESSRQYVIGFVMILAAAALYGFVLPLMELVY  190

Query  379  NKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVIC  200
             K+   I Y LV+E Q+V+   ATLFC+VGM IN+DF+VIPREAR+F+LG  KYY++++ 
Sbjct  191  KKSRQRITYSLVMEIQLVLCFFATLFCTVGMIINNDFKVIPREARDFKLGETKYYVVLVW  250

Query  199  SGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLW  20
            S I++QFF +GA+GVI   SSLLS +I    LPVTE+LAVI++ E F  EKGV+L L LW
Sbjct  251  SAIMWQFFFLGAIGVIFCASSLLSGIIIAAFLPVTEVLAVIVYKESFHAEKGVALVLSLW  310

Query  19   GFVSYF  2
            GFVSYF
Sbjct  311  GFVSYF  316



>dbj|BAK04933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   283 bits (725),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 222/317 (70%), Gaps = 4/317 (1%)
 Frame = -1

Query  943  LLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRS  764
            L+ N +L+ +G+  GPLLLR YFL GG R W S+ LQTA WP++  PL  S+L RRR   
Sbjct  38   LVINFLLMVVGSAFGPLLLRAYFLHGGTRKWLSSLLQTAGWPLLLAPLGASFLSRRRSNK  97

Query  763  DVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfa  584
            D  S T  FLM+P L  +   +GL+ GL + LY YG+A LPVSTSS+++S+QLAFTA FA
Sbjct  98   DGGSATPLFLMSPRLLAATVAVGLMTGLDDLLYAYGLAYLPVSTSSILISTQLAFTAAFA  157

Query  583  ffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLI  404
              LV+Q FTAFSVN++VLL+ GA +LG+ AG DRPAG +  +Y  GF +TLG+A +YG++
Sbjct  158  LLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVTRPQYYAGFGMTLGAALIYGIV  217

Query  403  MPLVELIYNKANTPIG----YILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFE  236
            +P++EL   +     G    Y LV+E Q+V+   AT F +VGM +N+DF  I  EAREF 
Sbjct  218  LPVMELSQARHAARTGAAVTYTLVMEMQIVIGFTATAFSAVGMLVNNDFHAIRGEAREFG  277

Query  235  LGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQ  56
            LG + YY+L+  S  ++QFF +G +G I YGS+LL+ VI TVL+PVTE+LAV+ FHE F 
Sbjct  278  LGQSGYYLLLAGSATVYQFFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVMFFHEPFN  337

Query  55   PEKGVSLFLCLWGFVSY  5
              KGV+L L LWGFVSY
Sbjct  338  GTKGVALALSLWGFVSY  354



>ref|XP_006661330.1| PREDICTED: purine permease 3-like [Oryza brachyantha]
Length=377

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 172/323 (53%), Positives = 224/323 (69%), Gaps = 5/323 (2%)
 Frame = -1

Query  955  RTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrr  776
            R   L+ N IL+ +G+  GPLLLR YFLRGG R   ST L  A WP++ +PL  SY  RR
Sbjct  31   RNPLLVVNFILMVVGSACGPLLLRAYFLRGGRRKGLSTLLPPAGWPLLLVPLCFSYCSRR  90

Query  775  rrRSDVD--SNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            RR  +    + T  FLMTP L  + A +GL+ GL + LY YG+A LPVSTSS+++S+QLA
Sbjct  91   RREEEDGGAATTPLFLMTPRLLAASATVGLMTGLDDLLYAYGLAYLPVSTSSILISTQLA  150

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTA FA  LV+Q FTAFSVN++VLL+ GA +LG+  G DRPAG S  +Y  GF +TLG+A
Sbjct  151  FTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNTGGDRPAGVSRAQYYAGFAMTLGAA  210

Query  421  ALYGLIMPLVELIYNK---ANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPRE  251
            ALYGL++P++EL   +   A   + Y LV+E Q+V+   AT F +VGM +N+DF  IP E
Sbjct  211  ALYGLVLPVMELSQARHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVNNDFHAIPGE  270

Query  250  AREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILF  71
            A+ F LG A YY+L+  S  ++Q F +G +G I YGS+LL+ VI TVL+PVTE+LAV+ F
Sbjct  271  AQGFGLGQAGYYLLLAGSAAMYQCFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVMFF  330

Query  70   HEKFQPEKGVSLFLCLWGFVSYF  2
            HE F   KGV+L L LWGFVSYF
Sbjct  331  HEPFNGTKGVALALSLWGFVSYF  353



>dbj|BAJ88843.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   282 bits (721),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 167/333 (50%), Positives = 224/333 (67%), Gaps = 11/333 (3%)
 Frame = -1

Query  967  CNKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISY  788
               +R   L  N +LLA+G   GPLLLRLYFLRGGAR W S+ LQTA WP++ +PL  S+
Sbjct  60   ARPLRDPLLAVNFLLLAVGASCGPLLLRLYFLRGGARKWLSSLLQTAGWPLLLVPLCFSF  119

Query  787  ------LrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSS  626
                   R R+   D   ++  FLMTP L  +  ++G++ G  N+LY YG A LPVSTSS
Sbjct  120  SSRRRRRRHRQGGGDDPISSAVFLMTPRLLAATVVVGIMTGADNFLYAYGTAYLPVSTSS  179

Query  625  LIVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLG  446
            +++S+QLAFTA FA  +V+Q FTA +VN+IVLL+ GA +LG+ +G DRPAG +  +Y  G
Sbjct  180  ILISTQLAFTAAFALLVVRQRFTASTVNAIVLLSVGAAMLGMGSGGDRPAGVTGAQYAAG  239

Query  445  FVLTLGSAALYGLIMPLVEL-----IYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFI  281
            F   LG+AALYGL++P++EL             + Y LV+E Q+V+ L AT FC+VGM +
Sbjct  240  FGTALGAAALYGLVLPVMELSQAWHAARAGAAALTYTLVVEIQVVIGLTATAFCAVGMLV  299

Query  280  NHDFQVIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLP  101
            N DFQ IPREAR+ ELG A YY+L++ +  ++Q F +G +G I YGS+L + +I TV LP
Sbjct  300  NKDFQAIPREARQSELGKAGYYLLLVGTAAVYQCFCLGIIGAIYYGSALFAGIIITVFLP  359

Query  100  VTELLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            VTE+LAV+ FHE F   KGV+L L LWG  SYF
Sbjct  360  VTEVLAVVFFHEPFSGTKGVALGLSLWGLASYF  392



>ref|XP_009113691.1| PREDICTED: purine permease 1-like [Brassica rapa]
Length=355

 Score =   280 bits (716),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 236/323 (73%), Gaps = 4/323 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+   L+   ++LAIG CGGPLL RLY+  GG R+WF +++ TA  PV+FIPL++S+LRR
Sbjct  1    MKNSLLVLICMILAIGTCGGPLLTRLYYNNGGERIWFMSFISTAGCPVIFIPLVLSFLRR  60

Query  778  rrrR-SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            R R  S+    T+  LM   +F++  +IGLL+GL NY + YG+A LPVST+SLIV +QL 
Sbjct  61   RNRNNSENIEKTEIVLMETPMFMASIVIGLLIGLDNYCFAYGLAYLPVSTTSLIVGTQLG  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGN-DRPAGESNKEYGLGFVLTLGS  425
            F A+F+FF+VKQ FT FS+N++VLLTAG  +L LR G+ +R A  S+KEY +GF++TL +
Sbjct  121  FNAIFSFFMVKQTFTPFSINAVVLLTAGTGILALRGGDGERSADVSHKEYVVGFLVTLTA  180

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A LY  I+P VEL Y K    I + LVLE Q+V+ +AA+ FC VGM +  DF+VIP EAR
Sbjct  181  AVLYAFILPFVELTYKKVRQQITFTLVLEMQLVMCIAASCFCIVGMLVEGDFKVIPIEAR  240

Query  244  EFELG--AAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILF  71
            EF++G  +A YY+L++ +GI++Q   +GA+GV+   SSL S V+ + LLPVTE+LAV+ F
Sbjct  241  EFKVGGGSAFYYMLILMTGIVYQGLFLGAIGVVFCASSLASGVLISALLPVTEVLAVVCF  300

Query  70   HEKFQPEKGVSLFLCLWGFVSYF  2
             EKFQ EKGV+L L LWGFVSYF
Sbjct  301  REKFQVEKGVALLLSLWGFVSYF  323



>dbj|BAJ87663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score =   281 bits (718),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 167/333 (50%), Positives = 223/333 (67%), Gaps = 11/333 (3%)
 Frame = -1

Query  967  CNKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISY  788
               +R   L  N +LLA+G   GPLLLRLYFLRGGAR W S+ LQTA WP++ +PL  S+
Sbjct  31   ARPLRDPLLAVNFLLLAVGASCGPLLLRLYFLRGGARKWLSSLLQTAGWPLLLVPLCFSF  90

Query  787  ------LrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSS  626
                   R R+   D   +   FLMTP L  +  ++G++ G  N+LY YG A LPVSTSS
Sbjct  91   SSRRRRRRHRQGGGDDPISGAVFLMTPRLLAATVVVGIMTGADNFLYAYGTAYLPVSTSS  150

Query  625  LIVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLG  446
            +++S+QLAFTA FA  +V+Q FTA +VN+IVLL+ GA +LG+ +G DRPAG +  +Y  G
Sbjct  151  ILISTQLAFTAAFALLVVRQRFTASTVNAIVLLSVGAAMLGMGSGGDRPAGVTGAQYAAG  210

Query  445  FVLTLGSAALYGLIMPLVEL-----IYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFI  281
            F   LG+AALYGL++P++EL             + Y LV+E Q+V+ L AT FC+VGM +
Sbjct  211  FGTALGAAALYGLVLPVMELSQAWHAARAGAAALTYTLVVEIQVVIGLTATAFCAVGMLV  270

Query  280  NHDFQVIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLP  101
            N DFQ IPREAR+ ELG A YY+L++ +  ++Q F +G +G I YGS+L + +I TV LP
Sbjct  271  NKDFQAIPREARQSELGKAGYYLLLVGTAAVYQCFCLGIIGAIYYGSALFAGIIITVFLP  330

Query  100  VTELLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            VTE+LAV+ FHE F   KGV+L L LWG  SYF
Sbjct  331  VTEVLAVVFFHEPFSGTKGVALGLSLWGLASYF  363



>ref|XP_009401279.1| PREDICTED: purine permease 1-like [Musa acuminata subsp. malaccensis]
Length=368

 Score =   280 bits (716),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 178/326 (55%), Positives = 231/326 (71%), Gaps = 6/326 (2%)
 Frame = -1

Query  964  NK-MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISY  788
            NK +R   +  N +L+AIGN GGPLLLRLYF  GG R W S WL+T  WP++F+PLL+SY
Sbjct  20   NKGLRRALIAVNCVLMAIGNAGGPLLLRLYFHSGGKRQWLSGWLETGGWPIIFLPLLVSY  79

Query  787  LrrrrrRSDV-----DSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSL  623
            L RRRR            TK FL+T  LF+  A +GLL+GL ++LY YG++ LPVSTS+L
Sbjct  80   LHRRRRLLRGHGHRHQPPTKLFLITRPLFLYCAALGLLLGLDDFLYAYGLSFLPVSTSAL  139

Query  622  IVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGF  443
            ++S+QL FTA FAF LVKQ FT +S+NS+VLLT GAV+LGL   +DRP   +  EY +GF
Sbjct  140  LISAQLVFTAFFAFVLVKQKFTPYSINSVVLLTVGAVMLGLHVSSDRPNNVTRGEYYMGF  199

Query  442  VLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQV  263
            VLTLG+AA+YGL +PLVEL Y KA   I Y LV+E QMV+   AT FC+VGM +N DFQ 
Sbjct  200  VLTLGAAAVYGLFLPLVELTYTKAKQAITYTLVMEMQMVMGFFATAFCTVGMLVNKDFQA  259

Query  262  IPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLA  83
            IPREA+ +E G  +YY++++   I++QF  +G +GVI   ++LL+ V+  V +PVTE+ A
Sbjct  260  IPREAKHYEQGEFRYYVVLVWCAILWQFLFLGTVGVIFCVNTLLAGVLIAVFIPVTEVFA  319

Query  82   VILFHEKFQPEKGVSLFLCLWGFVSY  5
            VI F EKF  EKGV+L L LWG  SY
Sbjct  320  VIFFKEKFGSEKGVALALSLWGLASY  345



>dbj|BAJ86755.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=360

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 224/323 (69%), Gaps = 7/323 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              M+ + +  N  +L +G  GGPLL RLYF +GG R W S WL+T  WP++ +P+  SYL
Sbjct  20   KAMQRLLVALNCGMLTLGTTGGPLLSRLYFSKGGHRKWLSAWLETGGWPLLLLPVAASYL  79

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            RRR +    D +    L  P + ++ A +GL  G  ++LY YG++ +PVSTS++++S+QL
Sbjct  80   RRRAQ----DPSAPVVLAPPRILVAAAGLGLATGADDFLYAYGLSFVPVSTSAILISTQL  135

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFT LFAF +V+Q  TA SVN++ LLT GAVVLGL   +DRPAG +  +Y LGF+LTLGS
Sbjct  136  AFTVLFAFLIVRQRLTALSVNAVALLTVGAVVLGLHVSSDRPAGVTRGQYWLGFLLTLGS  195

Query  424  AALYGLIMPLVELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPR  254
            AALYGL++PL+EL Y +A      + Y LV+E Q+V+   AT FC+VGM +N+DFQ + R
Sbjct  196  AALYGLVLPLIELTYKRAAGGGRVVTYALVMEMQLVMGFFATAFCTVGMIVNNDFQAMAR  255

Query  253  EAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVIL  74
            EAR FELG A+YY +++ S I++QFF +GA+GVI    +L + ++  V +PVTE+LAVI 
Sbjct  256  EARAFELGEARYYTVLVWSAILWQFFFLGAVGVIFCVHTLFAGILIAVFIPVTEVLAVIF  315

Query  73   FHEKFQPEKGVSLFLCLWGFVSY  5
             HEKF  EKGV+L L LWG  SY
Sbjct  316  LHEKFSSEKGVALVLSLWGLASY  338



>ref|XP_003578263.2| PREDICTED: purine permease 3-like [Brachypodium distachyon]
Length=397

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 168/326 (52%), Positives = 224/326 (69%), Gaps = 6/326 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            + M +   + N +L+ +G+  GPLLLR YFL GG R W S+ LQTA WP++   L  S++
Sbjct  44   HHMYSPLFVVNFLLMVVGSACGPLLLRAYFLHGGNRKWLSSLLQTAGWPLLLPALGFSFV  103

Query  784  rrrrrRSDVDSNTK--FFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSS  611
             RRRRR      T    FLM+P L  +   +G + GL + LY YG+A LPVSTSS+++S+
Sbjct  104  SRRRRRKATKGATAAPLFLMSPRLLAATVAVGFMTGLDDLLYAYGLAYLPVSTSSILIST  163

Query  610  QlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTL  431
            QL FTA FA  LV+Q FTAFSVN++VLL+ GA +LG+ AG DRPAG +  +Y  GF +TL
Sbjct  164  QLVFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVTKGQYVAGFAMTL  223

Query  430  GSAALYGLIMPLVELIYNKA----NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQV  263
            G+AALYGL++P++EL   +       P+ Y LV+E Q V+ L AT F +VGM +N+DFQ 
Sbjct  224  GAAALYGLVLPVMELSQARHAARYGRPVTYALVMEMQAVIGLTATAFSAVGMLVNNDFQA  283

Query  262  IPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLA  83
            IP EAREF LG   YY+L+  S  ++QFF +G +G I YGS+LL+ VI TVL+PVTE+LA
Sbjct  284  IPGEAREFGLGQVGYYLLLAGSATVYQFFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLA  343

Query  82   VILFHEKFQPEKGVSLFLCLWGFVSY  5
            V+ FHE F   KG++L L LWGFVSY
Sbjct  344  VMFFHEPFNGTKGIALALSLWGFVSY  369



>ref|NP_001063425.1| Os09g0467400 [Oryza sativa Japonica Group]
 dbj|BAD19736.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAF25339.1| Os09g0467400 [Oryza sativa Japonica Group]
 dbj|BAG90051.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 222/323 (69%), Gaps = 7/323 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
               R + +  N  +L +G  GGPL+ RLYF +GG R W S WLQTA WP++ +P+  SYL
Sbjct  21   RAARWLLVALNCGMLVVGTTGGPLISRLYFSKGGHRQWLSAWLQTAGWPLLLVPVAASYL  80

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR R    D     FL    + ++G  +G L G  +++Y YG+A LPVSTS++++S+QL
Sbjct  81   SRRAR----DRRAPLFLTPTRVLLAGVGLGFLNGADDFIYAYGLAYLPVSTSAILISTQL  136

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFT  FA  +V+Q FTA ++N++ LLT GAVVLGL A  DRPAG ++ +Y +GF LTLG+
Sbjct  137  AFTVFFACLIVRQRFTAATLNAVALLTIGAVVLGLHASKDRPAGVTSGKYWMGFFLTLGA  196

Query  424  AALYGLIMPLVELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPR  254
            AALYGLI+PLVEL Y  A      + Y LV+E Q+V+   AT FC+VGM +N DFQ IPR
Sbjct  197  AALYGLILPLVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKDFQAIPR  256

Query  253  EAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVIL  74
            EA+++ELG A+YY++++ + ++++FF +GA+GVI    +LL+ +I  V +P+TE+L VI 
Sbjct  257  EAKQYELGEARYYVVLVFNAVLWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIF  316

Query  73   FHEKFQPEKGVSLFLCLWGFVSY  5
             HEKF  EKGV+L L LWG  SY
Sbjct  317  LHEKFSSEKGVALVLSLWGLASY  339



>dbj|BAJ94351.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 225/325 (69%), Gaps = 7/325 (2%)
 Frame = -1

Query  955  RTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrr  776
            R   ++ N +L+A+G   GPLLLR Y+L GG   W ++ LQTA WP++  PL +S++ RR
Sbjct  49   RNPVVVVNFLLMALGTVSGPLLLRAYYLHGGTSKWLTSLLQTAGWPLLLPPLCVSFISRR  108

Query  775  rrRSDVDSNTK---FFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            RRR   +S T+     LM+  L  +   IGL++GL+NYLY YG+A LPVSTSS+++S+QL
Sbjct  109  RRRQSEESATEAASLSLMSAGLLAATIAIGLVIGLINYLYAYGLANLPVSTSSILISTQL  168

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA+FA  +V+  FTAFSVN++VLL  GA +LGL  G DRPAG S  +Y  GF +TLGS
Sbjct  169  AFTAVFALLVVRHRFTAFSVNAVVLLVVGAAMLGLNGGGDRPAGVSRAQYYAGFAMTLGS  228

Query  424  AALYGLIMPLVEL----IYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIP  257
            AALYGL++PL+EL       +A   + Y LVLE QMV+ + AT F  VGM +N DF  IP
Sbjct  229  AALYGLVLPLMELSQARHAARAGAAVTYTLVLEIQMVIGITATAFSVVGMLVNKDFHEIP  288

Query  256  REAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVI  77
             EAR F+LG A YY +++ S   FQ F IG +G I YGS+LL+ VI T+L+ VTE+ AV+
Sbjct  289  DEARRFDLGEAGYYFILVSSATAFQCFFIGMIGAIFYGSALLAGVIMTLLISVTEVFAVL  348

Query  76   LFHEKFQPEKGVSLFLCLWGFVSYF  2
            LFHE F   KGV+L + +WGF+SYF
Sbjct  349  LFHEPFNGTKGVALAISIWGFISYF  373



>gb|EEC84724.1| hypothetical protein OsI_31699 [Oryza sativa Indica Group]
Length=361

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 156/313 (50%), Positives = 220/313 (70%), Gaps = 7/313 (2%)
 Frame = -1

Query  934  NTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVD  755
            N  +L +G  GGP+L RLYF +GG R W S WL+TA WP++ +P+  SYL RR R    D
Sbjct  31   NCGMLVVGTTGGPILSRLYFSKGGHRKWLSAWLETAGWPLLLVPVSASYLSRRAR----D  86

Query  754  SNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffL  575
                 FL    + ++GA++G+L G  +++Y YG+A LPVSTS++++S+QLAFT  FA  +
Sbjct  87   RGAPLFLTPRRVLLAGAVLGVLTGADDFVYAYGLAYLPVSTSAILISTQLAFTVFFACLI  146

Query  574  VKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPL  395
            V+Q  TA ++N++ LLT GAVVLGL A  DRPAG +  +Y +GF LTLG+AALYGLI+PL
Sbjct  147  VRQRLTAATLNAVALLTIGAVVLGLHASKDRPAGVTTGKYWMGFFLTLGAAALYGLILPL  206

Query  394  VELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAA  224
            VEL Y  A      + Y LV+E Q+V+   AT FC+VG+ +N DFQ IPREA+++ELG A
Sbjct  207  VELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGVIVNKDFQAIPREAKQYELGEA  266

Query  223  KYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKG  44
            +YY++++ + ++++FF +GA+GVI    +LL+ +I  V +P+TE+L VI  HEKF  EKG
Sbjct  267  RYYVVLVFNAVLWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEKG  326

Query  43   VSLFLCLWGFVSY  5
            V+L L LWG  SY
Sbjct  327  VALVLSLWGLASY  339



>ref|XP_010234593.1| PREDICTED: purine permease 3-like isoform X1 [Brachypodium distachyon]
Length=375

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 165/317 (52%), Positives = 220/317 (69%), Gaps = 3/317 (1%)
 Frame = -1

Query  943  LLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrR-  767
            L+ N +LLA G   GPLLLR YF+ GG R W S+ LQTA WP++ +PL  S+  RRRR  
Sbjct  36   LVVNFVLLAAGTACGPLLLRAYFVHGGTRKWLSSLLQTAGWPLLLVPLCASFFSRRRRHL  95

Query  766  SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalf  587
             D  S+ + F MTP L  +   IG++ G+ N+ Y YG A LPVSTSS+++S+QL FTA F
Sbjct  96   QDHGSSCELFFMTPRLLAASTAIGVMTGVDNFFYAYGQAYLPVSTSSILLSTQLVFTAAF  155

Query  586  affLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGL  407
            A  LV+Q F A +VN++VLLT GA +LG+ AG DRPAG S  +Y  GF + LG+AALYGL
Sbjct  156  ALLLVRQRFAAATVNAVVLLTVGAAMLGMNAGGDRPAGVSAPQYRAGFGMVLGAAALYGL  215

Query  406  IMPLVEL--IYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFEL  233
            ++P +EL    + A   + Y LV+E Q+V+ L+A+ FC++GM IN DFQ I  EARE EL
Sbjct  216  LLPAMELSQARHAARGAVTYTLVVEIQLVIGLSASAFCAIGMIINKDFQGISGEARESEL  275

Query  232  GAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQP  53
            G A YY+L+  +  ++Q F +G +G I YGS+LL+ VI TV +PV+E+LAVI FHE F P
Sbjct  276  GEAGYYLLLAGTAAVYQCFCLGTIGAIFYGSALLAGVIITVFIPVSEVLAVIFFHEPFSP  335

Query  52   EKGVSLFLCLWGFVSYF  2
             KG++L L LWG +SYF
Sbjct  336  TKGIALGLSLWGLISYF  352



>ref|XP_006841262.1| hypothetical protein AMTR_s00135p00100890 [Amborella trichopoda]
 gb|ERN02937.1| hypothetical protein AMTR_s00135p00100890 [Amborella trichopoda]
Length=357

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 155/304 (51%), Positives = 220/304 (72%), Gaps = 3/304 (1%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFFL  734
            G  G PL+ RLYF+ GG R W + W+QTAA+P++ IPL +S +   +        +    
Sbjct  35   GASGAPLVSRLYFIHGGQRKWLTAWIQTAAFPILLIPLFLSKISSTKTSQSQRRQSH---  91

Query  733  MTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTA  554
            +T  L +  A IGLL+G+ +Y+Y +G++ LP+STS+L+VS+QL FTA FAF +V Q FTA
Sbjct  92   LTFPLALQSASIGLLIGIDDYMYAFGLSYLPISTSTLLVSTQLGFTAFFAFLIVGQRFTA  151

Query  553  FSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNK  374
             ++N++VLL+ G+V+LG+RA +DRP G +  +YGLGFVLTLG+AAL GL+ PL+EL+Y K
Sbjct  152  HTINAVVLLSLGSVLLGIRASSDRPEGVTGAQYGLGFVLTLGAAALIGLVFPLIELVYVK  211

Query  373  ANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICSG  194
            +   + + LV+E  +V+S+ AT FC++GM IN DFQVI RE++EF LG  KY++ V+ SG
Sbjct  212  SKQIVTFGLVMEMLLVMSVVATGFCTIGMVINKDFQVISRESKEFGLGEFKYHLTVVASG  271

Query  193  IIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGF  14
            I++Q FLIG+   I Y SSLL+ ++  V LP+T +LAVI FHEKF  EKG++L LCLWGF
Sbjct  272  ILWQVFLIGSFSFILYTSSLLNGILLAVQLPLTSILAVIFFHEKFSAEKGMALVLCLWGF  331

Query  13   VSYF  2
             SY+
Sbjct  332  ASYY  335



>gb|EPS58788.1| hypothetical protein M569_16026, partial [Genlisea aurea]
Length=330

 Score =   273 bits (699),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 219/320 (68%), Gaps = 2/320 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+ +FLL N ++LA+G CG PL LRLYF RGG  +WF+ WLQ+  WPV+ +PL ++YL R
Sbjct  1    MKRLFLLVNAVILAVGYCGLPLTLRLYFGRGGEMVWFAGWLQSGGWPVILLPLAVNYLAR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RR R+   S  K   + P LF +   IG++ G  N++Y YG++KLPVST +LI ++QLAF
Sbjct  61   RRERTPSGS-VKVIRLRPKLFAAAMAIGMITGADNFMYAYGISKLPVSTVALIDATQLAF  119

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            T +F+FF+VKQ  TAFSVN++VLLT GAVV  + +  DRPAGES+ EY  GF +  GSAA
Sbjct  120  TVVFSFFIVKQKLTAFSVNAVVLLTVGAVVFAVHSTGDRPAGESHSEYWKGFAMMAGSAA  179

Query  418  LYGLIMPLVELIYNKANTP-IGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             +GL + LVE  Y K   P + Y  VLEF +V +++ATLF +VGM   H+FQ I  EA  
Sbjct  180  TFGLCLSLVEFSYAKTGGPSMDYAAVLEFDLVTNISATLFSTVGMAAEHNFQAIRGEATG  239

Query  241  FELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEK  62
            +  G  KYY  V    ++ Q   +G  GVI Y SSL S ++ +VLLP+ E+LAV+ F ++
Sbjct  240  YRSGRIKYYAAVFSVALVCQCLRLGIAGVIHYSSSLYSGILLSVLLPLVEVLAVVFFKDE  299

Query  61   FQPEKGVSLFLCLWGFVSYF  2
            + PEKG++LFL LWGFVSYF
Sbjct  300  YPPEKGIALFLSLWGFVSYF  319



>gb|KCW51603.1| hypothetical protein EUGRSUZ_J01095 [Eucalyptus grandis]
Length=302

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/296 (52%), Positives = 199/296 (67%), Gaps = 26/296 (9%)
 Frame = -1

Query  889  LRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFFLMTPCLFIS  710
            +RLYF+RG AR+W  +WL+  AWP++ +PL  +Y    RRRS +    +  LM   LF +
Sbjct  1    MRLYFVRGKARMWLVSWLEMGAWPMLLLPLAAAY---SRRRSAMGPAARLILMDRFLFAA  57

Query  709  GALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTAFSVNSIvl  530
             A IG+L+GL NY Y YG+ +LPVSTS+L++++QLAFTA FAF LV+Q FT+ S+NS   
Sbjct  58   AAGIGVLMGLDNYFYVYGLGRLPVSTSALLIATQLAFTAGFAFLLVRQVFTSCSINS---  114

Query  529  ltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNKANTPIGYI  350
                                SN     GF ++LG+AALYG ++PLVEL Y KA   + Y 
Sbjct  115  --------------------SNGANYAGFFMSLGAAALYGFVLPLVELTYKKAKQAVTYS  154

Query  349  LVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICSGIIFQFFLI  170
            LVLE Q+V+   AT FC++GM +N DFQ IPREAR +ELG A+YY+L++ + II QFF +
Sbjct  155  LVLEIQLVMCFFATAFCTIGMLVNKDFQAIPREARSYELGEARYYVLLVWTAIINQFFFL  214

Query  169  GALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            GA+GVI Y SSL S VI   LLPVTE+LAVI F EKFQ EKGV+L L LWGF SYF
Sbjct  215  GAIGVIFYASSLFSAVIIAALLPVTEILAVICFQEKFQAEKGVALALSLWGFASYF  270



>dbj|BAD19737.1| putative purine permease [Oryza sativa Japonica Group]
Length=361

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/313 (49%), Positives = 217/313 (69%), Gaps = 7/313 (2%)
 Frame = -1

Query  934  NTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVD  755
            N  +L +G  GGP+L RLYF +GG R W S WL+TA WP++ +P+  SY      R   D
Sbjct  31   NCGMLVVGTTGGPILSRLYFSKGGHRKWLSAWLETAGWPLLLVPVSASY----HSRRARD  86

Query  754  SNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffL  575
                 FL    + ++GA++G+L G  +++Y YG+A LPVSTS++++S+QLAFT  FA  +
Sbjct  87   RGAPLFLTPRRVLLAGAVLGVLTGADDFVYAYGLAYLPVSTSAILISTQLAFTVFFACLI  146

Query  574  VKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPL  395
            V+Q  TA ++N++ LLT GAVVLGL A  DRPAG +  +Y +GF LTLG+AALYGLI+PL
Sbjct  147  VRQRLTAATLNAVALLTIGAVVLGLHASKDRPAGVTTGKYWMGFFLTLGAAALYGLILPL  206

Query  394  VELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAA  224
            VEL Y  A      + Y LV+E Q+V+   AT FC+VG+ +N DFQ IPREA+++ELG A
Sbjct  207  VELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGVIVNKDFQAIPREAKQYELGEA  266

Query  223  KYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKG  44
            +YY++++ + ++++FF +GA+GVI    +LL+ +I  V +P+TE+L VI  HEKF  EKG
Sbjct  267  RYYVVLVFNAVLWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEKG  326

Query  43   VSLFLCLWGFVSY  5
            V+L L LWG  SY
Sbjct  327  VALVLSLWGLASY  339



>ref|XP_010263028.1| PREDICTED: purine permease 1-like [Nelumbo nucifera]
Length=365

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 163/321 (51%), Positives = 217/321 (68%), Gaps = 7/321 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            N  +   L  N +   +G   GPLLLRLYFL GG R W  +WL+TA  P +  PL + YL
Sbjct  33   NMAKWWLLGINCVCTVLGTIAGPLLLRLYFLHGGNRKWIPSWLETAGVPALLGPLTVLYL  92

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
                   +  S  +F   T  L +S A IGLL GL N++Y+ G++ LPVSTSSL++S+QL
Sbjct  93   ------RERASGVRFLAPTKLLLLS-AGIGLLAGLNNFMYSLGLSFLPVSTSSLLLSTQL  145

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAF + KQ FT +S N++VL+T GAV+LGL    DRP G SNK+Y LGF+LTLG+
Sbjct  146  AFTAFFAFLIAKQKFTPYSTNAVVLMTLGAVLLGLTKSGDRPPGVSNKDYLLGFILTLGA  205

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A L G I+P  E+ Y  A   I Y +VL+FQ  V+  AT+FC++GM IN DFQ IPREA 
Sbjct  206  AGLLGFILPCCEVSYATARKTITYSVVLQFQFGVNFFATVFCTIGMLINKDFQAIPREAN  265

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
             FELGA KYY++++   I++Q  ++G LGV+   +SL + V+N  LLP+TE+ AVI++HE
Sbjct  266  AFELGAVKYYMVLVSIAIVWQMAVVGLLGVVFCTTSLFAGVLNATLLPLTEIAAVIVYHE  325

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KF  EKG++L LC WGF+SYF
Sbjct  326  KFTGEKGMALALCSWGFISYF  346



>ref|XP_004158055.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Cucumis 
sativus]
Length=304

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 218/298 (73%), Gaps = 6/298 (2%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            MR   L+FN  LLA+G CGGPLL+RLYFL GG R+W ST+L+TA  P++FIPLLISY+ R
Sbjct  1    MRRTLLVFNCFLLAVGTCGGPLLMRLYFLHGGNRVWLSTFLETAGCPIIFIPLLISYIHR  60

Query  778  rrrR------SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIV  617
            RRRR      S+  ++T+   M   LF++  +IG++ G +++LY YGVA++PVSTS+LI 
Sbjct  61   RRRRAHSLNPSESTNSTEMIFMKSRLFLASGVIGIITGFVDFLYAYGVARIPVSTSALIR  120

Query  616  SSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVL  437
            + QLAFTA FAF+LVKQ FTA+S+NS+VL+TAG  +L L    DR AGESN+EY  GF+ 
Sbjct  121  ACQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILALHTSGDRRAGESNREYIEGFLT  180

Query  436  TLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIP  257
            T+ ++ +YG I+PLVEL Y KA   I Y LVLE Q+++SL ATL CS+ M IN+DFQ+I 
Sbjct  181  TVAASVVYGFILPLVELTYKKARQQITYTLVLEVQLIMSLFATLVCSIAMLINNDFQMIA  240

Query  256  REAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLA  83
             EA  F LG AKYY++++ S II+Q F +G +GVI   SS  S +I  VLLPVTE+LA
Sbjct  241  MEAEAFGLGKAKYYVILVLSAIIWQGFFLGVIGVIFSSSSFXSGIIIAVLLPVTEILA  298



>emb|CDP01096.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 224/322 (70%), Gaps = 5/322 (2%)
 Frame = -1

Query  967  CNKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISY  788
            C  M+T+ +LFN ILLAIG  GGPLL+R+YFL GG R W + WL TA +P++ +P+ ISY
Sbjct  21   CISMKTLMVLFNCILLAIGQVGGPLLVRIYFLHGGKRKWLTAWLLTAGFPLLILPISISY  80

Query  787  LrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
             +     +   +++  FL+ P L  + A +G L+G+ +YLYT+G++ LPVS SSL+ SSQ
Sbjct  81   FK-----NRSKASSPKFLVPPRLVAASAFLGFLLGIDSYLYTFGMSYLPVSVSSLLGSSQ  135

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            LAFTA+FA+F+VK  FT +S+N++VL+T G+ +LGL    DRP+GESN  Y LGF +TLG
Sbjct  136  LAFTAIFAYFVVKHKFTHYSINAVVLMTFGSAILGLHMNGDRPSGESNANYTLGFFMTLG  195

Query  427  SAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREA  248
            +AAL+G IMP  E    KA   + + L L+ Q +VS+ ATLFC++ M IN DFQ IP+EA
Sbjct  196  AAALHGFIMPAFEYAQKKAEVTVTFDLFLQVQFLVSMFATLFCTIPMIINKDFQAIPQEA  255

Query  247  REFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFH  68
             EFELG  KYY +++ +GI  Q  +IG+ GVI   SSL   ++ ++L+PV ++ AV    
Sbjct  256  AEFELGPMKYYTILVMAGIALQCMMIGSTGVIFSSSSLFGGIVTSLLVPVQQIFAVFCLA  315

Query  67   EKFQPEKGVSLFLCLWGFVSYF  2
            E F  EKG++L +CLWGF SYF
Sbjct  316  ESFSGEKGMALAMCLWGFASYF  337



>ref|XP_006841259.1| hypothetical protein AMTR_s00135p00097090 [Amborella trichopoda]
 gb|ERN02934.1| hypothetical protein AMTR_s00135p00097090 [Amborella trichopoda]
Length=362

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 155/308 (50%), Positives = 215/308 (70%), Gaps = 4/308 (1%)
 Frame = -1

Query  916  IGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTK--  743
            +G  GGPL+ RLYFL GG +LW S +L+T  WP++  PL  S    +  + +  S  +  
Sbjct  28   LGATGGPLISRLYFLHGGHKLWLSAFLETGGWPILLFPLAFSKFFNKTNKKNPQSQQQEG  87

Query  742  --FFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVK  569
                 +T  LF+  + IGLL G+ +Y+Y +G++ LPVSTS+L+++SQLAFTALFA  +V+
Sbjct  88   EERTHITLPLFLQCSFIGLLTGVDDYMYAFGLSYLPVSTSALLIASQLAFTALFALIVVR  147

Query  568  QHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVE  389
              FTAF  NS+VLLT G+  LGL A  DRP G SN  Y LGF +TLG+AALYGL++PL+E
Sbjct  148  HKFTAFLTNSVVLLTLGSAFLGLGANGDRPKGLSNGRYFLGFFMTLGAAALYGLVLPLIE  207

Query  388  LIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYIL  209
            L+Y ++   I Y+LVLE Q+V+S+ AT FC+VGM IN DFQ IP+EAR F+LGA  YY  
Sbjct  208  LMYARSRQKITYMLVLEMQLVMSVFATAFCAVGMLINKDFQHIPKEARAFDLGAVGYYAT  267

Query  208  VICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFL  29
            ++ SG+ +Q F IG +G+I   SS++S ++   L+P+TE+LAVI +HEKF  EK ++L +
Sbjct  268  LVGSGVAWQLFFIGTVGLIFCASSVVSGIMIAFLIPITEILAVIFYHEKFTGEKAMALIM  327

Query  28   CLWGFVSY  5
             LWGF SY
Sbjct  328  SLWGFASY  335



>ref|XP_002462515.1| hypothetical protein SORBIDRAFT_02g027100 [Sorghum bicolor]
 gb|EER99036.1| hypothetical protein SORBIDRAFT_02g027100 [Sorghum bicolor]
Length=365

 Score =   269 bits (688),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 158/325 (49%), Positives = 220/325 (68%), Gaps = 9/325 (3%)
 Frame = -1

Query  964  NKMRTIFLL-FNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISY  788
            NK    FL+  N  +LA+G  GGPLL RLYF +GG R W S WL+T  WP++ +P+ +S+
Sbjct  16   NKAMHRFLVALNCGMLALGAIGGPLLSRLYFSKGGHRQWLSAWLETGGWPLLLVPVALSF  75

Query  787  LrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
            + R       D      L  P + ++   +G+  G+ +++Y YG+A LPVSTS++++S+Q
Sbjct  76   VAR----RARDRAAPVLLTPPRILLAAVALGVATGVDDFIYAYGLAYLPVSTSAILISTQ  131

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            LAFT  FAF +V+Q  TA SVN++ LLT GAVVLGL   +DRP G +  +Y LGF LTLG
Sbjct  132  LAFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGQYWLGFTLTLG  191

Query  427  SAALYGLIMPLVELIYNKA----NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVI  260
            +AALYGL++PLVEL Y +A       + Y LV+E Q+V+   AT FC+VGM +N DFQ I
Sbjct  192  AAALYGLVLPLVELAYKRAAAGGGRAVSYALVVEMQLVMGFFATAFCTVGMIVNKDFQAI  251

Query  259  PREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAV  80
            PREAR++ELG A+YY +++ S +++Q F +GA+GVI    +LL+ ++  V +PVTE+ AV
Sbjct  252  PREARQYELGEARYYTVLVWSAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIPVTEVAAV  311

Query  79   ILFHEKFQPEKGVSLFLCLWGFVSY  5
            I  HEKF  EKGV+L L LWG  SY
Sbjct  312  IFLHEKFSSEKGVALVLSLWGLASY  336



>ref|XP_004957086.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=356

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 157/323 (49%), Positives = 221/323 (68%), Gaps = 7/323 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              MR + +  N  +LA+G  GGPLL RLYF +GG R W S WL+TA WP++ +P++ +Y+
Sbjct  15   KAMRRLLVALNCGMLALGAIGGPLLSRLYFSKGGHRQWLSAWLETAGWPLLLVPVVAAYV  74

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             R       D      L  P + ++   +G+  G+ +++Y YG++ LPVSTS++++S+QL
Sbjct  75   AR----RARDRAAPALLTPPRILLAAVGLGVATGVDDFIYAYGLSYLPVSTSAILISTQL  130

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFT LFAF +V+Q  TA SVN++ LLT GAVVLGL   +DRP G +  +Y LGF+LTLG+
Sbjct  131  AFTVLFAFLIVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGQYWLGFILTLGA  190

Query  424  AALYGLIMPLVELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPR  254
            AALYGL++PLVEL Y +A      + Y LV+E Q+V+   AT FC+VGM +N DFQ IPR
Sbjct  191  AALYGLVLPLVELAYRRAAGGGRAVTYALVIEMQLVMGFFATAFCTVGMIVNKDFQAIPR  250

Query  253  EAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVIL  74
            EA+ FELG A+YY +++ S +++Q F +GA+GVI    +LL+ ++  V +PVTE+ AVI 
Sbjct  251  EAKHFELGEARYYTVLVWSAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIPVTEVAAVIF  310

Query  73   FHEKFQPEKGVSLFLCLWGFVSY  5
             HEKF  EKGV+L L LWG  SY
Sbjct  311  LHEKFSSEKGVALVLSLWGLASY  333



>ref|NP_001131978.1| uncharacterized protein LOC100193377 [Zea mays]
 gb|ACF80629.1| unknown [Zea mays]
 gb|ACG41442.1| ATPUP3 [Zea mays]
 tpg|DAA40288.1| TPA: ATPUP3 [Zea mays]
Length=361

 Score =   267 bits (682),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 154/323 (48%), Positives = 215/323 (67%), Gaps = 7/323 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              +R   +  N  +LA+G  GGPLL RLYF +GG R W S WL+T  WP++ +P+  S+ 
Sbjct  15   KAVRRFLVALNCGMLALGAIGGPLLSRLYFSKGGHRQWLSAWLETGGWPLLLVPVAASF-  73

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
                 R   D      L  P + ++ A +G+  G+ +++Y YG+A LPVSTS++++S+QL
Sbjct  74   ---GARRARDRGAPVLLTPPRILLAAAGLGVATGVDDFVYAYGLAYLPVSTSAILISTQL  130

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFT  FAF +V+Q  TA SVN++ LLT GAVVLGL   +DRP G +   Y LGF LTL +
Sbjct  131  AFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGRYWLGFSLTLCA  190

Query  424  AALYGLIMPLVELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPR  254
            AALYGL++PLVEL Y +A      + Y LV+E Q+V+   AT FC+VGM +N DFQ IPR
Sbjct  191  AALYGLVLPLVELAYRRAAGGGRAVTYALVVEMQLVMGFFATAFCTVGMVVNKDFQAIPR  250

Query  253  EAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVIL  74
            EAR++ELG A+YY+++  + +++Q F +GA+GVI    +LL+ ++  V +PVTE+ AVI 
Sbjct  251  EARQYELGEARYYMVLAWAAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIPVTEVAAVIF  310

Query  73   FHEKFQPEKGVSLFLCLWGFVSY  5
             HEKF  EKGV+L L LWG  SY
Sbjct  311  LHEKFSSEKGVALALSLWGLASY  333



>ref|XP_010263027.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=365

 Score =   266 bits (681),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 159/321 (50%), Positives = 215/321 (67%), Gaps = 7/321 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            N  +   L  N +   +G   GPL LRLYFL GG R W  +WLQTA  PV+  PL + YL
Sbjct  33   NMAKWWLLGINCVCTVLGTIAGPLFLRLYFLHGGNRKWIPSWLQTAGVPVLLGPLTVLYL  92

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
                   +  S  +F   T  L +S A IG+LVGL +++Y++G++ LPVSTS+L++S+QL
Sbjct  93   ------RERASGVRFLAPTKLLLLS-AGIGILVGLNDFMYSHGLSFLPVSTSALLLSTQL  145

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
             FTALFA  + KQ FT +S+N++VL+T GA +LGL    DR  G SN++Y LGFVLTLG+
Sbjct  146  GFTALFALLIAKQKFTPYSINAVVLMTLGAALLGLSKSGDRLLGVSNRDYWLGFVLTLGA  205

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            A L G I+P  E+ Y  A   I Y +VL+FQ  V+  AT+FC++GM IN DFQ IPREA 
Sbjct  206  AGLLGFILPCCEVAYATARKTITYSVVLQFQFGVNFFATVFCTIGMLINKDFQAIPREAN  265

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
             FELGA KYY++++   I++Q   +G LGV+   +SL + V+N  LLP+TE  AVI++HE
Sbjct  266  AFELGAVKYYLVLVSIAIVWQMAGVGTLGVVFSTTSLFAGVLNATLLPLTETAAVIVYHE  325

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KF  EKG++L LC WGF+SYF
Sbjct  326  KFTGEKGMALALCSWGFISYF  346



>ref|XP_002462514.1| hypothetical protein SORBIDRAFT_02g027090 [Sorghum bicolor]
 gb|EER99035.1| hypothetical protein SORBIDRAFT_02g027090 [Sorghum bicolor]
Length=378

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 160/338 (47%), Positives = 217/338 (64%), Gaps = 30/338 (9%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            +R   L+ N  L+ +G+ GGPL LR YFL GGAR W S +LQTA +P++ +PL +S+  R
Sbjct  24   IRNPLLVVNFALMVVGSAGGPLFLRAYFLHGGARKWLSAFLQTAGFPLLLVPLCVSFFSR  83

Query  778  rrrRSDVD-------------SNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPV  638
            RR+R   D             + T FFLMTP L  + A IGL+ G+ + LY YG+A LP+
Sbjct  84   RRQRDRDDADADADAPANKAATRTPFFLMTPRLLAASAAIGLMTGVDDLLYAYGLAYLPL  143

Query  637  STSSLIVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKE  458
            + ++                LV+Q FTAFSVN++ LLT GA +LG+ AG DRPAG S  +
Sbjct  144  AFTAAFA-----------LLLVRQRFTAFSVNAVALLTVGAAMLGMNAGGDRPAGVSRAQ  192

Query  457  YGLGFVLTLGSAALYGLIMPLVEL-----IYNKANTPIGYILVLEFQMVVSLAATLFCSV  293
            YG GF +TLG+AALYGL++P+VEL             + Y LV+E Q+V+ L AT+F +V
Sbjct  193  YGAGFAMTLGAAALYGLVLPVVELSQARHAARAGAGAVTYTLVIEMQLVIGLTATVFSAV  252

Query  292  GMFINHDFQVIPREAREFELG-AAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVIN  116
            GM  N+D   IP EAREF+LG +A YY+L+  S   +Q F +G +G + +GS+LL+ V+ 
Sbjct  253  GMLANNDLHAIPGEAREFDLGGSAGYYLLLAGSAATYQCFFLGTIGAVFFGSALLAGVVM  312

Query  115  TVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            TVL+PVTE+LAV+ FHE F   KGV+L L LWGFVSYF
Sbjct  313  TVLIPVTEVLAVMFFHEPFNGTKGVALALSLWGFVSYF  350



>ref|XP_008667169.1| PREDICTED: uncharacterized protein LOC100193377 isoform X1 [Zea 
mays]
 gb|ACR36679.1| unknown [Zea mays]
 tpg|DAA40290.1| TPA: hypothetical protein ZEAMMB73_258363 [Zea mays]
Length=363

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 218/324 (67%), Gaps = 7/324 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              MR + +  N ++LA+G  GG LL RLYF +GG R W S WLQT  WP++  P+  SY+
Sbjct  15   KTMRRLLVATNCVMLALGVTGGQLLSRLYFSKGGHRQWLSGWLQTGGWPLLLPPVAASYV  74

Query  784  rrrrrRSDVDSNTKFFLMT-PCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
            RRR   +   S       T P + ++ A +GL+ G+ N LY +G+  LPVSTS++++S+Q
Sbjct  75   RRR---ARYRSAPALLTQTQPRILLAAAGLGLIAGVDNLLYAWGLEFLPVSTSAILISTQ  131

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            LAFT LFAF +V+Q  T  +VN++ LLT GAVVLGL   +DRPAG +  +Y LGF LTLG
Sbjct  132  LAFTVLFAFLIVRQRLTMATVNAVALLTVGAVVLGLHVSSDRPAGVTRSQYWLGFTLTLG  191

Query  427  SAALYGLIMPLVELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIP  257
            +A LYGL +PLVEL Y  A      + Y LV+E Q+V+   AT FC+VGM +N DFQ IP
Sbjct  192  AAVLYGLFLPLVELTYKCAAGGGRAVTYALVVELQLVMGFVATAFCTVGMIVNKDFQAIP  251

Query  256  REAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVI  77
            REAR++ELG A+YY+++  + +++Q F +GA+GVI    +LL+ ++  V +PVTE+ AVI
Sbjct  252  REARQYELGEARYYMVLAWAAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIPVTEVAAVI  311

Query  76   LFHEKFQPEKGVSLFLCLWGFVSY  5
              HEKF  EKGV+L L LWG  SY
Sbjct  312  FLHEKFSSEKGVALALSLWGLASY  335



>emb|CDP16579.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 153/240 (64%), Positives = 188/240 (78%), Gaps = 0/240 (0%)
 Frame = -1

Query  721  LFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTAFSVN  542
            +FI+ A IGLL G  +Y Y YG A+LPVSTS++I+++QLAFTALFAF LVKQ FTA+SVN
Sbjct  5    VFIATACIGLLTGSDDYFYGYGAARLPVSTSAIIIATQLAFTALFAFLLVKQKFTAYSVN  64

Query  541  SIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNKANTP  362
            +IVLLT G+ VLGL A +DRP GESNK Y LGF++ L +AALYGLI+P+V L+Y KA  P
Sbjct  65   AIVLLTVGSAVLGLHASSDRPKGESNKMYVLGFLMMLAAAALYGLILPMVGLMYMKAKQP  124

Query  361  IGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICSGIIFQ  182
            I Y LVLE Q+V+   AT FC+VGM IN+DFQ I REARE+ELG  KYYI+++   I+ Q
Sbjct  125  ITYTLVLEIQLVMCFFATAFCTVGMLINNDFQAISREAREYELGETKYYIVLVSCAIVSQ  184

Query  181  FFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
             F +GA+GVI   SSLLS ++  VLLPVTE+LAVI F+EKFQ EK V+L L LWGFVSYF
Sbjct  185  CFFMGAIGVIFCASSLLSGIMIAVLLPVTEILAVIFFNEKFQAEKAVALVLSLWGFVSYF  244



>gb|ABR16841.1| unknown [Picea sitchensis]
Length=368

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 151/302 (50%), Positives = 210/302 (70%), Gaps = 9/302 (3%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFFL  734
            G+  GPLL R YFL GG++ W S+WL+TA WP++ +PL +SY ++  R + +        
Sbjct  39   GSTAGPLLTRFYFLHGGSKRWLSSWLETAGWPLLLLPLYLSYRKQPNRENHI--------  90

Query  733  MTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTA  554
             TP LF++   IG+L G  +YLY YG++ LP+ST+S++++S L FTA FA  LV+Q F+ 
Sbjct  91   -TPKLFLACCGIGILTGADDYLYAYGLSFLPLSTASVLIASHLGFTAGFALLLVRQKFSP  149

Query  553  FSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNK  374
            FSVNS+VLL+A +V+L      DRP G ++++Y +GFVLTLG+AALYG ++PL+EL Y +
Sbjct  150  FSVNSVVLLSASSVLLAFHTSGDRPEGVTSRQYVVGFVLTLGAAALYGFVIPLIELTYKR  209

Query  373  ANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICSG  194
            A  PI Y LV+E Q V+S+ AT+FC+VGM IN DFQ + REA  F LG   Y + ++ + 
Sbjct  210  AKRPITYTLVMEMQFVMSVTATVFCTVGMLINGDFQALHREAEGFRLGKIDYSMALVWAA  269

Query  193  IIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGF  14
            + +Q F IG  GV    SSLLS VI  +++P TE+LAVILFHEKF  EKG++L L LWGF
Sbjct  270  VAWQLFFIGVFGVTSMASSLLSGVIIALMIPGTEVLAVILFHEKFSAEKGMALVLALWGF  329

Query  13   VS  8
             S
Sbjct  330  AS  331



>ref|XP_008652812.1| PREDICTED: purine permease 3-like [Zea mays]
 tpg|DAA61853.1| TPA: hypothetical protein ZEAMMB73_233624 [Zea mays]
Length=367

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 216/324 (67%), Gaps = 8/324 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              M    +  N  +LA+G  GGPLL RLYF +GG R W S WL+T  WP++ IP+  S++
Sbjct  16   KAMHRFLVALNCGMLAVGAIGGPLLSRLYFSKGGHRQWLSAWLETGGWPLLVIPVAASFV  75

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR R    D      L  P + ++ A +G+  G  +++Y +G+A LPVSTS++++S+QL
Sbjct  76   ARRAR----DRGAPVLLAPPRILLAAAGLGVATGADDFIYAFGLAYLPVSTSAILISTQL  131

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFT  FAF +V+Q  TA SVN++ LLT GAVVLGL   +DRP G +  +Y LGFVLTLG+
Sbjct  132  AFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGQYWLGFVLTLGA  191

Query  424  AALYGLIMPLVELIYNKANTP----IGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIP  257
            AALYGL++PLVEL Y +A       + Y LV+E Q+V+   AT FC+VGM +N DFQ IP
Sbjct  192  AALYGLVLPLVELAYRRAAGAGGRAVTYALVVEMQLVMGFFATAFCTVGMVVNKDFQAIP  251

Query  256  REAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVI  77
            REAR ++LG A+YY ++  S +++Q F +GA+GVI    +LL+ ++  V +PVTE+ AVI
Sbjct  252  REARRYKLGEARYYAVLAWSAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIPVTEVAAVI  311

Query  76   LFHEKFQPEKGVSLFLCLWGFVSY  5
               E+F  EKGV+L L LWG  SY
Sbjct  312  FLRERFSSEKGVALVLSLWGLASY  335



>ref|XP_006841261.1| hypothetical protein AMTR_s00135p00099660 [Amborella trichopoda]
 gb|ERN02936.1| hypothetical protein AMTR_s00135p00099660 [Amborella trichopoda]
Length=366

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 160/316 (51%), Positives = 223/316 (71%), Gaps = 4/316 (1%)
 Frame = -1

Query  949  IFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrr  770
            I L  N + L +G    PL+ R+YFL GG R WF+ W+QTAAWP++ IPL +     ++ 
Sbjct  33   ILLAVNGLFLTLGGGCAPLVSRIYFLHGGQRKWFTAWIQTAAWPLLLIPLSLPKFFSKKL  92

Query  769  RSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftal  590
            +S  + +     +T  L +  A IGLL+GL +Y+Y +G++ LPVSTSSL++ +QLAFTAL
Sbjct  93   QSQQEKSH----LTFPLALQSAGIGLLIGLDDYMYAFGLSYLPVSTSSLLLCTQLAFTAL  148

Query  589  faffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYG  410
            FAF LV+  FTA+S+N++VLLT G V+LGL A  DRP G S  +Y LG+V+T+G+AA++G
Sbjct  149  FAFVLVRYRFTAYSINAVVLLTLGPVLLGLGARGDRPEGVSGAKYALGYVMTVGTAAVFG  208

Query  409  LIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELG  230
            L++PL+EL+Y KA   + Y LVLE Q+++ + AT FC+VGM  N DFQ IP EAREF LG
Sbjct  209  LVVPLLELVYGKAKVVVTYTLVLEMQVIMYVVATAFCTVGMIANKDFQAIPIEAREFGLG  268

Query  229  AAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPE  50
              KYY+ V+ SG+++Q F IG+ G I   SS+ + V   + +P++ELL VI FHEKF  E
Sbjct  269  EFKYYLTVVASGVMWQLFFIGSAGFIFCTSSMFTGVFVALQIPLSELLVVIFFHEKFTGE  328

Query  49   KGVSLFLCLWGFVSYF  2
            KG++L L +WGFVSYF
Sbjct  329  KGMALVLSMWGFVSYF  344



>ref|XP_003579811.2| PREDICTED: purine permease 3-like [Brachypodium distachyon]
Length=365

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 215/323 (67%), Gaps = 6/323 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              M  + +  N  +L +G  GGPLL RLY+ +GG R W S WL+T  WP++  P+  SYL
Sbjct  24   KAMHWLMVALNCGMLTLGTTGGPLLSRLYYSKGGQRQWLSAWLETGGWPLLLFPVSFSYL  83

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR   +         L  P   ++ A +GL  G  +++Y YG++ LPVSTS++++S+QL
Sbjct  84   ARR---ARDGPGAPLVLTRPRTLMAAAALGLATGADDFIYAYGLSYLPVSTSAILISTQL  140

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFT  FAF +V+Q  TAFSVN++ LLT GAVVLGL A +DRPAG +  +Y LGF L+LG+
Sbjct  141  AFTVFFAFLVVRQRLTAFSVNAVALLTVGAVVLGLHASSDRPAGVTRGQYWLGFFLSLGA  200

Query  424  AALYGLIMPLVELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPR  254
            AALYGL++PL+EL Y  A      + Y LVLE Q+V+   AT FC+VGM +N+DFQ I R
Sbjct  201  AALYGLVLPLIELAYKHAAGGGREVTYALVLEMQLVMGFFATAFCTVGMVVNNDFQAISR  260

Query  253  EAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVIL  74
            EAR FELG  +YY++++   +++QFF +GA+GVI    +L + ++  V +PVTE+L VI 
Sbjct  261  EARAFELGETRYYVVLVSCAVLWQFFFLGAVGVIFCVHTLFAGILIAVFIPVTEVLGVIF  320

Query  73   FHEKFQPEKGVSLFLCLWGFVSY  5
             HEKF  EKGV+L L LWG  SY
Sbjct  321  LHEKFSSEKGVALVLSLWGLASY  343



>gb|KFK31021.1| hypothetical protein AALP_AA6G057800 [Arabis alpina]
Length=317

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 211/321 (66%), Gaps = 35/321 (11%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
            KM+T+ ++ N I+LAIGNCGGPL+ RLY+  GG R+WFS++LQTA  P++ +PLL S   
Sbjct  4    KMKTVLVIINCIILAIGNCGGPLMTRLYYNNGGKRIWFSSFLQTAGCPIILLPLLFS---  60

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
                    +  T + L+   LF++  +IGLL G  NYLY YG+A LPVSTSSLI+SSQLA
Sbjct  61   --FFLRRKEEKTPYLLIKRPLFLASIVIGLLTGFDNYLYAYGLAYLPVSTSSLILSSQLA  118

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTALFAFFLVK  FT F++N+IVL+T G+ +L L    D+ A E++KEY +GF++TL ++
Sbjct  119  FTALFAFFLVKHKFTPFTINAIVLITIGSGILALHTDGDKLAEETHKEYVIGFLMTLAAS  178

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LY  ++PLVEL Y KA   I Y LVLE Q+V+   AT FC VGM  + DF+VI  EARE
Sbjct  179  VLYAFVLPLVELTYKKARQEISYTLVLEMQIVLCSVATCFCLVGMLADGDFKVIANEARE  238

Query  241  FELGAAKYY-ILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            F+LG  +YY ++V+ + II+Q                             ELLA++ F E
Sbjct  239  FKLGGTRYYYVVVVFTAIIWQ-----------------------------ELLAILFFRE  269

Query  64   KFQPEKGVSLFLCLWGFVSYF  2
            KFQ EKGVSL L LWGFVSYF
Sbjct  270  KFQAEKGVSLGLSLWGFVSYF  290



>ref|XP_010234594.1| PREDICTED: purine permease 3-like isoform X2 [Brachypodium distachyon]
Length=375

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 218/317 (69%), Gaps = 3/317 (1%)
 Frame = -1

Query  943  LLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrR-  767
            L+ N +LLA G   GPLLLR YF+ GG R W S+ LQTA WP++ +PL  S+  RRRR  
Sbjct  36   LVVNFVLLAAGTACGPLLLRAYFVHGGTRKWLSSLLQTAGWPLLLVPLCASFFSRRRRHL  95

Query  766  SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalf  587
             D  S+ + F MTP L  +   IG++ G+ N+ Y YG A LPVSTSS+++S+QL FTA F
Sbjct  96   QDHGSSCELFFMTPRLLAASTAIGVMTGVDNFFYAYGQAYLPVSTSSILLSTQLVFTAAF  155

Query  586  affLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGL  407
            A  LV+Q F A +VN++VLLT GA +LG+ AG DRPAG S  +Y  GF + LG+AALYGL
Sbjct  156  ALLLVRQRFAAATVNAVVLLTVGAAMLGMNAGGDRPAGVSAPQYRAGFGMVLGAAALYGL  215

Query  406  IMPLVEL--IYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFEL  233
            ++P +EL    + A   + Y LV+E Q+V+ L+A+ FC++GM IN DFQ IP EAREFEL
Sbjct  216  LLPAMELSQARHAARGAVTYTLVVEIQLVIGLSASAFCAIGMIINKDFQEIPAEAREFEL  275

Query  232  GAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQP  53
            G A YY+L++ +  +FQ   +G +G I YGS+LL+ V+  + +PV  +LAV+ FHE F  
Sbjct  276  GEAGYYLLLVGTASVFQCICLGTIGAIFYGSALLAGVVLAMFIPVNGMLAVLFFHEPFSA  335

Query  52   EKGVSLFLCLWGFVSYF  2
             KG++L L LWG +SYF
Sbjct  336  TKGIALGLSLWGLLSYF  352



>emb|CDX90135.1| BnaA08g18490D [Brassica napus]
Length=323

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 154/323 (48%), Positives = 200/323 (62%), Gaps = 36/323 (11%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+   L+   I LAIG CGGPLL RLY+ +GG+R+WF ++L TA  P++ IPL +S+LRR
Sbjct  1    MKNGLLIIVCIFLAIGTCGGPLLTRLYYTKGGSRIWFMSFLATAGCPIILIPLYVSFLRR  60

Query  778  rrrR---SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
              R    S+     K F+M   LFI+  L        N ++++                 
Sbjct  61   SNRNHNNSETAEKAKVFVMETPLFIASILA------FNAIFSF-----------------  97

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
                      +VKQ FT FS+N++VLLT G  +L L    DRPAG S KEY +GF+LTL 
Sbjct  98   ---------LMVKQKFTPFSINAVVLLTVGTGILALHTDRDRPAGVSKKEYVVGFLLTLI  148

Query  427  SAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREA  248
            +A LY  +MPLVEL Y K    I + LVLE QMV+ +A+T FC VGM +  DF  IPREA
Sbjct  149  AAVLYAFLMPLVELTYKKVRQEITFTLVLEMQMVMCVASTCFCLVGMVVKGDFVAIPREA  208

Query  247  REFELGAAK-YYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILF  71
            REF +G++  YY L++  GI++Q F +GALGV+   SSL S V  +VLLPVTE+LAV+ F
Sbjct  209  REFMIGSSLFYYTLIVVIGIVWQCFFLGALGVVYCASSLASGVFVSVLLPVTEVLAVVCF  268

Query  70   HEKFQPEKGVSLFLCLWGFVSYF  2
             EKFQ EKGV+L L LWGFVSYF
Sbjct  269  REKFQAEKGVALLLSLWGFVSYF  291



>gb|EPS74474.1| hypothetical protein M569_00285, partial [Genlisea aurea]
Length=311

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 157/314 (50%), Positives = 217/314 (69%), Gaps = 8/314 (3%)
 Frame = -1

Query  943  LLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRS  764
            L+ N +LLA+G+ G PL++RLYF+ GG  LWF++WLQT+A+P++ IPLL ++LR      
Sbjct  2    LIINGLLLAVGSSGIPLIMRLYFIHGGKMLWFASWLQTSAFPLILIPLLFNHLR-----R  56

Query  763  DVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfa  584
               +  +FF +   L  + A IG+ +G  NYLY YG +KLPVSTSSLI S+QL FTALF+
Sbjct  57   TTTTAARFFSINRKLSAAAAAIGIAIGFNNYLYAYGSSKLPVSTSSLIFSTQLIFTALFS  116

Query  583  ffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLI  404
            F LVK  FTA+S+N+IVLLT GAV+L     +     ES+++Y  GF +T+ + AL GLI
Sbjct  117  FLLVKHKFTAYSINAIVLLTVGAVILSF---HSSAKDESDRDYEFGFAVTVTAVALSGLI  173

Query  403  MPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAA  224
             PL+EL Y K++  +  ++ LEFQ V+S  AT FC+VGM +  DF+ I  EA+ FE+GA 
Sbjct  174  QPLMELCYLKSDQAVDGVVALEFQFVLSSFATGFCTVGMLMGKDFEGISGEAKGFEIGAV  233

Query  223  KYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKG  44
             Y + V  + ++ Q F +G++GVI   S+LL+ VI    LP+ E+LAV+LF EKF+PEKG
Sbjct  234  NYILTVFFTAVVSQCFFLGSVGVIHLSSALLAGVIICASLPLCEILAVVLFREKFRPEKG  293

Query  43   VSLFLCLWGFVSYF  2
            VSL L LWG VSYF
Sbjct  294  VSLLLSLWGSVSYF  307



>ref|XP_004959525.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=409

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 151/323 (47%), Positives = 210/323 (65%), Gaps = 7/323 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              M  + +  N  LLA+G  GG LL RLY++ GG R W S  LQT  WP++ IPL  SY 
Sbjct  68   TTMGRLLVALNCTLLALGGTGGQLLSRLYYINGGQRQWLSAGLQTGGWPLLLIPLAGSYA  127

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR R    D      L  P   ++ A +G++ G+ ++LY +G+  LPVSTS++++S+QL
Sbjct  128  SRRAR----DRGAPVLLSPPRFLLAAAGLGVITGVDDFLYAWGLEFLPVSTSAILISTQL  183

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
             FT LF+F +V+   TA +VN++ LLT G VVLGL   +DRP G +  +Y LGFVLTLG+
Sbjct  184  VFTVLFSFLIVRHRLTAATVNAVALLTVGGVVLGLHVSSDRPEGVTRGQYWLGFVLTLGA  243

Query  424  AALYGLIMPLVELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPR  254
            AAL G++MPLVEL Y  A      + Y + +E Q+V+ L AT F + GM +N DFQ IP 
Sbjct  244  AALGGVLMPLVELAYKCAAGGGRVLTYSVAMELQLVIGLVATAFFTAGMIVNKDFQAIPS  303

Query  253  EAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVIL  74
            EA+ FELG A+YY +++ + +++QFF +GA+GVI    +LL+ ++  V +PVTE+ AVI 
Sbjct  304  EAKRFELGEARYYTVLVWAAVLWQFFFLGAVGVIFCVHTLLAGILIAVFIPVTEVAAVIF  363

Query  73   FHEKFQPEKGVSLFLCLWGFVSY  5
             HEKF  EKGV+L L LWG  SY
Sbjct  364  LHEKFSSEKGVALVLSLWGLASY  386



>ref|XP_002301070.2| hypothetical protein POPTR_0002s09980g [Populus trichocarpa]
 gb|EEE80343.2| hypothetical protein POPTR_0002s09980g [Populus trichocarpa]
Length=349

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 149/320 (47%), Positives = 218/320 (68%), Gaps = 5/320 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              M+   +  N +L+A+G   GPLL+R+Y+L GG   W   WL TA +P++ IP+ ISY+
Sbjct  18   KHMKAFLVFLNCMLMAVGQVAGPLLVRIYYLHGGKSNWLGAWLLTAGFPILIIPIAISYI  77

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            R R R           L+TP LF +  ++GLL+GL +YLY++G++ LPVS SS++ SSQL
Sbjct  78   RARARAQ-----AGRLLVTPWLFSASVILGLLLGLDSYLYSFGMSYLPVSVSSILGSSQL  132

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA+FA+ +VK  FT +S+N++ L+T G+V+LG     DRP+GES  +Y LGF +T+G 
Sbjct  133  AFTAIFAYIIVKHKFTHYSINAVALMTFGSVILGFHMNGDRPSGESKGKYILGFFMTIGG  192

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AAL+G +MP +E  Y KA   I + LVL+ Q ++S+ ATLFCS+ M IN DF+ I +EA 
Sbjct  193  AALHGFLMPALEFTYLKAGKAITFDLVLQVQFLISMFATLFCSIPMIINKDFKAISKEAA  252

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            EF LG  KYY +++ + I+ Q  +IG+LGVI   SSLL  +++++L+PV +  AV++  E
Sbjct  253  EFGLGKTKYYTILLIAAIVLQLLVIGSLGVIFNSSSLLGGLVSSLLVPVQQAFAVMILKE  312

Query  64   KFQPEKGVSLFLCLWGFVSY  5
             F  EKG++L +CLWGF SY
Sbjct  313  VFNAEKGMALAMCLWGFASY  332



>ref|XP_009631999.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=358

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 146/319 (46%), Positives = 218/319 (68%), Gaps = 3/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++T+ ++ N I LA+G   G +L+R+YFL GG R W   +  TA +P++ +P+ IS+   
Sbjct  24   IKTLLIVINCIFLAVGQIAGVMLVRIYFLHGGKRKWLQAFWLTAGFPILLLPIAISF---  80

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
             +RR    + T   L+TP L ++ A++GLL+G+ +YLYT+G++ LPVS SSL+ S+ LAF
Sbjct  81   AKRRKANKTETNRVLLTPKLILASAILGLLLGVCSYLYTFGMSYLPVSISSLLASTSLAF  140

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA+FA+F+VK  FT +SVN++VL+T G+++LGL    DRP GESN++Y LGFV+T+  AA
Sbjct  141  TAIFAYFIVKHKFTHYSVNAVVLMTFGSIILGLHMNGDRPKGESNRQYVLGFVMTIVGAA  200

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            L+G +   VE  + KA   + + LV++ Q ++S+ +TLFC V M IN DFQ I REA  F
Sbjct  201  LHGFLNAGVEYSHIKAGVAVTFDLVMQMQFLISMFSTLFCVVAMIINKDFQTIHREAEAF  260

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG  KYY+++  S I  Q  +IG LG+I   S+LLS + N++L+PV ++ AV+   E F
Sbjct  261  GLGQNKYYMILALSAIALQIMIIGNLGLIFSSSALLSGIFNSLLVPVQQIFAVMFLPESF  320

Query  58   QPEKGVSLFLCLWGFVSYF  2
              EK ++L +CLWGF SYF
Sbjct  321  NAEKWMALAMCLWGFASYF  339



>gb|EPS72255.1| hypothetical protein M569_02503, partial [Genlisea aurea]
Length=232

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 176/228 (77%), Gaps = 0/228 (0%)
 Frame = -1

Query  685  GLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvl  506
            GL+NY YTYGV+K+PVSTSSLI++SQLAFTA+F FFLVKQ FT +S+N++VLLT GA VL
Sbjct  2    GLVNYFYTYGVSKIPVSTSSLIIASQLAFTAVFCFFLVKQKFTPYSINAVVLLTCGAAVL  61

Query  505  glraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMV  326
             + A +DRP GESNK+Y +GF++T   + LYGLI+PL+EL Y +A   + Y L+LEFQMV
Sbjct  62   AMHASSDRPNGESNKDYWMGFIMTAAVSVLYGLILPLMELSYMRAGQVLSYSLILEFQMV  121

Query  325  VSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICY  146
            +   AT FC+VGM +N DFQ I  EA  FELG AKYY++V  +  I Q F +G +GVI Y
Sbjct  122  MCFFATAFCTVGMIVNKDFQAIGEEAEGFELGVAKYYVVVFFNVTINQCFFVGVVGVIFY  181

Query  145  GSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
             SSL S V+  +LLP TE+LAV+ FHEKFQ EKGVSLFL LWGFVSYF
Sbjct  182  SSSLFSGVLLALLLPPTEILAVVFFHEKFQVEKGVSLFLALWGFVSYF  229



>ref|XP_009762898.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=359

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 143/319 (45%), Positives = 215/319 (67%), Gaps = 4/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++T+ +  N I +A+G   G +L+R+YFL GG R W   +L TA +P++ +P+ ISY   
Sbjct  23   IKTLLVFINCIFMAVGQIAGVMLVRIYFLHGGKRKWLQAFLLTAGFPILVLPIAISY---  79

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
              +R    + T   ++TP L ++ A++GLL  + +YLYT+G++ LPVS SSL+ S+ LAF
Sbjct  80   -AKRRKAKTETNRVILTPKLILASAILGLLFCVCSYLYTFGMSYLPVSISSLLASTSLAF  138

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA+FA+F VK  FT +S+N++VL+T G+++LGL    DRP GESN++Y LGFV+T+  AA
Sbjct  139  TAIFAYFFVKHKFTHYSINAVVLMTFGSIILGLHMNGDRPKGESNRQYVLGFVMTIVGAA  198

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            L+G +   VE  + KA   + + LV++ Q ++ + +TLFC V M IN DFQ I REA EF
Sbjct  199  LHGFVNAGVEYSHIKAGVVVTFDLVMQMQFLICIFSTLFCVVAMIINEDFQAIHREAGEF  258

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG  KYY+++  S I  Q  +IG LG+I   S+LLS ++N++L+PV ++ AV+   E F
Sbjct  259  RLGQNKYYMILALSAIALQIMIIGNLGLIFSSSALLSGIVNSLLVPVQQIFAVMFLPESF  318

Query  58   QPEKGVSLFLCLWGFVSYF  2
              EK ++L +CLWGF SYF
Sbjct  319  NAEKWMALAMCLWGFASYF  337



>ref|XP_010247465.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=364

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 155/314 (49%), Positives = 216/314 (69%), Gaps = 3/314 (1%)
 Frame = -1

Query  943  LLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRS  764
            L+ N  ++AIG  GGPLL+RLY+L GG R W S+ LQ+A +P++ IPL + YLR RR R 
Sbjct  32   LILNCTIMAIGTIGGPLLMRLYYLHGGNRRWLSSLLQSAGFPILLIPLSLLYLRHRRHRG  91

Query  763  DVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfa  584
               S    F + P L +S A++GLL+GL N++Y  G++ +PVSTS+++ +SQLAF A FA
Sbjct  92   VSPSE---FFIEPKLLVSSAVLGLLLGLDNFMYALGLSYIPVSTSAILFASQLAFIAGFA  148

Query  583  ffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLI  404
              +VKQ FT +S+NS+VL+T G++ LG+ +  DRPAG S+ EY  GF+LTLGSA L G I
Sbjct  149  RLIVKQRFTPYSINSVVLMTIGSITLGIHSDGDRPAGVSDGEYLSGFLLTLGSALLIGFI  208

Query  403  MPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAA  224
            +P +E  Y+KA+  +    V++FQ  V L +++  + GM IN DFQ IPREARE+ELG  
Sbjct  209  LPSIEFAYSKASRAVDLTAVMQFQFNVGLFSSILSATGMLINKDFQEIPREAREYELGHG  268

Query  223  KYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKG  44
             YY ++  S I +Q   +G LG+I   +SL + + + VLLP  E+ AVI +HEKF  EKG
Sbjct  269  MYYFVLSASAIAWQLSFVGLLGLIFCTTSLFTGIYSAVLLPFAEVGAVIAYHEKFTGEKG  328

Query  43   VSLFLCLWGFVSYF  2
            ++L LCLWGF SYF
Sbjct  329  IALALCLWGFTSYF  342



>tpg|DAA61854.1| TPA: hypothetical protein ZEAMMB73_233624 [Zea mays]
Length=394

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 155/351 (44%), Positives = 214/351 (61%), Gaps = 35/351 (10%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              M    +  N  +LA+G  GGPLL RLYF +GG R W S WL+T  WP++ IP+  S++
Sbjct  16   KAMHRFLVALNCGMLAVGAIGGPLLSRLYFSKGGHRQWLSAWLETGGWPLLVIPVAASFV  75

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
             RR R    D      L  P + ++ A +G+  G  +++Y +G+A LPVSTS++++S+QL
Sbjct  76   ARRAR----DRGAPVLLAPPRILLAAAGLGVATGADDFIYAFGLAYLPVSTSAILISTQL  131

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFT  FAF +V+Q  TA SVN++ LLT GAVVLGL   +DRP G +  +Y LGFVLTLG+
Sbjct  132  AFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGQYWLGFVLTLGA  191

Query  424  AALYGLIMPLVELIY----NKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ---  266
            AALYGL++PLVEL Y          + Y LV+E Q+V+   AT FC+VGM +N DFQ   
Sbjct  192  AALYGLVLPLVELAYRRAAGAGGRAVTYALVVEMQLVMGFFATAFCTVGMVVNKDFQGAH  251

Query  265  ------------------------VIPREAREFELGAAKYYILVICSGIIFQFFLIGALG  158
                                     IPREAR ++LG A+YY ++  S +++Q F +GA+G
Sbjct  252  RLANWQQQCPRAEMPPDDGIIIGAAIPREARRYKLGEARYYAVLAWSAVLWQCFFLGAVG  311

Query  157  VICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGFVSY  5
            VI    +LL+ ++  V +PVTE+ AVI   E+F  EKGV+L L LWG  SY
Sbjct  312  VIFCVHTLLAGILIAVFIPVTEVAAVIFLRERFSSEKGVALVLSLWGLASY  362



>emb|CDY15687.1| BnaA07g08580D [Brassica napus]
Length=303

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 190/255 (75%), Gaps = 0/255 (0%)
 Frame = -1

Query  766  SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalf  587
            ++   NT+FFL+ P L ++  LIG+L G  NYLY YG+A LPVST++LI++SQLAF A+F
Sbjct  19   NNEGENTRFFLIKPRLLMAAILIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAIF  78

Query  586  affLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGL  407
            ++F+V   FT F++N++VLLT GA VLG+    D+P  E++K+Y +GF++T+ +A +Y  
Sbjct  79   SYFMVSHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYMVGFLVTVAAAVMYAF  138

Query  406  IMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGA  227
            ++PLVEL Y KA  P+ Y LVLE QM++   A+L   VGM I  DF+ +P EAREF+LG 
Sbjct  139  LLPLVELAYQKAKQPMSYTLVLEVQMILCFLASLVSLVGMLIAGDFKALPNEAREFKLGE  198

Query  226  AKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEK  47
            A +Y++ + S II+Q F +GA+G+I   SSL+S ++ +VLLP+TE+LAVI +HEKFQ EK
Sbjct  199  AMFYVVAVLSAIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIFYHEKFQKEK  258

Query  46   GVSLFLCLWGFVSYF  2
            G+SL L LWGFVSYF
Sbjct  259  GLSLALSLWGFVSYF  273



>ref|XP_002513954.1| purine transporter, putative [Ricinus communis]
 gb|EEF48537.1| purine transporter, putative [Ricinus communis]
Length=358

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 150/325 (46%), Positives = 227/325 (70%), Gaps = 3/325 (1%)
 Frame = -1

Query  979  QRI*CNKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPL  800
            Q+     ++ + ++ N +L++IG  GGPLL+RLY+L GG R W ++WL TA +P++ +P+
Sbjct  13   QQENSKHIKILLVVLNCLLMSIGQVGGPLLIRLYYLHGGKRKWLTSWLLTAGFPILILPI  72

Query  799  LISYLrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLI  620
              SY+  R   +   + T   L+T  LF + A IGLL+GL  YLY++G++ LPVS SSL+
Sbjct  73   SSSYMIAR---ARSRAPTSRLLLTRWLFAASAFIGLLLGLDGYLYSFGLSYLPVSVSSLL  129

Query  619  VSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFV  440
             S+QLAFTA+FA+ +VK  FT +S+N++VL+T G+++LG     D P GESN +Y LGF 
Sbjct  130  GSTQLAFTAIFAYIVVKHRFTHYSINAVVLMTFGSIILGFHMNGDVPNGESNGKYVLGFF  189

Query  439  LTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVI  260
            + +G+AAL+G IMP VE  +  A  PI + LV++ Q ++S+ ATLFC++ M IN DFQ I
Sbjct  190  MAVGAAALHGFIMPAVEYTHMNAGMPITFDLVMQVQFLISMFATLFCTIPMIINKDFQAI  249

Query  259  PREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAV  80
            P+EA +F LG AKYY +++ + +I Q  +IG+LGVI   +SLL  +++++L+PV ++ AV
Sbjct  250  PKEAEKFGLGQAKYYTILVVAAVIMQLLIIGSLGVIFASTSLLGGLVSSLLVPVQQVFAV  309

Query  79   ILFHEKFQPEKGVSLFLCLWGFVSY  5
            I  HE F  EKG++L +CLWGF S+
Sbjct  310  IFLHEVFNAEKGMALAMCLWGFASH  334



>emb|CDY35721.1| BnaC03g58420D [Brassica napus]
Length=319

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 146/312 (47%), Positives = 192/312 (62%), Gaps = 34/312 (11%)
 Frame = -1

Query  925  LLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrR---SDVD  755
            LL I  CGGPLL RLY+ +GG+R+WF ++L TA  P++ IPL +S+LR   R    S+  
Sbjct  6    LLIIVTCGGPLLTRLYYTKGGSRIWFMSFLATAGCPIILIPLYVSFLRLSNRSHNNSETT  65

Query  754  SNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffL  575
               K F+M   LFI+   +     + ++L                              +
Sbjct  66   EKAKVFVMETPLFIAYPSLSAFNAIFSFL------------------------------M  95

Query  574  VKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPL  395
            VKQ FT FS+N++VLLT G  +L L    DRPAG S KEY +GF+LTL +A LY  +MPL
Sbjct  96   VKQKFTPFSINAVVLLTVGTGILALHTNGDRPAGVSKKEYVVGFMLTLIAAVLYAFLMPL  155

Query  394  VELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAK-Y  218
            VEL Y K    I + LVLE QMV+ +A+T FC VGM +  DF+ IPREAREF +G++  Y
Sbjct  156  VELTYKKVRQEITFTLVLEMQMVMCVASTCFCLVGMVVKGDFKAIPREAREFMIGSSLFY  215

Query  217  YILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVS  38
            Y L++  GI++Q F +GA GV+   SSL S V  +VLLPVTE+LAV+ F EKFQ +KGV+
Sbjct  216  YTLIVVIGIVWQCFFLGAFGVVYCASSLTSGVFVSVLLPVTEVLAVVCFREKFQAKKGVA  275

Query  37   LFLCLWGFVSYF  2
            L L LWGFVSYF
Sbjct  276  LLLSLWGFVSYF  287



>ref|XP_010926344.1| PREDICTED: purine permease 3-like isoform X1 [Elaeis guineensis]
Length=367

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 215/312 (69%), Gaps = 4/312 (1%)
 Frame = -1

Query  937  FNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDV  758
            FN +L+ +G+ GG LLLRLYF+RGG R+W ST+LQ AAWP   I LL  YL R    +  
Sbjct  35   FNAVLMLVGSGGGSLLLRLYFVRGGHRMWLSTFLQVAAWP---ILLLPLYLSRLFLPTTT  91

Query  757  DSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaff  578
                   L+   L  + A +GLL+ L  YLY YG + LP+STSSL+++SQLAFTA+F+F 
Sbjct  92   TPRRHHLLLPLPLAAASAFLGLLIALDCYLYAYGSSCLPLSTSSLLIASQLAFTAVFSFL  151

Query  577  LVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMP  398
            +V+Q FTAFS+N++VLLT G VVL L A  DRP GE+  +Y +GF +++ +AAL GL++P
Sbjct  152  IVRQRFTAFSLNAVVLLTLGPVVLSLGAAGDRPEGEAMSKYYVGFFMSIAAAALIGLVLP  211

Query  397  LVELIYNKANTP-IGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAK  221
            LVEL Y + +T  + Y  V+  Q+V+  + ++FC +GM IN DFQ IP+EA++FELG  K
Sbjct  212  LVELAYRRMSTEEMTYATVIVTQIVMGASGSVFCLLGMLINKDFQAIPKEAKDFELGELK  271

Query  220  YYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGV  41
            YY+++I + I +Q   +G +GVI   SSL   V+  +L+PV E+LAVI  +EKF   KGV
Sbjct  272  YYMVLIWNAICWQIINVGMVGVIFTASSLFCGVMIAILVPVGEILAVIFLNEKFNGSKGV  331

Query  40   SLFLCLWGFVSY  5
            +L LCLWGF SY
Sbjct  332  ALALCLWGFASY  343



>ref|XP_009801738.1| PREDICTED: purine permease 1-like isoform X1 [Nicotiana sylvestris]
Length=310

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 148/305 (49%), Positives = 199/305 (65%), Gaps = 29/305 (10%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL-r  782
            M+ + L+ N I LA+G CGGPL++RLYF++GG R+W STWLQT AWP+ F+PL ISY   
Sbjct  1    MKIVLLVLNCIFLAVGTCGGPLVMRLYFIKGGKRIWLSTWLQTVAWPINFLPLGISYFYS  60

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
             +    + ++NTK  LMTP +F++   IG+L G  NY Y+YG AKLPVSTS L+ ++QLA
Sbjct  61   LKNINDNNNNNTKVILMTPRIFVATIGIGVLQGFGNYFYSYGTAKLPVSTSGLLFATQLA  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FT  FAF + K  FT++ VN+++LLT G V+L L +G D+P GE+ KEY LGF++TL +A
Sbjct  121  FTTGFAFLIAKLKFTSYLVNAVILLTIGVVLLALHSGGDQPEGETKKEYILGFIMTLAAA  180

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
            AL GLI PLVELIY KA+  I Y LVLEFQ V    AT+  ++GM IN D          
Sbjct  181  ALSGLIFPLVELIYKKAHQAITYTLVLEFQTVYCFVATIVATIGMIINKD----------  230

Query  241  FELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEK  62
                              F F+ +G +GVI   SSL+S ++ +VLLPVTE+LAV ++ EK
Sbjct  231  ------------------FLFYFLGTIGVIYSASSLVSGILISVLLPVTEILAVFIYGEK  272

Query  61   FQPEK  47
               +K
Sbjct  273  LVQKK  277



>ref|XP_010098677.1| Purine permease 3 [Morus notabilis]
 gb|EXB75580.1| Purine permease 3 [Morus notabilis]
Length=273

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 170/233 (73%), Gaps = 4/233 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
            N+     L+ N ILL+IGNCGGPL++RLYFL GG R+W S+WL+T  W ++ +PL  S+ 
Sbjct  10   NRQNKALLILNCILLSIGNCGGPLIMRLYFLNGGKRVWLSSWLETGGWAIILLPLAFSF-  68

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
                RR   +S  KFF + P LF++ A +GLL GL +Y+Y YGVA+LPVSTS+LI++SQL
Sbjct  69   ---YRRRRQNSAAKFFEIKPFLFLASAGVGLLTGLDDYIYAYGVARLPVSTSALIIASQL  125

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FA+ LVKQ FT++SVN++VLLT    VL L    DRP GESNKEY +GF++T+G+
Sbjct  126  AFTAAFAYLLVKQKFTSYSVNAVVLLTIAGAVLALHTSGDRPKGESNKEYLMGFLMTVGA  185

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ  266
            A LYG I+PL+EL+Y KA   I Y LVLE QMV+   AT FC+VGM +N DFQ
Sbjct  186  AVLYGFILPLMELVYKKAKQEITYSLVLEIQMVMCFFATAFCTVGMIVNKDFQ  238



>ref|XP_004252530.1| PREDICTED: purine permease 1-like [Solanum lycopersicum]
Length=364

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/319 (45%), Positives = 223/319 (70%), Gaps = 1/319 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++T+ +  N I +++G   G LL+R+Y+L GG R W   +L TA +P++ +P+ ISYL++
Sbjct  23   IKTLLIFINFIFISVGQISGVLLVRIYYLHGGKRKWLQAFLLTAGFPILILPISISYLKK  82

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            R++ +++++N +FF+ TP L +  A++GLL+G+ +YLYT+G++ LPVS SSL+ S+ LAF
Sbjct  83   RKKITNINNNIRFFV-TPKLAMFSAILGLLLGICSYLYTFGMSYLPVSISSLLSSTSLAF  141

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA+FA+F+VK  FT +SVN++VL+  G+++LGL    DRP GESN+ Y LGFV+TL  AA
Sbjct  142  TAIFAYFMVKHKFTDYSVNAVVLMMLGSIILGLHMNGDRPIGESNRSYALGFVMTLVGAA  201

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            L+G +   VE  + KA   + + LV++ Q ++S+ + LFC V M IN DFQ I REA EF
Sbjct  202  LHGFVNAGVEYSHVKAGVVVTFDLVMQMQFLISMFSALFCIVAMIINKDFQAITREAEEF  261

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG  KYY+++  + I  Q  +IG LG+I   S+LL  ++N +L+P+ ++ AV+   E F
Sbjct  262  GLGQRKYYMILGLTAISLQIMIIGNLGMIFCSSALLLGIVNALLVPIQQIFAVMFLPESF  321

Query  58   QPEKGVSLFLCLWGFVSYF  2
              +K ++L +CLWGF SYF
Sbjct  322  NSDKWMALAMCLWGFASYF  340



>ref|XP_006360267.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=361

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 143/319 (45%), Positives = 224/319 (70%), Gaps = 2/319 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++T+ +L N I +++G   G LL+R+Y+L GG R W   +L TA +P++ +P+ ISY+++
Sbjct  21   IKTLLILINCIFISVGQISGVLLVRIYYLHGGKRKWLQAFLLTAGFPILILPISISYVKK  80

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            R++ ++ ++N + F+ TP L I  A++G+L+G+ +YLYT+G++ LPVS SSL+ S+ LAF
Sbjct  81   RKKITN-NNNIRLFV-TPKLAIFSAILGILLGICSYLYTFGMSYLPVSISSLLSSTSLAF  138

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA+FA+F+VK  FT +SVN++VL+  G+++LGL    DRP GESN+ Y LGFV+TL  AA
Sbjct  139  TAIFAYFMVKHKFTDYSVNAVVLMMLGSIILGLHMNGDRPIGESNRRYTLGFVMTLVGAA  198

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            L+G +   VE  + KA   + + LV++ Q ++S+ + LFC V M IN DFQ I REA EF
Sbjct  199  LHGFVNAGVEYSHVKAGVVVTFDLVMQMQFLISMFSALFCIVAMIINKDFQAITREAEEF  258

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG  KYY+++  + I  Q  +IG LG+I   S+LLS ++N +L+P+ ++ AV+   E+F
Sbjct  259  GLGQRKYYMILALTAISLQTMIIGNLGMIFCSSALLSGIVNALLVPIQQIFAVMFLPERF  318

Query  58   QPEKGVSLFLCLWGFVSYF  2
              +K ++L +CLWGF SYF
Sbjct  319  NSDKWMALAMCLWGFASYF  337



>ref|XP_010248452.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=326

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 157/307 (51%), Positives = 214/307 (70%), Gaps = 3/307 (1%)
 Frame = -1

Query  922  LAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTK  743
            +AIGN GGPLL+RLY+L GG R W S  LQ+A +P++ IPL + YL  RRRR    S   
Sbjct  1    MAIGNIGGPLLMRLYYLHGGNRRWLSCSLQSAGFPILLIPLSLLYLHHRRRRGVSPSE--  58

Query  742  FFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQH  563
             F + P L +S A++GLL+GL N++Y  G++ +PVSTS+L+ ++QLAFTA FA  +VKQ 
Sbjct  59   -FFIEPKLLVSSAVLGLLLGLDNFMYALGLSYIPVSTSALLFATQLAFTAGFARLIVKQR  117

Query  562  FTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELI  383
            FT +S+NS+VL+  G++ LG+ +G D PAG S+ EY  GF LTLGSA L G I+P +E  
Sbjct  118  FTPYSINSVVLMILGSITLGIHSGGDWPAGVSDGEYLSGFFLTLGSALLVGFILPCIEFA  177

Query  382  YNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVI  203
            Y+KA+  + +  V++FQ  + L AT+F ++ M IN DFQ IPREARE+ELG   YY ++ 
Sbjct  178  YSKASRAVDFAAVMQFQFNMGLFATIFAAMEMLINKDFQEIPREAREYELGHGMYYFVLS  237

Query  202  CSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCL  23
             S I++Q  LIG LG+I   +SL + +   VLLP  E+ AVI +HEKF  EKG++L LCL
Sbjct  238  ASAIVWQLSLIGLLGLIFCTTSLFTGIYGAVLLPFAEIGAVIAYHEKFTGEKGIALALCL  297

Query  22   WGFVSYF  2
            WGF SYF
Sbjct  298  WGFTSYF  304



>ref|XP_006360266.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=364

 Score =   228 bits (580),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 140/319 (44%), Positives = 219/319 (69%), Gaps = 1/319 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            ++T+ +L   I L +G   G LL+R+Y+L GG R W  + L TA +P++ +P+ ISY+++
Sbjct  23   IKTLLILIYCIFLLVGQISGVLLVRIYYLHGGKRKWLQSLLLTAGFPILILPISISYMKK  82

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
             ++ +  ++N + F+ TP L I  A++G+L G+ +YLYT G++ LPVS SSL+ S+ LAF
Sbjct  83   MKKITINNNNIRLFV-TPKLAIFSAILGILFGICSYLYTIGMSYLPVSISSLLSSTSLAF  141

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
            TA+FA+F+VK  FT +SVN++VL+  G+++LGL    DRP GESN++Y LGFV+T+  AA
Sbjct  142  TAIFAYFMVKHKFTHYSVNAVVLMMLGSIILGLHMNGDRPIGESNRQYTLGFVMTIIGAA  201

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            L+G +   VE  + KA   + + LV++ Q ++S+ ++LFC V + IN DFQ I REA EF
Sbjct  202  LHGFLNAGVEYSHVKAGVVVTFDLVMQIQFLISMFSSLFCIVAIIINRDFQAITREAEEF  261

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG  KYY+++  + I  Q  +IG+LG+I   S+LL  ++N +L+P+ ++ AVI   E F
Sbjct  262  GLGQKKYYMILALTAISLQTMMIGSLGMIFCSSALLFGIVNALLIPIQQIFAVIFLPESF  321

Query  58   QPEKGVSLFLCLWGFVSYF  2
              +K ++L +CLWGF SYF
Sbjct  322  NSDKWMALAMCLWGFASYF  340



>ref|XP_010418647.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=248

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 134/242 (55%), Positives = 177/242 (73%), Gaps = 2/242 (1%)
 Frame = -1

Query  961  KMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLr  782
            KM+++ ++ N I LAIG+CGGPL+LRLYF  GG R+WFS++LQT   P++  PLL S+L 
Sbjct  4    KMKSVRVIINCIFLAIGSCGGPLMLRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLS  63

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            RRR   +    T  FLM P LFI+  ++GLL+G  NYLY+YG+A +PVST+SLI+S+QL 
Sbjct  64   RRRL--EEQEKTSLFLMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLG  121

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FTALFAFF+VKQ FT F++N+IVLLT GAVVL   + +D+ A E++KEY +GF++T G+A
Sbjct  122  FTALFAFFMVKQKFTPFTINAIVLLTVGAVVLAFNSDSDKLANETHKEYVVGFLMTAGAA  181

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREARE  242
             LY  I+PLVEL Y K+   + Y LVLEFQMV+   AT FC VGM  + DF+VI RE   
Sbjct  182  LLYAFILPLVELAYKKSRQRVTYTLVLEFQMVLCFVATCFCLVGMLASGDFKVIAREXST  241

Query  241  FE  236
             E
Sbjct  242  LE  243



>ref|XP_011016754.1| PREDICTED: purine permease 1-like [Populus euphratica]
Length=349

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 146/320 (46%), Positives = 215/320 (67%), Gaps = 5/320 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              M+   +  N +L+A+G   GPLL+R+Y+L GG   W   WL TA +P++ IP+ ISY+
Sbjct  18   KHMKAFLVFLNCMLMAVGQVAGPLLVRMYYLHGGKSNWLGAWLLTAGFPILIIPISISYI  77

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            R R R           L+TP LF +  ++GL++GL +YLY++G++ LPVS SS++ SSQL
Sbjct  78   RARARAQ-----AGRLLVTPWLFSASVILGLVLGLDSYLYSFGMSYLPVSVSSILGSSQL  132

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
             FTA FA+ +VK  FT +S+N++ L+T G+++LG     DRP+GES  +Y LGF +T+G 
Sbjct  133  TFTAFFAYIIVKHKFTHYSINAVALMTFGSLILGFHMNGDRPSGESKGKYILGFFMTIGG  192

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR  245
            AAL+G +MP +E  Y KA   I + LVL+ Q ++S+ ATLFCS+ M IN DF+ I +EA 
Sbjct  193  AALHGFLMPALEFTYLKAGKAITFDLVLQVQFLISMFATLFCSIPMIINKDFKAISKEAA  252

Query  244  EFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHE  65
            EF LG  KYY +++ + I+ Q  +IG+LGVI   SSLL  +++++L+PV +  AVI+  E
Sbjct  253  EFGLGETKYYTILLIAAIVLQLLVIGSLGVIFNSSSLLGGLVSSLLVPVQQAFAVIILKE  312

Query  64   KFQPEKGVSLFLCLWGFVSY  5
             F   KG++L +CLWGF SY
Sbjct  313  VFNAVKGMALAMCLWGFASY  332



>gb|KCW66597.1| hypothetical protein EUGRSUZ_F00391 [Eucalyptus grandis]
Length=261

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 169/233 (73%), Gaps = 3/233 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
               + + L  N  +L++G CGGPLL+RLY+L GG+ +W S+WL+T  WP +F+ L ++YL
Sbjct  29   ETQKPLLLALNCAMLSLGTCGGPLLMRLYYLYGGSGVWLSSWLETGGWPAIFLALAVAYL  88

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
            RRR   S    + +  LM P LF + A++G+L GL +YLY YGVA+LP STS+L++++QL
Sbjct  89   RRR---SAEGPSARLVLMDPFLFAASAVVGVLTGLDDYLYAYGVARLPASTSALLIATQL  145

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
            AFTA FAF LV+Q FT++S+NS+ LLT  A VL L A +DRPAGES++EY  GF +TLG+
Sbjct  146  AFTAGFAFLLVRQQFTSYSINSVYLLTVAAGVLALNASSDRPAGESDQEYYAGFFMTLGA  205

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ  266
            AALYG ++PLVEL Y KA   + Y LVLE Q+V+   AT FC+VGM +N DFQ
Sbjct  206  AALYGFVLPLVELTYKKAKQAVTYSLVLEIQLVMCFFATAFCTVGMLVNKDFQ  258



>ref|XP_006661332.1| PREDICTED: purine permease 3-like, partial [Oryza brachyantha]
Length=265

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 175/240 (73%), Gaps = 3/240 (1%)
 Frame = -1

Query  715  ISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTAFSVNSI  536
            ++GA +G+L G  +++Y  G+A LPVSTS+++ S+ LAFT  FA  +V+Q  TA ++N++
Sbjct  1    LAGAGLGVLTGADDFIYASGLAYLPVSTSAILTSTHLAFTVFFACLIVRQRLTAATLNAV  60

Query  535  vlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNKA---NT  365
             LLT GAVVLGL   NDRPAG +N +Y +GF LTLG+AALYGLI+PLVEL Y  A     
Sbjct  61   ALLTIGAVVLGLHTSNDRPAGVTNGKYWMGFFLTLGAAALYGLILPLVELAYKHAAGGGR  120

Query  364  PIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICSGIIF  185
             + Y LV+E Q+V+   AT FC+VGM ++ DFQ IPREA+++ELG  +YY +++ + I++
Sbjct  121  AVTYALVVEMQLVMGFFATAFCTVGMIVDKDFQAIPREAKQYELGETRYYTVLVFNAILW  180

Query  184  QFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGFVSY  5
            QFF +GA+GVI Y  +LL+ +I  V +P+TE+L+V+  HEKF  EKGV+L L LWG  SY
Sbjct  181  QFFFVGAIGVIFYVHTLLAGIIIAVFIPITEVLSVVFLHEKFSSEKGVALVLSLWGLASY  240



>ref|XP_009801739.1| PREDICTED: purine permease 1-like isoform X2 [Nicotiana sylvestris]
Length=264

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 172/243 (71%), Gaps = 2/243 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL-r  782
            M+ + L+ N I LA+G CGGPL++RLYF++GG R+W STWLQT AWP+ F+PL ISY   
Sbjct  1    MKIVLLVLNCIFLAVGTCGGPLVMRLYFIKGGKRIWLSTWLQTVAWPINFLPLGISYFYS  60

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
             +    + ++NTK  LMTP +F++   IG+L G  NY Y+YG AKLPVSTS L+ ++QLA
Sbjct  61   LKNINDNNNNNTKVILMTPRIFVATIGIGVLQGFGNYFYSYGTAKLPVSTSGLLFATQLA  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FT  FAF + K  FT++ VN+++LLT G V+L L +G D+P GE+ KEY LGF++TL +A
Sbjct  121  FTTGFAFLIAKLKFTSYLVNAVILLTIGVVLLALHSGGDQPEGETKKEYILGFIMTLAAA  180

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDF-QVIPREAR  245
            AL GLI PLVELIY KA+  I Y LVLEFQ V    AT+  ++GM IN DF ++   E  
Sbjct  181  ALSGLIFPLVELIYKKAHQAITYTLVLEFQTVYCFVATIVATIGMIINKDFLEIRATEDP  240

Query  244  EFE  236
            EFE
Sbjct  241  EFE  243



>ref|XP_006415683.1| hypothetical protein EUTSA_v10009673mg [Eutrema salsugineum]
 gb|ESQ34036.1| hypothetical protein EUTSA_v10009673mg [Eutrema salsugineum]
Length=338

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 206/327 (63%), Gaps = 26/327 (8%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M    ++ N I+LAIGNCGGPL++RLYF  GG  +WFST+L+TA +P++FIPLL SYL+R
Sbjct  1    MGRAIVIINCIVLAIGNCGGPLIMRLYFNNGGKSIWFSTFLETAGFPIIFIPLLFSYLKR  60

Query  778  rrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaf  599
            RR  ++ + NT  FL+ P L I+  LIG+L G  NYLY YG+A LPVST++LI++SQLAF
Sbjct  61   RRS-NNGNENTSLFLIKPRLLIAAVLIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAF  119

Query  598  talfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAA  419
             A+F++F+V   FT F++N++VLLT GA VLG+    D+P  E++K+Y +GF++T+ +A 
Sbjct  120  IAIFSYFMVNHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYIIGFLVTVAAAV  179

Query  418  LYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
            +Y  ++PLVEL Y KA  P+ Y LVLE Q+++   A+L   +G+  N   ++        
Sbjct  180  MYAFVLPLVELAYQKAKQPMSYSLVLEVQLILCFLASLVSLIGL-TNRSKRIQAWRGN--  236

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGS---SLLSVVINTVLLPVTEL-----LA  83
                      V+C G  F       L  I  GS    LL ++       ++       L+
Sbjct  237  ----------VLCGGCGFSH----NLARILLGSHWIDLLRIISRLGYYDISPFAHHRGLS  282

Query  82   VILFHEKFQPEKGVSLFLCLWGFVSYF  2
               +HEKFQ EKG+SL L LWGFVSYF
Sbjct  283  CYFYHEKFQAEKGLSLALSLWGFVSYF  309



>ref|XP_009801740.1| PREDICTED: purine permease 1-like isoform X3 [Nicotiana sylvestris]
Length=237

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 166/231 (72%), Gaps = 1/231 (0%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL-r  782
            M+ + L+ N I LA+G CGGPL++RLYF++GG R+W STWLQT AWP+ F+PL ISY   
Sbjct  1    MKIVLLVLNCIFLAVGTCGGPLVMRLYFIKGGKRIWLSTWLQTVAWPINFLPLGISYFYS  60

Query  781  rrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
             +    + ++NTK  LMTP +F++   IG+L G  NY Y+YG AKLPVSTS L+ ++QLA
Sbjct  61   LKNINDNNNNNTKVILMTPRIFVATIGIGVLQGFGNYFYSYGTAKLPVSTSGLLFATQLA  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSA  422
            FT  FAF + K  FT++ VN+++LLT G V+L L +G D+P GE+ KEY LGF++TL +A
Sbjct  121  FTTGFAFLIAKLKFTSYLVNAVILLTIGVVLLALHSGGDQPEGETKKEYILGFIMTLAAA  180

Query  421  ALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDF  269
            AL GLI PLVELIY KA+  I Y LVLEFQ V    AT+  ++GM IN DF
Sbjct  181  ALSGLIFPLVELIYKKAHQAITYTLVLEFQTVYCFVATIVATIGMIINKDF  231



>gb|EEE69873.1| hypothetical protein OsJ_29687 [Oryza sativa Japonica Group]
Length=341

 Score =   214 bits (545),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 174/239 (73%), Gaps = 3/239 (1%)
 Frame = -1

Query  712  SGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTAFSVNSIv  533
             G  +G+L G  +++Y YG+A LPVSTS++++S+QLAFT  FA  +V+Q  TA ++N++ 
Sbjct  81   GGRGVGVLTGADDFVYAYGLAYLPVSTSAILISTQLAFTVFFACLIVRQRLTAATLNAVA  140

Query  532  lltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNKA---NTP  362
            LLT GAVVLGL A  DRPAG +  +Y +GF LTLG+AALYGLI+PLVEL Y  A      
Sbjct  141  LLTIGAVVLGLHASKDRPAGVTTGKYWMGFFLTLGAAALYGLILPLVELAYKHAAGGGRA  200

Query  361  IGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICSGIIFQ  182
            + Y LV+E Q+V+   AT FC+VG+ +N DFQ IPREA+++ELG A+YY++++ + ++++
Sbjct  201  VTYALVMEMQLVMGFFATAFCTVGVIVNKDFQAIPREAKQYELGEARYYVVLVFNAVLWE  260

Query  181  FFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGFVSY  5
            FF +GA+GVI    +LL+ +I  V +P+TE+L VI  HEKF  EKGV+L L LWG  SY
Sbjct  261  FFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEKGVALVLSLWGLASY  319



>ref|XP_009789614.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=271

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 172/220 (78%), Gaps = 3/220 (1%)
 Frame = -1

Query  919  AIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKF  740
            A+G CGGPL++RLY++ GG+R+WFS+WLQTA WP+  IPL I Y  RR       SNTK 
Sbjct  23   AVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPLTLIPLAILYFYRR---KTQGSNTKL  79

Query  739  FLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHF  560
            + +TP +FI+  +IG++ GL ++LY++G +KLPVSTSSL++++QLAFTA+ AFF+VK  F
Sbjct  80   YFITPRIFIASFIIGVVTGLDDFLYSWGGSKLPVSTSSLLLAAQLAFTAVGAFFIVKLKF  139

Query  559  TAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIY  380
            T +S+N+++LLT GAV+LG+R+  DRP G ++K Y LGF++TL +AALYG+I+P +ELIY
Sbjct  140  TPYSINAVILLTVGAVLLGIRSNGDRPEGVTSKAYILGFMMTLLAAALYGVILPCIELIY  199

Query  379  NKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVI  260
             KA   I   LVLE QM++ LAAT FC++GM +N+DFQV+
Sbjct  200  LKAKQVITATLVLEIQMIMCLAATTFCTMGMIVNNDFQVL  239



>ref|XP_008795222.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=351

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/292 (45%), Positives = 189/292 (65%), Gaps = 17/292 (6%)
 Frame = -1

Query  880  YFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFFLMTPCLFISGAL  701
            YF+RGG R+W S +LQTAA                   +       F L+ P L  + A+
Sbjct  53   YFVRGGHRMWLSAFLQTAA-----------------AATRRRCRRFFLLLPPALTAACAV  95

Query  700  IGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTAFSVNSIvllta  521
            +GLL+ + +Y+Y+Y  + LP+STSSL+++SQLAFTA+FA  +V+Q FT FS+N++VLLT 
Sbjct  96   LGLLIAVDSYMYSYASSFLPLSTSSLLMASQLAFTAVFALLIVRQRFTPFSLNAVVLLTL  155

Query  520  gavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNKANTPIGYILVL  341
            G VVLGL   +DRP GE   +Y LGF + + +AAL GL++PLVEL Y +    + Y +V+
Sbjct  156  GPVVLGLGGASDRPEGEPQSKYYLGFCMMVAAAALIGLVLPLVELAYRRTTEEMTYAMVI  215

Query  340  EFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICSGIIFQFFLIGAL  161
            E QMV+  + +LFC +GM ++ DFQ IP+EAREFELG  +YY+++I   I +Q   +G +
Sbjct  216  ETQMVMGASGSLFCLLGMLLSKDFQAIPKEAREFELGELRYYMVLIWDAICWQILNVGLV  275

Query  160  GVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGFVSY  5
            GVI   SSL   ++  +L+P+ E+L VI  +EKF   K V+L L LWGF SY
Sbjct  276  GVIFSASSLFGGMMIAILVPIGEILPVIFLNEKFNGSKAVALALSLWGFASY  327



>ref|XP_010939716.1| PREDICTED: purine permease 1-like isoform X1 [Elaeis guineensis]
Length=408

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 168/235 (71%), Gaps = 2/235 (1%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              +R   +  N  ++ IG   GPLLLRLYFL+GG R W S+WLQT  WP++FIPL ISY 
Sbjct  20   KHLRWFLMALNFTIMVIGTAVGPLLLRLYFLKGGTRKWLSSWLQTGGWPLLFIPLAISY-  78

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
               R R       K +LMTP LF++  ++GLLVGL ++LY YG++ LPVSTSS+++SSQL
Sbjct  79   -AHRCRCGGGRPIKLYLMTPPLFLACTVLGLLVGLDDFLYAYGLSYLPVSTSSILISSQL  137

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
             FTALFAFF+VKQ FT+FSVN++VLL+ GAV+LGL A  DRP GESN +Y LGF +TL +
Sbjct  138  GFTALFAFFMVKQKFTSFSVNAVVLLSIGAVILGLHASGDRPKGESNTQYYLGFFMTLAA  197

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVI  260
            A LYG I+PLVEL Y KA   + Y LV+E Q+ +   AT+FC+VGM +N DF  I
Sbjct  198  AVLYGFILPLVELTYAKAKQVVSYTLVIEMQLAMGFFATVFCTVGMLVNGDFHNI  252



>gb|EMS63809.1| Purine permease 3 [Triticum urartu]
Length=284

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 163/228 (71%), Gaps = 6/228 (3%)
 Frame = -1

Query  691  LVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTAFSVNSIvlltagav  512
            + GL + LY YG+A LPVSTSS+++S+QLAFTA FA  LV+Q FTAFSVN++VLL+ GA 
Sbjct  1    MTGLDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAA  60

Query  511  vlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNKANTPIG----YILV  344
            +LG+ AG DRPAG +  +Y  GF +TLG+AALYGL++P++EL   K     G    Y LV
Sbjct  61   MLGMNAGGDRPAGVTRAQYSAGFGMTLGAAALYGLMLPVMELSQAKHAARTGAAVTYTLV  120

Query  343  LEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICSGIIFQFFLIGA  164
            +E Q+V+   AT F +VGM +N+DF  IPREAREF LG   YY+L+  S I++QFF +G 
Sbjct  121  MEMQIVIGFTATAFSAVGMLVNNDFHAIPREAREFGLGQIGYYLLLAASAIVYQFFFLGT  180

Query  163  LGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLW  20
            +G I YGS+LL+ VI TVL+PVTE+LAV+ FHE F   K      CLW
Sbjct  181  IGAIFYGSALLAGVIMTVLIPVTEVLAVLFFHEPFNGTKANR--YCLW  226



>emb|CBI19192.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 181/262 (69%), Gaps = 6/262 (2%)
 Frame = -1

Query  979  QRI*CNKMRTIFL-LFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIP  803
            QR     ++ +FL L N +L+ IG  GGPLLLR+Y+L GG R W + WL T+ +P++ +P
Sbjct  13   QRQRRKSLKAMFLVLVNCVLMTIGQVGGPLLLRIYYLHGGKRKWLNAWLLTSGFPILILP  72

Query  802  LLISYLrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSL  623
            +  SYLR     +         L+TP L  + A +G+L+GL  YLY++G++ LP+S SSL
Sbjct  73   MAFSYLR-----AQAKGQATVLLVTPRLVAASAFLGILLGLDGYLYSFGLSYLPISVSSL  127

Query  622  IVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGF  443
            + S+QLAFTA+FAF +VK  FT +SVN++VL+T G++VLGL    DRP+G S+ +Y LGF
Sbjct  128  LGSTQLAFTAIFAFIVVKHKFTHYSVNAVVLMTFGSIVLGLHMNGDRPSGVSDGKYLLGF  187

Query  442  VLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQV  263
            ++TLG+AAL+G IMP +E  + KA  PI + LV++ Q ++S+ ATLFC++ M IN DFQ 
Sbjct  188  LMTLGAAALHGFIMPALEYTHLKAGMPITFDLVMQIQFLISMFATLFCTIPMVINKDFQA  247

Query  262  IPREAREFELGAAKYYILVICS  197
            + +EA E+ LG  KYY++ I S
Sbjct  248  VSKEAAEYGLGETKYYMVSIGS  269



>ref|XP_003602861.1| Purine permease [Medicago truncatula]
Length=274

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/244 (48%), Positives = 164/244 (67%), Gaps = 9/244 (4%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
             KM+   L+ N ++L++G C  PL++RLYF+ GG R+W S +LQTA +P++ IPL ISY+
Sbjct  11   KKMKRFLLVVNCLILSLGTCSAPLIMRLYFIHGGQRVWLSAFLQTAGFPLMLIPLAISYI  70

Query  784  rrr---------rrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVST  632
            +R             S          M P +F + A IG+L GL +YL+ YGVA+LPVST
Sbjct  71   KRHRLHHHPPPLTTISIAPEKLNIISMKPPIFFAAAFIGILTGLDDYLFAYGVARLPVST  130

Query  631  SSLIVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYG  452
            S+LI++SQL FTA FAF +VK+ FTAF+VN++VLLT GA VL +   +DRPAG S K+Y 
Sbjct  131  SALIIASQLGFTAFFAFLIVKEKFTAFTVNAVVLLTVGAGVLAMHTSSDRPAGVSAKQYW  190

Query  451  LGFVLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHD  272
            + F  T+ ++ALYG I+P VEL+Y K   P+ Y  V+EFQ V  + ATLFC++GM  N+D
Sbjct  191  ISFSTTVAASALYGFILPSVELVYKKIKQPVTYSFVMEFQFVTCMFATLFCAIGMIANND  250

Query  271  FQVI  260
            F+ +
Sbjct  251  FKRV  254



>ref|XP_008779125.1| PREDICTED: purine permease 1-like [Phoenix dactylifera]
Length=261

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 160/233 (69%), Gaps = 4/233 (2%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              +R      N  ++ IG    PLLLRLYFL+GG+R W S WL+T  WP++ IPL ISY 
Sbjct  19   KHLRWFLTALNFAIMVIGTTASPLLLRLYFLKGGSRKWLSGWLETVGWPLLLIPLAISY-  77

Query  784  rrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQl  605
                 R      TK +LMTP LF++  ++GLL+GL  +L  YG++ LPVSTSS+++S+QL
Sbjct  78   ---AHRRRGGGPTKLYLMTPPLFLACTVLGLLLGLDCFLNAYGLSYLPVSTSSILISTQL  134

Query  604  aftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGS  425
             FTALFAFF+VKQ FT+FS N++VLL+ GAV+LGL A  DRP GESN  Y LGF +TL +
Sbjct  135  GFTALFAFFIVKQKFTSFSTNAVVLLSIGAVMLGLHASGDRPEGESNTLYYLGFAMTLAA  194

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ  266
            A LY  I+PLVEL Y KA   + Y LV+E Q+V+   A +FC+VGM +N DFQ
Sbjct  195  AVLYAFILPLVELTYAKAKQVVSYTLVMEMQLVMGFFAAVFCTVGMLVNKDFQ  247



>gb|KHN08969.1| Purine permease 1, partial [Glycine soja]
Length=206

 Score =   195 bits (495),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 123/163 (75%), Gaps = 0/163 (0%)
 Frame = -1

Query  490  NDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAA  311
             DRP GES KEY +GFV+T+ +AALYG ++PL+EL+Y K   P+ Y LV+E Q V+  +A
Sbjct  19   GDRPPGESVKEYVMGFVMTVIAAALYGFVLPLIELVYQKIKQPLTYSLVMEIQFVMCFSA  78

Query  310  TLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLL  131
            TLFC +GM IN+DF+VIPREA++FE G   YY +++ S II+Q F +GA+GVI   SSL 
Sbjct  79   TLFCLLGMIINNDFKVIPREAKQFEHGEGSYYAVLVGSAIIWQAFFLGAIGVIFCASSLF  138

Query  130  SVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            S ++  VLLPVTE+LAVI + EKFQ EKGVSL L LWG VSYF
Sbjct  139  SGILIAVLLPVTEVLAVIFYKEKFQAEKGVSLLLSLWGMVSYF  181



>gb|EPS58881.1| hypothetical protein M569_15932 [Genlisea aurea]
Length=320

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 137/295 (46%), Positives = 192/295 (65%), Gaps = 0/295 (0%)
 Frame = -1

Query  889  LRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFFLMTPCLFIS  710
            +RLYF  GG  +WF TWL +A  P++ +PL ++Y+RRR + +       FF++ P L + 
Sbjct  1    MRLYFAEGGGLVWFLTWLSSAGCPIILLPLAVNYVRRRSKSAADGIMPPFFIVKPKLLVC  60

Query  709  GALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTAFSVNSIvl  530
            GA IG++    NY Y YG++KLPVST ++I ++QLAFTA FAF +VKQ FT +S+N++VL
Sbjct  61   GAAIGIIAAADNYFYVYGMSKLPVSTFAIIGATQLAFTAGFAFLIVKQKFTPYSINAVVL  120

Query  529  ltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNKANTPIGYI  350
            LTA A VL L A N R +GE + +Y  GF  T G A L+GLIM LVEL Y+K+  P+ Y 
Sbjct  121  LTAAAAVLSLDAKNVRLSGEPSVDYWTGFCFTAGEAVLFGLIMSLVELSYSKSQQPMTYG  180

Query  349  LVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICSGIIFQFFLI  170
            LVLEFQ+ +  +A +  ++GM     F  I  +A  FE G AKY  + + +    Q F +
Sbjct  181  LVLEFQLAMCSSACVCSAIGMAATGGFAKIRTDAAGFESGRAKYCAVALFTAAACQCFFL  240

Query  169  GALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGFVSY  5
            GA+GV+C+ SSL S V+   LL + E+ AV+ FH++F   K V+LFL LWGF SY
Sbjct  241  GAIGVVCFSSSLFSGVVLNSLLVLVEICAVVFFHDEFGAGKAVALFLSLWGFASY  295



>gb|ABR16480.1| unknown [Picea sitchensis]
Length=367

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 130/327 (40%), Positives = 201/327 (61%), Gaps = 11/327 (3%)
 Frame = -1

Query  979  QRI*CNKMRT--IFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFI  806
            +RI   K  T  + ++F+ + L +G     LL R YF  GG   W ST LQT  WP++ I
Sbjct  29   RRILAGKRTTHWVLVIFSILALLVGQAAATLLSRYYFAYGGDSRWISTLLQTVGWPILLI  88

Query  805  PLLISYLrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSS  626
            PL++               +K   +TP L +    +GLL+   N LY++GV+ +P ST S
Sbjct  89   PLVLY---------QGKEASKLTPLTPKLVLIYVALGLLLAGDNLLYSWGVSFMPASTYS  139

Query  625  LIVSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLG  446
            L+ SSQLAF A+FAF L++Q  T + VNS+VLLT  A++LG+ + +DRP G +  ++ +G
Sbjct  140  LLCSSQLAFNAVFAFMLIRQKITPYIVNSLVLLTLSAILLGVHSDSDRPEGVNTAKHIVG  199

Query  445  FVLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ  266
            F+ T+ ++A+YGL++PL++L++++      + +VLE Q+  SL AT+ C VG+F++ +F+
Sbjct  200  FICTIAASAIYGLLLPLMQLVFDRVIKKETFAVVLEMQIYTSLVATVVCIVGLFVSGEFR  259

Query  265  VIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELL  86
             I  EA  F  G   YY+ +I S I +Q   +G +G+I   SSL S VI+T+ LPV  +L
Sbjct  260  DIKEEAHSFTRGKVAYYMTLIWSAIGWQVCSVGVVGLIFLVSSLFSNVISTLALPVVPIL  319

Query  85   AVILFHEKFQPEKGVSLFLCLWGFVSY  5
            +V  FH+K    K +S+ L +WGFVSY
Sbjct  320  SVGFFHDKMDALKIISMLLSIWGFVSY  346



>ref|XP_002977418.1| hypothetical protein SELMODRAFT_417454 [Selaginella moellendorffii]
 gb|EFJ21422.1| hypothetical protein SELMODRAFT_417454 [Selaginella moellendorffii]
Length=388

 Score =   197 bits (501),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 184/307 (60%), Gaps = 13/307 (4%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFFL  734
            G   G LL R YF  GG+R W STWLQT+ WP++ +     Y              K   
Sbjct  75   GMIAGQLLTRFYFAAGGSRKWLSTWLQTSGWPLLAVATGSIYW---------KRGIKLTP  125

Query  733  MTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTA  554
            +TP L  +   +G L  L N++Y YG+A LP ST+ L+ SSQLAF A+FA  + +Q    
Sbjct  126  LTPALAATYIALGFLGALDNFMYAYGLAYLPASTNGLLSSSQLAFNAIFALIITRQRINP  185

Query  553  FSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNK  374
            F  N+IVL+++ A++L L + +++  G + KE  LG+V+T+G+AAL+GL+ PL+EL   K
Sbjct  186  FGWNAIVLVSSAAMILALHSDDEKLPGVTRKEVVLGYVMTIGAAALFGLLYPLIELAIRK  245

Query  373  ----ANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILV  206
                ++      +VLE Q ++SL +T   SV M INHDF  IP E+R F+ GAA YY+ +
Sbjct  246  FLTRSSDGGAAAVVLEMQTLLSLISTAVASVAMAINHDFLAIPGESRRFKAGAASYYLTL  305

Query  205  ICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLC  26
            + + + +QF  +G LG+I   SSLL+ VI  + +P+  + AVI F + F   K +S+ L 
Sbjct  306  VSTAVSWQFAFLGTLGIIFLSSSLLAGVILALAIPIGSIFAVIFFGDSFGGVKIMSMLLS  365

Query  25   LWGFVSY  5
            LWGFVSY
Sbjct  366  LWGFVSY  372



>dbj|BAG88745.1| unnamed protein product [Oryza sativa Japonica Group]
Length=289

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 166/241 (69%), Gaps = 10/241 (4%)
 Frame = -1

Query  955  RTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrr  776
            R+  L+ N +L+ +G+  GPLLLR YFLRGG R W S+ LQTA WP++  PL  SY  RR
Sbjct  36   RSPLLVVNFVLMVVGSACGPLLLRAYFLRGGNRKWLSSLLQTAGWPLLLAPLCFSYSSRR  95

Query  775  rrRSDVDSN-------TKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIV  617
            RRR   D         T  FLMTP L ++ A++GL+ G+ + LY YG+A LPVSTSS+++
Sbjct  96   RRREVEDDGAGAGAAATPLFLMTPRLLVASAVVGLMTGVDDLLYAYGLAYLPVSTSSILI  155

Query  616  SSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVL  437
            S+QLAFTA FA  LV+Q FTAFSVN++VLL+ GA +LG+ AG DRPAG S  +Y  GF +
Sbjct  156  STQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYCAGFAM  215

Query  436  TLGSAALYGLIMPLVELI---YNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ  266
            TL +AALYGL++P++EL    +  A   + Y LV+E Q+V+   AT F +VGM +N+DF 
Sbjct  216  TLAAAALYGLVLPVMELSQAHHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVNNDFH  275

Query  265  V  263
            V
Sbjct  276  V  276



>ref|XP_006661331.1| PREDICTED: purine permease 3-like [Oryza brachyantha]
Length=269

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 139/193 (72%), Gaps = 3/193 (2%)
 Frame = -1

Query  574  VKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPL  395
            V+Q  TA ++N++ LLT GAVVLGL   NDRPAG +N +Y +GF LTLG+AALYGLI+PL
Sbjct  56   VRQRLTAATLNAVALLTIGAVVLGLHTSNDRPAGVTNGKYWMGFFLTLGAAALYGLILPL  115

Query  394  VELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAA  224
            VEL Y  A      + Y LV+E Q+V+   AT FC+VGM +N DFQ IPREA+++ELG  
Sbjct  116  VELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMIVNKDFQAIPREAKQYELGET  175

Query  223  KYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKG  44
            +YY +++ S I+++FF +GA+GVI    +LL+ +I  V +P+TE+L VI  HEKF  EKG
Sbjct  176  RYYTVLVFSAILWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEKG  235

Query  43   VSLFLCLWGFVSY  5
            V+L L LWG  SY
Sbjct  236  VALVLSLWGLASY  248



>ref|XP_009380885.1| PREDICTED: purine permease 1-like [Musa acuminata subsp. malaccensis]
Length=266

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 158/214 (74%), Gaps = 4/214 (2%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            +R + +  N +L+A+GN GGPLLLRLYF  GG R W S+WL T  WP++F+PLL++YL R
Sbjct  27   LRRVLIGLNCVLMALGNTGGPLLLRLYFRSGGKRQWLSSWLVTGGWPLIFLPLLVTYLHR  86

Query  778  rrrR---SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
            RR +   S +   TK F +TP LF++ A +GLL GL ++LY YG++ LPVSTSSL++S+Q
Sbjct  87   RRHQIRPSHIHP-TKLFFITPRLFLACAFLGLLTGLDDFLYAYGLSFLPVSTSSLLISTQ  145

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            LAFTA FAF +VKQ FT +S+NS+ LLT GA +LGL   +DRP   +  EY +GF+LTLG
Sbjct  146  LAFTAFFAFLIVKQKFTPYSINSVALLTVGAAILGLHVSSDRPDNVTKSEYYMGFILTLG  205

Query  427  SAALYGLIMPLVELIYNKANTPIGYILVLEFQMV  326
            SAALY LI+PLV+L+Y K+   I Y LV+E Q+V
Sbjct  206  SAALYALILPLVQLMYAKSKQAITYTLVMEVQLV  239



>ref|XP_002977419.1| hypothetical protein SELMODRAFT_417455 [Selaginella moellendorffii]
 gb|EFJ21423.1| hypothetical protein SELMODRAFT_417455 [Selaginella moellendorffii]
Length=380

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 125/308 (41%), Positives = 182/308 (59%), Gaps = 14/308 (5%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFFL  734
            G   G LL R YF  GG+R W STWLQT+ WP++ +     Y              K   
Sbjct  68   GTVVGQLLTRFYFAAGGSRKWLSTWLQTSGWPLLAVATGSIYW---------KRGIKLTP  118

Query  733  MTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTA  554
            +TP L  +   +G LV L +++Y YG++ LP STS L+ SSQLAF A+FA  + +Q    
Sbjct  119  LTPALAATYTALGFLVALYSFMYAYGLSYLPASTSGLLSSSQLAFNAIFALIITRQKINP  178

Query  553  FSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNK  374
            F  N+IVL+T+ AV+L L + +++  G + KE  LG+V+T+ +AAL G   P+ EL+  K
Sbjct  179  FGWNAIVLVTSAAVILALHSDDEKLPGVTRKEVVLGYVMTIVAAALSGFFFPITELVIRK  238

Query  373  -----ANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYIL  209
                 + +     ++LE Q ++SL +T   SV M INHDF  IP E+R F+ GAA+YYI 
Sbjct  239  FLTGSSRSGDAATVLLEMQTLLSLISTAVSSVAMAINHDFLAIPGESRRFKAGAARYYIT  298

Query  208  VICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFL  29
            ++ + + +QF  +G LG+I   SSLL+ VI  + +P+  + AVI F + F   K +S+ L
Sbjct  299  LVSTAVSWQFAFLGTLGMIFLSSSLLAGVIMALEIPIGSIFAVIFFGDSFGGLKIMSMLL  358

Query  28   CLWGFVSY  5
             LWGFVSY
Sbjct  359  SLWGFVSY  366



>gb|EEE69876.1| hypothetical protein OsJ_29691 [Oryza sativa Japonica Group]
Length=265

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 157/233 (67%), Gaps = 7/233 (3%)
 Frame = -1

Query  955  RTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrr  776
            R + +  N  +L +G  GGPL+ RLYF +GG R W S WLQTA WP++ +P+  SYL RR
Sbjct  24   RWLLVALNCGMLVVGTTGGPLISRLYFSKGGHRQWLSAWLQTAGWPLLLVPVAASYLSRR  83

Query  775  rrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaft  596
             R    D     FL    + ++G  +G L G  +++Y YG+A LPVSTS++++S+QLAFT
Sbjct  84   AR----DRRAPLFLTPTRVLLAGVGLGFLNGADDFIYAYGLAYLPVSTSAILISTQLAFT  139

Query  595  alfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAAL  416
              FA  +V+Q FTA ++N++ LLT GAVVLGL A  DRPAG ++ +Y +GF LTLG+AAL
Sbjct  140  VFFACLIVRQRFTAATLNAVALLTIGAVVLGLHASKDRPAGVTSGKYWMGFFLTLGAAAL  199

Query  415  YGLIMPLVELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ  266
            YGLI+PLVEL Y  A      + Y LV+E Q+V+   AT FC+VGM +N DFQ
Sbjct  200  YGLILPLVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKDFQ  252



>ref|XP_004985414.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=376

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 129/315 (41%), Positives = 180/315 (57%), Gaps = 12/315 (4%)
 Frame = -1

Query  910  NCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFFLM  731
              GG LL+R YF+ GG RLW ST +Q + WP++  P+  S L R R R          L 
Sbjct  29   GAGGSLLIRAYFVHGGRRLWLSTMIQLSGWPLLLPPICASLLLRSRSRDGAGGGVADHLP  88

Query  730  TPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTAF  551
             P L  + A++G +  +  + Y+ G   LP+STSSL+ ++QL F A+ AF      FT F
Sbjct  89   PPRLVRAVAVLGAVFAVACFAYSLGSQALPLSTSSLLQATQLTFNAVSAFLFAGLRFTPF  148

Query  550  SVNSIvlltagavvlglraGNDRPA-GESNKEYGLGFVLTLGSAALYGLIMPLVELIYNK  374
            SVN++VLLT G  VLG    ++  A  E +  Y  GF+  + SAAL GL++PLVE+  ++
Sbjct  149  SVNAVVLLTIGPAVLGFAPSSETEAQAEGSTAYWTGFLECMSSAALIGLVLPLVEVAMSR  208

Query  373  ANTPIG-----------YILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGA  227
                 G           Y  V++ Q V+  A T  C VGM I  DFQ IP EA  F LG 
Sbjct  209  YGRRDGGPAAARAPPPSYATVMQIQAVMGAAGTAVCLVGMAIAKDFQAIPTEAAAFGLGE  268

Query  226  AKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEK  47
              YY+L+I   + +Q   +G +G+I   SSLL+ ++  ++LP++E+LAVI  HEKF   K
Sbjct  269  TNYYLLLIFGAVSWQLSNLGIMGLIVCSSSLLAGIMIALVLPLSEVLAVIFLHEKFDGVK  328

Query  46   GVSLFLCLWGFVSYF  2
            G++L LCLWGFVSY 
Sbjct  329  GIALVLCLWGFVSYL  343



>emb|CDY72169.1| BnaCnng76300D, partial [Brassica napus]
Length=253

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 165/234 (71%), Gaps = 2/234 (1%)
 Frame = -1

Query  958  MRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrr  779
            M+   L+   ++LAIG CGGPLL RLY+  GG R+WF +++ TA  PV FIPL++S+LRR
Sbjct  1    MKNGLLVLICMILAIGTCGGPLLTRLYYNNGGERIWFMSFISTAGCPVTFIPLVLSFLRR  60

Query  778  rrrR-SDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQla  602
            R R  S+    T+  LM   +F++  +IGLL+GL NY + YG+A LPVST+SLIV +QL 
Sbjct  61   RNRNNSENIDKTEIVLMETPMFMASIVIGLLIGLDNYCFAYGLAYLPVSTTSLIVGTQLG  120

Query  601  ftalfaffLVKQHFTAFSVNSIvlltagavvlglraGN-DRPAGESNKEYGLGFVLTLGS  425
            F A+F+FF+VKQ FT FS+N++VLLTAG  +L LR G+ DRPA  S+KEY +GF++TL +
Sbjct  121  FNAIFSFFMVKQTFTPFSINAVVLLTAGTGILALRGGDGDRPADVSHKEYVVGFLVTLTA  180

Query  424  AALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQV  263
            A LY  I+P VEL   K    I + LVLE Q+V+ LAA+ FC  GM +  DF+V
Sbjct  181  AVLYAFILPFVELTCKKVRQEITFTLVLEMQLVMCLAASCFCIFGMLVEGDFKV  234



>emb|CDY46618.1| BnaA09g27450D [Brassica napus]
Length=227

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 143/194 (74%), Gaps = 3/194 (2%)
 Frame = -1

Query  574  VKQHFTAFSVNSIvlltagavvlglraGN-DRPAGESNKEYGLGFVLTLGSAALYGLIMP  398
            VKQ FT FS+N++VLLTAG  +L LR G+ +R A  S+KEY +GF++TL +A LY  I+P
Sbjct  2    VKQTFTPFSINAVVLLTAGTGILALRGGDGERSADVSHKEYVVGFLVTLTAAVLYAFILP  61

Query  397  LVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELG--AA  224
             VEL Y K    I + LVLE Q+V+ +AA+ FC VGM +  DF+VIP EAREF++G  +A
Sbjct  62   FVELTYKKVRQQITFTLVLEMQLVMCIAASCFCIVGMLVEGDFKVIPIEAREFKVGGGSA  121

Query  223  KYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKG  44
             YY+L++ +GI++Q   +GA+GV+   SSL S V+ + LLPVTE+LAV+ F EKFQ EKG
Sbjct  122  FYYMLILMTGIVYQGLFLGAIGVVFCASSLASGVLISALLPVTEVLAVVCFREKFQVEKG  181

Query  43   VSLFLCLWGFVSYF  2
            V+L L LWGFVSYF
Sbjct  182  VALLLSLWGFVSYF  195



>ref|XP_002993859.1| hypothetical protein SELMODRAFT_236829 [Selaginella moellendorffii]
 gb|EFJ05096.1| hypothetical protein SELMODRAFT_236829 [Selaginella moellendorffii]
Length=336

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 190/307 (62%), Gaps = 5/307 (2%)
 Frame = -1

Query  916  IGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFF  737
            +G     LL+R Y+  GG+R W   W+QTA WPV  + +LI Y +     SD   +    
Sbjct  3    VGFIAATLLMRFYYSNGGSRRWLCGWVQTAGWPVCALAMLIVYFKASSSSSDSPGHHH--  60

Query  736  LMTPCLF---ISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQ  566
            L+ P  F    + A IG L+ L N+LY++G++ LP ST+ L+ SSQLAF +LFA FL+++
Sbjct  61   LLAPFSFKLVAAFASIGCLIALDNFLYSWGMSYLPASTAGLLTSSQLAFNSLFALFLLRK  120

Query  565  HFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVEL  386
                +  NSIVL+++ AV+LGL + +D   G S ++ G G+V+T+ +A LYGLI+ L EL
Sbjct  121  SIGPYVWNSIVLVSSSAVLLGLHSSSDELPGVSREQTGHGYVMTITAAGLYGLILSLTEL  180

Query  385  IYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILV  206
            ++ K       +LVL+ Q   +L AT+  +VGM IN+DF+ I  EA  F+ G+  Y++ +
Sbjct  181  VFAKVLGRKSTLLVLQMQTSTALVATIVSTVGMAINNDFEAIHVEAAVFKAGSLAYFVTL  240

Query  205  ICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLC  26
            +CS + +Q   +G +GVI   SSLL+ VI TV++PV  + A I FH+ F   K ++L L 
Sbjct  241  LCSTLAWQAAFLGTMGVIFLSSSLLAGVILTVVIPVGAVFAYIFFHDAFGGLKVMALLLS  300

Query  25   LWGFVSY  5
             WGFVSY
Sbjct  301  CWGFVSY  307



>ref|XP_002991403.1| hypothetical protein SELMODRAFT_236291 [Selaginella moellendorffii]
 gb|EFJ07515.1| hypothetical protein SELMODRAFT_236291 [Selaginella moellendorffii]
Length=340

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 191/309 (62%), Gaps = 5/309 (2%)
 Frame = -1

Query  916  IGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNT--K  743
            +G     LL+R Y+  GG+R W   W+QTA WPV  + +LI Y +     +   S++   
Sbjct  3    VGFIAATLLMRFYYSNGGSRRWLCGWVQTAGWPVCALAMLIVYFKASSSSNSSSSDSPGH  62

Query  742  FFLMTPCLF---ISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLV  572
              L+ P  F    + A IG L+ L N+LY++G++ LP ST+ L+ SSQLAF +LFA FL+
Sbjct  63   HHLLAPFSFKLVAAFASIGCLIALDNFLYSWGMSYLPASTAGLLTSSQLAFNSLFALFLL  122

Query  571  KQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLV  392
            ++    +  NSIVL+++ AV+LGL + +D   G S ++ G G+V+T+ +A LYGLI+ L 
Sbjct  123  RKSIGPYVWNSIVLVSSSAVLLGLHSSSDELPGVSREQTGHGYVMTITAAGLYGLILSLT  182

Query  391  ELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYI  212
            EL++ K       +LVL+ Q   +L AT+  +VGM IN+DF+ I  EA  F+ G+  Y++
Sbjct  183  ELVFAKVLGRKSTLLVLQMQTSTALVATIVSTVGMAINNDFEAIHVEAAAFKAGSLAYFV  242

Query  211  LVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLF  32
             ++CS + +Q   +G +GVI   SSLL+ VI TV++PV  + A I FH+ F   K ++L 
Sbjct  243  TLLCSTLAWQAAFLGTMGVIFLSSSLLAGVILTVVIPVGAVFAYIFFHDAFGGLKVMALL  302

Query  31   LCLWGFVSY  5
            L  WGFVSY
Sbjct  303  LSCWGFVSY  311



>ref|XP_002975003.1| hypothetical protein SELMODRAFT_232471 [Selaginella moellendorffii]
 gb|EFJ23788.1| hypothetical protein SELMODRAFT_232471 [Selaginella moellendorffii]
Length=292

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 123/303 (41%), Positives = 176/303 (58%), Gaps = 25/303 (8%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFFL  734
            G   G LL R YF  GG+R W STWLQT+ WP++ +     Y              K   
Sbjct  4    GMIAGQLLTRFYFAAGGSRKWLSTWLQTSGWPLLAVATGSIYW---------KRGIKLTP  54

Query  733  MTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTA  554
            +TP L  +   +G L  L N++Y YG+A LP ST+ L+ SSQLAF A+FA  + +Q    
Sbjct  55   LTPALAATYIALGFLGALDNFMYAYGLAYLPASTNGLLSSSQLAFNAIFALIITRQRINP  114

Query  553  FSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNK  374
            F  N+IVL+++ AV+L L + +++  G + KE  LG+V+T G+AAL            + 
Sbjct  115  FGWNAIVLVSSAAVILALHSDDEKLPGVTRKEVVLGYVMTTGAAALS-----------SD  163

Query  373  ANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREFELGAAKYYILVICSG  194
            A T     ++LE Q ++SL +T   SV M INHDF  IP E+R F+ GAA+YYI ++ + 
Sbjct  164  AAT-----VLLEMQTLLSLISTAVSSVAMAINHDFLAIPGESRRFKAGAARYYITLVSTA  218

Query  193  IIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKFQPEKGVSLFLCLWGF  14
            + +QF  +G LG+I   SSLL+ VI  + +P+  + AVI F + F   K +S+FL LWGF
Sbjct  219  VSWQFAFLGTLGMIFLSSSLLAGVIMALEIPIGSIFAVIFFGDSFGGLKIMSMFLSLWGF  278

Query  13   VSY  5
            VSY
Sbjct  279  VSY  281



>gb|EEC84725.1| hypothetical protein OsI_31703 [Oryza sativa Indica Group]
Length=265

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 155/233 (67%), Gaps = 7/233 (3%)
 Frame = -1

Query  955  RTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrr  776
            R + +  N  +L +G  GGPL+ RLYF +GG R W S WLQTA WP++ +P+  SYL RR
Sbjct  24   RWLLVALNCGMLVVGTTGGPLISRLYFSKGGHRQWLSAWLQTAGWPLLLVPVAASYLSRR  83

Query  775  rrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaft  596
             R          FL    + ++G  +G L G  +++Y YG+A LPVSTS++++S+QLAFT
Sbjct  84   AR----GRRAPLFLTPTRVLLAGVGLGFLNGADDFIYAYGLAYLPVSTSAILISTQLAFT  139

Query  595  alfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAAL  416
              FA  +V+Q  TA ++N++ LLT GAVVLGL A  DRPAG ++ +Y +GF LTLG+AAL
Sbjct  140  VFFACLIVRQRLTAATLNAVALLTIGAVVLGLHASKDRPAGVTSGKYWMGFFLTLGAAAL  199

Query  415  YGLIMPLVELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ  266
            YGLI+PLVEL Y  A      + Y LV+E Q+V+   AT FC+VGM +N DFQ
Sbjct  200  YGLILPLVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKDFQ  252



>gb|KHN08292.1| Purine permease 1 [Glycine soja]
Length=176

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 114/150 (76%), Gaps = 0/150 (0%)
 Frame = -1

Query  451  LGFVLTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHD  272
            +GFV+T+ +AALYG I+PLVEL+Y K   P+ Y LV+E Q V+  +ATLFC +GM IN+D
Sbjct  1    MGFVMTVIAAALYGFILPLVELVYKKIKQPLTYSLVMEIQFVMCFSATLFCLLGMIINND  60

Query  271  FQVIPREAREFELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTE  92
            F+VIPREA++FE G   YY +++ S I++Q F +GA+GVI   SSL S ++  VLLPVTE
Sbjct  61   FKVIPREAKKFEHGEGSYYAVLVGSAILWQAFFLGAIGVIFCASSLFSGILIAVLLPVTE  120

Query  91   LLAVILFHEKFQPEKGVSLFLCLWGFVSYF  2
            +LAVI + EKFQ EKGVSL L LWG VSYF
Sbjct  121  VLAVIFYKEKFQAEKGVSLLLSLWGMVSYF  150



>gb|KEH37326.1| triose-phosphate transporter family protein [Medicago truncatula]
Length=414

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 191/326 (59%), Gaps = 10/326 (3%)
 Frame = -1

Query  979  QRI*CNKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPL  800
            Q+   NK     L+ N +LL +G+    LL + YF+  G+  W STW+Q A +P++ IP+
Sbjct  61   QKSITNKRYMPLLIINYLLLFVGSISSSLLSKYYFIHKGSSKWVSTWVQCAGFPLLIIPI  120

Query  799  LISYLrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLI  620
             + YL       ++     F   TP +      +G+++G  N L ++GVA LPVSTS+L+
Sbjct  121  FLPYLF------NLTKRNPFTDFTPKMLTLSIFVGIMLGFNNLLISWGVAYLPVSTSALL  174

Query  619  VSSQlaftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFV  440
            +SSQL F  + +  +VKQ  T  ++N ++LLT  +++L L + ++RP G + KEY +GF 
Sbjct  175  LSSQLVFNLILSAIIVKQKITFSNLNCVILLTLSSIILALNSSSERPKGLTKKEYFIGFF  234

Query  439  LTLGSAALYGLIMPLVELIYNKANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVI  260
             TLG+  L+ L +P++E +Y K      Y +V+E Q+++ +AAT+  +VGM  +  F+ +
Sbjct  235  CTLGAGLLFALYLPVMEKVYKKV---YCYEMVMEMQLIMEIAATVLATVGMAWDGGFKEM  291

Query  259  PREARE-FELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLA  83
             RE+ E F+ G+  Y++ V+ + + +QF  +G  G++   SSL   +  T LL +  L  
Sbjct  292  KRESEEVFDKGSRVYWVTVMANVVTWQFCFMGTAGMVFLTSSLTGGICMTALLSMNVLGG  351

Query  82   VILFHEKFQPEKGVSLFLCLWGFVSY  5
            VI++ + F   K VS  LC+WGF SY
Sbjct  352  VIVYRDAFGGLKAVSTVLCMWGFCSY  377



>ref|XP_006859063.1| hypothetical protein AMTR_s00068p00197770 [Amborella trichopoda]
 gb|ERN20530.1| hypothetical protein AMTR_s00068p00197770 [Amborella trichopoda]
Length=376

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 121/318 (38%), Positives = 198/318 (62%), Gaps = 11/318 (3%)
 Frame = -1

Query  946  FLLF--NTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrr  773
            +LLF  N   L +G+    +L R YF+ GG+  W STW+Q+  +P++ +P+ +S+L    
Sbjct  31   WLLFASNCAALVLGSISASMLSRFYFMHGGSSRWLSTWVQSIGFPLLLMPIYLSHLTG--  88

Query  772  rRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlafta  593
                  S   F L TP L  +   +GLL+G+ N+LY++G++ + V+T+SL++S+QLAF A
Sbjct  89   -----HSPRPFSLFTPKLLYACFGLGLLIGINNFLYSWGISYISVTTASLLLSTQLAFNA  143

Query  592  lfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALY  413
            +F+F LVKQ  +  S+N IVLLT+ +++L L +  D P G +  +Y LGF+ TLG+A L+
Sbjct  144  IFSFVLVKQKISFPSMNCIVLLTSSSILLALSSSQDMPKGVTKFQYILGFLSTLGAAGLF  203

Query  412  GLIMPLVELIYNK-ANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAR-EF  239
             + +PL+E++Y K  +    Y LV+E Q+V+S++ATLF ++GM  +  F+ +  EA  +F
Sbjct  204  AIYLPLMEMVYKKLTSIKFTYALVMEMQLVMSISATLFATIGMVGDGAFREMREEANGKF  263

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
            ELG   Y + V+   I +QF  +   G+I   +SL+  +  + LLP+  +   ++F + F
Sbjct  264  ELGRLSYILTVVGGVISWQFCFMATTGLIFLTTSLMCGICMSALLPLIVVAGAVIFKDDF  323

Query  58   QPEKGVSLFLCLWGFVSY  5
              EK +S  LC+WGF SY
Sbjct  324  SGEKWISTVLCMWGFFSY  341



>ref|XP_006826553.1| hypothetical protein AMTR_s02825p00003100, partial [Amborella 
trichopoda]
 gb|ERM93790.1| hypothetical protein AMTR_s02825p00003100, partial [Amborella 
trichopoda]
Length=245

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 152/216 (70%), Gaps = 5/216 (2%)
 Frame = -1

Query  913  GNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDSNTKFFL  734
            G  G PL+ RLYF+ GG R W + W+QTAA+P++ IPL +S +    +     S+  F  
Sbjct  35   GATGAPLVSRLYFIHGGQRKWLTAWIQTAAFPILLIPLFLSKISSTSQSQRRQSHVTF--  92

Query  733  MTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTA  554
                L +  A IGLL+G+ +Y+Y +G++ LP+STS+L+VS+QL FTA FAF +V Q FTA
Sbjct  93   ---PLALQSAGIGLLIGIDDYMYAFGLSYLPISTSTLLVSTQLGFTAFFAFLIVGQRFTA  149

Query  553  FSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAALYGLIMPLVELIYNK  374
             ++N++VLL+ G+V+LGLRA  DRP G +  +YGLGFVLTLG+AAL GL+ PL+EL+Y K
Sbjct  150  HTINAVVLLSLGSVLLGLRASGDRPEGVTGAQYGLGFVLTLGAAALIGLVFPLIELVYVK  209

Query  373  ANTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQ  266
            +   + + LV+E   V+S+ AT FC++GM IN DFQ
Sbjct  210  SKQIVTFGLVMEMLFVMSVVATGFCTIGMVINKDFQ  245



>ref|XP_002465736.1| hypothetical protein SORBIDRAFT_01g044690 [Sorghum bicolor]
 gb|EER92734.1| hypothetical protein SORBIDRAFT_01g044690 [Sorghum bicolor]
Length=370

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 132/319 (41%), Positives = 191/319 (60%), Gaps = 18/319 (6%)
 Frame = -1

Query  904  GGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrrrrRSDVDS---NTKFFL  734
            GG LL+R+YF++GG  LW ST +Q + WP++  P+ IS L R RRR        +    L
Sbjct  23   GGSLLIRVYFVQGGQSLWLSTMIQVSGWPLLLPPICISLLLRSRRRDRDRDGGYSIADDL  82

Query  733  MTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaftalfaffLVKQHFTA  554
            + P L  + A++G+L  L  Y Y+ G   LP++TSSL+ ++QLAF AL AF      FT 
Sbjct  83   LQPRLVGAVAVLGVLFALACYAYSLGSQALPLTTSSLLQATQLAFNALCAFVFAGIRFTP  142

Query  553  FSVNSIvlltagavvlgl--raGNDRPAGE-SNKEYGLGFVLTLGSAALYGLIMPLVELI  383
            FSVN++VLLT G  VLG+   + ++  +GE S   Y  GF   + SAAL GL++PL E+ 
Sbjct  143  FSVNAVVLLTVGPAVLGVGPSSSDETVSGEGSRTAYWAGFTECMASAALMGLVVPLFEVA  202

Query  382  ---YNKANTPIG---------YILVLEFQMVVSLAATLFCSVGMFINHDFQVIPREAREF  239
               Y +   P G         Y+ V++ Q V+  A T+ C VGM +  +FQ +PREA  F
Sbjct  203  MSRYGRRTAPAGGAFTGAPPSYVTVMQVQAVMGAAGTVLCLVGMAVMEEFQAVPREAATF  262

Query  238  ELGAAKYYILVICSGIIFQFFLIGALGVICYGSSLLSVVINTVLLPVTELLAVILFHEKF  59
             LG   Y +++I   + +Q   +G +G++   SSLL+ ++  +LLP++E+LAV+  HEKF
Sbjct  263  GLGETSYCLVLIFGTVSWQLCNLGIMGLVACSSSLLAGIMLALLLPLSEVLAVVFLHEKF  322

Query  58   QPEKGVSLFLCLWGFVSYF  2
               KGV+L LCLWGFVSY 
Sbjct  323  DGVKGVALVLCLWGFVSYL  341



>ref|XP_004959529.1| PREDICTED: purine permease 2-like [Setaria italica]
Length=259

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 118/247 (48%), Positives = 156/247 (63%), Gaps = 8/247 (3%)
 Frame = -1

Query  967  CNKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISY  788
               M  + +  N ++L +G  GG LL RLYF +GG R W + W QTA WP    PLLI+ 
Sbjct  16   SKAMHRLLVALNCVMLGVGVTGGQLLSRLYFNKGGHRQWLAAWFQTAGWP----PLLIAV  71

Query  787  LrrrrrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
                  R   D   +F    P + ++ A IGL++G  N+LY YG+  LPVSTS++++S+Q
Sbjct  72   AAAYAGRRARDRGARFLPTPPRIHLAAAGIGLIIGADNFLYAYGLEFLPVSTSAILISTQ  131

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            L FT LFAF +V+Q  TA +VN++ LLTAGAVVLGL   +DR AG S  +Y LGFVLTLG
Sbjct  132  LIFTVLFAFLIVRQRLTAPTVNAVALLTAGAVVLGLHVSSDRIAGVSRGQYWLGFVLTLG  191

Query  427  SAALYGLIMPLVELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIP  257
            +A LYGLIMPLVEL Y  A      + Y LV+E Q+V+   AT FC+VGM +N DF   P
Sbjct  192  AAVLYGLIMPLVELAYKHAADGGRAVTYALVVEIQLVMGFVATAFCTVGMIVNKDFH-DP  250

Query  256  REAREFE  236
              + +F+
Sbjct  251  SGSLQFD  257



>tpg|DAA40289.1| TPA: hypothetical protein ZEAMMB73_258363 [Zea mays]
Length=281

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 118/243 (49%), Positives = 159/243 (65%), Gaps = 9/243 (4%)
 Frame = -1

Query  964  NKMRTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYL  785
              MR + +  N ++LA+G  GG LL RLYF +GG R W S WLQT  WP++  P+  SY+
Sbjct  15   KTMRRLLVATNCVMLALGVTGGQLLSRLYFSKGGHRQWLSGWLQTGGWPLLLPPVAASYV  74

Query  784  rrrrrRSDVDSNTKFFLMT-PCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQ  608
            RRR   +   S       T P + ++ A +GL+ G+ N LY +G+  LPVSTS++++S+Q
Sbjct  75   RRR---ARYRSAPALLTQTQPRILLAAAGLGLIAGVDNLLYAWGLEFLPVSTSAILISTQ  131

Query  607  laftalfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLG  428
            LAFT LFAF +V+Q  T  +VN++ LLT GAVVLGL   +DRPAG +  +Y LGF LTLG
Sbjct  132  LAFTVLFAFLIVRQRLTMATVNAVALLTVGAVVLGLHVSSDRPAGVTRSQYWLGFTLTLG  191

Query  427  SAALYGLIMPLVELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVIP  257
            +A LYGL +PLVEL Y  A      + Y LV+E Q+V+   AT FC+VGM +N DFQV  
Sbjct  192  AAVLYGLFLPLVELTYKCAAGGGRAVTYALVVELQLVMGFVATAFCTVGMIVNKDFQV--  249

Query  256  REA  248
            R+A
Sbjct  250  RDA  252



>gb|EAZ09428.1| hypothetical protein OsI_31702 [Oryza sativa Indica Group]
Length=262

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 110/235 (47%), Positives = 152/235 (65%), Gaps = 7/235 (3%)
 Frame = -1

Query  955  RTIFLLFNTILLAIGNCGGPLLLRLYFLRGGARLWFSTWLQTAAWPVVFIPLLISYLrrr  776
            R + +  N  +L +G  GGPL+ RLYF +GG R W S WL+TA WP++ +P+  SYL RR
Sbjct  24   RWLLVALNCGMLMVGTTGGPLISRLYFSKGGHRQWLSAWLETAGWPLLLVPVSASYLGRR  83

Query  775  rrRSDVDSNTKFFLMTPCLFISGALIGLLVGLMNYLYTYGVAKLPVSTSSLIVSSQlaft  596
             R    D     FL    + ++   +G+L G  +++Y YG+  LPVSTS+++ S+ LAFT
Sbjct  84   AR----DRGAPLFLTPRRVLLACVGLGVLTGADDFIYAYGLDYLPVSTSAILTSTHLAFT  139

Query  595  alfaffLVKQHFTAFSVNSIvlltagavvlglraGNDRPAGESNKEYGLGFVLTLGSAAL  416
              FA  +V+Q  TA ++N++ LLT GAVVLGL    DRPAG +N +Y +GF L +G+AAL
Sbjct  140  VFFACLIVRQRLTAATLNAVALLTIGAVVLGLHVSKDRPAGVTNGKYWMGFFLIIGAAAL  199

Query  415  YGLIMPLVELIYNKA---NTPIGYILVLEFQMVVSLAATLFCSVGMFINHDFQVI  260
            YGLI+PLVEL Y         + Y LV+E Q+V+   AT FC+VGM +N DFQVI
Sbjct  200  YGLILPLVELAYKHVAARGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKDFQVI  254



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2145275583018