BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23921_g1_i2 len=1023 path=[877:0-142 1020:143-183 3980:184-268
1515:269-295 4112:296-298 1545:299-339 3676:340-511 1758:512-657
25:658-1022]

Length=1023
                                                                      Score     E

sp|Q07472.1|MADS1_PETHY  RecName: Full=Floral homeotic protein PM...    372   9e-126   Petunia x hybrida [garden petunia]
ref|XP_009794650.1|  PREDICTED: floral homeotic protein PMADS 1         371   2e-125   
ref|XP_009619475.1|  PREDICTED: floral homeotic protein PMADS 1         369   9e-125   
emb|CAA47846.1|  deficiens analogue                                     363   3e-122   Solanum tuberosum [potatoes]
gb|ADI58370.1|  PAP3                                                    362   6e-122   
ref|NP_001275326.1|  floral homeotic protein PMADS 1-like               359   1e-120   
gb|ABG20629.1|  DEF                                                     357   6e-120   Cestrum elegans
emb|CAJ53871.1|  floral homeotic protein DEFICIENS                      356   2e-119   Solanum lycopersicum
gb|ABG20626.1|  DEF                                                     355   3e-119   Solandra maxima
ref|NP_001234077.1|  TAP3                                               355   5e-119   
sp|P23706.1|DEFA_ANTMA  RecName: Full=Floral homeotic protein DEF...    353   4e-118   Antirrhinum majus [garden snapdragon]
gb|ABG20624.1|  DEF                                                     351   1e-117   Mandragora autumnalis
gb|ABG20625.1|  DEF                                                     350   2e-117   Juanulloa mexicana
gb|AGN54423.1|  PFDEF                                                   350   4e-117   
dbj|BAI68389.1|  DEFICIENS protein                                      349   1e-116   Antirrhinum majus [garden snapdragon]
emb|CAJ44129.1|  deficiens protein                                      348   2e-116   Misopates orontium
gb|AEM60197.1|  MADS box transcription factor                           345   3e-115   
gb|AEM60199.1|  MADS box transcription factor                           340   1e-113   
gb|AAS45984.1|  deficiens                                               340   4e-113   Erythranthe guttata [common monkey flower]
gb|ABG20622.1|  DEF                                                     339   7e-113   Brunfelsia uniflora
ref|XP_011074633.1|  PREDICTED: floral homeotic protein DEFICIENS       339   8e-113   
gb|AGA61764.1|  apetala 3                                               338   1e-112   
gb|AEM60198.1|  MADS box transcription factor                           337   3e-112   
gb|ADU56837.1|  MADS-box protein DEF subfamily                          337   5e-112   
gb|AEM60188.1|  MADS box transcription factor                           336   8e-112   
gb|ABG20628.1|  DEF2                                                    336   9e-112   Scopolia carniolica
gb|AEM60180.1|  MADS box transcription factor                           335   3e-111   
gb|AAS45992.1|  deficiens                                               335   5e-111   Erythranthe guttata [common monkey flower]
gb|AAS45985.1|  deficiens                                               335   6e-111   Erythranthe lewisii
gb|ABG20627.1|  DEF1                                                    334   7e-111   Scopolia carniolica
gb|AEM60183.1|  MADS box transcription factor                           333   7e-111   
gb|AAS45967.1|  deficiens                                               334   7e-111   Mimulus ringens
ref|XP_011083640.1|  PREDICTED: floral homeotic protein DEFICIENS...    332   3e-110   
gb|ADU15474.1|  AP3                                                     333   3e-110   
gb|AGA61754.1|  apetala 3                                               331   1e-109   
gb|AAS45990.1|  deficiens                                               330   3e-109   Paulownia tomentosa
gb|AAS45982.1|  deficiens                                               330   3e-109   Pedicularis groenlandica [elephant's head]
gb|AEM60186.1|  MADS box transcription factor                           328   6e-109   
gb|AAS45979.1|  deficiens                                               328   1e-108   Syringa vulgaris
gb|ACK43086.1|  deficiens 2 protein                                     328   1e-108   Eustoma exaltatum subsp. russellianum [bluebells]
gb|AEM60172.1|  MADS box transcription factor                           328   1e-108   
gb|AEM60200.1|  MADS box transcription factor                           328   1e-108   
gb|AAS45981.1|  deficiens                                               327   7e-108   Verbena officinalis [common verbena]
gb|ABG20623.1|  DEF                                                     326   9e-108   Solanum pseudolulo
gb|ADL57412.1|  MADS domain transcription factor                        326   1e-107   
gb|AEM60193.1|  MADS box transcription factor                           324   3e-107   
gb|AAS45972.1|  deficiens                                               325   3e-107   Leucocarpus perfoliatus
gb|AEM60187.1|  MADS box transcription factor                           324   3e-107   
gb|AEM60190.1|  MADS box transcription factor                           323   5e-107   
gb|AAS45969.1|  deficiens                                               324   5e-107   Diplacus kelloggii [Kellog's monkeyflower]
gb|AEM60195.1|  MADS box transcription factor                           323   1e-106   
gb|AEM60192.1|  MADS box transcription factor                           323   1e-106   
gb|AAS45986.1|  deficiens                                               323   1e-106   Verbena officinalis [common verbena]
gb|AEM60174.1|  MADS box transcription factor                           323   1e-106   
dbj|BAG24492.1|  DEFICIENS-like MADS-box protein                        323   2e-106   Torenia fournieri [bluewings]
gb|AEM60182.1|  MADS box transcription factor                           322   2e-106   
gb|AAS45971.1|  deficiens                                               323   2e-106   Mimulus ringens
gb|AEM60169.1|  MADS box transcription factor                           322   3e-106   
gb|AAS45973.1|  deficiens                                               322   5e-106   Diplacus kelloggii [Kellog's monkeyflower]
gb|AEM60167.1|  MADS box transcription factor                           320   1e-105   
gb|AEM60168.1|  MADS box transcription factor                           320   2e-105   
gb|AAS45989.1|  deficiens                                               320   2e-105   Pedicularis groenlandica [elephant's head]
gb|ABQ59274.4|  deficiens 1 protein                                     320   3e-105   Eustoma exaltatum subsp. russellianum [bluebells]
gb|AEM60170.1|  MADS box transcription factor                           319   4e-105   
gb|AAS45988.1|  deficiens                                               319   1e-104   Salvia coccinea [blood sage]
ref|XP_007017681.1|  Floral homeotic protein DEFICIENS isoform 1        318   1e-104   
gb|AAS45980.1|  deficiens                                               318   1e-104   Chelone glabra [snakehead]
gb|AAS45968.1|  deficiens                                               317   3e-104   Leucocarpus perfoliatus
gb|AAS45970.1|  deficiens                                               317   3e-104   Mazus reptans
gb|AEM60191.1|  MADS box transcription factor                           316   6e-104   
gb|AEM60166.1|  MADS box transcription factor                           316   7e-104   
gb|AEM60194.1|  MADS box transcription factor                           315   1e-103   
gb|AEM60185.1|  MADS box transcription factor                           315   1e-103   
gb|ACY08914.1|  MADS-domain transcription factor                        315   1e-103   Halesia diptera
gb|AEJ76847.1|  MADS24                                                  315   2e-103   
gb|AAS45983.1|  deficiens                                               314   2e-103   Paulownia tomentosa
gb|AEM60176.1|  MADS box transcription factor                           314   4e-103   
gb|KHG05937.1|  Floral homeotic DEFICIENS                               314   6e-103   
gb|AAS45966.1|  deficiens                                               315   8e-103   Mazus reptans
gb|AEM60178.1|  MADS box transcription factor                           312   2e-102   
ref|NP_001267960.1|  flowering-related B-class MADS-box protein A...    312   3e-102   
gb|AEM60189.1|  MADS box transcription factor                           311   3e-102   
gb|ABN46893.1|  AP3-like MADS-box protein                               312   4e-102   Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|AEX10627.1|  DEFICIENS                                               310   1e-101   
gb|AEG19541.1|  apetala3-like protein                                   310   1e-101   
gb|AAC42583.1|  APETALA3 homolog LeAP3                                  308   7e-101   Solanum lycopersicum
gb|AEM60161.1|  MADS box transcription factor                           308   9e-101   
gb|AEM60177.1|  MADS box transcription factor                           307   3e-100   
gb|AEM60181.1|  MADS box transcription factor                           306   3e-100   
gb|AEM60163.1|  MADS box transcription factor                           306   7e-100   
gb|ACY08901.1|  MADS-domain transcription factor                        304   2e-99    Napoleonaea vogelii
gb|AEM60162.1|  MADS box transcription factor                           304   5e-99    
gb|ACY08903.1|  MADS-domain transcription factor                        303   6e-99    Diospyros digyna [black persimmon]
gb|AAS45987.1|  deficiens                                               303   2e-98    Salvia coccinea [blood sage]
gb|AEM60173.1|  MADS box transcription factor                           300   5e-98    
ref|XP_006581063.1|  PREDICTED: MADS-box protein GmNMH7 isoform X1      299   3e-97    
gb|AAS45991.1|  deficiens                                               298   6e-97    Erythranthe lewisii
ref|NP_001236857.1|  MADS-box protein GmNMH7                            299   7e-97    
gb|ACU13442.1|  unknown                                                 297   2e-96    Glycine max [soybeans]
ref|XP_003603721.1|  Apetala3-like protein                              297   2e-96    
gb|AAX13301.1|  MADS box protein AP3                                    296   7e-96    Lotus japonicus
gb|KDP38582.1|  hypothetical protein JCGZ_04507                         295   8e-96    
ref|XP_008466510.1|  PREDICTED: floral homeotic protein DEFICIENS       297   1e-95    
gb|AAC42584.1|  APETALA3 homolog SvAP3                                  295   1e-95    Syringa vulgaris
ref|XP_004147841.1|  PREDICTED: floral homeotic protein DEFICIENS...    296   4e-95    
gb|AAC15419.1|  MADS-box protein NMH 7                                  292   3e-94    Medicago sativa [alfalfa]
gb|AAX37273.1|  MADS box protein                                        291   8e-94    Cucumis sativus [cucumbers]
gb|AEM60196.1|  MADS box transcription factor                           289   1e-93    
gb|AEA76416.1|  putative DEF1                                           287   2e-93    
dbj|BAK20024.1|  PgMADS protein9                                        290   2e-93    
gb|KHN45898.1|  Floral homeotic protein DEFICIENS                       289   2e-93    
gb|AAB48660.1|  MADS-box protein                                        290   3e-93    Medicago sativa [alfalfa]
gb|ABD78317.1|  Def-like protein                                        289   4e-93    Primula vulgaris
gb|ACY08913.1|  MADS-domain transcription factor                        286   3e-92    Sarracenia drummondii
gb|ACY08899.1|  MADS-domain transcription factor                        284   1e-91    Alangium platanifolium
gb|AEM60164.1|  MADS box transcription factor                           283   6e-91    
gb|AEM60165.1|  MADS box transcription factor                           283   7e-91    
gb|AEM60179.1|  MADS box transcription factor                           282   8e-91    
ref|XP_004500961.1|  PREDICTED: floral homeotic protein PMADS 1-like    283   1e-90    
gb|AEM60175.1|  MADS box transcription factor                           282   1e-90    
gb|ABE11601.1|  MADS-box transcription factor AP3                       281   3e-90    Trochodendron aralioides
gb|ACY08910.1|  MADS-domain transcription factor                        280   3e-90    Clethra tomentosa
ref|NP_001267937.1|  flowering-related B-class MADS-box protein         281   3e-90    
dbj|BAK09615.1|  MADS-box transcription factor                          280   1e-89    
gb|AEW43604.1|  MADS-box transcription factor NMH7                      280   1e-89    
gb|AEM60171.1|  MADS box transcription factor                           279   1e-89    
gb|ADO16136.1|  MADS                                                    276   2e-89    
gb|ACY08915.1|  MADS-domain transcription factor                        278   2e-89    Styrax japonicus [Japanese snowbell]
gb|ABF56131.1|  APETALA3-like protein                                   278   4e-89    Ilex aquifolium [English holly]
gb|ACY08917.1|  MADS-domain transcription factor                        277   5e-89    Galax urceolata
gb|AEM60184.1|  MADS box transcription factor                           277   6e-89    
gb|ADO16147.1|  MADS                                                    275   6e-89    
gb|ADO16151.1|  MADS                                                    275   7e-89    
gb|ADO16134.1|  MADS                                                    273   2e-88    
gb|ADO16133.1|  MADS                                                    273   2e-88    
gb|ADO16137.1|  MADS                                                    273   2e-88    
gb|ADO16153.1|  MADS                                                    273   3e-88    
gb|ACY08912.1|  MADS-domain transcription factor                        275   3e-88    Stewartia pseudocamellia [Japanese stewartia]
gb|ADO16139.1|  MADS                                                    273   3e-88    
ref|XP_006425563.1|  hypothetical protein CICLE_v10026433mg             276   4e-88    
gb|ADO16152.1|  MADS                                                    272   6e-88    
ref|XP_011028945.1|  PREDICTED: floral homeotic protein DEFICIENS...    274   8e-88    
gb|KDO71079.1|  hypothetical protein CISIN_1g027470mg                   275   8e-88    
gb|ADO16140.1|  MADS                                                    271   9e-88    
gb|ADU15473.1|  AP3                                                     275   1e-87    
gb|ADO16135.1|  MADS                                                    271   2e-87    
gb|ADO16145.1|  MADS                                                    271   2e-87    
ref|XP_006340689.1|  PREDICTED: floral homeotic protein DEFICIENS...    273   4e-87    
ref|XP_006386194.1|  MADS-box protein GmNMH7                            272   4e-87    
gb|ADO16143.1|  MADS                                                    270   6e-87    
gb|ABR68543.1|  APETALA3-like                                           272   8e-87    Dillenia indica
gb|ADO16150.1|  MADS                                                    269   1e-86    
gb|ADO16142.1|  MADS                                                    268   2e-86    
gb|ADO16144.1|  MADS                                                    268   2e-86    
gb|ACY08909.1|  MADS-domain transcription factor                        270   2e-86    Synsepalum dulcificum [miracle fruit]
gb|ADO16148.1|  MADS                                                    267   4e-86    
gb|ACY08902.1|  MADS-domain transcription factor                        270   4e-86    Phlox paniculata
gb|ACY08898.1|  MADS-domain transcription factor                        269   1e-85    Jacquinia aurantiaca
ref|XP_010061014.1|  PREDICTED: floral homeotic protein DEFICIENS       269   2e-85    
gb|AHH28320.1|  MADS-box transcription factor                           268   3e-85    
gb|ABF67489.1|  MADS-domain protein                                     269   4e-85    Impatiens hawkeri
gb|AIC33047.1|  flower development transporter AP3                      268   6e-85    
ref|XP_006435093.1|  hypothetical protein CICLE_v10002410mg             268   6e-85    
gb|AHY19023.1|  AP3 MADS box protein                                    268   6e-85    
emb|CAA08803.1|  MADS-box protein, GDEF2                                268   7e-85    Gerbera hybrid cultivar
gb|ACV53813.1|  MADS-box protein                                        268   9e-85    Gerbera hybrid cultivar
ref|XP_009605879.1|  PREDICTED: floral homeotic protein DEFICIENS...    267   1e-84    
ref|XP_004232453.1|  PREDICTED: floral homeotic protein DEFICIENS...    267   1e-84    
gb|AGH39936.1|  MADS domain protein                                     266   1e-84    
gb|KDO84726.1|  hypothetical protein CISIN_1g040046mg                   266   2e-84    
ref|XP_008221326.1|  PREDICTED: LOW QUALITY PROTEIN: floral homeo...    267   2e-84    
emb|CDP01943.1|  unnamed protein product                                266   2e-84    
gb|AAD53326.1|AF180365_1  DEFICIENS homolog DEF2                        266   2e-84    Hieracium piloselloides
gb|ABR18735.1|  MADS-box transcription factor HAM63                     266   2e-84    Helianthus annuus
gb|AAO22985.1|  MADS-box transcription factor CDM115                    266   2e-84    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_006403587.1|  hypothetical protein EUTSA_v10010683mg             266   3e-84    
gb|AGS42079.2|  AP3a                                                    266   4e-84    
gb|ACY08911.1|  MADS-domain transcription factor                        265   4e-84    Camellia japonica [common camellia]
ref|XP_009116122.1|  PREDICTED: floral homeotic protein APETALA 3       266   4e-84    
gb|ABD24434.1|  APETALA3-3                                              266   4e-84    Brassica napus [oilseed rape]
gb|ADU56836.1|  MADS-box protein DEF subfamily                          265   5e-84    
gb|AIU94279.1|  APETALA3-like protein transcript variant 1              265   5e-84    
gb|ABR18734.1|  MADS-box transcription factor HAM2                      266   6e-84    Helianthus annuus
gb|AAO22988.1|  MADS-box transcription factor CDM19                     265   7e-84    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_006473587.1|  PREDICTED: floral homeotic protein DEFICIENS...    265   7e-84    
gb|AAD53325.1|AF180364_1  DEFICIENS homolog DEF1                        265   8e-84    Hieracium piloselloides
gb|AGH39930.1|  truncated MADS domain protein                           263   1e-83    
gb|AHH28321.1|  MADS-box transcription factor                           263   2e-83    
ref|XP_009798453.1|  PREDICTED: floral homeotic protein DEFICIENS...    264   2e-83    
gb|ABF67492.1|  MADS-domain transcription factor                        263   3e-83    Marcgravia umbellata
ref|XP_010504236.1|  PREDICTED: floral homeotic protein APETALA 3...    263   5e-83    
gb|AAF73931.1|AF230702_1  MADS box transcription factor AP3             261   8e-83    Hydrangea macrophylla
ref|XP_002533305.1|  Floral homeotic protein DEFICIENS, putative        263   9e-83    Ricinus communis
ref|XP_011028630.1|  PREDICTED: floral homeotic protein DEFICIENS...    262   1e-82    
dbj|BAC79180.1|  MADS-box protein                                       262   1e-82    Rosa rugosa [Japanese rose]
ref|XP_010271509.1|  PREDICTED: floral homeotic protein DEFICIENS...    261   2e-82    
ref|XP_002877970.1|  APETALA3                                           261   2e-82    
gb|AGH39927.1|  MADS domain protein                                     261   2e-82    
gb|AHH28294.1|  MADS-box transcription factor                           261   2e-82    
gb|AAM64919.1|  floral homeotic protein APETALA3 (AP3)                  261   2e-82    Arabidopsis thaliana [mouse-ear cress]
gb|ACY08907.1|  MADS-domain transcription factor                        261   2e-82    Primula denticulata
gb|ADD14338.1|  APETALA3                                                260   3e-82    Spinacia oleracea
gb|ABP01802.1|  MADS transcription factor AP3-3                         261   3e-82    Aquilegia vulgaris
ref|XP_006292594.1|  hypothetical protein CARUB_v10018833mg             261   4e-82    
gb|AAD51901.1|  floral homeotic protein AP3                             261   4e-82    Arabidopsis thaliana [mouse-ear cress]
ref|NP_191002.1|  Floral homeotic protein APETALA 3                     260   5e-82    Arabidopsis thaliana [mouse-ear cress]
gb|ADC79696.1|  APETALA3-like protein                                   260   5e-82    Euptelea pleiosperma
gb|AAD51895.1|  floral homeotic protein AP3                             260   6e-82    Arabidopsis thaliana [mouse-ear cress]
gb|AGH39931.1|  MADS domain protein                                     260   7e-82    
gb|KFK34668.1|  hypothetical protein AALP_AA5G175900                    260   7e-82    
gb|AGH39924.1|  MADS domain protein                                     259   8e-82    
ref|XP_010515958.1|  PREDICTED: floral homeotic protein APETALA 3       260   8e-82    
gb|AAD51887.1|  floral homeotic protein AP3                             259   1e-81    Arabidopsis thaliana [mouse-ear cress]
dbj|BAG68950.1|  APETALA3 like protein                                  259   1e-81    Hydrangea macrophylla
ref|XP_010427128.1|  PREDICTED: floral homeotic protein APETALA 3...    259   1e-81    
gb|AAD51897.1|  floral homeotic protein AP3                             259   2e-81    Arabidopsis thaliana [mouse-ear cress]
gb|ABQ51322.1|  B-class MADS-box protein TM6-2                          259   2e-81    Carica papaya [mamon]
dbj|BAA04665.1|  APETALA3                                               259   2e-81    Arabidopsis thaliana [mouse-ear cress]
gb|AAD51902.1|  floral homeotic protein AP3                             259   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008241774.1|  PREDICTED: floral homeotic protein DEFICIENS...    259   2e-81    
gb|AAF28894.1|AF124814_1  APETALA3                                      258   2e-81    Brassica napus [oilseed rape]
gb|AGA61783.1|  apetala 3                                               258   2e-81    
gb|AAD51899.1|  floral homeotic protein AP3                             258   3e-81    Arabidopsis thaliana [mouse-ear cress]
gb|ABF56128.1|  APETALA3-like protein                                   258   3e-81    Corylopsis pauciflora [buttercup winter-hazel]
ref|XP_010263856.1|  PREDICTED: floral homeotic protein DEFICIENS...    258   3e-81    
gb|AGH39926.1|  MADS domain protein                                     258   4e-81    
gb|AAY63866.1|  APETALA3                                                258   4e-81    Brassica juncea [brown mustard]
gb|AAD51896.1|  floral homeotic protein AP3                             258   4e-81    Arabidopsis thaliana [mouse-ear cress]
dbj|BAN13567.1|  apetala3/pistillata-like protein                       258   5e-81    
gb|AGN54424.1|  PFTM6                                                   258   5e-81    
gb|AAP93899.1|  APETALA3                                                258   6e-81    Brassica napus [oilseed rape]
gb|AAD51890.1|  floral homeotic protein AP3                             258   7e-81    Arabidopsis thaliana [mouse-ear cress]
gb|EPS57782.1|  hypothetical protein M569_17035                         255   7e-81    
gb|AEM60229.1|  MADS box transcription factor                           256   8e-81    
gb|AAF73933.1|AF230704_1  MADS box transcription factor TM6             257   8e-81    Petunia x hybrida [garden petunia]
emb|CAA43171.1|  TDR6                                                   257   8e-81    Solanum lycopersicum
ref|XP_009139246.1|  PREDICTED: floral homeotic protein APETALA 3...    257   1e-80    
gb|AAD51898.1|  floral homeotic protein AP3                             257   1e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AAM33100.2|  TDR6 transcription factor                               256   1e-80    Solanum lycopersicum
ref|XP_007046776.1|  Floral homeotic protein DEFICIENS, putative ...    256   1e-80    
gb|AAD51894.1|  floral homeotic protein AP3                             256   2e-80    Arabidopsis thaliana [mouse-ear cress]
gb|ABE11655.1|  DEFICIENS                                               253   2e-80    Nicotiana benthamiana
gb|AGS42080.1|  AP3.b                                                   256   2e-80    
ref|XP_010672335.1|  PREDICTED: floral homeotic protein DEFICIENS...    256   4e-80    
gb|AAP93898.1|  APETALA3-2                                              255   4e-80    Brassica napus [oilseed rape]
ref|XP_008241773.1|  PREDICTED: floral homeotic protein DEFICIENS...    256   5e-80    
gb|ABF67488.1|  MADS-domain protein                                     254   5e-80    Impatiens hawkeri
gb|AGH39923.1|  MADS domain protein                                     255   8e-80    
gb|AAT46097.1|  APETALA3-like protein                                   254   1e-79    Akebia trifoliata
emb|CAA56657.1|  SLM3                                                   254   1e-79    Silene latifolia
gb|AEK33828.1|  apetala 3                                               254   2e-79    
gb|ABO93622.2|  APETALA3                                                253   3e-79    Platanus x hispanica [London plane tree]
gb|ABG20636.1|  TM6                                                     252   4e-79    Solanum pseudolulo
gb|KGN60009.1|  hypothetical protein Csa_3G865440                       252   5e-79    
gb|ABQ51321.1|  B-class MADS-box protein TM6-1                          253   5e-79    Carica papaya [mamon]
gb|AAF25590.1|  apetala3                                                253   6e-79    Arabidopsis lyrata [lyrate rockcress]
gb|AGH39915.1|  MADS domain protein                                     252   6e-79    
gb|ACY08885.1|  MADS-domain transcription factor                        252   6e-79    Nyssa sylvatica
gb|ABG20630.1|  TM6                                                     252   7e-79    Juanulloa mexicana
ref|XP_007046775.1|  Floral homeotic protein DEFICIENS, putative ...    252   8e-79    
emb|CAC81070.1|  MADS box transcription factor                          252   8e-79    Daucus carota subsp. sativus
gb|ACY08916.1|  MADS-domain transcription factor                        251   1e-78    Erica x hiemalis
ref|XP_010240899.1|  PREDICTED: floral homeotic protein DEFICIENS...    251   2e-78    
gb|ACY08882.1|  MADS-domain transcription factor                        251   2e-78    Alangium platanifolium
gb|AEM60228.1|  MADS box transcription factor                           250   2e-78    
ref|XP_007202502.1|  hypothetical protein PRUPE_ppa010727mg             251   4e-78    
gb|AEM60224.1|  MADS box transcription factor                           250   4e-78    
gb|ABG20635.1|  TM6                                                     250   4e-78    Solandra maxima
gb|AEM60230.1|  MADS box transcription factor                           249   4e-78    
ref|XP_010530322.1|  PREDICTED: floral homeotic protein APETALA 3...    250   7e-78    
gb|AAB17139.1|  homeotic protein bobap3                                 249   7e-78    Brassica oleracea
gb|AEE73593.1|  APETALA3-like protein                                   250   9e-78    
gb|AEG25797.1|  APETALA3-like protein                                   249   1e-77    
gb|AAT46098.1|  APETALA3-like protein                                   249   1e-77    Akebia trifoliata
gb|ADX60056.1|  transcription factor TM6                                249   1e-77    
gb|ACY08893.1|  MADS-domain transcription factor                        248   1e-77    Styrax japonicus [Japanese snowbell]
gb|AAB08879.1|  homeotic protein boi2AP3                                249   2e-77    Brassica oleracea
gb|AAP93897.1|  APETALA3-1                                              248   2e-77    Brassica napus [oilseed rape]
gb|AIU94285.1|  APETALA3-like protein transcript variant 2              249   2e-77    
emb|CAC38765.1|  putative apetala 3 protein                             248   2e-77    
gb|AGW23361.1|  MADS box protein MADS59                                 248   2e-77    
ref|XP_010530324.1|  PREDICTED: floral homeotic protein APETALA 3...    248   3e-77    
ref|XP_007046774.1|  K-box region and MADS-box transcription fact...    248   3e-77    
gb|AHH28279.1|  MADS-box transcription factor                           247   5e-77    
gb|KHG11328.1|  Floral homeotic PMADS 1                                 248   5e-77    
gb|AHH28319.1|  MADS-box transcription factor                           246   6e-77    
ref|XP_007202503.1|  hypothetical protein PRUPE_ppa010727mg             248   7e-77    
gb|AFV74879.1|  TM6-like protein                                        247   7e-77    
gb|ACY08883.1|  MADS-domain transcription factor                        246   8e-77    
ref|XP_004291814.1|  PREDICTED: floral homeotic protein DEFICIENS...    247   8e-77    
gb|AFO83618.1|  APETALA3-like protein                                   247   8e-77    
gb|AEM60231.1|  MADS box transcription factor                           246   1e-76    
gb|AFO83616.1|  APETALA3-like protein                                   246   1e-76    
gb|AFN68920.1|  APETALA3-like protein                                   246   1e-76    
gb|AAR88330.1|  AP3                                                     246   1e-76    
gb|AFN68944.1|  APETALA3-like protein                                   246   1e-76    
gb|AFN68945.1|  APETALA3-like protein                                   246   2e-76    
emb|CAA08802.1|  MADs-box protein, GDEF1                                246   2e-76    
gb|ACY08897.1|  MADS-domain transcription factor                        245   3e-76    
gb|ABG20632.1|  TM6                                                     245   3e-76    
gb|ABG20634.1|  TM6                                                     245   4e-76    
gb|ABP01803.1|  MADS transcription factor AP3-2                         245   4e-76    
gb|AAT69984.1|  APETALA3                                                244   4e-76    
gb|AGW23354.1|  MADS box protein MADS52                                 245   4e-76    
gb|AHH28259.1|  MADS-box transcription factor                           244   6e-76    
gb|AGZ63860.1|  APETALA3-like protein                                   243   1e-75    
gb|AFN68933.1|  APETALA3-like protein                                   243   1e-75    
gb|AGH61292.1|  apetala 3                                               244   1e-75    
gb|ACY08894.1|  MADS-domain transcription factor                        243   1e-75    
dbj|BAK09616.1|  MADS-box transcription factor                          243   3e-75    
gb|AFN68953.1|  APETALA3-like protein                                   243   3e-75    
gb|AGH39935.1|  MADS domain protein                                     243   3e-75    
gb|ABC02398.1|  APETALA3-like protein                                   243   3e-75    
gb|ACD76820.1|  APETALA3-like protein                                   243   3e-75    
gb|AFN68925.1|  APETALA3-like protein                                   242   4e-75    
gb|AFN68917.1|  APETALA3-like protein                                   242   4e-75    
gb|ACY08896.1|  MADS-domain transcription factor                        242   4e-75    
gb|AFN68928.1|  APETALA3-like protein                                   242   5e-75    
ref|XP_011025894.1|  PREDICTED: floral homeotic protein DEFICIENS...    242   7e-75    
gb|AIE44760.1|  putative MADS-domain transcription factor AP3           241   7e-75    
ref|XP_006453002.1|  hypothetical protein CICLE_v10009338mg             241   7e-75    
gb|AAC13695.2|  PTD protein                                             242   7e-75    
gb|AGW23353.1|  MADS box protein MADS51                                 242   8e-75    
gb|AGH39914.1|  MADS domain protein                                     242   8e-75    
dbj|BAL04871.1|  AP3/DEF-like protein                                   240   8e-75    
gb|AEG25816.1|  APETALA3-like protein                                   241   9e-75    
gb|ABG20631.1|  TM6                                                     241   1e-74    
gb|ABG20633.1|  TM6                                                     241   1e-74    
dbj|BAF34915.1|  MADS-box protein                                       241   1e-74    
dbj|BAG68949.1|  APETALA3 like protein                                  240   2e-74    
ref|XP_008781489.1|  PREDICTED: MADS-box transcription factor 16 ...    241   2e-74    
gb|AFN68918.1|  APETALA3-like protein                                   241   2e-74    
gb|AGH39929.1|  MADS domain protein                                     241   2e-74    
dbj|BAB63261.1|  MADS-box protein                                       242   2e-74    
ref|XP_007227134.1|  hypothetical protein PRUPE_ppa026083mg             239   2e-74    
dbj|BAD80745.1|  MADS-box transcription factor                          240   3e-74    
gb|AGH61291.1|  apetala 3                                               240   3e-74    
gb|AEG25799.1|  APETALA3-like protein                                   240   4e-74    
gb|AHH28338.1|  MADS-box transcription factor                           239   5e-74    
gb|ADC79708.1|  APETALA3-like protein                                   239   5e-74    
emb|CAA61484.1|  MADS box regulatory protein                            239   6e-74    
gb|AFV74876.1|  TM6-like protein                                        239   6e-74    
gb|AEG25803.1|  APETALA3-like protein                                   238   9e-74    
dbj|BAE48147.1|  MADS-box transcription factor                          239   1e-73    
ref|XP_006474489.1|  PREDICTED: floral homeotic protein PMADS 1-like    238   1e-73    
gb|ACY08888.1|  MADS-domain transcription factor                        238   1e-73    
ref|XP_010029721.1|  PREDICTED: floral homeotic protein DEFICIENS...    238   2e-73    
gb|ADJ96374.1|  MADS protein                                            238   2e-73    
gb|ACA47117.1|  MADS box transcription factor TM6                       237   3e-73    
gb|AFV74877.1|  TM6-like protein                                        237   3e-73    
gb|AGA61760.1|  TM6                                                     236   4e-73    
ref|XP_009418316.1|  PREDICTED: MADS-box transcription factor 16-...    237   4e-73    
gb|ACX50635.1|  MADS-box2 transcription factor                          237   4e-73    
gb|AEX92972.1|  MADS box protein 6                                      237   5e-73    
gb|ACR16055.1|  DEFICIENS-like MADS-box transcription factor            236   1e-72    
gb|AGH39937.1|  MADS domain protein                                     236   1e-72    
gb|ACR16041.1|  DEFICIENS-like MADS-box transcription factor            236   1e-72    
gb|AGO59776.1|  AP3-like MADS-box protein                               236   2e-72    
gb|AAR06664.1|  transcription factor AP3                                235   2e-72    
gb|AGH39938.1|  MADS domain protein                                     236   2e-72    
gb|AFN68946.1|  APETALA3-like protein                                   234   4e-72    
dbj|BAE06050.1|  MADS-box transcription factor                          234   5e-72    
dbj|BAC75969.1|  MADS-box transcription factor                          234   5e-72    
gb|ACA62949.1|  MADS-box protein                                        234   6e-72    
gb|ADL36746.1|  MADS domain class transcription factor                  234   7e-72    
gb|AEW43605.1|  MADS-box transcription factor TM6                       234   8e-72    
gb|ABF56132.1|  TM6-like protein                                        233   1e-71    
gb|ADM08179.1|  MADS-domain transcription factor TM6                    233   1e-71    
ref|XP_008346633.1|  PREDICTED: floral homeotic protein DEFICIENS...    234   1e-71    
gb|ACD85095.1|  B-class MADS-box protein AP3-3                          234   1e-71    
gb|AFM75880.1|  APETALA3-like protein                                   233   1e-71    
gb|AAO26542.1|  AP3-3 type 1                                            233   1e-71    
ref|XP_009346296.1|  PREDICTED: floral homeotic protein DEFICIENS...    233   2e-71    
gb|AFN68921.1|  APETALA3-like protein                                   233   2e-71    
gb|AFX61404.1|  deficiens                                               233   2e-71    
gb|AGH39934.1|  MADS domain protein                                     233   2e-71    
gb|AGH39933.1|  MADS domain protein                                     233   2e-71    
gb|AAO49713.1|  APETALA3                                                233   2e-71    
dbj|BAC11907.1|  MADS-box protein                                       233   3e-71    
ref|XP_003612101.1|  MADS box transcription factor TM6                  233   3e-71    
gb|AAW78035.1|  APETALA3-like protein                                   233   3e-71    
gb|AGA61765.1|  apetala 3                                               229   4e-71    
gb|AGA61779.1|  apetala 3                                               231   4e-71    
gb|ACY08895.1|  MADS-domain transcription factor                        231   5e-71    
gb|AHH28313.1|  MADS-box transcription factor                           231   5e-71    
gb|AFN68947.1|  APETALA3-like protein                                   231   6e-71    
gb|AFX61406.1|  APETALA3-like MADS-box transcription factor             233   7e-71    
ref|XP_009378223.1|  PREDICTED: floral homeotic protein DEFICIENS...    232   7e-71    
gb|AAM27456.1|AF503913_1  MADS box protein                              232   8e-71    
dbj|BAF46353.1|  MADS-box transcription factor                          231   8e-71    
gb|ACR16047.1|  DEFICIENS-like MADS-box transcription factor            231   9e-71    
gb|AFP17801.1|  transcription factor AP3                                231   9e-71    
gb|AHH28312.1|  MADS-box transcription factor                           230   9e-71    
gb|ACD85115.1|  B-class MADS-box protein AP3-2                          231   1e-70    
gb|AFN68914.1|  APETALA3-like protein                                   231   1e-70    
gb|ABP01804.1|  MADS transcription factor AP3-1                         231   1e-70    
gb|AIR76783.1|  APETALA3                                                230   1e-70    
gb|AFV74874.1|  TM6-like protein                                        231   1e-70    
gb|AEW43603.1|  MADS-box transcription factor TM6                       231   1e-70    
gb|AAQ83493.1|  APETALA3                                                231   1e-70    
gb|ABN55895.1|  DEFICIENS                                               231   2e-70    
gb|AAR26626.1|  MADS box transcription factor                           231   2e-70    
ref|XP_008346632.1|  PREDICTED: floral homeotic protein DEFICIENS...    231   2e-70    
gb|AGA61770.1|  TM6                                                     229   2e-70    
gb|ACD85120.1|  B-class MADS-box protein AP3-3                          231   2e-70    
ref|XP_008344258.1|  PREDICTED: floral homeotic protein DEFICIENS...    231   2e-70    
gb|AGA61771.1|  TM6                                                     228   2e-70    
emb|CAC80856.1|  B-type MADS box protein                                230   3e-70    
ref|XP_009346295.1|  PREDICTED: floral homeotic protein DEFICIENS...    230   3e-70    
gb|AFN68922.1|  APETALA3-like protein                                   229   3e-70    
gb|AFV74869.1|  AP3-like protein                                        231   3e-70    
dbj|BAG50400.1|  MADS-box transcription factor                          229   3e-70    
gb|AEG25808.1|  APETALA3-like protein                                   229   3e-70    
gb|AGH39921.1|  MADS domain protein                                     229   4e-70    
gb|ADD25194.1|  AP3-2                                                   229   4e-70    
ref|XP_007157955.1|  hypothetical protein PHAVU_002G112200g             230   4e-70    
ref|XP_006590707.1|  PREDICTED: floral homeotic protein PMADS 1-l...    230   5e-70    
gb|ADD60473.1|  AP3-related protein 4                                   229   5e-70    
dbj|BAB91550.1|  MADS-box transcription factor                          229   6e-70    
gb|AFN68916.1|  APETALA3-like protein                                   229   6e-70    
gb|AFN68931.1|  APETALA3-like protein                                   229   6e-70    
gb|ADI58466.1|  DEFICIENS                                               228   1e-69    
gb|ADI58459.1|  DEFICIENS                                               228   1e-69    
gb|AIR76784.1|  APETALA3                                                228   1e-69    
gb|KEH27574.1|  MADS-box transcription factor                           229   1e-69    
dbj|BAD80747.1|  MADS-box transcription factor                          228   1e-69    
ref|XP_009378222.1|  PREDICTED: floral homeotic protein DEFICIENS...    229   1e-69    
ref|XP_004287844.1|  PREDICTED: floral homeotic protein DEFICIENS...    229   2e-69    
gb|AAW78034.1|  APETALA3-like protein                                   228   2e-69    
gb|ACD85098.1|  B-class MADS-box protein AP3-2                          228   2e-69    
gb|ACY08887.1|  MADS-domain transcription factor                        228   2e-69    
gb|AAX13302.1|  MADS box protein AP3-like                               227   4e-69    
gb|ACR16038.1|  DEFICIENS-like MADS-box transcription factor            226   6e-69    
gb|ACR16049.1|  DEFICIENS-like MADS-box transcription factor            226   6e-69    
gb|AAO26529.1|  AP3-1                                                   226   6e-69    
gb|AFN68939.1|  APETALA3-like protein                                   226   7e-69    
gb|ADJ67235.1|  MADS box transcription factor 9                         226   7e-69    
gb|AHM92089.1|  MADS-box protein 13                                     226   8e-69    
ref|XP_006453003.1|  hypothetical protein CICLE_v10009338mg             227   8e-69    
gb|AAC42590.1|  APETALA3 homolog DeAP3-1                                225   9e-69    
gb|ACJ66727.1|  MADS box AP3-like protein 1                             226   1e-68    
gb|AFH66787.1|  AP3-like MADS-box 3 protein                             226   1e-68    
gb|ABF56129.1|  TM6-like protein                                        225   1e-68    
gb|ACY08889.1|  MADS-domain transcription factor                        225   1e-68    
gb|ACD85119.1|  B-class MADS-box protein AP3-2                          226   1e-68    
gb|AFL03391.1|  MADS box transcription factor AP3-1                     225   2e-68    
gb|ACR16040.1|  DEFICIENS-like MADS-box transcription factor            226   2e-68    
gb|ACS74865.1|  APETALA3                                                224   2e-68    
dbj|BAF46354.1|  MADS-box transcription factor                          225   2e-68    
gb|ACR16056.1|  DEFICIENS-like MADS-box transcription factor            225   2e-68    
gb|ACD85094.1|  B-class MADS-box protein AP3-2                          225   2e-68    
ref|XP_006590706.1|  PREDICTED: floral homeotic protein PMADS 1-l...    226   2e-68    
gb|ADC79700.1|  APETALA3-like protein                                   225   2e-68    
gb|ABW96393.1|  AP3-related protein B                                   225   2e-68    
gb|AFL03387.1|  MADS box transcription factor AP3-3                     224   2e-68    
ref|XP_007157954.1|  hypothetical protein PHAVU_002G112200g             226   2e-68    
gb|AIR76787.1|  APETALA3                                                225   2e-68    
gb|AFN68926.1|  APETALA3-like protein                                   225   2e-68    
gb|ACY08906.1|  MADS-domain transcription factor                        223   3e-68    
ref|XP_009412806.1|  PREDICTED: MADS-box transcription factor 16-...    225   3e-68    
gb|AEQ75406.1|  APETALA3-like protein 3                                 225   3e-68    
gb|AAF73932.1|AF230703_1  MADS box transcription factor TM6             224   3e-68    
gb|ACY08900.1|  MADS-domain transcription factor                        223   3e-68    
gb|AHH28316.1|  MADS-box transcription factor                           224   4e-68    
gb|AFV74870.1|  TM6-like protein                                        224   4e-68    
gb|AGH39918.1|  MADS domain protein                                     224   4e-68    
emb|CDY69833.1|  BnaAnng31650D                                          222   7e-68    
gb|AEG25798.1|  APETALA3-like protein                                   224   7e-68    
gb|AAR06684.1|  APETALA3-like protein AP3-1                             224   7e-68    
gb|AHH28315.1|  MADS-box transcription factor                           223   1e-67    
gb|AGH39917.1|  MADS domain protein                                     223   1e-67    
gb|AAZ95249.1|  MADS box AP3-like protein B                             223   2e-67    
gb|AFO68771.1|  APETALA3                                                222   2e-67    
gb|ABK34952.1|  APETALA-3-like protein                                  222   3e-67    
gb|AAR26629.1|  MADS box transcription factor                           222   4e-67    
gb|AAR06685.1|  APETALA3-like protein AP3-2                             221   4e-67    
gb|AEM60225.1|  MADS box transcription factor                           221   5e-67    
gb|AEQ75405.1|  APETALA3-like protein 4                                 221   5e-67    
gb|AAG35773.1|AF209729_1  putative MADS box transcription factor        222   5e-67    
gb|KCW56676.1|  hypothetical protein EUGRSUZ_I02376                     221   5e-67    
dbj|BAF44100.1|  transcription factor MADS                              220   5e-67    
gb|ABS83561.1|  APETALA3-like protein                                   221   6e-67    
gb|AAO26512.1|  AP3-3                                                   220   7e-67    
emb|CCC54332.1|  MADS box protein                                       221   1e-66    
gb|ACD85099.1|  B-class MADS-box protein AP3-3                          221   1e-66    
gb|ACY08905.1|  MADS-domain transcription factor                        219   1e-66    
gb|AGH39922.1|  MADS domain protein                                     220   2e-66    
ref|XP_007136051.1|  hypothetical protein PHAVU_009G0139001g            217   2e-66    
gb|ADD25193.1|  AP3-1                                                   219   2e-66    
emb|CAM59057.1|  MIKC-type MADS-box transcription factor WM13           220   2e-66    
ref|XP_006572851.1|  PREDICTED: uncharacterized protein LOC100784...    221   2e-66    
gb|AFV74868.1|  AP3-like protein                                        220   3e-66    
ref|XP_006590705.1|  PREDICTED: floral homeotic protein PMADS 1-l...    220   3e-66    
ref|NP_001290512.1|  MADS-box transcription factor 16                   219   3e-66    
ref|XP_010316397.1|  PREDICTED: floral homeotic protein DEFICIENS...    220   3e-66    
dbj|BAA33459.1|  MADS box transcription factor                          219   4e-66    
dbj|BAO00919.1|  DEF-like protein                                       219   4e-66    
gb|ACD85091.1|  B-class MADS-box protein AP3-3                          219   4e-66    
gb|AHH28257.1|  MADS-box transcription factor                           219   4e-66    
dbj|BAO00918.1|  DEF-like protein                                       219   5e-66    



>sp|Q07472.1|MADS1_PETHY RecName: Full=Floral homeotic protein PMADS 1; AltName: Full=Green 
petal homeotic protein [Petunia x hybrida]
 emb|CAA49567.1| GP (green petal) [Petunia x hybrida]
 gb|AAQ72510.2| DEF [Petunia x hybrida]
Length=231

 Score =   372 bits (955),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 198/231 (86%), Positives = 219/231 (95%), Gaps = 0/231 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQLFD YQKTVGVDLW+SH+EKMQEQL+KL++VNR LR+EIRQRMGESLNDL++EQ
Sbjct  61   SITTKQLFDLYQKTVGVDLWNSHYEKMQEQLRKLKEVNRNLRKEIRQRMGESLNDLNYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  650
            L EL+E+VDNS+KLIRERKYKVIGNQIET KKKVRNVEEIHRNLLLE +ARQEDPYGLV+
Sbjct  121  LEELMENVDNSLKLIRERKYKVIGNQIETFKKKVRNVEEIHRNLLLEFDARQEDPYGLVE  180

Query  651  HEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
             EGDYNSVLGF NGGHRILALRLQP+HH  +HH HLHSGGGSD+TTF LLE
Sbjct  181  QEGDYNSVLGFPNGGHRILALRLQPNHHQPNHHHHLHSGGGSDITTFALLE  231



>ref|XP_009794650.1| PREDICTED: floral homeotic protein PMADS 1 [Nicotiana sylvestris]
 emb|CAA65288.1| MADS-box protein [Nicotiana tabacum]
Length=227

 Score =   371 bits (953),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQLFD YQKTVGVDLW+SH+EKMQEQL+KL+DVNR LRREIRQRMGESLNDL++EQ
Sbjct  61   SVTTKQLFDLYQKTVGVDLWNSHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  650
            L EL E+VDNS+KLIRERKYKVIGNQI+T+KKKVRNVEEIHRNLLLE +ARQEDPYGLV+
Sbjct  121  LEELNENVDNSLKLIRERKYKVIGNQIDTYKKKVRNVEEIHRNLLLEFDARQEDPYGLVE  180

Query  651  HEGDYNSVLGFANGGHRILALRLQP  725
             EGDYNSVLGF NGG RILALRLQP
Sbjct  181  QEGDYNSVLGFPNGGPRILALRLQP  205



>ref|XP_009619475.1| PREDICTED: floral homeotic protein PMADS 1 [Nicotiana tomentosiformis]
Length=227

 Score =   369 bits (948),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQLFD YQKTVGVDLW+ H+EKMQEQL+KL+DVNR LRREIRQRMGESLNDL++EQ
Sbjct  61   SITTKQLFDLYQKTVGVDLWNFHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  650
            L EL E+VDNS+KLIRERKYKVIGNQIET+KKKVRNVEEIHRNLLLE +ARQEDPYGLV+
Sbjct  121  LEELNENVDNSLKLIRERKYKVIGNQIETYKKKVRNVEEIHRNLLLEFDARQEDPYGLVE  180

Query  651  HEGDYNSVLGFANGGHRILALRLQP  725
             EGDYNSVLGF NGG RILALRLQP
Sbjct  181  QEGDYNSVLGFPNGGPRILALRLQP  205



>emb|CAA47846.1| deficiens analogue [Solanum tuberosum]
Length=228

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 195/206 (95%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIVMIS++GKLHE+ISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQLFD YQKT+GVD+W+SH+EKMQEQL+KL+DVNR LR+EIRQRMGESLNDL+FEQ
Sbjct  61   SITTKQLFDLYQKTIGVDIWTSHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNFEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLV  647
            L EL+E+VDNS+KLIRERKYKVIGNQIET++KKVRNVEEIHRNLLLE +ARQEDPY GLV
Sbjct  121  LEELMENVDNSLKLIRERKYKVIGNQIETYRKKVRNVEEIHRNLLLEFDARQEDPYGGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            + EGDYNSVLGF  GGH ILAL LQP
Sbjct  181  EQEGDYNSVLGFPTGGHHILALGLQP  206



>gb|ADI58370.1| PAP3 [Capsicum annuum]
Length=226

 Score =   362 bits (929),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 197/207 (95%), Gaps = 2/207 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIVMIS++GKLHE+ISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQLFD YQKTVGVDLW+SH+EKMQEQL+KL+DVNR LR+EIRQRMGESLNDL++EQ
Sbjct  61   SITTKQLFDLYQKTVGVDLWNSHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLV  647
            L EL+E+VDNS+KLIRERKYKVIGNQIET+KKKVRNVEEIHRNLLLE +ARQEDPY GLV
Sbjct  121  LEELMENVDNSLKLIRERKYKVIGNQIETYKKKVRNVEEIHRNLLLEFDARQEDPYGGLV  180

Query  648  DHEGDYNSVLGFAN-GGHRILALRLQP  725
            + EGDYNSVLGF N GG RILALRLQP
Sbjct  181  EQEGDYNSVLGFPNGGGARILALRLQP  207



>ref|NP_001275326.1| floral homeotic protein PMADS 1-like [Solanum tuberosum]
 emb|CAA47845.1| deficiens analogue [Solanum tuberosum]
Length=228

 Score =   359 bits (921),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 193/206 (94%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIVMIS++GKLHE+ISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TT  LFD YQKT+GVD+W+SH+EKMQEQL+KL+DVNR LR+EIRQRMGESLNDL+FEQ
Sbjct  61   SITTNNLFDLYQKTIGVDIWTSHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNFEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLV  647
            L EL+E+VDNS+KLIRERKYKVIGNQIET++KKVRNVEEIHRNLLLE +ARQEDPY GLV
Sbjct  121  LEELMENVDNSLKLIRERKYKVIGNQIETYRKKVRNVEEIHRNLLLEFDARQEDPYGGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            + EGDYNSVLGF  GGH ILAL LQP
Sbjct  181  EQEGDYNSVLGFPTGGHHILALGLQP  206



>gb|ABG20629.1| DEF [Cestrum elegans]
Length=215

 Score =   357 bits (915),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = +3

Query  138  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFD  317
            RIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISP  TTKQLFD
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISPQITTKQLFD  60

Query  318  QYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVD  497
             YQKTVGVDLW+SH+EKMQEQL+KL+DVNR LRREIRQRMGESLNDL++EQL EL+E+VD
Sbjct  61   LYQKTVGVDLWNSHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQLEELMENVD  120

Query  498  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVDHEGDYNSVL  677
            NS+KLIRERKYKVIGNQIET+KKKVRNVEEIHRNLLLE +ARQEDPYGLV+ EGDYNSVL
Sbjct  121  NSLKLIRERKYKVIGNQIETYKKKVRNVEEIHRNLLLEFDARQEDPYGLVEQEGDYNSVL  180

Query  678  GFANGGHRILALRLQP  725
            GF NGGHRILALRLQP
Sbjct  181  GFQNGGHRILALRLQP  196



>emb|CAJ53871.1| floral homeotic protein DEFICIENS [Solanum lycopersicum]
Length=228

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 196/206 (95%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIVMIS++GKLHE+ISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQLFD YQKT+GVD+W++H+EKMQEQL+KL+DVNR LR+EIRQRMGESLNDL++EQ
Sbjct  61   SITTKQLFDLYQKTIGVDIWTTHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLV  647
            L EL+E+VDNS+KLIRERK+KVIGNQIET++KKVRNVEEI+RNLLLE +ARQEDPY GLV
Sbjct  121  LEELMENVDNSLKLIRERKFKVIGNQIETYRKKVRNVEEINRNLLLEFDARQEDPYGGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            +H+GDYNSVLGF  GG RIL LRLQP
Sbjct  181  EHDGDYNSVLGFPTGGPRILDLRLQP  206



>gb|ABG20626.1| DEF [Solandra maxima]
Length=220

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = +3

Query  138  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFD  317
            RIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISPS TTKQLFD
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISPSITTKQLFD  60

Query  318  QYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVD  497
            QYQKTVGVDLW+SH+EKMQEQL+KL+DVNR LRREIRQRMGESLNDL++EQL EL+E+VD
Sbjct  61   QYQKTVGVDLWNSHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQLEELMENVD  120

Query  498  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVDHEGDYNSVL  677
            +S+KLIRERKYKVIGNQIET+KKKVRNVEEIHRNLLLE +ARQEDPYGLV+ EGDYNSVL
Sbjct  121  SSLKLIRERKYKVIGNQIETYKKKVRNVEEIHRNLLLEFDARQEDPYGLVEQEGDYNSVL  180

Query  678  GFANGGHRILALRLQP  725
            GF NG  RILALRLQP
Sbjct  181  GFPNGVPRILALRLQP  196



>ref|NP_001234077.1| TAP3 [Solanum lycopersicum]
 gb|ABG73412.1| TAP3 [Solanum lycopersicum]
Length=228

 Score =   355 bits (911),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 196/206 (95%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIVMIS++GKLHE+ISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQLFD YQKT+GVD+W++H+EKMQEQL+KL+DVNR LR+EIRQRMGESLNDL++EQ
Sbjct  61   SITTKQLFDLYQKTIGVDIWTTHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLV  647
            L EL+E+VDNS+KLIRERK+KVIGNQIET++KKVRNVEEI+RNLLLE +ARQEDPY GLV
Sbjct  121  LEELMENVDNSLKLIRERKFKVIGNQIETYRKKVRNVEEINRNLLLEFDARQEDPYGGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            +H+GDYNS+LGF  GG RIL LRLQP
Sbjct  181  EHDGDYNSMLGFPTGGPRILDLRLQP  206



>sp|P23706.1|DEFA_ANTMA RecName: Full=Floral homeotic protein DEFICIENS [Antirrhinum 
majus]
 emb|CAA44629.1| DEF A protein [Antirrhinum majus]
 emb|CAA36268.1| deficiens [Antirrhinum majus]
Length=227

 Score =   353 bits (905),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +T TKQLFDQYQK VGVDLWSSH+EKMQE LKKL +VNR LRREIRQRMGESLNDL +EQ
Sbjct  61   TTATKQLFDQYQKAVGVDLWSSHYEKMQEHLKKLNEVNRNLRREIRQRMGESLNDLGYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  LIED+DNS+KLIRERKYKVI NQI+T KKKVRNVEEIHRNL+LE +AR+EDP +GLV
Sbjct  121  IVNLIEDMDNSLKLIRERKYKVISNQIDTSKKKVRNVEEIHRNLVLEFDARREDPHFGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRL  719
            D+EGDYNSVLGF NGG RI+ALRL
Sbjct  181  DNEGDYNSVLGFPNGGPRIIALRL  204



>gb|ABG20624.1| DEF [Mandragora autumnalis]
Length=214

 Score =   351 bits (901),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = +3

Query  138  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFD  317
            RIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIST+GKLHE+ISPS TTKQ+FD
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISTTGKLHEFISPSITTKQVFD  60

Query  318  QYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVD  497
             YQKTVGVDLW+SH+EKMQEQL+KL+DVNR LRREIRQRMGESLNDL++EQL EL+E+VD
Sbjct  61   LYQKTVGVDLWNSHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQLEELMENVD  120

Query  498  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVDHEGDYNSVL  677
            NS+KLIRERK+KVIGNQIET+KKKVRNVEEIHRNLLLE +ARQEDPYGLV+ EGDY SVL
Sbjct  121  NSLKLIRERKFKVIGNQIETYKKKVRNVEEIHRNLLLEFDARQEDPYGLVEQEGDYTSVL  180

Query  678  GFANGGHRILALRLQP  725
            GF NGG RILALR+QP
Sbjct  181  GFQNGGPRILALRIQP  196



>gb|ABG20625.1| DEF [Juanulloa mexicana]
Length=218

 Score =   350 bits (899),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  138  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFD  317
            RIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISPS TTKQLFD
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISPSITTKQLFD  60

Query  318  QYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVD  497
             YQKTVGVD+W SH+EKMQEQL+KL+DVNR LRREIRQRMGESLNDL+ EQL EL+E+VD
Sbjct  61   LYQKTVGVDIWYSHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNCEQLQELMENVD  120

Query  498  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVDHEGDYNSVL  677
            NS+KLIRERKYKVIGNQIET+KKKVRNVEEIHRNLLLE +ARQEDPYGLV+ EGDYNSVL
Sbjct  121  NSLKLIRERKYKVIGNQIETYKKKVRNVEEIHRNLLLEFDARQEDPYGLVEQEGDYNSVL  180

Query  678  GFANGGHRILALRLQP  725
            GF NGG  ILALRLQP
Sbjct  181  GFPNGGSHILALRLQP  196



>gb|AGN54423.1| PFDEF [Physalis pubescens]
Length=235

 Score =   350 bits (898),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/209 (83%), Positives = 195/209 (93%), Gaps = 4/209 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIVMIS++GKLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S +TKQLFD YQKTVG DLW+SH+EKMQEQL+KL+DVNR L++EIRQRMGESLNDL++EQ
Sbjct  61   SISTKQLFDLYQKTVGADLWNSHYEKMQEQLRKLKDVNRNLQKEIRQRMGESLNDLNYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLV  647
            L EL+E+VD+S+KLIRERKYKVIGNQIET+KKKVRNVEEIHRNLLLE +ARQ+DPY GLV
Sbjct  121  LGELMENVDDSLKLIRERKYKVIGNQIETYKKKVRNVEEIHRNLLLEFDARQDDPYGGLV  180

Query  648  DHEGD--YNSVLGFANG-GHRILALRLQP  725
            + EG   YNSVLGF NG G RILALRLQP
Sbjct  181  EQEGADHYNSVLGFPNGAGARILALRLQP  209



>dbj|BAI68389.1| DEFICIENS protein [Antirrhinum majus]
Length=227

 Score =   349 bits (895),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 188/204 (92%), Gaps = 1/204 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +T TKQLFDQYQK VGVDLWSSH+EKMQE LKKL +VNR LRREIRQRMGESLNDL +EQ
Sbjct  61   TTATKQLFDQYQKAVGVDLWSSHYEKMQEHLKKLNEVNRNLRREIRQRMGESLNDLGYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  LIED+DNS+KLIRERKYKVI NQI+T KKKVRNVEEI RNL+LE +AR+EDP +GLV
Sbjct  121  IVNLIEDMDNSLKLIRERKYKVISNQIDTSKKKVRNVEEIPRNLVLEFDARREDPHFGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRL  719
            D+EGDYNSVLGF NGG RI+ALRL
Sbjct  181  DNEGDYNSVLGFPNGGPRIIALRL  204



>emb|CAJ44129.1| deficiens protein [Misopates orontium]
Length=228

 Score =   348 bits (893),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 189/206 (92%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +T TKQLFDQYQK VGVDLWSSH+EKMQE LKKL +VNR LRREIRQRMGESLNDL +EQ
Sbjct  61   TTATKQLFDQYQKAVGVDLWSSHYEKMQEHLKKLNEVNRNLRREIRQRMGESLNDLGYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  LIED+DNS+KLIRERKYKVI NQI+T KKKVRNVEEIHRNL+LE +AR+EDP +GLV
Sbjct  121  IVNLIEDMDNSLKLIRERKYKVISNQIDTSKKKVRNVEEIHRNLVLEFDARREDPHFGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            ++EGDYNSVLGF NGG RI+AL+  P
Sbjct  181  ENEGDYNSVLGFPNGGPRIIALQRLP  206



>gb|AEM60197.1| MADS box transcription factor, partial [Iochroma cyaneum]
Length=212

 Score =   345 bits (884),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = +3

Query  138  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFD  317
            +IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIVM+S++GKLHE+ISPS TTKQLFD
Sbjct  1    KIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMVSSTGKLHEFISPSITTKQLFD  60

Query  318  QYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVD  497
             YQKTVGVDLW+SH+EKMQEQL+KL DVNR LRREIRQRMGESLNDL++EQL EL+E+VD
Sbjct  61   LYQKTVGVDLWNSHYEKMQEQLRKLMDVNRNLRREIRQRMGESLNDLNYEQLEELMENVD  120

Query  498  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNSV  674
            NS+KLIRERKYK IGNQIET+KKKVRNVEEIHRNLLLE +ARQEDPY GLV+ EGDYNSV
Sbjct  121  NSLKLIRERKYKSIGNQIETYKKKVRNVEEIHRNLLLEFDARQEDPYGGLVEQEGDYNSV  180

Query  675  LGFANGGHRILALRLQP  725
            LGF NGG  ILALRLQP
Sbjct  181  LGFPNGGAGILALRLQP  197



>gb|AEM60199.1| MADS box transcription factor, partial [Solanum nigrum]
Length=212

 Score =   340 bits (873),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 187/198 (94%), Gaps = 1/198 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIVMIS++GKLHE+ISPS TTKQLF
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISPSITTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D YQ T+GVD+W++H+EKMQEQL+KL+DVNR LR+EIRQR+GESLNDL+FEQL EL+E+V
Sbjct  61   DLYQNTIGVDIWTTHYEKMQEQLRKLKDVNRNLRKEIRQRVGESLNDLNFEQLEELMENV  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNS  671
            DNS+KLIRERKYKVI NQI+T+K+KVRNVEEIHRNLLLE +ARQEDPY GLV+ EGDYNS
Sbjct  121  DNSLKLIRERKYKVISNQIDTYKEKVRNVEEIHRNLLLEFDARQEDPYGGLVEQEGDYNS  180

Query  672  VLGFANGGHRILALRLQP  725
            +LGF NGG RILALRLQP
Sbjct  181  MLGFPNGGGRILALRLQP  198



>gb|AAS45984.1| deficiens [Erythranthe guttata]
Length=244

 Score =   340 bits (873),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 191/206 (93%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSIVMIS++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIVMISSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQ+FDQYQK VGVDLW++H++KMQ+ L+KL++VNR LR+EIRQRMGESLNDL ++Q
Sbjct  61   SITTKQVFDQYQKAVGVDLWNTHYQKMQDHLQKLKEVNRNLRKEIRQRMGESLNDLGYDQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  LIE+VDNS+ LIRE+KYKVIGN+IET KKK+RNVEEIHR+L+LE +ARQEDP YGLV
Sbjct  121  MVNLIEEVDNSLGLIREKKYKVIGNRIETSKKKLRNVEEIHRSLVLEFDARQEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            ++EGDYNSVLGF +GG RI+ALRL P
Sbjct  181  ENEGDYNSVLGFPHGGPRIIALRLPP  206



>gb|ABG20622.1| DEF [Brunfelsia uniflora]
Length=228

 Score =   339 bits (870),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 185/195 (95%), Gaps = 1/195 (1%)
 Frame = +3

Query  138  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFD  317
            RIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISPS TTKQLFD
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISPSLTTKQLFD  60

Query  318  QYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVD  497
             YQ TVGVDLW+SH+E+MQEQL+KL+DVNR LR+EIRQRMGESLNDL++EQL +L+E+VD
Sbjct  61   LYQNTVGVDLWNSHYEQMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQLEKLMENVD  120

Query  498  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVDHEGDYNSVL  677
            +S+KLIRERKYKVIGNQIET KKKVRNVEEIHRNLLLE +ARQEDPYGLV+ EGDYNSVL
Sbjct  121  DSLKLIRERKYKVIGNQIETCKKKVRNVEEIHRNLLLEFDARQEDPYGLVEQEGDYNSVL  180

Query  678  GFANG-GHRILALRL  719
            GF NG GHRILALRL
Sbjct  181  GFPNGSGHRILALRL  195



>ref|XP_011074633.1| PREDICTED: floral homeotic protein DEFICIENS [Sesamum indicum]
 gb|AIS82594.1| APETALA 3 [Sesamum indicum]
Length=234

 Score =   339 bits (870),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 186/204 (91%), Gaps = 1/204 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            + TTKQLFDQYQ    VDLW+SH+EKMQ+ LKKL++VNR LRREIRQRMGESLNDL + +
Sbjct  61   TITTKQLFDQYQTAATVDLWNSHYEKMQQHLKKLKEVNRNLRREIRQRMGESLNDLGYGE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  LIED+DNS++LIR+RKYKVIGNQI+T KKK+RNVEEIHRNL LE +ARQEDP YGLV
Sbjct  121  MVNLIEDMDNSLRLIRDRKYKVIGNQIDTSKKKLRNVEEIHRNLALEFDARQEDPQYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRL  719
            ++EGDYNSVLGF NGG RI+ALRL
Sbjct  181  ENEGDYNSVLGFPNGGPRIIALRL  204



>gb|AGA61764.1| apetala 3 [Cornus florida]
Length=228

 Score =   338 bits (868),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHE+ISP
Sbjct  1    MARGKIQIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQLFDQYQKT+G+DLWSSH+E+MQE LKKL+D+NR LRREIRQR GESLNDLS+E 
Sbjct  61   STTTKQLFDQYQKTLGIDLWSSHYERMQENLKKLKDINRKLRREIRQRTGESLNDLSYED  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ED++ S+K+IR+RKYKVIGNQIET+KKKVRNVEEIHRNLL E E + EDP YGLV
Sbjct  121  LLRLQEDMEISLKIIRDRKYKVIGNQIETYKKKVRNVEEIHRNLLHEFETKGEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ GDY+SVLGF  G   ILALRLQP
Sbjct  181  DNGGDYDSVLGFTGGAASILALRLQP  206



>gb|AEM60198.1| MADS box transcription factor, partial [Solanum pennellii]
Length=212

 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 187/198 (94%), Gaps = 1/198 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIVMIS++GKLHE+ISPS TTKQLF
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISPSITTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D YQKT+GVD+W++H+EKMQEQL+KL+DVNR LR+EIRQRMGESLNDL++EQL E +E+V
Sbjct  61   DLYQKTIGVDIWTTHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQLEEPMENV  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNS  671
            DNS+KLIRERK+KVIGNQIET++KKVRNVEEI+RNLLLE +ARQEDPY GLV+H+GDYNS
Sbjct  121  DNSLKLIRERKFKVIGNQIETYRKKVRNVEEINRNLLLEFDARQEDPYGGLVEHDGDYNS  180

Query  672  VLGFANGGHRILALRLQP  725
            VLGF  GG RIL LRLQP
Sbjct  181  VLGFPTGGPRILDLRLQP  198



>gb|ADU56837.1| MADS-box protein DEF subfamily [Coffea arabica]
 gb|AHW58030.1| AP3 [Coffea arabica]
 emb|CDP07446.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   337 bits (864),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 197/233 (85%), Gaps = 11/233 (5%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M+S++ KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMVSSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            + TTKQL DQYQK VGVDLWSSH EKMQEQLKKL++VNR LR+EIRQRMGESLNDLS+++
Sbjct  61   TATTKQLVDQYQKAVGVDLWSSHHEKMQEQLKKLKEVNRNLRKEIRQRMGESLNDLSYDE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  LIEDVDNS++ IRERKYKVIGNQIETHKKKVRNVEEIHRNLLLE +AR EDP YGLV
Sbjct  121  LGFLIEDVDNSLRAIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLELDARGEDPHYGLV  180

Query  648  DH-EGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+  GDYN VLG+     R+LALR QP             GG SDLTTF LLE
Sbjct  181  DNGGGDYNPVLGYP----RVLALRFQP-----TQPNLHSGGGSSDLTTFALLE  224



>gb|AEM60188.1| MADS box transcription factor, partial [Eustoma sp. VFI-2011]
Length=209

 Score =   336 bits (861),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M+S++ KLHEYISP+ TTKQL 
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMVSSTHKLHEYISPTATTKQLI  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK +GVDLWSSH+EKMQEQL+KL++VNR LR+EIRQRMGESLNDLS++QL  L+EDV
Sbjct  61   DQYQKALGVDLWSSHYEKMQEQLRKLKEVNRNLRKEIRQRMGESLNDLSYDQLGNLMEDV  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DN+++ IRERK+KVIGNQIETHKKK+RNVEEIHRNLLLE +ARQEDP YGLVD+ GDYNS
Sbjct  121  DNALRGIRERKFKVIGNQIETHKKKLRNVEEIHRNLLLELDARQEDPHYGLVDNGGDYNS  180

Query  672  VLGFANGGHRILALRLQP  725
            V+GF+NGG  +LALRLQP
Sbjct  181  VVGFSNGGPCMLALRLQP  198



>gb|ABG20628.1| DEF2 [Scopolia carniolica]
Length=222

 Score =   336 bits (862),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 184/197 (93%), Gaps = 2/197 (1%)
 Frame = +3

Query  138  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFD  317
            RIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISPS TTKQLFD
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISPSITTKQLFD  60

Query  318  QYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVD  497
             YQKTVGVDLW+SH+EKMQEQL+KL+DVNR LRREIRQRMGESLNDL++EQL EL+E+VD
Sbjct  61   LYQKTVGVDLWNSHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQLEELMENVD  120

Query  498  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNSV  674
            NS+KLIRERKYKVIGNQIET KKKVRNVEEIH+NLLLE +AR+EDPY GLV+ EGDYN +
Sbjct  121  NSLKLIRERKYKVIGNQIETFKKKVRNVEEIHKNLLLEFDAREEDPYGGLVEQEGDYNFM  180

Query  675  LGFANGGHRILALRLQP  725
            LGF NG H IL LRLQP
Sbjct  181  LGFPNGDH-ILTLRLQP  196



>gb|AEM60180.1| MADS box transcription factor, partial [Sesamum indicum]
Length=217

 Score =   335 bits (858),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 181/196 (92%), Gaps = 1/196 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+MIS++ KLHEYISPSTTTKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMISSTQKLHEYISPSTTTKQVF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK V VDLWSSH+EKMQE LKKL+DVNR LRREIRQRMGESLNDL ++Q+  LIED+
Sbjct  61   DQYQKAVAVDLWSSHYEKMQEHLKKLKDVNRNLRREIRQRMGESLNDLGYDQMVNLIEDM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            D+S++LIRERKYKVIGNQIET KKK+RNVEEIHRNL LE +ARQEDP YGLV++EG YNS
Sbjct  121  DSSLRLIRERKYKVIGNQIETSKKKLRNVEEIHRNLALEFDARQEDPQYGLVENEGGYNS  180

Query  672  VLGFANGGHRILALRL  719
            VLGF NGG RI+ALRL
Sbjct  181  VLGFPNGGPRIIALRL  196



>gb|AAS45992.1| deficiens [Erythranthe guttata]
 gb|EYU36756.1| hypothetical protein MIMGU_mgv1a012867mg [Erythranthe guttata]
Length=237

 Score =   335 bits (858),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 187/204 (92%), Gaps = 1/204 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQ+FDQYQK VGVD+W++H+E+MQE LKKL+DVNR LR EIRQR+GESLNDL +EQ
Sbjct  61   SITTKQMFDQYQKAVGVDVWNTHYERMQEHLKKLKDVNRNLRTEIRQRIGESLNDLGYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  LIE++DNS+ +IRE+KYK I +QI+T KKK+RNVEEI+RNL+LE +ARQEDP YGLV
Sbjct  121  MVNLIEEIDNSLTIIREKKYKAISSQIDTSKKKLRNVEEINRNLVLEFDARQEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRL  719
            ++EGDYNS+LGF NGG RI+ALRL
Sbjct  181  ENEGDYNSLLGFPNGGPRIIALRL  204



>gb|AAS45985.1| deficiens [Erythranthe lewisii]
Length=238

 Score =   335 bits (858),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 188/206 (91%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSIVMIS++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIVMISSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQ+FDQYQK VGVDLW+SH++KMQE L+KL+DVNR LR+EIRQRMGESLNDL +EQ
Sbjct  61   SITTKQVFDQYQKAVGVDLWNSHYQKMQEHLQKLKDVNRNLRKEIRQRMGESLNDLGYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
               LIE+VD ++ LIRE+KYKVIGN+IET KKK+RNVEEIHR+L+LE ++ QE+P YGLV
Sbjct  121  TVNLIEEVDTALSLIREKKYKVIGNRIETSKKKLRNVEEIHRSLVLEFDSIQEEPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            ++EGDYNSVLGF +GG RI+ALRL P
Sbjct  181  ENEGDYNSVLGFQHGGPRIIALRLPP  206



>gb|ABG20627.1| DEF1 [Scopolia carniolica]
Length=219

 Score =   334 bits (856),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 183/197 (93%), Gaps = 2/197 (1%)
 Frame = +3

Query  138  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFD  317
            RIENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS +GKLHE+ISPS TTKQLFD
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISNTGKLHEFISPSITTKQLFD  60

Query  318  QYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVD  497
             YQKTVGVDLW+ H+EKMQEQL+KL+DVNR LRREIRQRMGESLNDL++EQL +L+E+VD
Sbjct  61   LYQKTVGVDLWNFHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQLEQLMENVD  120

Query  498  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNSV  674
            NS+KLIRERKYKVIGNQIET KKKVRNVEEIHRNL+LE +AR+EDPY GLV+  GDYNS+
Sbjct  121  NSLKLIRERKYKVIGNQIETFKKKVRNVEEIHRNLMLEFDAREEDPYGGLVEQGGDYNSM  180

Query  675  LGFANGGHRILALRLQP  725
            LGF NGG RILAL LQP
Sbjct  181  LGFPNGG-RILALHLQP  196



>gb|AEM60183.1| MADS box transcription factor, partial [Halleria lucida]
Length=215

 Score =   333 bits (855),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 184/198 (93%), Gaps = 1/198 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP+TTTKQLF
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPATTTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW+ H+EKMQE LKKL++VNR LRREIRQRMGESLN+L ++Q+  LIE++
Sbjct  61   DQYQKAVGVDLWNPHYEKMQEHLKKLKEVNRNLRREIRQRMGESLNNLGYDQMVNLIEEM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            D+S++LIR+RKYKVIGNQIET KKK+RNVEEIH+NL+LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DSSLRLIRDRKYKVIGNQIETSKKKLRNVEEIHKNLVLEFDARQEDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRLQP  725
            VLGF NGG RI+ALRL P
Sbjct  181  VLGFPNGGSRIIALRLPP  198



>gb|AAS45967.1| deficiens [Mimulus ringens]
Length=235

 Score =   334 bits (857),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSIVM+S+S KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIVMVSSSQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            + TTKQ+FD YQ  VGVDLWSSH++KMQE L+KL++VNR L REIRQR+GESLNDL ++Q
Sbjct  61   TITTKQVFDDYQTAVGVDLWSSHYQKMQEHLQKLKEVNRNLTREIRQRVGESLNDLGYDQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  LIED+D S+ +IRE+KYKVIGN+IET KKKVRNVEEIHRNL+LE EARQEDP YGLV
Sbjct  121  MVNLIEDIDKSLGVIREKKYKVIGNRIETGKKKVRNVEEIHRNLVLEFEARQEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            ++EGDYNS LGFA+GG RI+AL + P
Sbjct  181  ENEGDYNSFLGFAHGGPRIVALHVPP  206



>ref|XP_011083640.1| PREDICTED: floral homeotic protein DEFICIENS-like [Sesamum indicum]
Length=217

 Score =   332 bits (852),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMISSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQ+FDQYQK V VDLWSSH+EKMQE LKKL+DVNR LRREIRQRMGESLNDL ++Q
Sbjct  61   STTTKQVFDQYQKAVAVDLWSSHYEKMQEHLKKLKDVNRNLRREIRQRMGESLNDLGYDQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  LIED+D+S++LIRERKYKVIGNQIET KKK+RNVEEIHRNL+LE +ARQEDP YGLV
Sbjct  121  MVNLIEDMDSSLRLIRERKYKVIGNQIETSKKKLRNVEEIHRNLVLELDARQEDPHYGLV  180

Query  648  DHEGDYNSV  674
            +H+GDYNSV
Sbjct  181  EHDGDYNSV  189



>gb|ADU15474.1| AP3 [Actinidia eriantha]
Length=226

 Score =   333 bits (853),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 187/206 (91%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHEYISP
Sbjct  1    MARGKIQIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S +TKQLFDQYQKT+G+DLWSSH+EKMQE LKKL+DVNR  RREIRQRMGESLN+LS+E 
Sbjct  61   SVSTKQLFDQYQKTLGIDLWSSHYEKMQEHLKKLKDVNRNFRREIRQRMGESLNELSYED  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L +D++ S+K+IR+RKYKVIGNQIET+KKK+RNVEEIHR+LL E +A   DP YGLV
Sbjct  121  LRGLEQDMETSLKIIRDRKYKVIGNQIETYKKKLRNVEEIHRSLLHEFDAIGADPTYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+EGDY+SVL +++GG  ILALRLQP
Sbjct  181  DNEGDYDSVLAYSDGGRGILALRLQP  206



>gb|AGA61754.1| apetala 3 [Cornus kousa]
Length=228

 Score =   331 bits (849),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHE+ISP
Sbjct  1    MARGKIQIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQLFDQYQKT+G+DLWSSH+E+MQE LKKL+++NR  RREIRQR GESLNDLS+E 
Sbjct  61   STTTKQLFDQYQKTLGIDLWSSHYERMQENLKKLKEINRKFRREIRQRTGESLNDLSYED  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ED++ S+K+IR+RKYKVIGNQIET+KKK+RNVEEIHRNLL E + + EDP YGLV
Sbjct  121  LLRLQEDMEISLKIIRDRKYKVIGNQIETYKKKLRNVEEIHRNLLHEFDIKGEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ GDY+SVLGF  G   +LALRLQP
Sbjct  181  DNGGDYDSVLGFTGGAASVLALRLQP  206



>gb|AAS45990.1| deficiens, partial [Paulownia tomentosa]
Length=219

 Score =   330 bits (845),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 180/198 (91%), Gaps = 1/198 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP+TTTKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISPNTTTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW+SH+ KMQE LKKL +VNR LR E+RQR+GESLNDL ++Q   LIED+
Sbjct  61   DQYQKAVGVDLWNSHYMKMQEHLKKLNEVNRNLRMEVRQRVGESLNDLGYDQTVNLIEDI  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            +NS+KLIRERKYKVIGNQI+T KKK+RNVEEIHR LLLE +ARQEDP YGLV++EGDYNS
Sbjct  121  ENSLKLIRERKYKVIGNQIDTSKKKLRNVEEIHRTLLLEFDARQEDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRLQP  725
            VLGF NGG RI+ALRL P
Sbjct  181  VLGFPNGGPRIIALRLPP  198



>gb|AAS45982.1| deficiens, partial [Pedicularis groenlandica]
Length=219

 Score =   330 bits (845),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 180/196 (92%), Gaps = 1/196 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISPST TKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPSTMTKQVF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW +H+EKMQ  L+KL+DVNR LR+EIRQRMGE LNDL +EQ+  LIED+
Sbjct  61   DQYQKAVGVDLWKTHYEKMQGHLQKLKDVNRNLRKEIRQRMGECLNDLGYEQMVNLIEDI  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DNS++LIRERKYKVIGNQIET KKK+RNVEEIHRNL+LE +AR+EDP YGLV++EGDYNS
Sbjct  121  DNSLRLIRERKYKVIGNQIETGKKKLRNVEEIHRNLVLEFDAREEDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRL  719
            VLG+ NGG RI+ALRL
Sbjct  181  VLGYPNGGSRIIALRL  196



>gb|AEM60186.1| MADS box transcription factor, partial [Streptocarpus x hybridus]
Length=207

 Score =   328 bits (842),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 181/196 (92%), Gaps = 4/196 (2%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISPS+TTKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPSSTTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLWSSH+EKMQE LKKL++VNR LRREIRQRMGESLNDL + Q+  LIED+
Sbjct  61   DQYQKAVGVDLWSSHYEKMQEHLKKLKEVNRNLRREIRQRMGESLNDLDYHQMVNLIEDM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            D+S+K+IRERKYKVIGNQIET KKK+RNVEEIHRNL+LE +ARQEDP YGLVD+EGDYN+
Sbjct  121  DSSLKIIRERKYKVIGNQIETGKKKLRNVEEIHRNLVLEFDARQEDPHYGLVDNEGDYNT  180

Query  672  VLGFANGGHRILALRL  719
            VLG+ N   RI+ALRL
Sbjct  181  VLGYPN---RIIALRL  193



>gb|AAS45979.1| deficiens, partial [Syringa vulgaris]
Length=219

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 182/196 (93%), Gaps = 1/196 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ K+HEYISP+++TKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKIHEYISPTSSTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D YQ TVGVDLW +H+E+MQE L+KL+D+N+ LRREIRQRMGESLNDL+++Q+  LIEDV
Sbjct  61   DLYQTTVGVDLWITHYERMQEHLRKLKDINKNLRREIRQRMGESLNDLNYDQIVSLIEDV  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            D+S++ IRERKYKVIGNQIET KKK+RNVEEIHRN+LLE +ARQEDP YGLVD+EGDYNS
Sbjct  121  DDSLRKIRERKYKVIGNQIETSKKKLRNVEEIHRNILLEFDARQEDPQYGLVDNEGDYNS  180

Query  672  VLGFANGGHRILALRL  719
            VLGF NGG RI+ALRL
Sbjct  181  VLGFPNGGPRIIALRL  196



>gb|ACK43086.1| deficiens 2 protein [Eustoma exaltatum subsp. russellianum]
Length=226

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+M+S++ KLHE+ISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMLSSTSKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTKQL DQYQK +GVDLWSSH+EKMQEQLKKL+DVNR LRREIRQR+GESLND+S+++
Sbjct  61   TTTTKQLMDQYQKALGVDLWSSHYEKMQEQLKKLKDVNRNLRREIRQRLGESLNDMSYDE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L +L +++D S+K IRERK K I NQIET KKKV++  +IHRNLLLE +ARQEDP YGLV
Sbjct  121  LRKLTDEIDESLKAIRERKIKAISNQIETLKKKVKSANDIHRNLLLELDARQEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            ++ GDY+S++G  NGGH +LAL LQP
Sbjct  181  ENAGDYHSLIGLPNGGHHVLALCLQP  206



>gb|AEM60172.1| MADS box transcription factor, partial [Betonica officinalis]
Length=222

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 180/198 (91%), Gaps = 1/198 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SIVMI ++ KLHEYISP+ TTK +F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISIVMIPSTQKLHEYISPTITTKSMF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLWSSH+EKMQE  KKL++VNR LRREIRQRMGE LNDL +EQ+ +LIED+
Sbjct  61   DQYQKAVGVDLWSSHYEKMQENSKKLKEVNRNLRREIRQRMGECLNDLGYEQMVDLIEDM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            D S++LIR+RKYKVIGNQI+THKKK RNVEEIHR+L+LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DKSLRLIRDRKYKVIGNQIDTHKKKFRNVEEIHRSLVLEFDARQEDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRLQP  725
            VLGF +GG RI+ALRL P
Sbjct  181  VLGFPHGGPRIIALRLPP  198



>gb|AEM60200.1| MADS box transcription factor, partial [Solanum pyracanthum]
Length=222

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 183/198 (92%), Gaps = 6/198 (3%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDA+VSIVMIS++GKLHE+ISPS TTKQLF
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKANELTVLCDAQVSIVMISSTGKLHEFISPSITTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D YQKT+GVD+W+SH+EKMQEQL+KL+DVNR LR+EIRQRMGESLNDL++EQL EL+E+V
Sbjct  61   DLYQKTIGVDIWTSHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQLEELMENV  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNS  671
            DNS+K+IRERKYKVI NQI+T KKKVRNVEEIHRNLLLE +ARQEDPY GLV+ EGDYNS
Sbjct  121  DNSLKIIRERKYKVISNQIDTFKKKVRNVEEIHRNLLLEFDARQEDPYGGLVEQEGDYNS  180

Query  672  VLGFANGGHRILALRLQP  725
            VL     G RILALRLQP
Sbjct  181  VL-----GARILALRLQP  193



>gb|AAS45981.1| deficiens, partial [Verbena officinalis]
Length=226

 Score =   327 bits (837),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 199/226 (88%), Gaps = 3/226 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISPST TKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPSTATKQVF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW SH+EKMQE LKKL++VNR LR+EIRQRMGESLNDL ++ +  LIED+
Sbjct  61   DQYQKAVGVDLWQSHYEKMQEHLKKLKEVNRNLRKEIRQRMGESLNDLGYDHMVNLIEDM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DNS++LIRERKYKVIGNQIET KKK+RNVEEIHRNL+LE +ARQEDP Y LV++EGDYNS
Sbjct  121  DNSLRLIRERKYKVIGNQIETSKKKLRNVEEIHRNLVLEFDARQEDPHYALVENEGDYNS  180

Query  672  VLGFAN--GGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            V+G+ N  GG RI+ALRL    HHH  H  LHSGGGSDLTTF LLE
Sbjct  181  VIGYPNGGGGPRIIALRLPQPIHHHLPHPALHSGGGSDLTTFHLLE  226



>gb|ABG20623.1| DEF [Solanum pseudolulo]
Length=217

 Score =   326 bits (835),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 204/221 (92%), Gaps = 6/221 (3%)
 Frame = +3

Query  138  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFD  317
            +IENQTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSIVMIS++GKLHE+ISPS TTKQLFD
Sbjct  1    KIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFISPSITTKQLFD  60

Query  318  QYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVD  497
             YQKT+GVD+W+SH+EKMQEQL+KL+DVNR LR+EIRQRMGESLNDL+++QL EL+E+VD
Sbjct  61   LYQKTIGVDIWTSHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYQQLEELMENVD  120

Query  498  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNSV  674
            N++K+IRERKYKVI NQI+T KKKVRNVEEIHRNLLLE +ARQEDPY GLV+ EGDYNSV
Sbjct  121  NALKIIRERKYKVISNQIDTCKKKVRNVEEIHRNLLLEFDARQEDPYGGLVEQEGDYNSV  180

Query  675  LGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTL  797
            L     G RILALRLQP+++HHHHH HLHSGGGSD+TTF L
Sbjct  181  L-----GARILALRLQPNNNHHHHHHHLHSGGGSDITTFAL  216



>gb|ADL57412.1| MADS domain transcription factor [Camellia japonica]
Length=226

 Score =   326 bits (835),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 186/206 (90%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M+S++GKLHE+ISP
Sbjct  1    MARGKIQIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMVSSTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            ST+TKQ++DQYQK +G+DLW SH+E+MQE LKKL+DVN+ LR EIRQRMG+ LNDLS+E+
Sbjct  61   STSTKQMYDQYQKALGIDLWCSHYERMQEHLKKLKDVNKNLRTEIRQRMGDCLNDLSYEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L +D+++S+K+IR+RKYKV+ NQIET KKK RNVEEIHRNLL +  +++EDP YGLV
Sbjct  121  LCGLEQDMESSVKIIRDRKYKVLNNQIETQKKKKRNVEEIHRNLLHQVNSKEEDPQYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+  DYNS+LGF+NGGH ILALRLQP
Sbjct  181  DNGVDYNSILGFSNGGHGILALRLQP  206



>gb|AEM60193.1| MADS box transcription factor, partial [Jasminum humile]
Length=210

 Score =   324 bits (831),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 180/196 (92%), Gaps = 1/196 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+MIS++ K+HEYISP+TTTKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAEVSIIMISSTQKIHEYISPATTTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D+YQK VGVDLW +H+EKMQ+ L+ L+D+N+ LRREIRQRMGESLNDL+++Q+  LIEDV
Sbjct  61   DKYQKAVGVDLWITHYEKMQQHLRNLKDINKNLRREIRQRMGESLNDLNYDQIVNLIEDV  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            D S++ IRERKYKVI NQIET KKK+RNVEEIHRN+LLE EARQEDP YGLVD+EGDYNS
Sbjct  121  DESLRKIRERKYKVITNQIETSKKKLRNVEEIHRNILLEFEARQEDPQYGLVDNEGDYNS  180

Query  672  VLGFANGGHRILALRL  719
            VLGF +GG RI+ALRL
Sbjct  181  VLGFPDGGPRIIALRL  196



>gb|AAS45972.1| deficiens, partial [Leucocarpus perfoliatus]
Length=227

 Score =   325 bits (832),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 181/196 (92%), Gaps = 1/196 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISPS TTKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISPSITTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW+SH+E+MQE LKKL++VNR LRREIRQR+GESLNDL ++Q+  LIED+
Sbjct  61   DQYQKAVGVDLWNSHYERMQEHLKKLKEVNRNLRREIRQRIGESLNDLGYDQMVNLIEDI  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DNS+++IRE+KYK I NQI+T KKK+RNVEEI+RNL+LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSLRIIREKKYKAISNQIDTSKKKLRNVEEINRNLVLEFDARQEDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRL  719
            +LGF NGG RI+ALRL
Sbjct  181  LLGFPNGGPRIIALRL  196



>gb|AEM60187.1| MADS box transcription factor, partial [Gardenia jasminoides]
Length=207

 Score =   324 bits (830),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 181/199 (91%), Gaps = 6/199 (3%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+M+S++ KLH+YISP+ TTKQL 
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMVSSTQKLHDYISPTATTKQLV  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLWSSH+EKMQEQLKKL+DVNR LRREIRQRMGESLN+LS+++L  LIEDV
Sbjct  61   DQYQKAVGVDLWSSHYEKMQEQLKKLKDVNRNLRREIRQRMGESLNELSYDELGFLIEDV  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDH-EGDYN  668
            DNS++ IRERK+KVIGNQIETH+KK RNVEEIHRNLLL+ EARQEDP YGLVD+  GDYN
Sbjct  121  DNSLRSIRERKFKVIGNQIETHRKKFRNVEEIHRNLLLQLEARQEDPHYGLVDNGGGDYN  180

Query  669  SVLGFANGGHRILALRLQP  725
            SVLG+     R+LALRLQP
Sbjct  181  SVLGYP----RVLALRLQP  195



>gb|AEM60190.1| MADS box transcription factor, partial [Pentas lanceolata]
Length=207

 Score =   323 bits (829),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 179/198 (90%), Gaps = 4/198 (2%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+M+S++ KLHEYISPSTTTKQ+ 
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMVSSTHKLHEYISPSTTTKQMV  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW+SH+E+MQEQLKKL+DVNR LRRE+RQRMGESLNDLS+E+L  LIEDV
Sbjct  61   DQYQKVVGVDLWNSHYERMQEQLKKLKDVNRNLRREMRQRMGESLNDLSYEELGVLIEDV  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DNSI+ IRERK KVI NQIETHKKK+RNVEEIHRNLLLE +ARQEDP YGLVD+ GDY+S
Sbjct  121  DNSIRSIRERKIKVISNQIETHKKKLRNVEEIHRNLLLELDARQEDPHYGLVDNGGDYSS  180

Query  672  VLGFANGGHRILALRLQP  725
            VL       R+LALRLQP
Sbjct  181  VLA---AYPRLLALRLQP  195



>gb|AAS45969.1| deficiens, partial [Diplacus kelloggii]
Length=219

 Score =   324 bits (830),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSI+MIS++ KLHEYISPS +TKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTHKLHEYISPSISTKQVF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW+SH++KMQ+ L+KL+DVNR LRREIRQRMGESLNDL +EQ+ +LIEDV
Sbjct  61   DQYQKAVGVDLWNSHYQKMQDHLQKLKDVNRNLRREIRQRMGESLNDLGYEQMVDLIEDV  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            D+S++LIRE+KYKVI N+IET KKK+RNVEEIHRNL LE +  QEDP YGLV++EGDYNS
Sbjct  121  DSSLRLIREKKYKVISNRIETSKKKLRNVEEIHRNLALEFDTLQEDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRLQP  725
            VLGF +GG RI+ALRL P
Sbjct  181  VLGFPHGGPRIIALRLPP  198



>gb|AEM60195.1| MADS box transcription factor, partial [Ligustrum vulgare]
Length=210

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 180/196 (92%), Gaps = 1/196 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSI+MIS++ K+HEYISP+++TKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTQKIHEYISPTSSTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D YQK VGVDLW  H+E+MQE L+KL+D+N+ LRREIRQRMGESLNDL+++Q+  LIEDV
Sbjct  61   DLYQKAVGVDLWIIHYERMQEHLRKLKDINKNLRREIRQRMGESLNDLNYDQIVSLIEDV  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            D+S++ IRERKYKVI NQIET KKK+RNVEEIHRN+LLE +ARQEDP YGLVD+EGDYNS
Sbjct  121  DDSLRKIRERKYKVISNQIETGKKKLRNVEEIHRNMLLEFDARQEDPQYGLVDNEGDYNS  180

Query  672  VLGFANGGHRILALRL  719
            VLGF NGG RI+ALRL
Sbjct  181  VLGFPNGGPRIIALRL  196



>gb|AEM60192.1| MADS box transcription factor, partial [Jasminum mesnyi]
Length=210

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 178/196 (91%), Gaps = 1/196 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+MIS++ K+HEYISP+TTTKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAEVSIIMISSTQKIHEYISPTTTTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D+YQK VGVDLW +H+EKMQE L+ L+D+N+ LR EIRQRMGESLNDL+++Q+  LIEDV
Sbjct  61   DKYQKAVGVDLWITHYEKMQEHLRNLKDINKNLRTEIRQRMGESLNDLNYDQVVNLIEDV  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            D S++ IRERKYKVI NQIET KKK+RNVEEIHRN+LLE EARQEDP YGLVD+EGDYNS
Sbjct  121  DESLRKIRERKYKVITNQIETSKKKLRNVEEIHRNILLEFEARQEDPQYGLVDNEGDYNS  180

Query  672  VLGFANGGHRILALRL  719
            VLGF N G RI+ALRL
Sbjct  181  VLGFPNAGPRIIALRL  196



>gb|AAS45986.1| deficiens, partial [Verbena officinalis]
Length=225

 Score =   323 bits (828),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 201/224 (90%), Gaps = 1/224 (0%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP  TTKQLF
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISPPATTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D YQK VGVDLW +H+EKMQE L+KL++VNR LRREIRQRMGESLND+ ++ +  LIED+
Sbjct  61   DNYQKAVGVDLWQTHYEKMQEHLRKLKEVNRNLRREIRQRMGESLNDMGYDHMVNLIEDM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DNS++LIR+RKYKVIGNQI+T KKK+RNVEEIH+NL+LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSLRLIRDRKYKVIGNQIDTSKKKLRNVEEIHKNLVLEFDARQEDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            VLGF NGG RI+ALRL P+HH +HH  HLH GGGSDLTTF LL+
Sbjct  181  VLGFPNGGPRIIALRLPPNHHLNHHPNHLHGGGGSDLTTFHLLD  224



>gb|AEM60174.1| MADS box transcription factor, partial [Sesamum indicum]
Length=217

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 178/196 (91%), Gaps = 1/196 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP+ TTKQLF
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISPTITTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQ    VDLW+SH+EKMQ+ LKKL++VNR LRREIRQRMGESLNDL + ++  LIED+
Sbjct  61   DQYQTAATVDLWNSHYEKMQQHLKKLKEVNRNLRREIRQRMGESLNDLGYGEMVNLIEDM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DNS++LIR+RKYKVIGNQI+T KKK+RNVEEIHRNL LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSLRLIRDRKYKVIGNQIDTSKKKLRNVEEIHRNLALEFDARQEDPQYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRL  719
            VLGF NGG RI+ALRL
Sbjct  181  VLGFPNGGPRIIALRL  196



>dbj|BAG24492.1| DEFICIENS-like MADS-box protein [Torenia fournieri]
Length=234

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 182/207 (88%), Gaps = 2/207 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQ+FDQYQK VGVDLW + ++KMQE LKKL++VNR L+REIRQRMGE LND+S+E 
Sbjct  61   STTTKQVFDQYQKAVGVDLWQTSYQKMQEHLKKLKEVNRNLKREIRQRMGECLNDMSYEH  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  LIED+DNS+++IRERKYKVI +QIET KKK+RNVEEIH+ L+ E +AR EDP YGLV
Sbjct  121  MVNLIEDIDNSLRVIRERKYKVITSQIETGKKKLRNVEEIHKKLVFEYDARHEDPHYGLV  180

Query  648  DHEG-DYNSVLGFANGGHRILALRLQP  725
            ++E  DY+SVLGF N G R +ALR  P
Sbjct  181  ENEAVDYHSVLGFPNNGSRTIALRYVP  207



>gb|AEM60182.1| MADS box transcription factor, partial [Antirrhinum sp. VFI-2011]
Length=216

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 179/198 (90%), Gaps = 3/198 (2%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSI+MIS++ KLHEYISPST TKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISSTSKLHEYISPSTATKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW+SH++KMQE LKKL +VNR LR+EIRQRMGESLNDL +EQ+  LIED+
Sbjct  61   DQYQKAVGVDLWNSHYQKMQEHLKKLNEVNRNLRKEIRQRMGESLNDLGYEQIVNLIEDI  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEG--DY  665
            DNS+KLIRERKYKVI NQI+T KKKVRNVEEIHRNL+LE +AR+EDP +GLV++EG   Y
Sbjct  121  DNSLKLIRERKYKVISNQIDTSKKKVRNVEEIHRNLVLEFDARREDPHFGLVENEGHDHY  180

Query  666  NSVLGFANGGHRILALRL  719
            NSVLGF NGG RI+ LRL
Sbjct  181  NSVLGFPNGGPRIITLRL  198



>gb|AAS45971.1| deficiens [Mimulus ringens]
Length=244

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 184/203 (91%), Gaps = 1/203 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M+S++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAQVSILMVSSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQLFD+YQ  VG+DLWSSH+EKMQE LKK ++VNR LRREIRQR+GESLNDL ++Q
Sbjct  61   SITTKQLFDKYQNAVGLDLWSSHYEKMQEHLKKQKEVNRNLRREIRQRVGESLNDLGYDQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  LIED++NS++LIRE+KYK I   I+T +KKVRNVEEIHR+LLL+ +ARQEDP YGLV
Sbjct  121  IVNLIEDINNSLELIREKKYKSISGLIDTTRKKVRNVEEIHRSLLLDYDARQEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALR  716
            ++EGDYNS+LGF NGG RI+ALR
Sbjct  181  ENEGDYNSLLGFPNGGPRIIALR  203



>gb|AEM60169.1| MADS box transcription factor, partial [Buddleja davidii]
Length=211

 Score =   322 bits (825),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 179/198 (90%), Gaps = 1/198 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYI+P+ TTKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYITPNITTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK V  DLW+SH+EKMQE LKKL++VNR LRREIRQRMGESLNDL ++Q+  LIE++
Sbjct  61   DQYQKNVRADLWNSHYEKMQEHLKKLKEVNRNLRREIRQRMGESLNDLGYDQMVNLIEEM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            D S+ LIR+RKYKVI NQI+T KKK+RNVEEIHR+LLLE +ARQ+DP YGLV++EGDYNS
Sbjct  121  DKSVTLIRDRKYKVISNQIDTGKKKLRNVEEIHRSLLLEFDARQDDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRLQP  725
            VLGF NGG RI+ALRL P
Sbjct  181  VLGFPNGGSRIVALRLPP  198



>gb|AAS45973.1| deficiens, partial [Diplacus kelloggii]
Length=225

 Score =   322 bits (824),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 180/196 (92%), Gaps = 1/196 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISPS TTKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISPSITTKQMF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW+SH++KMQE LKKL++VNR LRREIRQR+GESLNDL ++Q+  LIED+
Sbjct  61   DQYQKAVGVDLWNSHYQKMQEHLKKLKEVNRNLRREIRQRIGESLNDLGYDQMVNLIEDI  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DNS+++IRE+KYK I +QI+T KKK+RNVEEI+RNL LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSLRIIREKKYKAINSQIDTSKKKLRNVEEINRNLALEFDARQEDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRL  719
            +LGF NGG RI+ALRL
Sbjct  181  LLGFPNGGPRIIALRL  196



>gb|AEM60167.1| MADS box transcription factor, partial [Lantana camara]
Length=213

 Score =   320 bits (820),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 181/197 (92%), Gaps = 2/197 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIST+ KLHEYISP+TTTKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISTTQKLHEYISPATTTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D YQ+ VGVDLW +H+EKMQE L+KL++VN+ LR+EIRQRMGESLNDL ++Q+  LI+D+
Sbjct  61   DYYQEAVGVDLWQTHYEKMQEHLRKLKEVNKNLRKEIRQRMGESLNDLGYDQMVTLIDDM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DNS++LIR+RKYKVIGNQI+T KKKVRNVEEIH+NL+LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSLRLIRDRKYKVIGNQIDTSKKKVRNVEEIHKNLVLEFDARQEDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHR-ILALRL  719
            VLGF NGG   I+ALRL
Sbjct  181  VLGFPNGGGPGIIALRL  197



>gb|AEM60168.1| MADS box transcription factor, partial [Lantana camara]
Length=217

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP+ TTKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISPAMTTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D YQ+ VGVDLW +H+EKMQE L+KL++V++ LR+EIRQRMGESLNDL ++Q+  LI+D+
Sbjct  61   DYYQEAVGVDLWQTHYEKMQEHLRKLKEVSKNLRKEIRQRMGESLNDLGYDQMVNLIDDM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DNS++LIR+RKYKVIGNQI+T KKKVRNVEEIH+NL+LE +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSLRLIRDRKYKVIGNQIDTSKKKVRNVEEIHKNLVLEFDARQEDPHYGLVENEGDYNS  180

Query  672  VLGFAN-GGHRILALRLQP  725
            VLGF N GG RI+ALRL P
Sbjct  181  VLGFPNGGGPRIIALRLPP  199



>gb|AAS45989.1| deficiens, partial [Pedicularis groenlandica]
Length=217

 Score =   320 bits (819),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 177/198 (89%), Gaps = 1/198 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP+  TKQLF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISSTQKLHEYISPAIMTKQLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW+S +EKMQE LKKL++VNR LRREIRQR+GES NDL ++Q+  LIED+
Sbjct  61   DQYQKDVGVDLWNSQYEKMQEHLKKLKEVNRNLRREIRQRIGESSNDLGYDQIVNLIEDI  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            ++S+ LIRERKYKVIG QI+T KKK+RNVEEIHRNL LE + RQEDP YGLV++EGDYNS
Sbjct  121  ESSLSLIRERKYKVIGGQIDTSKKKLRNVEEIHRNLALEYDVRQEDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRLQP  725
            VLGF NGG RI+ALRL P
Sbjct  181  VLGFPNGGTRIIALRLPP  198



>gb|ABQ59274.4| deficiens 1 protein [Eustoma exaltatum subsp. russellianum]
Length=226

 Score =   320 bits (819),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+M+ST+ KLHE+ISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMLSTTHKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTKQL DQYQK +GVDLWSSH+EKMQEQLKKL++VN+ LRREIRQR+GE LNDLSF++
Sbjct  61   TTTTKQLMDQYQKALGVDLWSSHYEKMQEQLKKLKEVNKNLRREIRQRLGEGLNDLSFDE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  L  ++D S++ IRERK K I NQI+T KKKV++  +IHRNLLLE +ARQEDP YGLV
Sbjct  121  MHNLTHEIDESLRAIRERKIKAISNQIDTLKKKVKSANDIHRNLLLELDARQEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            ++ GDY+S++GF  GGH +LAL LQP
Sbjct  181  ENAGDYHSLIGFPIGGHHLLALFLQP  206



>gb|AEM60170.1| MADS box transcription factor, partial [Clerodendrum infortunatum]
Length=216

 Score =   319 bits (817),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SI+MIS++ KLHEYISP+ TTKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISIIMISSTQKLHEYISPTITTKQMF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D+YQ+ VGVDLWSSH+E+MQE LKKL++VNR LR+EIRQR G+ LNDL +EQ+ +LIED+
Sbjct  61   DKYQEAVGVDLWSSHYERMQEHLKKLKEVNRNLRKEIRQRTGDCLNDLGYEQIVDLIEDM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            + S+KLIRE+KYKVIGNQI+T KKK+RNVEEIHR+L+LE +ARQEDP YGLV++EGDYNS
Sbjct  121  NTSVKLIREKKYKVIGNQIDTSKKKLRNVEEIHRSLVLEFDARQEDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRLQP  725
            VLGF +GG RI+AL L P
Sbjct  181  VLGFPHGGPRIIALHLPP  198



>gb|AAS45988.1| deficiens [Salvia coccinea]
Length=242

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 184/204 (90%), Gaps = 1/204 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISIIMISSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            + TTKQ+ D+YQKTV  D+WSSH+EKMQE LKKL+++NR L  EIRQR GESLNDL +EQ
Sbjct  61   TITTKQIVDEYQKTVRTDIWSSHYEKMQEHLKKLKEINRNLMMEIRQRRGESLNDLGYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  LIED+DNS+K+IRE+KYKVI ++I+T +KK+RNVEEIHR L+L+ +ARQEDP YGLV
Sbjct  121  MVNLIEDMDNSMKVIREKKYKVISSRIDTSRKKLRNVEEIHRGLVLQFDARQEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRL  719
            ++EGDYNS+LGF +GG RI+A+RL
Sbjct  181  ENEGDYNSMLGFPHGGPRIIAVRL  204



>ref|XP_007017681.1| Floral homeotic protein DEFICIENS isoform 1 [Theobroma cacao]
 gb|EOY14906.1| Floral homeotic protein DEFICIENS isoform 1 [Theobroma cacao]
Length=225

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK IEN TNRQVTYSKRRNGLFKKA+ELTVLCDA+ SI+M S++GKLHE+ISP
Sbjct  1    MARGKIQIKLIENATNRQVTYSKRRNGLFKKANELTVLCDARASIIMFSSTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            ST+TKQ++DQYQK +GVDLW++H+EKMQEQLKKL++VNR LR+EIRQRMG+ LND+SFE 
Sbjct  61   STSTKQIYDQYQKVLGVDLWTTHYEKMQEQLKKLKEVNRNLRKEIRQRMGDCLNDVSFED  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  650
            L  L ++++ S+KLIR+RKY+VI NQI+T +KKVRNVEEIHRNLL E +A +EDPYGLVD
Sbjct  121  LQALEQEMETSVKLIRDRKYRVISNQIDTSRKKVRNVEEIHRNLLHELDAIKEDPYGLVD  180

Query  651  HEGDYNSVLGFANGGHRILALRLQP  725
            +  DY++++G+ NGG RI ALRLQP
Sbjct  181  NGVDYDTIIGYQNGGPRIFALRLQP  205



>gb|AAS45980.1| deficiens, partial [Chelone glabra]
Length=219

 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/223 (76%), Positives = 192/223 (86%), Gaps = 4/223 (2%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKA+EL+VLCDAKVSI+MIS++ KLHEYISP+TTTKQL 
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKANELSVLCDAKVSIIMISSTQKLHEYISPTTTTKQLL  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVD+W+SH+EKMQE LKKL+DVNR LRREIRQRMGESLNDL +E+L  LIEDV
Sbjct  61   DQYQKAVGVDIWNSHYEKMQEHLKKLKDVNRNLRREIRQRMGESLNDLGYEELVNLIEDV  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVDHEGDYNSV  674
            D+S+ LIRERKYKVIGNQIET KKKVRNVEEIHR+L+LE +A     YGL+++EGDYNS+
Sbjct  121  DSSLSLIRERKYKVIGNQIETSKKKVRNVEEIHRSLVLEFDATH---YGLIENEGDYNSI  177

Query  675  LGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            LGF N G RI+ALRL P H   HH      GGGSDLTTF LL+
Sbjct  178  LGFPNRGQRIIALRL-PTHPDDHHPSLHSGGGGSDLTTFALLD  219



>gb|AAS45968.1| deficiens, partial [Leucocarpus perfoliatus]
Length=228

 Score =   317 bits (812),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 178/196 (91%), Gaps = 1/196 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSIVMIS++ KLHEYISP  TTKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIVMISSTQKLHEYISPIITTKQVF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW+SH++KMQE L+KL++VNR LR EIRQRMGESLNDL + Q+  LIEDV
Sbjct  61   DQYQKAVGVDLWNSHYQKMQEHLQKLKEVNRNLRMEIRQRMGESLNDLGYHQMVNLIEDV  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DNS+ LIRE+KYKVIGN+IET KKK+RNVEEIHR+L+LE +ARQEDP +GLV++EGDYNS
Sbjct  121  DNSLALIREKKYKVIGNRIETSKKKLRNVEEIHRSLVLEFDARQEDPHFGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRL  719
            VLGF +GG RI+AL L
Sbjct  181  VLGFPHGGPRIIALHL  196



>gb|AAS45970.1| deficiens [Mazus reptans]
Length=237

 Score =   317 bits (813),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 179/205 (87%), Gaps = 2/205 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQ+FDQYQK   VD+W  H+EKMQE LKKL++VNR LRREI QR+GES+ DLS++Q
Sbjct  61   SITTKQMFDQYQKIAQVDVWQPHYEKMQEHLKKLKEVNRNLRREIMQRVGESVTDLSYDQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  LI D+DN++K+IRE+KYK I  QI+T KKKVRNVEEIHR L+LE EAR EDP YGLV
Sbjct  121  IVNLIADIDNALKVIREKKYKTISGQIDTTKKKVRNVEEIHRGLVLEYEARHEDPHYGLV  180

Query  648  DHEGD-YNSVLGFANGGHRILALRL  719
            ++EGD YNSVLGF +GG RI+AL L
Sbjct  181  ENEGDPYNSVLGFPSGGPRIVALHL  205



>gb|AEM60191.1| MADS box transcription factor, partial [Forsythia x intermedia]
Length=210

 Score =   316 bits (809),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 178/196 (91%), Gaps = 1/196 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLC AKVSI+MIS++ K+HEYISP+TTTK LF
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCGAKVSIIMISSTQKIHEYISPTTTTKHLF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW S++EKMQ+ L+KL+D+N+ LR EIRQRMGESLNDL+++Q+  L+EDV
Sbjct  61   DQYQKAVGVDLWISNYEKMQDHLRKLKDINKNLRMEIRQRMGESLNDLNYDQIVNLVEDV  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            D+S++ IRE+KYKVI NQIET KKK+RNVEEIHR +L+E +ARQEDP YGLVD+EGDYNS
Sbjct  121  DDSLRKIREKKYKVISNQIETSKKKLRNVEEIHRKILVEFDARQEDPHYGLVDNEGDYNS  180

Query  672  VLGFANGGHRILALRL  719
            VLGF NGG RI+ALR+
Sbjct  181  VLGFPNGGPRIIALRM  196



>gb|AEM60166.1| MADS box transcription factor, partial [Justicia brandegeana]
Length=226

 Score =   316 bits (810),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 178/199 (89%), Gaps = 2/199 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYI+PS  TKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYITPSIATKQMF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D YQKT G+DLW +H+++M+E +KK++++NR LR EIRQRMGESLNDL +E++  LIE++
Sbjct  61   DHYQKTTGIDLWQTHYQRMEEHMKKMKEINRNLRMEIRQRMGESLNDLGYEEMVNLIEEI  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DNS++LIRERKYKVIGNQI+T KKKVRNVEEIHRNLLLE  AR EDP YGLV++EGDYNS
Sbjct  121  DNSLRLIRERKYKVIGNQIDTSKKKVRNVEEIHRNLLLEFGARHEDPHYGLVENEGDYNS  180

Query  672  VLGFANG-GHRILALRLQP  725
            +LGF NG G RI+ALR+ P
Sbjct  181  MLGFPNGVGPRIVALRIPP  199



>gb|AEM60194.1| MADS box transcription factor, partial [Polypremum procumbens]
Length=213

 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 178/200 (89%), Gaps = 4/200 (2%)
 Frame = +3

Query  138  RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFD  317
            RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVS++MIS++ KLHEYISPSTTTKQL D
Sbjct  1    RIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSVIMISSTHKLHEYISPSTTTKQLID  60

Query  318  QYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVD  497
            QYQKTV VDLW+SH+E MQE L+KL +VN+ LRREIRQRMGESLND+ ++++ +LI DVD
Sbjct  61   QYQKTVNVDLWNSHYENMQENLRKLMEVNKNLRREIRQRMGESLNDVGYDEIVKLIGDVD  120

Query  498  NSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDH---EGDY  665
            +S+KLIRERKYKVIGNQIET KKK+RNV+EI+RNLLL  +ARQEDP YGLVD    EG Y
Sbjct  121  DSLKLIRERKYKVIGNQIETGKKKLRNVDEIYRNLLLGFDARQEDPHYGLVDDEGIEGHY  180

Query  666  NSVLGFANGGHRILALRLQP  725
            NSVLGF NGG RI+ALRL P
Sbjct  181  NSVLGFPNGGPRIIALRLPP  200



>gb|AEM60185.1| MADS box transcription factor, partial [Digitalis purpurea]
Length=207

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 176/199 (88%), Gaps = 5/199 (3%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            +RIENQTNRQVTYSKRRNGL KKAHELTVLCDAKVSI+MIS++ KLHEYISPSTTTKQ+F
Sbjct  1    RRIENQTNRQVTYSKRRNGLLKKAHELTVLCDAKVSIIMISSTQKLHEYISPSTTTKQVF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLWSSH+EKMQE LKKL +VNR LRREIRQRMGESLNDL +EQ+  L+ED+
Sbjct  61   DQYQKAVGVDLWSSHYEKMQEHLKKLNEVNRNLRREIRQRMGESLNDLGYEQMVNLVEDM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHE-GDYN  668
            DNS+K+IRERKYKV+ NQI+T KKKVRNVEEIHRNL+LE E    DP YGLV++E GDYN
Sbjct  121  DNSLKIIRERKYKVLSNQIDTGKKKVRNVEEIHRNLVLEFEG---DPHYGLVENEAGDYN  177

Query  669  SVLGFANGGHRILALRLQP  725
            SVLGF +GG  I+ LRL P
Sbjct  178  SVLGFPHGGPSIITLRLPP  196



>gb|ACY08914.1| MADS-domain transcription factor, partial [Halesia diptera]
Length=211

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 175/192 (91%), Gaps = 1/192 (1%)
 Frame = +3

Query  153  TNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKT  332
            TNRQVTYSKR NGLFKKA+ELTVLCDAKVSI+M ST+GKLHEYISP+ TTKQ++DQYQK 
Sbjct  3    TNRQVTYSKRSNGLFKKANELTVLCDAKVSIIMFSTTGKLHEYISPAATTKQMYDQYQKA  62

Query  333  VGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKL  512
            + VDLWSSH+E+MQE LKKL++VNR LRREIRQRMGESL DLSFE+L  L +D+++S+K+
Sbjct  63   LEVDLWSSHYERMQEHLKKLKEVNRNLRREIRQRMGESLTDLSFEELRGLEQDIEDSLKV  122

Query  513  IRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFAN  689
            IRERKYKVI NQIET KKK+RNVEEIHRNLLLE +AR++DP YGLVD  GDY+SVLGF+N
Sbjct  123  IRERKYKVISNQIETSKKKLRNVEEIHRNLLLEFDAREDDPHYGLVDDGGDYDSVLGFSN  182

Query  690  GGHRILALRLQP  725
            GGHRILALRLQP
Sbjct  183  GGHRILALRLQP  194



>gb|AEJ76847.1| MADS24 [Gossypium hirsutum]
 gb|AGW23355.1| MADS box protein MADS53 [Gossypium hirsutum]
Length=225

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK IEN TNRQVTYSKRRNGLFKKA+ELTVLCDA+VSI+M ST+GKLHE+ISP
Sbjct  1    MARGKIQIKLIENSTNRQVTYSKRRNGLFKKANELTVLCDARVSIIMFSTTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQ+ DQYQKT+G+D+W++H+EKMQEQLK+L++VNR LR+EIR+RMG+ LNDLS E 
Sbjct  61   STTTKQVIDQYQKTLGIDIWNTHYEKMQEQLKQLKEVNRNLRKEIRRRMGDCLNDLSIED  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  650
            L  L +++++S+ LIR+RKY+V+ NQI+T +KKVRNVEEIH+NLL E E+ +EDPYGLVD
Sbjct  121  LGALEQEMESSVTLIRDRKYRVLSNQIDTSRKKVRNVEEIHKNLLHELESLKEDPYGLVD  180

Query  651  HEGDYNSVLGFANGGHRILALRLQP  725
            + GDY++++G+ NGG RI ALRLQP
Sbjct  181  NGGDYDTLIGYQNGGPRIFALRLQP  205



>gb|AAS45983.1| deficiens, partial [Paulownia tomentosa]
Length=214

 Score =   314 bits (805),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 171/186 (92%), Gaps = 1/186 (1%)
 Frame = +3

Query  171  YSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLW  350
            YSKRRNGLFK AHELTVLCDAKVSI+MIS++ KLHEYISP+T TKQ+FDQYQK VGVDLW
Sbjct  1    YSKRRNGLFKTAHELTVLCDAKVSIIMISSTQKLHEYISPTTMTKQVFDQYQKAVGVDLW  60

Query  351  SSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKY  530
            SSH+EKMQE L+KL++VNR LRREIRQRMGESLNDL ++Q+  LIED+D+S++LIRERKY
Sbjct  61   SSHYEKMQEHLQKLKEVNRNLRREIRQRMGESLNDLGYDQMVNLIEDMDSSLRLIRERKY  120

Query  531  KVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHRIL  707
            KVIGNQIET KKK+RNVEEIHRNL+LE +ARQEDP YGLV++EGDYNSVLGF NGG RI+
Sbjct  121  KVIGNQIETSKKKLRNVEEIHRNLVLEIDARQEDPHYGLVENEGDYNSVLGFPNGGPRII  180

Query  708  ALRLQP  725
            ALRL P
Sbjct  181  ALRLPP  186



>gb|AEM60176.1| MADS box transcription factor, partial [Lantana camara]
Length=225

 Score =   314 bits (805),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 178/197 (90%), Gaps = 3/197 (2%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISPST TKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPSTATKQIF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW +H+EKMQE LKKL++VN+ LRREIRQRMGESLN+L ++Q+  LI D+
Sbjct  61   DQYQKAVGVDLWHTHYEKMQEHLKKLKEVNKNLRREIRQRMGESLNNLGYDQMVNLIYDM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDY-N  668
            DNS +LIRERKYKVIGNQIET KKKVRNVEEIHRNL+LE +ARQEDP YGLV++EGDY +
Sbjct  121  DNSQRLIRERKYKVIGNQIETSKKKVRNVEEIHRNLVLEFDARQEDPHYGLVENEGDYTH  180

Query  669  SVLGFAN-GGHRILALR  716
             VLG+ N GG RI+ALR
Sbjct  181  PVLGYPNGGGPRIVALR  197



>gb|KHG05937.1| Floral homeotic DEFICIENS [Gossypium arboreum]
Length=225

 Score =   314 bits (804),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK IEN TNRQVTYSKRRNGLFKKA+ELTVLCDA+VSI+M ST+GKLHE+ISP
Sbjct  1    MARGKIQIKLIENSTNRQVTYSKRRNGLFKKANELTVLCDARVSIIMFSTTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQ+ DQYQK++G+D+W++H+EKMQEQLK+L++VNR LR+EIR+RMG+ LNDLS E 
Sbjct  61   STTTKQVIDQYQKSLGIDIWNTHYEKMQEQLKQLKEVNRNLRKEIRRRMGDCLNDLSIED  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  650
            L  L +++++S+ LIR+RKY+V+ NQI+T +KKVRNVEEIH+NLL E E+ +EDPYGLVD
Sbjct  121  LGALEQEMESSVTLIRDRKYRVLSNQIDTSRKKVRNVEEIHKNLLHELESLKEDPYGLVD  180

Query  651  HEGDYNSVLGFANGGHRILALRLQP  725
            + GDY++++G+ NGG RI ALRLQP
Sbjct  181  NGGDYDTLIGYQNGGPRIFALRLQP  205



>gb|AAS45966.1| deficiens [Mazus reptans]
Length=252

 Score =   315 bits (806),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 184/209 (88%), Gaps = 4/209 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHEL+VLCDAKVSI+MIS + KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIIMISGTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S +TKQ+ D YQK VG D+WSSH+EKMQE L+KL++VN  LR+EIRQRMGE LNDLS+EQ
Sbjct  61   SISTKQVLDLYQKAVGADVWSSHYEKMQEHLRKLKEVNSNLRKEIRQRMGECLNDLSYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQ--EDP-YG  641
            +  LI+D+D+S++LIRE+KYKVIG++IET KKK+RNVEEIH NL+LE +ARQ  EDP YG
Sbjct  121  MVNLIQDIDSSLELIREKKYKVIGSRIETSKKKLRNVEEIHSNLVLEFDARQEVEDPHYG  180

Query  642  LVDH-EGDYNSVLGFANGGHRILALRLQP  725
            LV++ E  YNSVLGF +GG RI+A+RL P
Sbjct  181  LVENGEDPYNSVLGFPHGGPRIMAVRLPP  209



>gb|AEM60178.1| MADS box transcription factor, partial [Utricularia sp. VFI-2011]
Length=215

 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 174/196 (89%), Gaps = 2/196 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVM+S++ KLHEYISPSTTTKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMVSSTQKLHEYISPSTTTKQVF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW++H+EK QE LKKL++VNR LR+EIRQRMGE LNDL +EQ+ +LIE++
Sbjct  61   DQYQKAVGVDLWNTHYEKTQEHLKKLKEVNRNLRKEIRQRMGECLNDLGYEQMVDLIENM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECE-ARQEDP-YGLVDHEGDYN  668
            D SI LIRERKYKVIGNQIET KKKVRN EE+HR  LLE + ARQEDP YGLV++E D+N
Sbjct  121  DKSISLIRERKYKVIGNQIETSKKKVRNAEEVHRKNLLEFDAARQEDPHYGLVENEADFN  180

Query  669  SVLGFANGGHRILALR  716
            SVLGF  GG RI+ LR
Sbjct  181  SVLGFPGGGPRIITLR  196



>ref|NP_001267960.1| flowering-related B-class MADS-box protein APETALA3 [Vitis vinifera]
 gb|ABN71371.1| flowering-related B-class MADS-box protein APETALA3 [Vitis vinifera]
 gb|ACZ26526.1| apetala3 [Vitis vinifera]
Length=226

 Score =   312 bits (799),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVSI+M+S++GKLHEYISP
Sbjct  1    MARGKIEIKRIENSTNRQVTYSKRRNGIFKKASELTVLCDAKVSIIMLSSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQ+FDQYQ T+GVDLWS H+E+MQE LKKL+DVN+ LR+EIRQRMGE L+DLS E+
Sbjct  61   STTTKQIFDQYQNTLGVDLWSYHYERMQENLKKLKDVNKNLRKEIRQRMGEHLSDLSVEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L +L +++++S+K++R+RKY+VI NQIET KKKVRNVE+IH+NLL E +AR  D  YGLV
Sbjct  121  LRDLEQEMESSLKMVRDRKYQVINNQIETFKKKVRNVEQIHKNLLHEFDARDRDQYYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ GDY SVLGF+NG   + AL LQP
Sbjct  181  DNGGDYESVLGFSNGSSPVFALSLQP  206



>gb|AEM60189.1| MADS box transcription factor, partial [Allamanda cathartica]
Length=209

 Score =   311 bits (797),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 177/198 (89%), Gaps = 1/198 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+M+ST+ KLHE+ISP+TTTKQL 
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMLSTTHKLHEFISPTTTTKQLM  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK +GVDLWSSH+EKMQEQLKKL+DVNR LRREIRQR+GESLND+S+++L +L +++
Sbjct  61   DQYQKALGVDLWSSHYEKMQEQLKKLKDVNRNLRREIRQRLGESLNDMSYDELRKLTDEI  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            D S+K IRERK K I NQIET KKKV++  +IHRNLLLE +ARQEDP YGLV++ GDY+S
Sbjct  121  DESLKSIRERKIKAISNQIETLKKKVKSANDIHRNLLLELDARQEDPHYGLVENAGDYHS  180

Query  672  VLGFANGGHRILALRLQP  725
            ++G  NGGH +LAL LQP
Sbjct  181  LIGLPNGGHHVLALCLQP  198



>gb|ABN46893.1| AP3-like MADS-box protein [Vitis labrusca x Vitis vinifera]
 emb|CBI19790.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   312 bits (799),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVSI+M+S++GKLHEYISP
Sbjct  1    MARGKIEIKRIENSTNRQVTYSKRRNGIFKKASELTVLCDAKVSIIMLSSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQ+FDQYQ T+GVDLWS H+E+MQE LKKL+DVN+ LR+EIRQRMGE L+DLS E+
Sbjct  61   STTTKQIFDQYQNTLGVDLWSYHYERMQENLKKLKDVNKNLRKEIRQRMGEHLSDLSVEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L +L +++++S+K++R+RKY+VI NQIET KKKVRNVE+IH+NLL E +AR  D  YGLV
Sbjct  121  LRDLEQEMESSLKMVRDRKYQVINNQIETFKKKVRNVEQIHKNLLHEFDARDRDQHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ GDY SVLGF+NG   + AL LQP
Sbjct  181  DNGGDYESVLGFSNGSSPVFALSLQP  206



>gb|AEX10627.1| DEFICIENS, partial [Lophospermum atrosanguineum]
Length=205

 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = +3

Query  177  KRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSS  356
            KRRNGLFKKAHEL+VLCDAKVSI+MIS++ KLHEYISP+T TKQLFDQYQK VGVDLWSS
Sbjct  1    KRRNGLFKKAHELSVLCDAKVSIIMISSTQKLHEYISPTTATKQLFDQYQKAVGVDLWSS  60

Query  357  HFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKV  536
            H+EKMQE LKKL ++NR LRREIRQRMGESLNDL +EQ+  LIED+DNS+KLIRERKYKV
Sbjct  61   HYEKMQEHLKKLNEINRNLRREIRQRMGESLNDLGYEQIVNLIEDMDNSLKLIRERKYKV  120

Query  537  IGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHRILAL  713
            IGNQI+T KKKVRNVEEIHRNL+LE EAR+EDP +GLV++EGDYNSVLGF NGG RI+AL
Sbjct  121  IGNQIDTSKKKVRNVEEIHRNLVLEFEARREDPHFGLVENEGDYNSVLGFPNGGPRIIAL  180

Query  714  RL  719
            RL
Sbjct  181  RL  182



>gb|AEG19541.1| apetala3-like protein [Vitis labrusca x Vitis vinifera]
Length=226

 Score =   310 bits (795),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVSI+M+S++GKLHEYISP
Sbjct  1    MARGKIEIKRIENSTNRQVTYSKRRNGIFKKASELTVLCDAKVSIIMLSSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQ+FDQYQ T+GVDLWS H+E+MQE LKKL+DVN+ LR+EIRQRMGE L+DLS E+
Sbjct  61   SATTKQIFDQYQNTLGVDLWSYHYERMQENLKKLKDVNKNLRKEIRQRMGEHLSDLSVEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L +L +++++S+K++R+RKY+VI NQIET KKKVRNVE+IH+NLL E +AR  D  YGLV
Sbjct  121  LRDLEQEMESSLKMVRDRKYQVINNQIETFKKKVRNVEQIHKNLLHEFDARDRDQYYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ GDY SVLGF+NG   + AL LQP
Sbjct  181  DNGGDYESVLGFSNGSSPVFALSLQP  206



>gb|AAC42583.1| APETALA3 homolog LeAP3 [Solanum lycopersicum]
Length=203

 Score =   308 bits (788),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 171/181 (94%), Gaps = 1/181 (1%)
 Frame = +3

Query  186  NGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSSHFE  365
            NGLFKKA+ELTVLCDAKVSIVMIS++GKLHE+ISPS TTKQLFD YQKT+GVD+W++H+E
Sbjct  1    NGLFKKANELTVLCDAKVSIVMISSTGKLHEFISPSITTKQLFDLYQKTIGVDIWTTHYE  60

Query  366  KMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  545
            KMQEQL+KL+DVNR LR+EIRQRMGESLNDL++EQL EL+E+VDNS+KLIRERK+KVIGN
Sbjct  61   KMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQLEELMENVDNSLKLIRERKFKVIGN  120

Query  546  QIETHKKKVRNVEEIHRNLLLECEARQEDPY-GLVDHEGDYNSVLGFANGGHRILALRLQ  722
            QIET++KKVRNVEEI+RNLLLE +ARQEDPY GLV+H+GDYNSVLGF  GG RIL LRLQ
Sbjct  121  QIETYRKKVRNVEEINRNLLLEFDARQEDPYGGLVEHDGDYNSVLGFPTGGPRILDLRLQ  180

Query  723  P  725
            P
Sbjct  181  P  181



>gb|AEM60161.1| MADS box transcription factor, partial [Salvia greggii]
Length=226

 Score =   308 bits (789),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 177/198 (89%), Gaps = 1/198 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SI+MIS++ KLHEYISP+ TTKQ+ 
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISIIMISSTQKLHEYISPTITTKQIV  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D+YQKTV  D+WSSH+EKMQE LKKL+++NR L  EIRQR GESLNDL +EQ+  LIED+
Sbjct  61   DEYQKTVRTDIWSSHYEKMQEHLKKLKEINRNLMMEIRQRRGESLNDLGYEQMVNLIEDM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DNS+K+IRE+KYKVI ++I+T +KK+RNVEEIHR L+L+ +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSMKVIREKKYKVISSRIDTSRKKLRNVEEIHRGLVLQFDARQEDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRLQP  725
            +LGF +GG RI+A+RL P
Sbjct  181  MLGFPHGGPRIIAVRLSP  198



>gb|AEM60177.1| MADS box transcription factor, partial [Torenia fournieri]
Length=226

 Score =   307 bits (786),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISPSTTTKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPSTTTKQVF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW + ++KMQE LKKL++VNR L+REIRQRMGE LND+S+E +  LIED+
Sbjct  61   DQYQKAVGVDLWQTSYQKMQEHLKKLKEVNRNLKREIRQRMGECLNDMSYEHMVNLIEDI  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEG-DYN  668
            DNS+++IRERKYKVI +QIET KKK+RNVEEIH+ L+ E +AR EDP YGLV++E  DY+
Sbjct  121  DNSLRVIRERKYKVITSQIETGKKKLRNVEEIHKKLVFEYDARHEDPHYGLVENEAVDYH  180

Query  669  SVLGFANGGHRILALRLQP  725
            SVLGF N G R +ALR  P
Sbjct  181  SVLGFPNNGSRTIALRYVP  199



>gb|AEM60181.1| MADS box transcription factor, partial [Torenia fournieri]
Length=216

 Score =   306 bits (785),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISPSTTTKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPSTTTKQVF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW + ++KMQE LKKL++VNR L+REIRQRMGE LND+S+E +  LIED+
Sbjct  61   DQYQKAVGVDLWQTSYQKMQEHLKKLKEVNRNLKREIRQRMGECLNDMSYEHMVNLIEDI  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEG-DYN  668
            DNS+++IRERKYKVI +QIET KKK+RNVEEIH+ L+ E +AR EDP YGLV++E  DY+
Sbjct  121  DNSLRVIRERKYKVITSQIETGKKKLRNVEEIHKKLVFEYDARHEDPHYGLVENEAVDYH  180

Query  669  SVLGFANGGHRILALRLQP  725
            SVLGF N G R +ALR  P
Sbjct  181  SVLGFPNNGSRTIALRYVP  199



>gb|AEM60163.1| MADS box transcription factor, partial [Salvia greggii]
Length=226

 Score =   306 bits (783),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 177/196 (90%), Gaps = 1/196 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SI+MIS++ KLHEYISP+ TTKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISIIMISSTQKLHEYISPTITTKQIF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D+YQKTV  DLWSSH+EKMQE LKKL+++NR L +EIRQR GESLNDL ++Q   LIED+
Sbjct  61   DEYQKTVRADLWSSHYEKMQEHLKKLKEINRNLIKEIRQRTGESLNDLGYDQTVNLIEDI  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DNS+K+IRE+KYKVI ++I+T +KK+RNVEEIHR L+L+ +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSMKVIREKKYKVISSRIDTSRKKLRNVEEIHRGLVLQFDARQEDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRL  719
            +LGF +GG RI+A+RL
Sbjct  181  MLGFPHGGPRIIAVRL  196



>gb|ACY08901.1| MADS-domain transcription factor, partial [Napoleonaea vogelii]
Length=207

 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 188/216 (87%), Gaps = 11/216 (5%)
 Frame = +3

Query  162  QVTYSKRR-NGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVG  338
            QVTYSKRR NGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISPST+TKQLFDQYQ  +G
Sbjct  1    QVTYSKRRRNGLFKKAHELTVLCDAKVSIIMISSTNKLHEYISPSTSTKQLFDQYQNALG  60

Query  339  VDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIR  518
            VDLWSSH+EKMQE LKKL++VNR+LRREIRQRMGESLNDLSF++L  L +DVD S+K+IR
Sbjct  61   VDLWSSHYEKMQEHLKKLKEVNRSLRREIRQRMGESLNDLSFDELLGLEQDVDTSLKMIR  120

Query  519  ERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGG  695
            ERKYKVIGNQI+THKKK+RN +EI+R+L+LE +AR EDP YGLVD+ GDYNSVLGF+N G
Sbjct  121  ERKYKVIGNQIDTHKKKMRNAQEINRSLILEFDARGEDPHYGLVDNGGDYNSVLGFSNRG  180

Query  696  HRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
              +LAL LQP          LHSGGGSDLTT+TLLE
Sbjct  181  PHLLALHLQP---------TLHSGGGSDLTTYTLLE  207



>gb|AEM60162.1| MADS box transcription factor, partial [Salvia coccinea]
Length=225

 Score =   304 bits (778),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 176/196 (90%), Gaps = 1/196 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SI+MIS++ KLHEYISP+ TTKQ+ 
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISIIMISSTQKLHEYISPTITTKQIV  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D+YQKTV  D+WSSH+EKMQE LKKL++VNR L  EIRQR GESLNDL +EQ+  LIED+
Sbjct  61   DEYQKTVRTDIWSSHYEKMQEHLKKLKEVNRNLMMEIRQRRGESLNDLGYEQMVNLIEDM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            DNS+K+IRE+KYKVI ++I+T +KK+RNVEEIHR L+L+ +ARQEDP YGLV++EGDYNS
Sbjct  121  DNSMKVIREKKYKVISSRIDTSRKKLRNVEEIHRGLVLQFDARQEDPHYGLVENEGDYNS  180

Query  672  VLGFANGGHRILALRL  719
            +LGF +GG RI+A+RL
Sbjct  181  MLGFPHGGPRIIAVRL  196



>gb|ACY08903.1| MADS-domain transcription factor, partial [Diospyros digyna]
Length=223

 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 175/192 (91%), Gaps = 1/192 (1%)
 Frame = +3

Query  153  TNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKT  332
            TNRQVTYSKRRNGLFKKA+ELTVLCDA+VSI+M+S++GK+HEYI+P+TTTKQLFDQYQKT
Sbjct  3    TNRQVTYSKRRNGLFKKANELTVLCDARVSIIMVSSTGKIHEYINPTTTTKQLFDQYQKT  62

Query  333  VGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKL  512
            + +DLWSSH+E+MQE LKKL+DVNR LRR+IRQRMGESLNDL+F ++  L ED+++S+K+
Sbjct  63   LNIDLWSSHYERMQENLKKLKDVNRNLRRQIRQRMGESLNDLNFNEMHGLEEDIESSLKV  122

Query  513  IRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFAN  689
            IRERKYKVIGNQIET+KKK+RNVEEI+RNL+ E  AR+EDP YGLVD+  DY  VLGF N
Sbjct  123  IRERKYKVIGNQIETYKKKMRNVEEINRNLMHEFGAREEDPHYGLVDNGVDYEHVLGFLN  182

Query  690  GGHRILALRLQP  725
            GG R+LALRLQP
Sbjct  183  GGPRMLALRLQP  194



>gb|AAS45987.1| deficiens [Salvia coccinea]
Length=231

 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 174/202 (86%), Gaps = 1/202 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISIIMISSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            + TTKQ+ D+YQKTV  DLWS H+EKMQE LKKL+++N  LR++IRQR GESLNDL +EQ
Sbjct  61   TITTKQIVDEYQKTVRTDLWSFHYEKMQEHLKKLKEMNMNLRKDIRQRSGESLNDLGYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  LIED+D S+  IRERKYK +GNQI+  KKK+RNVE+IH++LL    AR +DP YGLV
Sbjct  121  VVSLIEDIDKSLAFIRERKYKALGNQIDNTKKKLRNVEDIHKSLLFGFNARHDDPQYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILAL  713
            ++EG YNS+LGF +GG RI+AL
Sbjct  181  ENEGHYNSMLGFRHGGPRIIAL  202



>gb|AEM60173.1| MADS box transcription factor, partial [Buddleja davidii]
Length=193

 Score =   300 bits (768),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 167/182 (92%), Gaps = 2/182 (1%)
 Frame = +3

Query  186  NGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSSHFE  365
            NGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP+ TTKQ+FDQYQK VGVDLWSSH+E
Sbjct  1    NGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISPTVTTKQMFDQYQKAVGVDLWSSHYE  60

Query  366  KMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  545
            KMQE LKKL++VNR LRREIRQRMGESLNDL ++Q+  LIEDVD+S++LIR+RKYKVIGN
Sbjct  61   KMQEHLKKLKEVNRNLRREIRQRMGESLNDLGYDQMVNLIEDVDSSLRLIRDRKYKVIGN  120

Query  546  QIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSV-LGFANGGHRILALRL  719
            QI+T KKK+RNVEEIHRNL+LE +ARQEDP YGLV++EGDYNSV LGF NGG RI+ALRL
Sbjct  121  QIDTTKKKLRNVEEIHRNLVLEFDARQEDPHYGLVENEGDYNSVNLGFPNGGSRIIALRL  180

Query  720  QP  725
             P
Sbjct  181  PP  182



>ref|XP_006581063.1| PREDICTED: MADS-box protein GmNMH7 isoform X1 [Glycine max]
 gb|KHN22206.1| Floral homeotic protein DEFICIENS [Glycine soja]
Length=227

 Score =   299 bits (766),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            ST+TKQ FDQYQ T+GVDLW+SH+E MQE LKKL+DVNR LR+EIRQRMG+ LNDL  E 
Sbjct  61   STSTKQFFDQYQMTLGVDLWNSHYENMQENLKKLKDVNRNLRKEIRQRMGDCLNDLGMED  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E++D + K++RERKYKVI NQI+T +KK  N +E+H  LL + +AR EDP + L+
Sbjct  121  LKLLEEEMDKAAKVVRERKYKVITNQIDTQRKKFNNEKEVHNRLLRDLDARAEDPRFALI  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ G+Y SV+GF+N G R+ AL LQP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSLQP  206



>gb|AAS45991.1| deficiens [Erythranthe lewisii]
Length=218

 Score =   298 bits (763),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 167/232 (72%), Positives = 195/232 (84%), Gaps = 15/232 (6%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++         
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSILMISST---------  51

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
                 Q+FDQYQK VGVD+W+SH+EKMQE LKKL+DVNR LRREIRQR+GE LNDL + Q
Sbjct  52   -----QMFDQYQKAVGVDIWNSHYEKMQEHLKKLKDVNRNLRREIRQRVGECLNDLGYHQ  106

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            +  L +D+DNS+++IRE+KYK I NQI+  KKK+RNVEEI+RNL LE +ARQEDP YGLV
Sbjct  107  MVNLSDDIDNSLRIIREKKYKAISNQIDNSKKKLRNVEEINRNLALEFDARQEDPHYGLV  166

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            +++GDYN++LGF NGG RI+ALRL  +HH HHHH HLHSGGGSDLTTF LLE
Sbjct  167  ENDGDYNALLGFPNGGPRIVALRLPHNHHPHHHHHHLHSGGGSDLTTFALLE  218



>ref|NP_001236857.1| MADS-box protein GmNMH7 [Glycine max]
 gb|AAQ81636.1| MADS-box protein GmNMH7 [Glycine max]
Length=252

 Score =   299 bits (766),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            ST+TKQ FDQYQ T+GVDLW+SH+E MQE LKKL+DVNR LR+EIRQRMG+ LNDL  E 
Sbjct  61   STSTKQFFDQYQMTLGVDLWNSHYENMQENLKKLKDVNRNLRKEIRQRMGDCLNDLGMED  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E++D + K++RERKYKVI NQI+T +KK  N +E+H  LL + +AR EDP + L+
Sbjct  121  LKLLEEEMDKAAKVVRERKYKVITNQIDTQRKKFNNEKEVHNRLLRDLDARAEDPRFALI  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ G+Y SV+GF+N G R+ AL LQP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSLQP  206



>gb|ACU13442.1| unknown [Glycine max]
Length=227

 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            ST+TKQ FDQYQ T+GVDLW+SH+E MQE LKKL+DVNR LR+EIRQRMG+ LNDL  E 
Sbjct  61   STSTKQFFDQYQMTLGVDLWNSHYENMQENLKKLKDVNRNLRKEIRQRMGDCLNDLGMED  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E++D + K++RERKYKVI NQI+T +KK  N +E+H  LL + + R EDP + L+
Sbjct  121  LKLLEEEMDKAAKVVRERKYKVITNQIDTQRKKFNNEKEVHNRLLRDLDVRAEDPRFALI  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ G+Y SV+GF+N G R+ AL LQP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSLQP  206



>ref|XP_003603721.1| Apetala3-like protein [Medicago truncatula]
 gb|AES73972.1| MADS-box transcription factor [Medicago truncatula]
 gb|AEW43601.1| MADS-box transcription factor NMH7 [Medicago truncatula]
Length=229

 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S +TKQ FDQYQ TVG+DLW+SH+E MQE LKKL+DVNR LR+EIRQRMGE LNDLS E+
Sbjct  61   SASTKQFFDQYQMTVGIDLWNSHYENMQENLKKLKDVNRNLRKEIRQRMGECLNDLSMEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L +++D + K IRERKYKVI NQI+T +KK  N  E+H  LL + +AR EDP + ++
Sbjct  121  LRLLEDEMDKAAKAIRERKYKVITNQIDTQRKKFNNEREVHNRLLRDLDARAEDPRFEMM  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ G+Y SV+GF+N G R+ AL LQP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSLQP  206



>gb|AAX13301.1| MADS box protein AP3 [Lotus japonicus]
Length=229

 Score =   296 bits (757),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 173/206 (84%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            ST+TKQ FDQYQ TVGVDLWSSH+E MQE LKKL++VNR LR+EIRQR+G+ LNDLS ++
Sbjct  61   STSTKQFFDQYQMTVGVDLWSSHYENMQENLKKLKEVNRNLRKEIRQRVGDCLNDLSMDE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQED-PYGLV  647
            L  L +++DN+ K +RERKYKVI NQI+T +KK  N  E+H  LL + +AR E+ PY L+
Sbjct  121  LRLLEQEMDNAAKAVRERKYKVITNQIDTQRKKFNNEREVHNRLLRDLDARAENPPYELM  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ G+Y SV+GF+N G R+ AL LQP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSLQP  206



>gb|KDP38582.1| hypothetical protein JCGZ_04507 [Jatropha curcas]
Length=221

 Score =   295 bits (756),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 172/207 (83%), Gaps = 8/207 (4%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQLFD+YQKT+G+DLWS+ +  MQE LKKL+DVNR L  EIRQRMGE LND SFE 
Sbjct  61   STTTKQLFDEYQKTLGIDLWSTQYASMQENLKKLKDVNRNLITEIRQRMGECLNDASFEH  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L +DVD ++ L+R+RK K+I NQI+T +KKVRNVEEIH+NLL E EAR EDP YGLV
Sbjct  121  LRSLEQDVDTALLLVRQRKNKMINNQIQTCRKKVRNVEEIHQNLLREFEARDEDPHYGLV  180

Query  648  DH-EGDYNSVLGFANGGHRILALRLQP  725
            D+  GDY+S+L        I ALRLQP
Sbjct  181  DNGAGDYDSML------RNIFALRLQP  201



>ref|XP_008466510.1| PREDICTED: floral homeotic protein DEFICIENS [Cucumis melo]
Length=270

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 182/216 (84%), Gaps = 11/216 (5%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHEYISP
Sbjct  27   MARGKIQIKRIENPTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  86

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +T+TK+LFDQYQKT+GVDLW SH+E+MQ+ LKKL+D+NR LRR+IRQRMGE +NDLSFE+
Sbjct  87   ATSTKELFDQYQKTLGVDLWISHYERMQDNLKKLKDINRNLRRQIRQRMGECMNDLSFEE  146

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECE-ARQEDPY---  638
            L  L +D+DN++++IRERKY+VI NQIETHKKK+++V EIH++LL E + A +EDP+   
Sbjct  147  LRCLEQDMDNAVRIIRERKYRVISNQIETHKKKLKSVGEIHKSLLQEFDIATEEDPHYGL  206

Query  639  ------GLVDHEGDYNSVLGFANGGH-RILALRLQP  725
                  G+    GDY S++GF+   H RI ALRLQP
Sbjct  207  VDNGGVGVGIGGGDYESIMGFSGAAHPRIFALRLQP  242



>gb|AAC42584.1| APETALA3 homolog SvAP3 [Syringa vulgaris]
Length=202

 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = +3

Query  186  NGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSSHFE  365
            NGLFKKAHELTVLCDAKVSI+MIS++ K+HEYISP+++TKQLFD YQ TVGVDLW +H+E
Sbjct  1    NGLFKKAHELTVLCDAKVSIIMISSTQKIHEYISPTSSTKQLFDLYQTTVGVDLWITHYE  60

Query  366  KMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  545
            +MQE L+KL+D+N+ LRREIRQRMGESLNDL+++Q+  LIEDVD+S++ IRERKYKVIGN
Sbjct  61   RMQEHLRKLKDINKNLRREIRQRMGESLNDLNYDQIVSLIEDVDDSLRKIRERKYKVIGN  120

Query  546  QIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHRILALRL  719
            QIET KKK+RNVEEIHRN+LLE +ARQEDP YGLVD+EGDYNSVLGF NGG RI+ALRL
Sbjct  121  QIETSKKKLRNVEEIHRNILLEFDARQEDPQYGLVDNEGDYNSVLGFPNGGPRIIALRL  179



>ref|XP_004147841.1| PREDICTED: floral homeotic protein DEFICIENS-like [Cucumis sativus]
 ref|XP_004154859.1| PREDICTED: floral homeotic protein DEFICIENS-like [Cucumis sativus]
Length=276

 Score =   296 bits (757),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 182/216 (84%), Gaps = 11/216 (5%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHEYISP
Sbjct  33   MARGKIQIKRIENPTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  92

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +T+TK+LFDQYQKT+GVDLW +H+E+MQ+ LKKL+D+NR LRR+IRQRMGE +NDLSFE+
Sbjct  93   ATSTKELFDQYQKTLGVDLWITHYERMQDNLKKLKDINRNLRRQIRQRMGECMNDLSFEE  152

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECE-ARQEDPY---  638
            L  L +D+DN++++IRERKY+VI NQIETHKKK+++V EIH++LL E + A +EDP+   
Sbjct  153  LRCLEQDMDNAVRIIRERKYRVISNQIETHKKKLKSVGEIHKSLLQEFDIATEEDPHYGL  212

Query  639  ------GLVDHEGDYNSVLGFANGGH-RILALRLQP  725
                  G+    GDY S++GF+   H RI ALRLQP
Sbjct  213  VDNGGVGVGIGGGDYESIMGFSGAAHPRIFALRLQP  248



>gb|AAC15419.1| MADS-box protein NMH 7 [Medicago sativa]
Length=229

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 170/206 (83%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRR+GLFKKA+ELTVLCDAKVSI+M S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRDGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S +TKQ FDQYQ TVG+DLW+SH+E MQE LKKL+DVNR LR+EIRQ MGE LNDLS E+
Sbjct  61   SASTKQFFDQYQMTVGIDLWNSHYENMQENLKKLKDVNRNLRKEIRQGMGECLNDLSMEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L +++D + K IRERKYKVI NQI+T +KK  N  E+H  LL + +AR EDP + ++
Sbjct  121  LRLLEDEMDKAAKAIRERKYKVITNQIDTQRKKSNNEREVHNRLLRDLDARAEDPRFEMM  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ G+Y SV+GF+N G R+ AL LQP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSLQP  206



>gb|AAX37273.1| MADS box protein [Cucumis sativus]
Length=244

 Score =   291 bits (745),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 181/216 (84%), Gaps = 11/216 (5%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGL KKA+ELTVLCDAKVSI+M S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENPTNRQVTYSKRRNGLLKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +T+TK+LFDQYQKT+GVDLW +H+E+MQ+ LKKL+D+NR LRR+IRQRMGE +NDLSFE+
Sbjct  61   ATSTKELFDQYQKTLGVDLWITHYERMQDNLKKLKDINRNLRRQIRQRMGECMNDLSFEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECE-ARQEDPY---  638
            L  L +D+D+++++IRERKY+VI NQIETHKKK+++V EIH++LL E + A +EDP+   
Sbjct  121  LRCLEQDMDSAVRIIRERKYRVISNQIETHKKKLKSVGEIHKSLLQEFDIATEEDPHYGL  180

Query  639  ------GLVDHEGDYNSVLGFANGGH-RILALRLQP  725
                  G+    GDY S++GF+   H RI ALRLQP
Sbjct  181  VDNGGVGVGIGGGDYESIMGFSGAAHPRIFALRLQP  216



>gb|AEM60196.1| MADS box transcription factor, partial [Osmanthus fragrans]
Length=188

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = +3

Query  186  NGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSSHFE  365
            NGLFKKAHELTVL DAKVSI+MIS++ K+HEYISP++TTKQLFDQYQK VG+DLW++H+E
Sbjct  1    NGLFKKAHELTVLRDAKVSIIMISSTQKIHEYISPTSTTKQLFDQYQKAVGIDLWTTHYE  60

Query  366  KMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  545
            KMQE L+KL+D+++ LR EIRQRMGESLNDL+++Q+  LIEDVD+S+K IRE KYKVIGN
Sbjct  61   KMQEHLRKLKDIHKNLRTEIRQRMGESLNDLNYDQIVNLIEDVDDSLKKIREGKYKVIGN  120

Query  546  QIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHRILALRL  719
            QIET KKK+RNVEEIHRN+LLE +ARQEDP YGLVD+EGDYNSVLGF+NGG RI+A RL
Sbjct  121  QIETSKKKLRNVEEIHRNILLEFDARQEDPQYGLVDNEGDYNSVLGFSNGGPRIIAYRL  179



>gb|AEA76416.1| putative DEF1, partial [Catharanthus roseus]
Length=163

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  141  IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQ  320
            IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+M+S++ KLHEYISP+T+TKQL DQ
Sbjct  1    IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMVSSTQKLHEYISPTTSTKQLIDQ  60

Query  321  YQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDN  500
            YQK +GVDLW+SH+EKMQEQLKKL+DVNR LRREIRQRMGESLN+L+++QL  LIEDVDN
Sbjct  61   YQKALGVDLWNSHYEKMQEQLKKLKDVNRNLRREIRQRMGESLNELTYDQLGNLIEDVDN  120

Query  501  SIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            S+  IRERK+KVIGNQIETHKKKVRNVEEIHRNLLLE +ARQE
Sbjct  121  SLSAIRERKFKVIGNQIETHKKKVRNVEEIHRNLLLELDARQE  163



>dbj|BAK20024.1| PgMADS protein9 [Panax ginseng]
Length=240

 Score =   290 bits (742),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 176/212 (83%), Gaps = 8/212 (4%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M+ST+ KLHEYISP
Sbjct  1    MARGKIQIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMVSTTNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S +TKQ FD YQKT  +DLWSSH+E MQEQL+KL++VN+ L+REIR+RMGESLN ++ E+
Sbjct  61   SISTKQFFDLYQKTKRIDLWSSHYEAMQEQLRKLKEVNKNLKREIRRRMGESLNGMTLEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L + +D S+K+IRERK KVIGNQIETHKKKVRN EEIHRNLL E E R+EDP YGLV
Sbjct  121  LWSLEQKMDESVKIIRERKMKVIGNQIETHKKKVRNGEEIHRNLLHEFELREEDPRYGLV  180

Query  648  DHEGDY----NSVLGFANGG---HRILALRLQ  722
            ++ G+     +SV+G++       RILA RLQ
Sbjct  181  ENGGEEYEYDSSVVGYSQEAVLLPRILAFRLQ  212



>gb|KHN45898.1| Floral homeotic protein DEFICIENS [Glycine soja]
Length=227

 Score =   289 bits (740),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLH+YISP
Sbjct  1    MARGKIQIKRIENNTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHQYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            ST+TKQ FDQYQ T+GVDLW+SH+E MQE LKKL++VNR LR+E RQRMG+ LN+L  E 
Sbjct  61   STSTKQFFDQYQMTLGVDLWNSHYENMQENLKKLKEVNRNLRKEFRQRMGDCLNELGMED  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E++D + K++RERKYKVI NQI+T +KK  N +E+H  LL + +A+ EDP + L+
Sbjct  121  LKLLEEEMDKAAKVVRERKYKVITNQIDTQRKKFNNEKEVHNRLLHDLDAKAEDPRFALI  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ G+Y SV+GF+N G R+ AL +QP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSIQP  206



>gb|AAB48660.1| MADS-box protein [Medicago sativa]
Length=247

 Score =   290 bits (741),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQV YSKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVIYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S +TKQ FDQYQ TVG+DLW+SH+E MQE LKKL+DVNR LR+EIRQ MGE LNDLS E+
Sbjct  61   SASTKQFFDQYQTTVGIDLWNSHYENMQENLKKLKDVNRNLRKEIRQGMGECLNDLSMEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L +++D ++K IRERKYKVI NQI+T +KK  N  E+   LL + +AR EDP + ++
Sbjct  121  LRLLEDEMDKALKAIRERKYKVITNQIDTQRKKFNNEREVDNRLLRDLDARAEDPRFEMM  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ G+Y SV+GF+N G R+ AL LQP
Sbjct  181  DNGGEYESVIGFSNLGPRMFALSLQP  206



>gb|ABD78317.1| Def-like protein [Primula vulgaris]
 gb|ABD78319.1| Def-like protein [Primula vulgaris]
Length=228

 Score =   289 bits (739),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 177/208 (85%), Gaps = 3/208 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA EL VLCDAKVSI+M+S + K+HE+ SP
Sbjct  1    MARGKIQIKKIENATNRQVTYSKRRNGLFKKAGELAVLCDAKVSIIMLSGTNKIHEFHSP  60

Query  291  S-TTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFE  467
               TTKQLFDQYQ+T+G+DLWSSH+EKMQE L+K +++N+ LR+EIRQRMG+SL++L   
Sbjct  61   DHVTTKQLFDQYQQTMGIDLWSSHYEKMQEDLRKRKEINKNLRQEIRQRMGDSLSELDLN  120

Query  468  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGL  644
            +L  L +D++ S++ IR RKYKVIGNQIET +KKVRN EE+HR LLLE +AR+EDP YGL
Sbjct  121  KLQTLEQDMEKSLEAIRGRKYKVIGNQIETSRKKVRNGEEVHRTLLLEFDAREEDPHYGL  180

Query  645  VDHEGDYNSVLGFANGGH-RILALRLQP  725
            VD+ GDY+SV+G+ N G  R+L+LRLQP
Sbjct  181  VDNGGDYDSVIGYTNEGEPRMLSLRLQP  208



>gb|ACY08913.1| MADS-domain transcription factor, partial [Sarracenia drummondii]
Length=206

 Score =   286 bits (731),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 183/214 (86%), Gaps = 10/214 (5%)
 Frame = +3

Query  168  TYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDL  347
            TYSKRRNGLFKKA+ELTVLCDAKVSI+M+S++GKLHEYISPS +TKQLFDQYQKT+G+DL
Sbjct  1    TYSKRRNGLFKKANELTVLCDAKVSIIMLSSTGKLHEYISPSASTKQLFDQYQKTLGIDL  60

Query  348  WSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERK  527
            WSSH+EKMQE LKKL++VNR+LRREIRQRMGESLN +SF +L +L +D+D+S+K+IRERK
Sbjct  61   WSSHYEKMQEHLKKLQEVNRSLRREIRQRMGESLNGVSFAELGDLEKDMDSSLKIIRERK  120

Query  528  YKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHR-  701
            YK+I NQI+T KKK RN EE+HR+LL E +A  EDP YGLVD+ GDY SVLG++N G++ 
Sbjct  121  YKMINNQIDTCKKKHRNAEEVHRSLLHEFDAIGEDPHYGLVDNGGDYESVLGYSNRGYQG  180

Query  702  ILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            ILALRLQP         H  +G GSDLTT+TLLE
Sbjct  181  ILALRLQP--------LHAGAGAGSDLTTYTLLE  206



>gb|ACY08899.1| MADS-domain transcription factor, partial [Alangium platanifolium]
Length=211

 Score =   284 bits (727),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 164/192 (85%), Gaps = 1/192 (1%)
 Frame = +3

Query  153  TNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKT  332
            TNRQVTYSKRRNGLFKKA+ELTVLCDAK+SI+M S++GKLHEYISPSTT K LFDQYQ+T
Sbjct  3    TNRQVTYSKRRNGLFKKANELTVLCDAKLSIIMFSSTGKLHEYISPSTTMKHLFDQYQRT  62

Query  333  VGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKL  512
            +GVDLWSSH+E+MQE LKKL+DVNR +RR+IRQRMGESLNDLS+E+L  L ++++NS+K+
Sbjct  63   MGVDLWSSHYERMQENLKKLKDVNRNIRRKIRQRMGESLNDLSYEELRGLEQEMENSLKI  122

Query  513  IRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFAN  689
            IRERK +VIGNQIET +KKVRNVEEIHRNLL E E  +ED   G  D  G+  SVLGF+ 
Sbjct  123  IRERKNRVIGNQIETQRKKVRNVEEIHRNLLNEFEMMEEDSRCGFFDSGGNSGSVLGFSA  182

Query  690  GGHRILALRLQP  725
            GG RILAL   P
Sbjct  183  GGARILALHFHP  194



>gb|AEM60164.1| MADS box transcription factor, partial [Salvia coccinea]
Length=214

 Score =   283 bits (723),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 164/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK SI+MIS++ KLH YISP+ TTKQ+ 
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKTSIIMISSTQKLHGYISPTITTKQIV  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D+YQKTV  DLWS H+EKMQE LKKL+++N  LR++IRQR GESLNDL +EQ+  LIED+
Sbjct  61   DEYQKTVRTDLWSFHYEKMQEHLKKLKEMNMNLRKDIRQRSGESLNDLGYEQVVSLIEDI  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            D S+  IRERKYK +GNQI+  KKK+RNVE+IH++LL    AR +DP YGLV++EG YNS
Sbjct  121  DKSLAFIRERKYKALGNQIDNTKKKLRNVEDIHKSLLFGFNARHDDPQYGLVENEGHYNS  180

Query  672  VLGFANGGHRILAL  713
            +LGF +GG RI+AL
Sbjct  181  MLGFRHGGPRIIAL  194



>gb|AEM60165.1| MADS box transcription factor, partial [Nepeta grandiflora]
Length=226

 Score =   283 bits (724),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 167/195 (86%), Gaps = 1/195 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKAHELTVLCDAK+SI+MIS++ KLHEYISP+ TTKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKISILMISSTQKLHEYISPTITTKQIF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            D+YQKT   DLWSSH+EKMQE LKKL+++NR L +EI QRMGESLNDL ++Q   LIED+
Sbjct  61   DEYQKTARTDLWSSHYEKMQEHLKKLKEINRNLMKEISQRMGESLNDLGYDQTVHLIEDM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            + S++ IRE+KYK I ++I+T +KK RNV+EIH NLL + +AR EDP YGLV+++GDYN 
Sbjct  121  NQSLEKIREKKYKSISSKIDTTRKKQRNVQEIHNNLLSQLDARHEDPHYGLVENDGDYNC  180

Query  672  VLGFANGGHRILALR  716
            VLGF +GG RI+ +R
Sbjct  181  VLGFPHGGPRIIPVR  195



>gb|AEM60179.1| MADS box transcription factor, partial [Utricularia sp. VFI-2011]
Length=207

 Score =   282 bits (722),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 158/180 (88%), Gaps = 2/180 (1%)
 Frame = +3

Query  186  NGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSSHFE  365
            NGLFKKAHELTVLCDAKVSIVM+S++ KLHEYISPSTTTKQ+FDQYQK VGVDLW++H+E
Sbjct  1    NGLFKKAHELTVLCDAKVSIVMVSSTQKLHEYISPSTTTKQVFDQYQKAVGVDLWNTHYE  60

Query  366  KMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  545
            KMQE LKKL++ NR LR+EIRQRMGE LNDL +EQ+ +LIE++D SI LIRERKYKVIGN
Sbjct  61   KMQEHLKKLKEANRNLRKEIRQRMGECLNDLGYEQMVDLIENMDKSISLIRERKYKVIGN  120

Query  546  QIETHKKKVRNVEEIHRNLLLECE-ARQEDP-YGLVDHEGDYNSVLGFANGGHRILALRL  719
            QIET KKKVRN EE+HR  LLE + ARQEDP YGLV++E D+NSVLGF  GG RI+ LRL
Sbjct  121  QIETSKKKVRNAEEVHRKNLLEFDAARQEDPHYGLVENEADFNSVLGFPGGGPRIITLRL  180



>ref|XP_004500961.1| PREDICTED: floral homeotic protein PMADS 1-like [Cicer arietinum]
Length=230

 Score =   283 bits (723),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 170/206 (83%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S ++KQ FD YQ TVG DLW+SH+E MQE LKKL+DVNR LR+EIRQRMG+ LNDLS E+
Sbjct  61   SISSKQFFDLYQMTVGTDLWTSHYENMQEHLKKLKDVNRNLRKEIRQRMGDCLNDLSMEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E++D ++K+IRE+KYK I +QI+TH+KK  N  E+H  LL + +AR EDP Y L+
Sbjct  121  LRLLEEEMDKAVKVIREKKYKGITSQIDTHRKKFNNEREVHNRLLHDLDARGEDPRYELM  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D  G+Y SV+GF+N G R+ AL LQP
Sbjct  181  DKGGEYESVIGFSNLGPRMFALTLQP  206



>gb|AEM60175.1| MADS box transcription factor, partial [Justicia brandegeana]
Length=219

 Score =   282 bits (721),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 163/185 (88%), Gaps = 5/185 (3%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            KRIENQTNRQVTYSKRRNGLFKKA ELTV CDAKVSI+MIS++ KLHEYISP+  TKQ+F
Sbjct  1    KRIENQTNRQVTYSKRRNGLFKKAQELTVPCDAKVSIIMISSTQKLHEYISPTIGTKQVF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK VGVDLW++H+EKMQE LKKL++ NR LR+EIRQRMGE LNDL ++Q+  LIE++
Sbjct  61   DQYQKAVGVDLWNTHYEKMQEHLKKLKEFNRNLRKEIRQRMGECLNDLGYDQMVNLIEEI  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV-DHEGDYN  668
            D S+ LIRERKYKVIGNQI+T KKK+RNVEEIHRNL+LE +ARQEDP YGLV +++GDY 
Sbjct  121  DASLGLIRERKYKVIGNQIDTSKKKLRNVEEIHRNLMLEFDARQEDPHYGLVENNDGDY-  179

Query  669  SVLGF  683
              LGF
Sbjct  180  --LGF  182



>gb|ABE11601.1| MADS-box transcription factor AP3 [Trochodendron aralioides]
Length=225

 Score =   281 bits (719),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TN+QVTYSKRR G+FKKA ELTVLCDAKVS++MIS +GK+HE+ISP
Sbjct  1    MGRGKIEIKRIENSTNKQVTYSKRRKGIFKKASELTVLCDAKVSLIMISNTGKMHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQ++DQYQ T G++LWSSH+EKMQ+ LKKL+++N  LRREI +R G  LN LSF +
Sbjct  61   STTTKQIYDQYQLTTGINLWSSHYEKMQDNLKKLKEINHNLRREIGRRTGGDLNGLSFAE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++ S+ ++RERKY+VI  Q ET++KK RN+EEI+RNLL E EAR +DP YGLV
Sbjct  121  LRGLEQNMEESLNIVRERKYRVISTQTETYRKKKRNMEEINRNLLNEFEARDDDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ GDY S +  ANGG +I A R+QP
Sbjct  181  DNGGDYESAVRLANGGSQIFAFRMQP  206



>gb|ACY08910.1| MADS-domain transcription factor, partial [Clethra tomentosa]
Length=206

 Score =   280 bits (717),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 164/189 (87%), Gaps = 1/189 (1%)
 Frame = +3

Query  162  QVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGV  341
            QVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS+SGK HE+ISPST+ KQ++D YQK +G+
Sbjct  1    QVTYSKRRNGLFKKANELTVLCDAKVSIIMISSSGKHHEFISPSTSMKQMYDDYQKALGI  60

Query  342  DLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRE  521
            DLWSSH+EKMQEQLK+L +VNR LRR+IRQRMGESLND+S+E L  L +D+D+S+K IRE
Sbjct  61   DLWSSHYEKMQEQLKRLNEVNRNLRRQIRQRMGESLNDVSYEDLRVLEQDMDSSVKDIRE  120

Query  522  RKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGH  698
            RKYKV+ NQ +T+KKKVRN EEIHR+LL E +   EDP YGLVD+ GDY SV+G++NGG 
Sbjct  121  RKYKVLSNQTDTYKKKVRNGEEIHRSLLHEFDVIGEDPHYGLVDNGGDYESVIGYSNGGR  180

Query  699  RILALRLQP  725
             ILAL LQP
Sbjct  181  GILALGLQP  189



>ref|NP_001267937.1| flowering-related B-class MADS-box protein [Vitis vinifera]
 gb|ABI98021.1| flowering-related B-class MADS-box protein [Vitis vinifera]
 emb|CAN66176.1| hypothetical protein VITISV_019954 [Vitis vinifera]
Length=225

 Score =   281 bits (719),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 165/205 (80%), Gaps = 1/205 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS++M S +GK HEY SP
Sbjct  1    MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTGKFHEYTSP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            + TTK+++DQYQKT+G+DLWSSH+E+MQE L+KL+++N  LRREIRQRMGE L DLS E 
Sbjct  61   TITTKKVYDQYQKTLGIDLWSSHYERMQENLRKLKEINNKLRREIRQRMGEDLGDLSIED  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L + +D S+ L+RERKY VI  Q ET++KKVRN+EE H NLLL  EA+ +DP YGLV
Sbjct  121  LRGLEQKMDASLGLVRERKYHVIKTQTETYRKKVRNLEEQHGNLLLNFEAKCDDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQ  722
            +++GDY S + FANG   + A RL 
Sbjct  181  ENDGDYESAVAFANGASNLYAFRLH  205



>dbj|BAK09615.1| MADS-box transcription factor [Cyclamen persicum]
Length=226

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 173/208 (83%), Gaps = 3/208 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQI++IEN TNRQVTYSKRRNGLFKKA EL VLCDA+VSIVM+S + K+HE+  P
Sbjct  1    MARGKIQIRKIENPTNRQVTYSKRRNGLFKKAGELAVLCDARVSIVMLSGTNKIHEFHCP  60

Query  291  S-TTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFE  467
               +TKQLFD YQ+T G+DLWSSH+EKMQE+L+K +++N+ L REIRQRMG+SL +L  +
Sbjct  61   EHISTKQLFDHYQQTTGIDLWSSHYEKMQEELRKRKEINKNLHREIRQRMGDSLTELDLD  120

Query  468  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGL  644
            +L  L +D++ S+++IR RKYKVI NQIET +KKVRN EE+HR LLLE E R+EDP YGL
Sbjct  121  ELQTLEQDMEKSLEVIRCRKYKVITNQIETCRKKVRNGEEVHRTLLLEFETREEDPHYGL  180

Query  645  VDHEGDYNSVLGFAN-GGHRILALRLQP  725
            VD+ GDY+SV+GF N G  R+LALRLQP
Sbjct  181  VDNGGDYDSVIGFTNEGPPRMLALRLQP  208



>gb|AEW43604.1| MADS-box transcription factor NMH7 [Pisum sativum]
Length=233

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 181/232 (78%), Gaps = 2/232 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHEYISP
Sbjct  1    MARGKIQIKRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S +TKQ FDQYQ TVG+DLW+SH+E MQE LKKL+DVNR LR+EIRQRMG+ LNDLS E+
Sbjct  61   SVSTKQFFDQYQMTVGIDLWNSHYENMQENLKKLKDVNRNLRKEIRQRMGDCLNDLSMEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E++D + K IRERKYKVI NQI+T +KK  N  E+H  LL + +AR ED  + ++
Sbjct  121  LRLLEEEMDKAAKAIRERKYKVITNQIDTQRKKFNNEREVHNRLLRDLDARAEDGRFEMM  180

Query  648  DH-EGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLL  800
            ++   DY SV+GF+N G R+ AL LQP H  ++ H        SDLTT+ LL
Sbjct  181  ENGAADYESVIGFSNLGPRMFALTLQPTHPANNPHNTGQQQPASDLTTYPLL  232



>gb|AEM60171.1| MADS box transcription factor, partial [Clerodendrum infortunatum]
Length=202

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = +3

Query  186  NGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSSHFE  365
            NGLFKKAHELTVLCDAK+SI+MIS++ KLHEYISP+ TTKQ+FD+YQ+ VGVDLWSSH+E
Sbjct  1    NGLFKKAHELTVLCDAKISIIMISSTQKLHEYISPTITTKQMFDKYQEAVGVDLWSSHYE  60

Query  366  KMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  545
            +MQE LKKL++VNR LR+EIRQR G+ LNDL +EQ+ +LIED++ S+KLIRE+KYKVI N
Sbjct  61   RMQEHLKKLKEVNRNLRKEIRQRTGDCLNDLGYEQIVDLIEDMNTSVKLIREKKYKVISN  120

Query  546  QIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHRILALRL  719
            QI+T KKK+RNVEEIHR+L+LE +ARQEDP YGLV++ GDYNSVLGF +GG RI+A RL
Sbjct  121  QIDTTKKKLRNVEEIHRSLVLEFDARQEDPHYGLVENGGDYNSVLGFPHGGPRIIAFRL  179



>gb|ADO16136.1| MADS [Ipomoea argillicola]
 gb|ADO16138.1| MADS [Ipomoea diamantinensis]
 gb|ADO16141.1| MADS [Ipomoea nil]
 gb|ADO16146.1| MADS [Ipomoea platensis]
 gb|ADO16149.1| MADS [Ipomoea purpurea]
Length=134

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/134 (100%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL
Sbjct  1    LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ACY08915.1| MADS-domain transcription factor, partial [Styrax japonicus]
Length=194

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = +3

Query  198  KKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQE  377
            KKA E+TVLCDAKVSI+M+S++GK HEYISPS +TKQL+D+YQKT+GVDLW+ H+++MQE
Sbjct  1    KKAKEITVLCDAKVSIIMLSSTGKFHEYISPSASTKQLYDEYQKTLGVDLWNPHYQRMQE  60

Query  378  QLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIET  557
             L++L++VNR LR+EIRQRMGESLNDLSF++L  L +D+D+S+K+IRERKYKVI NQIET
Sbjct  61   HLRQLKEVNRNLRKEIRQRMGESLNDLSFDELRGLEQDIDDSLKVIRERKYKVINNQIET  120

Query  558  HKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHRILALRLQP  725
             KKK+RNVEEIHRNLLLE +AR+EDP YGLVD+  DY SVLGF+NGGHRILALRLQP
Sbjct  121  SKKKLRNVEEIHRNLLLEFDAREEDPHYGLVDNGVDYGSVLGFSNGGHRILALRLQP  177



>gb|ABF56131.1| APETALA3-like protein [Ilex aquifolium]
Length=200

 Score =   278 bits (710),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = +3

Query  186  NGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSSHFE  365
            +GLFKKAHELTVLCDAKVSI+M S + KLHEYISPS TTKQ FDQYQ+T+GVDLWSSH+E
Sbjct  1    SGLFKKAHELTVLCDAKVSIIMFSCTNKLHEYISPSITTKQFFDQYQRTLGVDLWSSHYE  60

Query  366  KMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  545
            +MQ  LKKL++VNR LRREIRQR+GESLNDL++++L  L ++VD S+K+IRERKYKVI N
Sbjct  61   EMQGHLKKLKEVNRNLRREIRQRLGESLNDLNYDELRGLEQEVDGSVKIIRERKYKVISN  120

Query  546  QIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHRILALRLQ  722
            Q++T+KKK+RNVEEIHRNLL E + R EDP YGLVD+ GDY+SVLGF NGG  ILALRLQ
Sbjct  121  QVDTYKKKLRNVEEIHRNLLHEFDLRDEDPHYGLVDNGGDYDSVLGFPNGGPHILALRLQ  180

Query  723  P  725
            P
Sbjct  181  P  181



>gb|ACY08917.1| MADS-domain transcription factor, partial [Galax urceolata]
Length=205

 Score =   277 bits (709),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 161/187 (86%), Gaps = 1/187 (1%)
 Frame = +3

Query  165  VTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVD  344
            VTYSKRRNGLFKKA+ELTVLCDAKVSI+M STS KLHEYISP T+TKQ+FD YQ+  G+D
Sbjct  1    VTYSKRRNGLFKKANELTVLCDAKVSIIMFSTSNKLHEYISPCTSTKQMFDLYQQAKGID  60

Query  345  LWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRER  524
            LWS+H+EKMQE L+ L++ NR +RREIR RMGE LNDL F++L  L +D+D+S+K +RER
Sbjct  61   LWSTHYEKMQENLRNLKETNRNIRREIRHRMGEGLNDLDFDELRGLEQDMDSSLKTVRER  120

Query  525  KYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHR  701
            K+K+IGNQI+T KKKVRN EE++RNLL E E R+EDP YGLVD+ GDY+SVL FANGG R
Sbjct  121  KFKMIGNQIDTFKKKVRNGEEVNRNLLHEFEIREEDPHYGLVDNGGDYDSVLRFANGGPR  180

Query  702  ILALRLQ  722
            ILALRLQ
Sbjct  181  ILALRLQ  187



>gb|AEM60184.1| MADS box transcription factor, partial [Plantago lanceolata]
Length=207

 Score =   277 bits (709),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 169/198 (85%), Gaps = 4/198 (2%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IENQTNRQVTYSKRRNGLFKKA ELTVLCDAKVSI+MIS++ KLHE+ISP+TTTKQ+F
Sbjct  1    KKIENQTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMISSTQKLHEFISPTTTTKQIF  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQK +GVDLW+S +E+MQE LKK  ++NR L +EIRQR+GESLNDL + ++  L++ +
Sbjct  61   DQYQKALGVDLWNSQYERMQEDLKKHTEINRKLHKEIRQRVGESLNDLGYREIVNLLDMM  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
            D+++K IRERKYKV+ NQI+T KKK+RNVEE HRN +LE +    DP YGLV++EGDYNS
Sbjct  121  DDALKNIRERKYKVLSNQIDTTKKKLRNVEEQHRNRILELDG---DPHYGLVENEGDYNS  177

Query  672  VLGFANGGHRILALRLQP  725
            VLG+ +GG RI+ LR+ P
Sbjct  178  VLGYHHGGPRIITLRMPP  195



>gb|ADO16147.1| MADS [Ipomoea plebeia]
Length=134

 Score =   275 bits (702),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/134 (99%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPST+TKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ADO16151.1| MADS [Ipomoea saintronanensis]
Length=134

 Score =   275 bits (702),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 133/134 (99%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL
Sbjct  1    LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLT+LIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTDLIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ADO16134.1| MADS [Ipomoea amnicola]
Length=134

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/134 (99%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISP+TTTKQLFDQYQKT+GVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL
Sbjct  1    LHEYISPATTTKQLFDQYQKTLGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ADO16133.1| MADS [Ipomoea alba]
Length=134

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/134 (99%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPST+TKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVN+ALRREIRQRMGESL
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNKALRREIRQRMGESL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ADO16137.1| MADS [Ipomoea cordatotriloba]
Length=134

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/134 (99%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPST+TKQLFDQYQKTVGVDLWSSHFEKMQ+QLKKLRDVNRALRREIRQRMGESL
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQDQLKKLRDVNRALRREIRQRMGESL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ADO16153.1| MADS [Ipomoea wrightii]
Length=134

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/134 (99%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL
Sbjct  1    LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTELIEDVDNSIKLI ERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIPERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ACY08912.1| MADS-domain transcription factor, partial [Stewartia pseudocamellia]
Length=194

 Score =   275 bits (703),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 157/176 (89%), Gaps = 1/176 (1%)
 Frame = +3

Query  201  KAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQ  380
            K +ELTVLCDAKVSI+M+S++ KLHEYISPST+TKQ+FDQYQK +G+DLW SH+E+MQE 
Sbjct  1    KDNELTVLCDAKVSIIMLSSTNKLHEYISPSTSTKQMFDQYQKALGIDLWCSHYERMQEH  60

Query  381  LKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETH  560
            LKKL++ NR LRREIRQRMGESLNDLSFE L  L +D+++S+K+IR+RKYKV+GNQIETH
Sbjct  61   LKKLKEFNRNLRREIRQRMGESLNDLSFEDLCSLEQDMESSVKIIRDRKYKVLGNQIETH  120

Query  561  KKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHRILALRLQP  725
            KKK RNVEEIHRN L + +A +EDP YGLVD+ GDY+S+LGF+NGGH ILALRLQP
Sbjct  121  KKKKRNVEEIHRNFLHDIKAVEEDPQYGLVDNGGDYDSILGFSNGGHSILALRLQP  176



>gb|ADO16139.1| MADS [Ipomoea eriocarpa]
Length=134

 Score =   273 bits (697),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/134 (99%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPST+TKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTELIEDVD+SIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDSSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>ref|XP_006425563.1| hypothetical protein CICLE_v10026433mg [Citrus clementina]
 ref|XP_006466888.1| PREDICTED: floral homeotic protein DEFICIENS-like [Citrus sinensis]
 gb|ESR38803.1| hypothetical protein CICLE_v10026433mg [Citrus clementina]
Length=223

 Score =   276 bits (705),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS++M+S +GK HEYISP
Sbjct  1    MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMVSNTGKFHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++FDQYQK++GVDLWS+H+ KMQE  +KL+++N  LR++IRQRMGE L+DL+FE+
Sbjct  61   TTTTKKMFDQYQKSLGVDLWSTHYAKMQESYRKLKEINNKLRKDIRQRMGEDLDDLTFEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L +++ +S   +RERK+ VI  Q +T+KKKVRN+EE H N+LL+ E + +DP YGLV
Sbjct  121  LRGLEQNMSSSAATVRERKFHVIKTQTDTYKKKVRNLEERHGNILLDFETKYDDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQ  722
            D+ GDY S +  ANG   + A R+Q
Sbjct  181  DN-GDYQSAMALANGASNLYAFRMQ  204



>gb|ADO16152.1| MADS [Ipomoea umbraticola]
Length=134

 Score =   272 bits (696),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/134 (98%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LH+YISPSTTTKQLFDQYQKTVG+DLWSSHFEKMQ+QLKKLRDVNRALRREIRQRMGESL
Sbjct  1    LHQYISPSTTTKQLFDQYQKTVGLDLWSSHFEKMQDQLKKLRDVNRALRREIRQRMGESL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>ref|XP_011028945.1| PREDICTED: floral homeotic protein DEFICIENS-like [Populus euphratica]
Length=191

 Score =   274 bits (700),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKAHELTVLCDA+VS+VM+S + K+H+Y SP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKAHELTVLCDAEVSLVMVSCTHKVHDYTSP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTK++FDQYQ+T G+DLWSSH+E M+E+L+KL++VN  +RRE+RQRMG+ LNDLSF+ 
Sbjct  61   STTTKRIFDQYQQTKGIDLWSSHYEIMKEKLEKLKEVNMKIRREMRQRMGQCLNDLSFQD  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  650
            L  L  D++++ ++I +R  +V+ NQIET KKK RNVE+I+R L +E EA  +DPYGLVD
Sbjct  121  LHSLESDMESAWRVIHDRADRVLTNQIETSKKKARNVEQINRKLHVELEAMDQDPYGLVD  180

Query  651  HEGDYNSVLGF  683
            + GDYNSV+GF
Sbjct  181  NGGDYNSVMGF  191



>gb|KDO71079.1| hypothetical protein CISIN_1g027470mg [Citrus sinensis]
Length=223

 Score =   275 bits (703),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS++M S +GK HEYISP
Sbjct  1    MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTGKFHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++FDQYQK++GVDLWS+H+ KMQE  +KL+++N  LR++IRQRMGE L+DL+FE+
Sbjct  61   TTTTKKMFDQYQKSLGVDLWSTHYAKMQESYRKLKEINNKLRKDIRQRMGEDLDDLTFEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L +++ +S   +RERK+ VI  Q +T+KKKVRN+EE H N+LL+ E + +DP YGLV
Sbjct  121  LRGLEQNMSSSAATVRERKFHVIKTQTDTYKKKVRNLEERHGNILLDFETKYDDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQ  722
            D+ GDY S +  ANG   + A R+Q
Sbjct  181  DN-GDYQSAMALANGASNLYAFRMQ  204



>gb|ADO16140.1| MADS [Ipomoea lobata]
Length=134

 Score =   271 bits (694),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 132/134 (99%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL
Sbjct  1    LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DP+GLVD EGDYNS
Sbjct  121  DPFGLVDREGDYNS  134



>gb|ADU15473.1| AP3 [Actinidia chinensis]
Length=227

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS++M+S +GKLHEYISP
Sbjct  1    MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMLSNTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            + +TK+++DQYQKT+G+DLWS+H+E+MQE L+KL++VN  LRREIRQ+MGE LNDLS  +
Sbjct  61   NISTKKIYDQYQKTLGIDLWSTHYERMQEHLRKLKEVNNRLRREIRQKMGEELNDLSVHE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE--DPYGL  644
            L  L + +  S+ +IR+RKY VI  Q ET++KKVRN+EE H NLLL+ EA+ +    Y L
Sbjct  121  LRGLEQKMSASLTIIRDRKYHVIKTQTETYRKKVRNLEERHGNLLLDFEAKCDLAPQYEL  180

Query  645  VDHEGDYNSVLGFANGGHRILALRLQP  725
            V++EGDY+S + FANG   + A RLQP
Sbjct  181  VENEGDYDSAVAFANGVSNLYAFRLQP  207



>gb|ADO16135.1| MADS [Ipomoea aquatica]
Length=134

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/134 (98%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPST+TKQLFDQYQKTVGVDLW+SHFEKMQEQLKKLRDVNRALRREIRQRMGE L
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ADO16145.1| MADS [Ipomoea pes-tigridis]
Length=134

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/134 (97%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPST+TKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNR LRREIRQRMGESL
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRGLRREIRQRMGESL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTEL+ED+DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELVEDMDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>ref|XP_006340689.1| PREDICTED: floral homeotic protein DEFICIENS-like [Solanum tuberosum]
Length=225

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 167/206 (81%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IK+IEN TNRQVTYSKRRNG+FKKA ELTVLCDAK+S++M+S++ K HEY SP
Sbjct  1    MGRGKIEIKKIENSTNRQVTYSKRRNGIFKKAKELTVLCDAKISLIMLSSTRKYHEYTSP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ DQYQ  +GVD+WS+H+EKMQE LK+L+++N  LRREIRQR GE ++ L+ ++
Sbjct  61   NTTTKKMIDQYQSALGVDIWSTHYEKMQENLKRLQEINNKLRREIRQRTGEDMSGLNLQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E++  S+  IRERKY VI NQ +T +KKVRN+EE H NL+L+ EA+ EDP YG+V
Sbjct  121  LCHLQENITESVAEIRERKYHVIKNQTDTCRKKVRNLEEQHGNLVLDLEAKCEDPKYGVV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            ++EG YNS + FANG H + A RLQP
Sbjct  181  ENEGHYNSAVAFANGVHNLYAFRLQP  206



>ref|XP_006386194.1| MADS-box protein GmNMH7 [Populus trichocarpa]
 gb|ERP63991.1| MADS-box protein GmNMH7 [Populus trichocarpa]
Length=191

 Score =   272 bits (696),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 162/191 (85%), Gaps = 0/191 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKAHELTVLCDA+VS+VM+S + K+H+Y SP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKAHELTVLCDAEVSLVMVSCTDKVHDYTSP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTK++FDQYQ+T G+DLWSSH+E M+E L+KL++VN  +RRE+RQRMG+ LN LSF+ 
Sbjct  61   STTTKRIFDQYQQTKGIDLWSSHYEIMKENLEKLKEVNMKIRREMRQRMGQCLNGLSFQD  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  650
            L  L  D++++ ++I +R  +V+ NQIET KKK RNVE+I+R L +E EA  +DPYGLVD
Sbjct  121  LQSLESDMESAWRVIHDRADRVLTNQIETSKKKARNVEQINRKLQVELEAMDQDPYGLVD  180

Query  651  HEGDYNSVLGF  683
            + GDYNSV+GF
Sbjct  181  NGGDYNSVMGF  191



>gb|ADO16143.1| MADS [Ipomoea ochracea]
Length=134

 Score =   270 bits (689),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/134 (97%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPST+TKQLFDQYQKTVG+DLW+SHFEKMQEQLKKLRDVNRALRREIRQRMGE L
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGLDLWNSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ABR68543.1| APETALA3-like [Dillenia indica]
Length=205

 Score =   272 bits (695),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 160/190 (84%), Gaps = 3/190 (2%)
 Frame = +3

Query  141  IENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQ  320
            IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSI+M S +GK+HE+ISPS TTKQ++D 
Sbjct  1    IENATNRQVTYSKRRNGLFKKAGELTVLCDAKVSIIMFSGTGKMHEFISPSLTTKQVYDD  60

Query  321  YQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDN  500
            YQK +G+DLW +H+E+MQE LKKL++ NR LR+EIRQRMGE LNDL  ++L  L E+++N
Sbjct  61   YQKAMGIDLWKTHYERMQENLKKLKETNRNLRKEIRQRMGEQLNDLGIDELRALEENMEN  120

Query  501  SIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEG--DYNS  671
            ++K+IR+RKYKVI  QIETHKKK RNV++IHR LL E +AR+EDP YG VD+ G  DYNS
Sbjct  121  AVKVIRDRKYKVINGQIETHKKKWRNVQDIHRKLLQELDAREEDPHYGFVDNGGGVDYNS  180

Query  672  VLGFANGGHR  701
            ++ +ANGG R
Sbjct  181  MIAYANGGPR  190



>gb|ADO16150.1| MADS [Ipomoea quamoclit]
Length=134

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPST+TKQLFDQYQKTVGVDLW+SHFEKMQEQ+KKLRDVNRALRREIRQRMGE L
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWNSHFEKMQEQMKKLRDVNRALRREIRQRMGEGL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDY+S
Sbjct  121  DPYGLVDHEGDYSS  134



>gb|ADO16142.1| MADS [Ipomoea obscura]
Length=134

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/134 (97%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPST+TKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRA RREIRQRMGESL
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRAFRREIRQRMGESL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTELIEDVDNSIKLIRERKYKVI NQIET+KKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIEDVDNSIKLIRERKYKVITNQIETNKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ADO16144.1| MADS [Ipomoea ochracea]
Length=134

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/134 (97%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPST+TKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLTELI DVDNSIKLIR+RKYKVI NQIETHKKKVRNVEEIHRNLLLECEARQE
Sbjct  61   NDLSFEQLTELIGDVDNSIKLIRDRKYKVISNQIETHKKKVRNVEEIHRNLLLECEARQE  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ACY08909.1| MADS-domain transcription factor, partial [Synsepalum dulcificum]
Length=186

 Score =   270 bits (690),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 155/170 (91%), Gaps = 1/170 (1%)
 Frame = +3

Query  219  VLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRD  398
            VLCDAKVSI+M+S++GKLHE+ISPSTTTK+L+DQYQKT+G+DLWSSH+E+MQE LKKL+D
Sbjct  1    VLCDAKVSIIMLSSTGKLHEFISPSTTTKELYDQYQKTLGIDLWSSHYERMQEHLKKLKD  60

Query  399  VNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRN  578
            VNR LRREIRQRMGESLNDLSFE+L  L +D++ S+K IRERKYK +GNQIETH+KK+RN
Sbjct  61   VNRNLRREIRQRMGESLNDLSFEELRGLEQDMEISVKNIRERKYKALGNQIETHRKKLRN  120

Query  579  VEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHRILALRLQP  725
            VEEIH+NLL E +  +EDP YGLVD+ GDY+SVLGF+NGG RIL+LRLQP
Sbjct  121  VEEIHKNLLHEFDVAEEDPHYGLVDNGGDYDSVLGFSNGGPRILSLRLQP  170



>gb|ADO16148.1| MADS [Ipomoea plebeia]
Length=134

 Score =   267 bits (683),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +3

Query  270  LHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL  449
            LHEYISPST+TKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGE L
Sbjct  1    LHEYISPSTSTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGEGL  60

Query  450  NDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQE  629
            NDLSFEQLT+LIEDVDNSIKLIRERKYKVIGNQIET+KKKVRNVEEIHRNLLLECEARQ+
Sbjct  61   NDLSFEQLTDLIEDVDNSIKLIRERKYKVIGNQIETYKKKVRNVEEIHRNLLLECEARQK  120

Query  630  DPYGLVDHEGDYNS  671
            DPYGLVDHEGDYNS
Sbjct  121  DPYGLVDHEGDYNS  134



>gb|ACY08902.1| MADS-domain transcription factor, partial [Phlox paniculata]
Length=209

 Score =   270 bits (690),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 167/193 (87%), Gaps = 6/193 (3%)
 Frame = +3

Query  153  TNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKT  332
            TNRQVT     NGLFKKA ELTVLCDAKVS++M S++GKLHEYISPSTTTKQLFDQYQKT
Sbjct  3    TNRQVT----SNGLFKKASELTVLCDAKVSLLMFSSTGKLHEYISPSTTTKQLFDQYQKT  58

Query  333  VGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKL  512
            +G+DLWSSH+EKMQE LKKL+DVNR LRREIR+RMGE LNDL+FE+L  L  D+D ++K+
Sbjct  59   LGIDLWSSHYEKMQEHLKKLKDVNRNLRREIRRRMGECLNDLTFEELRTLELDMDEAVKV  118

Query  513  IRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFAN  689
            IRERK KVI NQI+T+KKK RNV+EIHRNLLLE +AR+EDP YGLVD+ GDY SVLGF  
Sbjct  119  IRERKNKVINNQIDTYKKKWRNVQEIHRNLLLEFDAREEDPHYGLVDNGGDYESVLGFQG  178

Query  690  GGH-RILALRLQP  725
            G H R+LALRLQP
Sbjct  179  GSHPRMLALRLQP  191



>gb|ACY08898.1| MADS-domain transcription factor, partial [Jacquinia aurantiaca]
Length=215

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 162/194 (84%), Gaps = 3/194 (2%)
 Frame = +3

Query  153  TNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPST-TTKQLFDQYQK  329
            TNRQVTYSKRRNGLFKKA EL VLCDAKVSI+M+S + K+HE+ SP+  + KQLFDQYQ+
Sbjct  3    TNRQVTYSKRRNGLFKKAGELAVLCDAKVSIIMLSGTNKVHEFHSPTNISVKQLFDQYQQ  62

Query  330  TVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIK  509
            T G+DLWSSH+EKMQE LKK +++NR L REIRQRMG+SLN+L    L  L +D++ S++
Sbjct  63   TTGIDLWSSHYEKMQEDLKKRKEINRNLLREIRQRMGDSLNELDLNDLQALEQDMEKSLE  122

Query  510  LIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFA  686
             IR RK+KV+GNQIET +KKVRNVE+IHRNLLLE +AR+EDP YGLVD  G Y+SVLGF 
Sbjct  123  NIRLRKFKVLGNQIETSRKKVRNVEDIHRNLLLEFDAREEDPHYGLVDDGGHYDSVLGFT  182

Query  687  N-GGHRILALRLQP  725
            N G HR+LALRLQP
Sbjct  183  NEGAHRMLALRLQP  196



>ref|XP_010061014.1| PREDICTED: floral homeotic protein DEFICIENS [Eucalyptus grandis]
 gb|KCW67911.1| hypothetical protein EUGRSUZ_F01615 [Eucalyptus grandis]
Length=233

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 172/213 (81%), Gaps = 8/213 (4%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK IEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHEYISP
Sbjct  1    MARGKIQIKLIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            ST+TK+++DQYQ+ + VDLWSSH+EKMQE L+KL++VN+ L+ E+R+R GE LN +S  +
Sbjct  61   STSTKKMYDQYQQALEVDLWSSHYEKMQENLRKLKEVNKKLQLEVRRRFGEGLNGMSLSE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLEC-----EARQEDP  635
            L  L +D+DN++ LIRERKYK +GNQI+T +KK +N EEI+++LL +        R++DP
Sbjct  121  LCGLEQDMDNAVSLIRERKYKTLGNQIDTARKKKKNAEEINKSLLQDWTNLIKHLREDDP  180

Query  636  -YGLVDHEGDYNSVLGF--ANGGHRILALRLQP  725
             +G+VD+  DY +V+G+  A    R+  LRLQP
Sbjct  181  HFGMVDNGRDYEAVIGYTDAAAAARLYTLRLQP  213



>gb|AHH28320.1| MADS-box transcription factor, partial [Garcia nutans]
Length=209

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 160/186 (86%), Gaps = 2/186 (1%)
 Frame = +3

Query  174  SKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWS  353
            SKRRNGLFKKA+ELTVLCDAKVS++M S +GKLHE+ISPSTTTKQLFDQYQKT+GVDLW 
Sbjct  1    SKRRNGLFKKANELTVLCDAKVSLIMFSGTGKLHEFISPSTTTKQLFDQYQKTLGVDLWI  60

Query  354  SHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYK  533
            + +E+MQE LKKL+DVNR LR+EIRQRMGE L+D++FE L  L ED+D ++ +IRERK +
Sbjct  61   TQYERMQENLKKLKDVNRNLRKEIRQRMGECLDDVNFEHLRSLEEDMDTALNVIRERKNR  120

Query  534  VIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHR-IL  707
            VI NQIET+KKK+RNVE+IHRNLL E +AR EDP YGLVD+ GDY+S++GF  GG R + 
Sbjct  121  VITNQIETYKKKLRNVEQIHRNLLREFDARDEDPHYGLVDNGGDYDSMIGFHYGGIRNVF  180

Query  708  ALRLQP  725
             +RLQP
Sbjct  181  GIRLQP  186



>gb|ABF67489.1| MADS-domain protein [Impatiens hawkeri]
Length=259

 Score =   269 bits (688),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLF+KA ELTVLCDAK+SI+M S++ KLHE+ISP
Sbjct  1    MARGKIQIKRIENDTNRQVTYSKRRNGLFRKAGELTVLCDAKISILMFSSTSKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S + KQLFDQYQKTVGVDLWSS +E+MQE LKKL++ NR+LR EIRQRMG+ LN+L +EQ
Sbjct  61   SISAKQLFDQYQKTVGVDLWSSQYERMQEHLKKLKEGNRSLRTEIRQRMGDCLNELCYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQED  632
            L  L +D+D+S++ IR+RK+KV+GNQIETH+KK+RNVE+IHRNLL E + R+ED
Sbjct  121  LVGLEQDMDSSLQRIRDRKFKVLGNQIETHRKKLRNVEQIHRNLLQEFDVREED  174



>gb|AIC33047.1| flower development transporter AP3 [Chrysanthemum lavandulifolium]
Length=229

 Score =   268 bits (685),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 167/208 (80%), Gaps = 3/208 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSI+M+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQ FDQYQK  G+DLW+SH+EKMQE+L++L+DVN+ LR  IRQR+G+ L+ L FE+
Sbjct  61   SITTKQFFDQYQKASGIDLWNSHYEKMQEELRQLKDVNKKLRTHIRQRLGDCLDHLGFEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L +L ++   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E + R EDP +G++
Sbjct  121  LLDLEKESQEAVYVIRERKLKVIGNKLETSKKKVRSAQDVYKKLMHEFDIRGEDPQFGMI  180

Query  648  DHEGDYNSVLGFAN--GGHRILALRLQP  725
            +  G+Y ++ G+       RIL LRLQP
Sbjct  181  EDAGEYETIYGYPPHIATQRILTLRLQP  208



>ref|XP_006435093.1| hypothetical protein CICLE_v10002410mg [Citrus clementina]
 gb|ESR48333.1| hypothetical protein CICLE_v10002410mg [Citrus clementina]
Length=221

 Score =   268 bits (684),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 167/208 (80%), Gaps = 3/208 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVT+SKRRNGLFKKA ELTVLCDAKVSI+M S++GK+ EY+S 
Sbjct  1    MARGKIQIKRIENATNRQVTFSKRRNGLFKKAQELTVLCDAKVSIIMCSSTGKVQEYVSS  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQL D+YQ+ + +DLWSS +EKMQE LK L++VN  L++EIRQR+GESLNDLS ++
Sbjct  61   STTTKQLLDEYQRRLKIDLWSSQYEKMQENLKNLKEVNINLKKEIRQRLGESLNDLSLKK  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLL--LECEARQEDP-YG  641
            L++L +DVDN +++IRERK + I  QI THKKKVR  EE +R L       A++ED  Y 
Sbjct  121  LSDLEQDVDNCLRIIRERKLRAISGQIVTHKKKVRREEEENRKLRNGFIINAKEEDQHYE  180

Query  642  LVDHEGDYNSVLGFANGGHRILALRLQP  725
            LVD+EG Y+SV+ F NGG  I ALRLQP
Sbjct  181  LVDNEGHYDSVIRFQNGGPGIFALRLQP  208



>gb|AHY19023.1| AP3 MADS box protein [Ribes diacanthum]
Length=233

 Score =   268 bits (685),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 168/207 (81%), Gaps = 3/207 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKI+IKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M S++ KLHEY+SP
Sbjct  1    MARGKIEIKRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTNKLHEYLSP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
              +TKQ+FDQYQ  +G+DLW +HFE+MQE LK+L+DVN  LR EIR RMG SL+ LS  +
Sbjct  61   FISTKQVFDQYQNQLGIDLWQTHFERMQEHLKQLKDVNNNLRMEIRHRMGASLDGLSLAE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E++D S+ +IRERK  VIGNQI+T KKKVRN EE++R L+ E + R+EDP +GLV
Sbjct  121  LRNLEEEMDGSLDIIRERKRHVIGNQIDTLKKKVRNSEEVNRKLVHEFDVRREDPHFGLV  180

Query  648  DHEG-DYNSVLGFAN-GGHRILALRLQ  722
            ++ G +Y++V G+ N GG RI AL +Q
Sbjct  181  ENGGSEYDTVFGYQNGGGARIFALPMQ  207



>emb|CAA08803.1| MADS-box protein, GDEF2 [Gerbera hybrid cultivar]
Length=228

 Score =   268 bits (684),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 167/208 (80%), Gaps = 3/208 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSI+M+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQ FDQYQK  G+DLW+SH+EKMQE+L++L++VNR LRR+IRQR+G+ L DL FE+
Sbjct  61   SITTKQFFDQYQKASGIDLWNSHYEKMQEELRQLKEVNRNLRRQIRQRLGDCLEDLGFEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
              +L ++   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E + R EDP YG++
Sbjct  121  FLDLEKESQEAVYIIRERKLKVIGNKLETSKKKVRSAQDVYKKLMHEFDIRGEDPQYGMI  180

Query  648  DHEGDYNSVLGFAN--GGHRILALRLQP  725
            +   +Y ++ G+       RIL LRLQP
Sbjct  181  EDGVEYEALYGYPPHISAPRILTLRLQP  208



>gb|ACV53813.1| MADS-box protein [Gerbera hybrid cultivar]
Length=231

 Score =   268 bits (684),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 164/207 (79%), Gaps = 2/207 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSI+M+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQ FDQYQK  G+DLW+SH++KMQE+L++L++VNR LRR+IRQR+G+ L DL FE 
Sbjct  61   SITTKQFFDQYQKASGIDLWNSHYQKMQEELRQLKEVNRNLRRQIRQRLGDCLEDLGFED  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
               L  D   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E + R EDP YG++
Sbjct  121  FLALENDSQQAVSIIRERKLKVIGNKVETSKKKVRSAQDVYKKLMREFDLRGEDPQYGMI  180

Query  648  DHEGDYNSVLGFANG-GHRILALRLQP  725
            +   +Y ++ G+      RIL LRLQP
Sbjct  181  EDGREYENMYGYPQMVAPRILTLRLQP  207



>ref|XP_009605879.1| PREDICTED: floral homeotic protein DEFICIENS-like [Nicotiana 
tomentosiformis]
Length=225

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 165/205 (80%), Gaps = 1/205 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IK+IEN TNRQVTYSKRRNG+ KKA ELTVLCDAK+S++M+S++ K HEY SP
Sbjct  1    MGRGKIEIKKIENSTNRQVTYSKRRNGIIKKAKELTVLCDAKISLLMLSSTRKFHEYTSP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TT K++ DQYQ+T+GVD+WS+H+EKMQE LK+L+++N  LRREIRQR GE ++ L+  +
Sbjct  61   NTTQKKMIDQYQRTLGVDIWSTHYEKMQENLKRLKEINNKLRREIRQRTGEDMSGLNLLE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E++  S+  IRERKY VI  Q +T +KKV+N+EE H NL+L+ EA+ EDP YG+V
Sbjct  121  LCHLQENISESLAEIRERKYHVIKTQTDTFRKKVKNLEEQHGNLVLDLEAKSEDPKYGVV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQ  722
            ++EG+YNS + FANG H + A RLQ
Sbjct  181  ENEGEYNSAMAFANGAHNLYAFRLQ  205



>ref|XP_004232453.1| PREDICTED: floral homeotic protein DEFICIENS isoform X2 [Solanum 
lycopersicum]
Length=225

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IK+IEN TNRQVTYSKRRNG+FKKA ELTVLCDAK+S++M+S++ K HEY SP
Sbjct  1    MGRGKIEIKKIENSTNRQVTYSKRRNGIFKKAKELTVLCDAKISLIMLSSTRKYHEYTSP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ DQYQ  +GVD+WS H+EKMQE LK+L+++N  LRREIRQR GE ++ L+ ++
Sbjct  61   NTTTKKMIDQYQSALGVDIWSIHYEKMQENLKRLKEINNKLRREIRQRTGEDMSGLNLQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E++  S+  IRERKY VI NQ +T KKK RN+EE + NL+L+ EA+ EDP YG+V
Sbjct  121  LCHLQENITESVAEIRERKYHVIKNQTDTCKKKARNLEEQNGNLVLDLEAKCEDPKYGVV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            ++EG Y+S + FANG H + A RLQP
Sbjct  181  ENEGHYHSAVAFANGVHNLYAFRLQP  206



>gb|AGH39936.1| MADS domain protein [Actaea vaginata]
Length=220

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 165/205 (80%), Gaps = 4/205 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS++M S++GKL EYISP
Sbjct  1    MGRGKIEIKRIENTTNRQVTYSKRRTGIVKKARELTVLCDAEVSLIMFSSTGKLSEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTK+++D YQ+  GVDLW+SH+EKM+E LKK ++ N  LR+EIRQR+GE L+DLSFE+
Sbjct  61   STTTKKIYDTYQQVNGVDLWNSHYEKMKETLKKQKESNMKLRKEIRQRIGEGLDDLSFEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  650
            L  L +D+D S+K++R+RKY +I  Q ET++KK+RN++E H +L+ E +AR EDPY    
Sbjct  121  LRGLEQDLDGSVKVVRDRKYHMIATQTETYRKKLRNLQETHTHLMREFDARGEDPY----  176

Query  651  HEGDYNSVLGFANGGHRILALRLQP  725
            ++GDY S+LG +NG   +L  RLQP
Sbjct  177  YDGDYESLLGMSNGAAHLLPYRLQP  201



>gb|KDO84726.1| hypothetical protein CISIN_1g040046mg [Citrus sinensis]
Length=221

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 167/208 (80%), Gaps = 3/208 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVT+SKRRNGLFKKA ELTVLCDAKVSI+M S++GK+ EY+S 
Sbjct  1    MARGKIQIKRIENATNRQVTFSKRRNGLFKKAQELTVLCDAKVSIIMCSSTGKVQEYVSS  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQL D+YQ+ + +DLWSS +EKMQE LK L++VN  L++EIRQR+GESLNDLS ++
Sbjct  61   STTTKQLLDEYQRRLKIDLWSSQYEKMQENLKNLKEVNINLKKEIRQRLGESLNDLSLKK  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLL--LECEARQEDP-YG  641
            L++L +DVDN +++IRERK + I  QI TH+KKVR  EE +R L       A++ED  Y 
Sbjct  121  LSDLEQDVDNCLRIIRERKLRAISGQIVTHRKKVRREEEENRKLRNGFIINAKEEDQHYE  180

Query  642  LVDHEGDYNSVLGFANGGHRILALRLQP  725
            LVD+EG Y+SV+ F NGG  I ALRLQP
Sbjct  181  LVDNEGHYDSVIRFQNGGPGIFALRLQP  208



>ref|XP_008221326.1| PREDICTED: LOW QUALITY PROTEIN: floral homeotic protein DEFICIENS-like 
[Prunus mume]
Length=229

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 172/207 (83%), Gaps = 4/207 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKIQIKRIEN TNRQVTYSKRRNGLFKKAHELTVLCDA VS++M+S+SGK+HEYISP
Sbjct  1    MTRGKIQIKRIENATNRQVTYSKRRNGLFKKAHELTVLCDATVSLIMVSSSGKIHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQR-MGESLNDLSFE  467
            STTTKQ FDQ+QKT GVD+WSSH+E MQE LKKL++VNR+L+++IRQR +GE LND+SF+
Sbjct  61   STTTKQFFDQFQKTKGVDIWSSHYEAMQEHLKKLKEVNRSLQKQIRQRVLGECLNDMSFD  120

Query  468  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLV  647
            +L  + ++++ ++ +IR+RK ++I NQI+T KKK+R+  E++RN L E +AR +  Y LV
Sbjct  121  ELRGVEQEMEGAVDVIRKRKIRMISNQIDTTKKKLRSATEMNRN-LHEFDARDDTHYRLV  179

Query  648  DHEG-DYNSVLGF-ANGGHRILALRLQ  722
            ++ G DY S  G+ +NGG RI  LRLQ
Sbjct  180  ENGGEDYESAFGYSSNGGPRIFXLRLQ  206



>emb|CDP01943.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 164/207 (79%), Gaps = 3/207 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+I++IEN TNRQVTYSKRRNG+FKKAHEL+VLCDAKVS++M+S + K HEY SP
Sbjct  1    MGRGKIEIRKIENSTNRQVTYSKRRNGIFKKAHELSVLCDAKVSLIMLSDTKKFHEYTSP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTK++ D YQ  VGVDLWS+H+EKMQE L++L++ N  LRR+IRQRMGE LNDL+++ 
Sbjct  61   SITTKKVMDDYQSAVGVDLWSTHYEKMQENLRRLKETNNKLRRDIRQRMGEDLNDLNWDN  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQ-EDP-YGL  644
            +  L E + +S+ +IR RKY VI NQ +T+KKKVRN++E H NLL E EAR  EDP YG+
Sbjct  121  MCRLQEKIVDSLAIIRHRKYHVIKNQTDTYKKKVRNLKERHGNLLYELEARSCEDPKYGI  180

Query  645  VDHEGDYNSVLGFANGG-HRILALRLQ  722
            VD+  DYNS L  A+GG   + ALRLQ
Sbjct  181  VDNARDYNSALALADGGLSNLYALRLQ  207



>gb|AAD53326.1|AF180365_1 DEFICIENS homolog DEF2 [Hieracium piloselloides]
Length=228

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 169/208 (81%), Gaps = 4/208 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSI+M+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQ FDQYQK  G+DLW+SH+EKMQE+L++L++VN+ LRR+IRQR+G+ L  L FE+
Sbjct  61   STTTKQFFDQYQKAAGIDLWNSHYEKMQEELRQLKEVNKNLRRQIRQRLGDCLEHLGFEK  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L +L ++   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E   R EDP +G++
Sbjct  121  LLDLEKESQEAVYIIRERKLKVIGNKLETSKKKVRSAQDVYKKLMHEFGIRGEDPQFGMI  180

Query  648  DHEGDYNSVLGFAN--GGHRILALRLQP  725
            + +G+Y++V G+       RIL  RLQP
Sbjct  181  E-DGEYDAVYGYPPQMSAPRILTFRLQP  207



>gb|ABR18735.1| MADS-box transcription factor HAM63 [Helianthus annuus]
Length=229

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 167/209 (80%), Gaps = 4/209 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+M+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMVSCTEKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQ FDQYQK  G+DLW+SH+EKMQE+L++L+DVN  LRR+IRQR+G+ L ++ FE+
Sbjct  61   SITTKQFFDQYQKASGIDLWNSHYEKMQEELRQLKDVNTNLRRQIRQRLGDCLENVGFEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L +L  +   ++ +IRERK KVI N++ET KKKVR+ +++++ L+ E + R EDP YG++
Sbjct  121  LLDLERESQEAVYIIRERKLKVISNKLETCKKKVRSAQDVYKKLMHEFDIRGEDPQYGMI  180

Query  648  DHEGDYNSVLGFAN---GGHRILALRLQP  725
            +  G+Y ++ G+        RIL LRLQP
Sbjct  181  EDAGEYEALYGYPPRIAAAPRILTLRLQP  209



>gb|AAO22985.1| MADS-box transcription factor CDM115 [Chrysanthemum x morifolium]
Length=229

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 166/208 (80%), Gaps = 3/208 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSI+M+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQ FDQYQK  G+DLW+SH+EKMQE L++L+DVN+ LR  IRQR+G+ L+ L FE+
Sbjct  61   SITTKQFFDQYQKASGIDLWNSHYEKMQEVLRQLKDVNKKLRTHIRQRLGDCLDHLGFEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L +L ++   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E + R EDP +G++
Sbjct  121  LLDLEKESQEAVYVIRERKLKVIGNKLETSKKKVRSAQDVYKKLMHEFDIRGEDPQFGMI  180

Query  648  DHEGDYNSVLGFAN--GGHRILALRLQP  725
            +  G+Y ++ G+       RIL LRLQP
Sbjct  181  EDAGEYETIYGYPPHIATQRILTLRLQP  208



>ref|XP_006403587.1| hypothetical protein EUTSA_v10010683mg [Eutrema salsugineum]
 gb|ESQ45040.1| hypothetical protein EUTSA_v10010683mg [Eutrema salsugineum]
Length=232

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 183/232 (79%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+WS+H+E+MQE  +KL + NR LR +I+QR+GE L++L  E+
Sbjct  61   NTTTKEIIDLYQTVSDVDVWSTHYERMQETKRKLLETNRNLRTQIKQRLGECLDELDVEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHHH+ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHHYPNHALHAASASDIITFHLLE  232



>gb|AGS42079.2| AP3a [Brassica oleracea var. viridis]
 emb|CDX73487.1| BnaC08g25160D [Brassica napus]
Length=232

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 182/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+WS+H+E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIIDLYQTVSDVDVWSAHYERMQETKRKLLETNRKLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   + HHH+ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRYHQNQHHHYPNHALHAPSASDIITFHLLE  232



>gb|ACY08911.1| MADS-domain transcription factor, partial [Camellia japonica]
Length=193

 Score =   265 bits (676),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 156/176 (89%), Gaps = 1/176 (1%)
 Frame = +3

Query  201  KAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQ  380
            KA+ELTVLCDAKVSI+M+S++GKLHE+ISPST+TKQ++DQYQK +G+DLW SH+E+MQE 
Sbjct  1    KANELTVLCDAKVSIIMVSSTGKLHEFISPSTSTKQMYDQYQKALGIDLWCSHYERMQEH  60

Query  381  LKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETH  560
            LKKL+DVN+ LR EIRQRMG+ LNDLS+E+L  L +D+++S+K+IR+RKYKV+ NQIET 
Sbjct  61   LKKLKDVNKNLRTEIRQRMGDCLNDLSYEELCGLEQDMESSVKIIRDRKYKVLNNQIETQ  120

Query  561  KKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHRILALRLQP  725
            KKK RNVEEIHRNLL +  +++EDP YGLVD+   YNS+LGF+NGGH ILALRLQP
Sbjct  121  KKKKRNVEEIHRNLLHQVNSKEEDPQYGLVDNGVHYNSILGFSNGGHGILALRLQP  176



>ref|XP_009116122.1| PREDICTED: floral homeotic protein APETALA 3 [Brassica rapa]
 gb|AAB08877.1| homeotic protein boi1AP3 [Brassica oleracea var. italica]
Length=232

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 183/232 (79%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+WS+H+E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIIDLYQTVSDVDVWSAHYERMQETKRKLLETNRKLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHHH+ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRYHQNHHHHYPNHALHAPSASDIITFHLLE  232



>gb|ABD24434.1| APETALA3-3 [Brassica napus]
Length=232

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 183/232 (79%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+WS+H+E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIIDLYQTVSDVDVWSAHYERMQETKRKLLETNRKLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHHH+ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRYHQNHHHHYPNHTLHAPSASDIITFHLLE  232



>gb|ADU56836.1| MADS-box protein DEF subfamily [Coffea arabica]
 gb|AHW58039.1| TM6 [Coffea arabica]
Length=219

 Score =   265 bits (678),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 164/207 (79%), Gaps = 3/207 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+I++IEN TNRQVTYSKRRNG+FKKAHEL+VLCDAKVS++M+S + K HEY SP
Sbjct  1    MGRGKIEIRKIENSTNRQVTYSKRRNGIFKKAHELSVLCDAKVSLIMLSDTKKFHEYTSP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTK++ D YQ  VGVDLWS+H+EKMQE L++L++ N  LRR+IRQRMGE LNDL+++ 
Sbjct  61   SITTKKVMDDYQSAVGVDLWSTHYEKMQENLRRLKETNNKLRRDIRQRMGEDLNDLNWDN  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQ-EDP-YGL  644
            +  L E + +S+ +IR RKY VI NQ +T+KKKVRN++E H NLL + EAR  EDP YG+
Sbjct  121  MCRLQEKIVDSLAIIRHRKYHVIKNQTDTYKKKVRNLKERHGNLLYDLEARSCEDPKYGI  180

Query  645  VDHEGDYNSVLGFANGG-HRILALRLQ  722
            VD+  DYNS L  A+GG   + ALRLQ
Sbjct  181  VDNARDYNSALALADGGLSNLYALRLQ  207



>gb|AIU94279.1| APETALA3-like protein transcript variant 1 [Prunus pseudocerasus]
Length=204

 Score =   265 bits (676),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 171/204 (84%), Gaps = 4/204 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKAHELTVLCDA VS++M+S+SGK+HEYISP
Sbjct  1    MARGKIQIKRIENATNRQVTYSKRRNGLFKKAHELTVLCDATVSLIMVSSSGKIHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQR-MGESLNDLSFE  467
            STTTKQ FDQ+QKT GVD+WSSH+E MQE LKKL++VNR+LR++IRQR +GE LND+SF+
Sbjct  61   STTTKQFFDQFQKTKGVDIWSSHYEAMQEHLKKLKEVNRSLRKQIRQRVLGECLNDMSFD  120

Query  468  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGL  644
            +L  + ++++ ++ +IR+RK ++I NQI+T KKK+R+  E++RNL    +A ++DP Y L
Sbjct  121  ELRGVGQEMEGAVDVIRKRKNRMISNQIDTTKKKLRSATEMNRNLREFIKAARDDPHYRL  180

Query  645  VDHEG-DYNSVLGFAN-GGHRILA  710
            V++ G DY S  G+++ GG RI A
Sbjct  181  VENGGEDYESAFGYSSKGGPRIFA  204



>gb|ABR18734.1| MADS-box transcription factor HAM2 [Helianthus annuus]
Length=239

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 168/208 (81%), Gaps = 3/208 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSI+M+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S T KQ FDQYQK  GVDLW+SH++KMQ++L++ ++VNR LR++IRQR+G+ L DLSFE+
Sbjct  61   SITMKQFFDQYQKASGVDLWNSHYQKMQDELRQQKEVNRNLRKQIRQRLGDCLEDLSFEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L +D   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E + R EDP YGL+
Sbjct  121  LLALEKDSQEAVYVIRERKLKVIGNKVETSKKKVRSAQDVYKKLMHEFDIRGEDPQYGLI  180

Query  648  DHEGDYNSVLGFANGG--HRILALRLQP  725
            ++  +Y++V G+   G    IL LRLQP
Sbjct  181  ENGIEYDNVYGYPQMGAPPHILTLRLQP  208



>gb|AAO22988.1| MADS-box transcription factor CDM19 [Chrysanthemum x morifolium]
Length=232

 Score =   265 bits (678),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = +3

Query  117  RGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPST  296
            RGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSI+M+S + KLHEYISPS 
Sbjct  2    RGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISPSI  61

Query  297  TTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLT  476
            T KQ FDQYQKT G+DLW+SH++KMQE+L++ ++VNR LR++IRQR+G+ L DL FE+L 
Sbjct  62   TMKQFFDQYQKTTGIDLWNSHYQKMQEELRQQKEVNRNLRKQIRQRLGDCLEDLGFEELL  121

Query  477  ELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDH  653
             L +D   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E + R EDP YG+++ 
Sbjct  122  ALEKDSQEAVYIIRERKLKVIGNKVETSKKKVRSAQDVYKKLMHEFDIRGEDPQYGMIED  181

Query  654  EGDYNSVLGFAN-GGHRILALRLQP  725
              DY +V G+ + G   IL LRLQP
Sbjct  182  GVDYENVYGYPHMGAQHILTLRLQP  206



>ref|XP_006473587.1| PREDICTED: floral homeotic protein DEFICIENS-like [Citrus sinensis]
Length=223

 Score =   265 bits (677),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 167/208 (80%), Gaps = 3/208 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVT+SKRRNGLFKKA ELTVLCDAKVSI+M S++GK+ EY+S 
Sbjct  3    MARGKIQIKRIENATNRQVTFSKRRNGLFKKAQELTVLCDAKVSIIMCSSTGKVQEYVSS  62

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQL D+YQ+ + +DLWSS +EKMQ+ LK L++VN  L++EIRQR+GESLNDLS ++
Sbjct  63   STTTKQLLDEYQRRLKIDLWSSQYEKMQKNLKNLKEVNINLKKEIRQRLGESLNDLSLKK  122

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLL--LECEARQEDP-YG  641
            L++L +DVDN +++IRERK + I  QI TH+KKVR  EE +R L       A++ED  Y 
Sbjct  123  LSDLEQDVDNCLRIIRERKLRAISGQIVTHRKKVRREEEENRKLRNGFIINAKEEDQHYE  182

Query  642  LVDHEGDYNSVLGFANGGHRILALRLQP  725
            LVD+EG Y+SV+ F NGG  I ALRLQP
Sbjct  183  LVDNEGHYDSVIRFQNGGPGIFALRLQP  210



>gb|AAD53325.1|AF180364_1 DEFICIENS homolog DEF1 [Hieracium piloselloides]
Length=224

 Score =   265 bits (677),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 168/208 (81%), Gaps = 4/208 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAKVSI+M+S + KLHEYISP
Sbjct  1    MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQ FDQYQK  G+DLW+SH+EKMQE+L++L++VN+ LRR+IRQR+G+ L  L FE+
Sbjct  61   STTTKQFFDQYQKAAGIDLWNSHYEKMQEELRQLKEVNKNLRRQIRQRLGDCLEHLGFEK  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L +L ++   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E   R EDP +G++
Sbjct  121  LLDLEKESQEAVYIIRERKLKVIGNKLETSKKKVRSAQDVYKKLMHEFGIRGEDPQFGMI  180

Query  648  DHEGDYNSVLGFAN--GGHRILALRLQP  725
            + +G+Y++V G+       RIL  RL P
Sbjct  181  E-DGEYDAVYGYPPQMSAPRILTFRLHP  207



>gb|AGH39930.1| truncated MADS domain protein [Leptopyrum fumarioides]
Length=207

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 166/206 (81%), Gaps = 5/206 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS++M ST+GKL E+ISP
Sbjct  1    MGRGKIEIKRIENTTNRQVTYSKRRTGIVKKARELTVLCDAEVSLIMFSTTGKLSEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL-NDLSFE  467
            STTTK+++DQYQ+  G++LW+SHFEKMQE LKK ++ N  LR EIRQR+GESL +D+SF+
Sbjct  61   STTTKKVYDQYQQVSGINLWNSHFEKMQESLKKQKETNMRLRNEIRQRIGESLYDDMSFD  120

Query  468  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLV  647
            +L  L +D+D S+KL+R+RKY +I  Q ET++KK+RN++E H +L+ E EAR EDPY   
Sbjct  121  ELRGLEQDLDESVKLVRDRKYHMIATQTETYRKKLRNLQETHTHLVREFEARGEDPY---  177

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
             +EGDY S+LG  +G   +++ RLQP
Sbjct  178  -YEGDYESLLGMPSGSAHLVSYRLQP  202



>gb|AHH28321.1| MADS-box transcription factor, partial [Garcia nutans]
Length=210

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 158/187 (84%), Gaps = 3/187 (2%)
 Frame = +3

Query  174  SKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWS  353
            SKRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHEY+SPS TTKQLFDQYQKT+GVDLW 
Sbjct  1    SKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYVSPSPTTKQLFDQYQKTLGVDLWI  60

Query  354  SHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYK  533
            + +E++QE LKKL+DVNR L  EIRQRMGE LND SFE L  L ED+D ++K+IRERK +
Sbjct  61   TQYERLQEHLKKLKDVNRNLWTEIRQRMGECLNDASFEHLLSLEEDMDTALKVIRERKNR  120

Query  534  VIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHRILA  710
            VI NQIET+KKK+RNVE+IHRNLL E +AR EDP YGLVD+ GDY+S++G  +GG R + 
Sbjct  121  VITNQIETYKKKLRNVEQIHRNLLHEFDARDEDPLYGLVDNGGDYDSMIGLHSGGIRNIF  180

Query  711  --LRLQP  725
              LRLQP
Sbjct  181  GRLRLQP  187



>ref|XP_009798453.1| PREDICTED: floral homeotic protein DEFICIENS-like [Nicotiana 
sylvestris]
Length=225

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IK+IEN TNRQVTYSKRRNG+ KKA ELTVLCDAK+S++M+S++ K HEY SP
Sbjct  1    MGRGKIEIKKIENSTNRQVTYSKRRNGIIKKAKELTVLCDAKISLLMLSSTRKFHEYTSP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TT K++ DQYQ+T+GVD+WS+H+E+MQE LK+L+++N  LRREIRQR GE ++ LS ++
Sbjct  61   NTTQKKMIDQYQRTLGVDIWSTHYERMQENLKRLKEINNKLRREIRQRTGEDMSGLSLQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E++  S+  IRERKY VI  Q +T +KKV+N+E+ H NL+L+ EA+ EDP YG+V
Sbjct  121  LCHLQENISESLDEIRERKYHVIKTQTDTCRKKVKNLEKRHGNLVLDLEAKSEDPKYGVV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            ++EG YNS + FANG H + A RLQ 
Sbjct  181  ENEGQYNSAMAFANGVHNLYAFRLQS  206



>gb|ABF67492.1| MADS-domain transcription factor [Marcgravia umbellata]
Length=209

 Score =   263 bits (672),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 158/190 (83%), Gaps = 1/190 (1%)
 Frame = +3

Query  159  RQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVG  338
            RQVT+ KRRNGLFKKA EL+VLCDA+VSI+M S++GKLHEYISPS +TKQLFDQYQKTVG
Sbjct  1    RQVTFCKRRNGLFKKARELSVLCDARVSIIMFSSTGKLHEYISPSISTKQLFDQYQKTVG  60

Query  339  VDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIR  518
            +DLWS H+E+MQE LKKL++VN  LRREIRQRMGESL++L +  L  L   +D+S++LIR
Sbjct  61   IDLWSIHYERMQEHLKKLKEVNGGLRREIRQRMGESLDELRYADLLALEHAMDSSLQLIR  120

Query  519  ERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGG  695
            +RK KVIGNQIET KKK++NVE+IHRNLL E + R+++P YGLVD+ G+Y    GF    
Sbjct  121  DRKNKVIGNQIETFKKKLKNVEQIHRNLLQEFDLREDEPHYGLVDNGGEYAPFNGFTTRS  180

Query  696  HRILALRLQP  725
             RILA+RLQP
Sbjct  181  PRILAVRLQP  190



>ref|XP_010504236.1| PREDICTED: floral homeotic protein APETALA 3-like [Camelina sativa]
Length=232

 Score =   263 bits (672),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+WS+ +E+MQE  +KL + NR LR +I+QR+GE L +L + +
Sbjct  61   NTTTKEIVDLYQSISDVDVWSTQYERMQETKRKLLETNRNLRTQIKQRLGECLEELDYHE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKIKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+EGDY+SVLG+   G R  ALR   +HHHH+ +  LH+   SD+ TF LLE
Sbjct  181  DNEGDYDSVLGYQIEGSRAYALRYHQNHHHHYPNHALHAPSASDIITFHLLE  232



>gb|AAF73931.1|AF230702_1 MADS box transcription factor AP3 [Hydrangea macrophylla]
Length=202

 Score =   261 bits (668),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 157/181 (87%), Gaps = 2/181 (1%)
 Frame = +3

Query  186  NGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSSHFE  365
            NGLFKKA+ELTVLCDAKVSI+M ST+ KLHEYISPS +TK+LFD YQ T+G+DLWSSH+E
Sbjct  1    NGLFKKANELTVLCDAKVSIIMFSTTNKLHEYISPSISTKELFDLYQTTMGIDLWSSHYE  60

Query  366  KMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGN  545
            +MQE LKKL+DVNR LR EIRQRMGESLNDLS++ L  L +++D+S+K+IRERKY+V+GN
Sbjct  61   RMQENLKKLKDVNRNLRMEIRQRMGESLNDLSWKDLRGLEQEMDSSVKIIRERKYRVLGN  120

Query  546  QIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGG-HRILALRL  719
            QI+TH+KKVRN EEIHR ++ E E ++EDP YGLVD+ G+Y+SVLGF N G  RI+A RL
Sbjct  121  QIDTHRKKVRNAEEIHRYIIHEFEVKEEDPHYGLVDNGGNYDSVLGFPNDGPPRIVAFRL  180

Query  720  Q  722
            Q
Sbjct  181  Q  181



>ref|XP_002533305.1| Floral homeotic protein DEFICIENS, putative [Ricinus communis]
 gb|EEF29082.1| Floral homeotic protein DEFICIENS, putative [Ricinus communis]
Length=235

 Score =   263 bits (671),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 158/206 (77%), Gaps = 2/206 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSG-KLHEYIS  287
            M RGKI+IK+IEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS++M S SG K HE+IS
Sbjct  1    MGRGKIEIKKIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNSGRKFHEFIS  60

Query  288  PSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFE  467
            P TTTK++FDQYQKT+G+DLW +H+E+MQ+ LKKL D+N  LRR+IRQRMGE LNDLSF+
Sbjct  61   PGTTTKKIFDQYQKTLGIDLWITHYERMQDHLKKLNDINNKLRRDIRQRMGEDLNDLSFD  120

Query  468  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGL  644
            +L  L + +  ++ +IRERKY  I  Q  T +KK RN+ E HR LL   EA  EDP YGL
Sbjct  121  ELRGLEQRMAPALHMIRERKYHFIETQTNTKRKKERNLVERHRELLQRYEANCEDPQYGL  180

Query  645  VDHEGDYNSVLGFANGGHRILALRLQ  722
            VD+EGDY S +  ANG   + + RL 
Sbjct  181  VDYEGDYESAIALANGASNLYSFRLH  206



>ref|XP_011028630.1| PREDICTED: floral homeotic protein DEFICIENS-like [Populus euphratica]
Length=229

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 158/205 (77%), Gaps = 1/205 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IK+IEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS++M S + K HEYISP
Sbjct  1    MGRGKIEIKKIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTNKFHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTK+++DQYQK +G+DLWS+ +EKMQEQL+KL+D+N  L++EIRQR+GE LN+LS + 
Sbjct  61   STTTKKIYDQYQKALGIDLWSTQYEKMQEQLRKLKDINHKLKKEIRQRIGEDLNELSIDH  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L  ++  ++  +R RKY VI  Q ET+KKKVR++EE H NL +E EA+ EDP +GLV
Sbjct  121  LRVLEHNMTEALNGVRGRKYHVIKTQTETYKKKVRSLEERHGNLWMEYEAKMEDPRFGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQ  722
            D EG Y S     NG   + A RL 
Sbjct  181  DSEGGYESAAALVNGASNLYAFRLH  205



>dbj|BAC79180.1| MADS-box protein [Rosa rugosa]
Length=229

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 170/209 (81%), Gaps = 5/209 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIEN TNRQVTYSKRRNGLFKKA+ELTVLCDAKVS++M+S+SGKLHE+ISP
Sbjct  1    MARGKIQIKRIENVTNRQVTYSKRRNGLFKKANELTVLCDAKVSLLMVSSSGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQ++D+YQK +G+DLW SH+E MQE LKKL+++N++LRR+I  R+GE LNDL F +
Sbjct  61   STTTKQVYDEYQKLLGIDLWKSHYETMQENLKKLKEINKSLRRQISHRVGECLNDLRFAE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  650
            L  L ++++++++++R RK K+I NQI+T +KK+RN  E +R  L E +A +E  YGLVD
Sbjct  121  LHSLEKEMESAVEVVRNRKLKLISNQIDTKRKKIRNATECNRR-LYEYDAMEEPHYGLVD  179

Query  651  HEGDY--NSVLGFANG--GHRILALRLQP  725
              GDY  ++V+G++     H +  LRLQP
Sbjct  180  DGGDYYDSAVIGYSANEDPHNVFPLRLQP  208



>ref|XP_010271509.1| PREDICTED: floral homeotic protein DEFICIENS-like [Nelumbo nucifera]
Length=225

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS++M S++GK  EYIS 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIVKKARELTVLCDAEVSLIMFSSTGKFSEYISH  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++FD+YQ+  G++LWSSH+E+MQE L K +++N  L+REIR+RMG  L+D+S E+
Sbjct  61   TTTTKKIFDRYQQVSGINLWSSHYERMQEHLNKQKEINNNLQREIRRRMGGDLDDMSIEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++NS+K++RERKY VI  Q +T+KKK+RN++E H NLL + E R EDP YGLV
Sbjct  121  LRGLEQNLENSLKVVRERKYHVISTQTDTYKKKIRNLQEAHTNLLRQFEERDEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D++ DY S LG +N G  + + RLQP
Sbjct  181  DNDADYESSLGLSNAGSHLFSFRLQP  206



>ref|XP_002877970.1| APETALA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54229.1| APETALA3 [Arabidopsis lyrata subsp. lyrata]
Length=232

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTVSDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L +++DN+ KL+RERK K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMDNTFKLVRERKIKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHHH+ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHHYPNHALHAPSASDIITFHLLE  232



>gb|AGH39927.1| MADS domain protein [Isopyrum manshuricum]
Length=223

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 169/207 (82%), Gaps = 6/207 (3%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS++M S++GKL E+ISP
Sbjct  1    MGRGKIEIKRIENTTNRQVTYSKRRTGIVKKARELTVLCDAEVSLIMFSSTGKLSEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL-NDLSFE  467
            STTTK+++DQYQ+  G+DLW+SH+EKMQE LKK ++ N  LR+EIRQR+GESL +D+SF+
Sbjct  61   STTTKKIYDQYQQLSGIDLWNSHYEKMQESLKKQKETNMKLRKEIRQRIGESLDDDMSFD  120

Query  468  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLV  647
            +L  L +D+D S+KL+R+RKY +I  Q ET++KK+RN++E H +L+ E EAR EDPY   
Sbjct  121  ELRSLEQDLDESVKLVRDRKYHMIATQTETYRKKLRNLQETHTHLVREFEARGEDPY---  177

Query  648  DHEGDYNSVLGFANGG-HRILALRLQP  725
             +EGDY ++LG ++GG   +++ R+QP
Sbjct  178  -YEGDYEALLGMSSGGAAHLVSYRVQP  203



>gb|AHH28294.1| MADS-box transcription factor, partial [Clutia sp. DAV B80.252/F1980.8371]
Length=206

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 155/185 (84%), Gaps = 2/185 (1%)
 Frame = +3

Query  177  KRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSS  356
            KRRNGLFKKA+ELTVLCDAKVSI+M S++GKLHEYIS ST+ KQ +DQYQK  G+DLW++
Sbjct  1    KRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYISSSTSMKQFYDQYQKNAGIDLWNT  60

Query  357  HFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKV  536
            H+E+MQE L+K ++ NR LRREIRQRMG+ LNDL FE L  L +D+D ++  IRERK +V
Sbjct  61   HYERMQESLRKQKETNRNLRREIRQRMGDCLNDLKFEDLRFLEQDMDTALTNIRERKNRV  120

Query  537  IGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHR-ILA  710
            I NQIET+KKK+RNVEEIHRNLL E E+R++DP YGLVD+ GDY+SV G+ NGG R + A
Sbjct  121  ITNQIETYKKKLRNVEEIHRNLLHEFESREDDPHYGLVDNGGDYDSVFGYQNGGPRNMFA  180

Query  711  LRLQP  725
            LRLQP
Sbjct  181  LRLQP  185



>gb|AAM64919.1| floral homeotic protein APETALA3 (AP3) [Arabidopsis thaliana]
Length=232

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE LN L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLNKLDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHH++ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE  232



>gb|ACY08907.1| MADS-domain transcription factor, partial [Primula denticulata]
Length=209

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = +3

Query  159  RQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPS-TTTKQLFDQYQKTV  335
            RQVTYSKRRNGLFKKA EL VLCDAKVSI+M+S + K+HE+ SP   TTKQLFDQYQ+T+
Sbjct  1    RQVTYSKRRNGLFKKAGELAVLCDAKVSIIMLSGTNKIHEFHSPDHVTTKQLFDQYQQTM  60

Query  336  GVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLI  515
            G+DLWSSH+EKMQE L+K +++N+ LR+EIRQRMG+SL++L   +L  L +D++ S++ I
Sbjct  61   GIDLWSSHYEKMQEDLRKRKEINKNLRQEIRQRMGDSLSELDLNKLQTLEQDMEKSLEAI  120

Query  516  RERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANG  692
            R RKYKVIGNQIET +KKVRN EE+HR LLLE +AR+EDP YGLVD+ GDY+SV+G+ N 
Sbjct  121  RGRKYKVIGNQIETSRKKVRNGEEVHRTLLLEFDAREEDPHYGLVDNGGDYDSVIGYTNE  180

Query  693  GH-RILALRLQP  725
            G  R+L+LRLQP
Sbjct  181  GEPRMLSLRLQP  192



>gb|ADD14338.1| APETALA3 [Spinacia oleracea]
Length=214

 Score =   260 bits (665),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 171/207 (83%), Gaps = 4/207 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IEN TNRQVTYSKRRNGLFKKA+EL+VLCDA VSIVMIS S KLHE+++P
Sbjct  1    MARGKIQIKKIENNTNRQVTYSKRRNGLFKKANELSVLCDATVSIVMISNSNKLHEFLTP  60

Query  291  -STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFE  467
             +TTTK+++D+YQ  +GVDLW+  ++KMQE+L+KL D+NR L+++IR+RMG+ L DL++ 
Sbjct  61   GTTTTKEVYDKYQAAMGVDLWAKQYQKMQEELQKLNDINRGLQKDIRRRMGDCLEDLTYH  120

Query  468  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGL  644
            +L+ L E++ NS+K+IRERK K I N I+T KKKVRN  E+H++LL   +  +++P YGL
Sbjct  121  ELSSLKEEMVNSVKVIRERKAKKIENHIDTTKKKVRNCNEVHKSLLQAFDIPKDEPQYGL  180

Query  645  VDHEGDYNSVLGFANGGHRILALRLQP  725
            VD+ G+YN VLG+ N   RILALRLQP
Sbjct  181  VDN-GEYNHVLGY-NDDSRILALRLQP  205



>gb|ABP01802.1| MADS transcription factor AP3-3 [Aquilegia vulgaris]
Length=221

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 167/206 (81%), Gaps = 5/206 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS++M S++GKL E+ISP
Sbjct  1    MGRGKIEIKRIENTTNRQVTYSKRRTGIVKKARELTVLCDAEVSLIMFSSTGKLSEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL-NDLSFE  467
            STTTK+++DQYQ+  G++LW+SH+EKMQE LKK ++ N  LRREIRQR+GESL +D+SF+
Sbjct  61   STTTKKIYDQYQQVSGINLWNSHYEKMQESLKKQKETNMRLRREIRQRIGESLDDDMSFD  120

Query  468  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLV  647
            +L  L +D+D S+KL+R+RKY +I  Q ET++KK+RN++E H +L+ E E R EDPY   
Sbjct  121  ELRSLEQDLDESVKLVRDRKYHMIATQTETYRKKLRNLQETHTHLVREFETRGEDPY---  177

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
             +EGDY S+LG ++ G  +++ R+QP
Sbjct  178  -YEGDYESLLGMSSVGAHLVSYRVQP  202



>ref|XP_006292594.1| hypothetical protein CARUB_v10018833mg [Capsella rubella]
 gb|EOA25492.1| hypothetical protein CARUB_v10018833mg [Capsella rubella]
Length=232

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 180/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+WS+ +E+MQE  +KL + NR LR +I+QR+GE L +L + +
Sbjct  61   NTTTKEIVDLYQSISDVDVWSTQYERMQETKRKLLETNRNLRTQIKQRLGECLEELDYHE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKIKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHHH+ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHHYPNHALHAPSASDIITFHLLE  232



>gb|AAD51901.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 182/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRVGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKSKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHH++ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE  232



>ref|NP_191002.1| Floral homeotic protein APETALA 3 [Arabidopsis thaliana]
 sp|P35632.1|AP3_ARATH RecName: Full=Floral homeotic protein APETALA 3 [Arabidopsis 
thaliana]
 gb|AAA32740.1| APETELA3 [Arabidopsis thaliana]
 gb|AAD51888.1| floral homeotic protein AP3 [Arabidopsis thaliana]
 gb|AAD51889.1| floral homeotic protein AP3 [Arabidopsis thaliana]
 gb|AAD51891.1| floral homeotic protein AP3 [Arabidopsis thaliana]
 gb|AAD51893.1| floral homeotic protein AP3 [Arabidopsis thaliana]
 gb|AAD51900.1| floral homeotic protein AP3 [Arabidopsis thaliana]
 gb|AAD51903.1| floral homeotic protein AP3 [Arabidopsis thaliana]
 emb|CAB81799.1| floral homeotic protein APETALA3 (AP3) [Arabidopsis thaliana]
 gb|AAL49893.1| putative floral homeotic protein APETALA3 (AP3) [Arabidopsis 
thaliana]
 gb|AAN13159.1| putative floral homeotic protein APETALA3 (AP3) [Arabidopsis 
thaliana]
 gb|AEE79216.1| Floral homeotic protein APETALA 3 [Arabidopsis thaliana]
Length=232

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 182/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHH++ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE  232



>gb|ADC79696.1| APETALA3-like protein [Euptelea pleiosperma]
 gb|AEG25813.1| APETALA3-like protein [Euptelea pleiosperma]
Length=223

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 166/206 (81%), Gaps = 2/206 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS++M S +GKL E+ISP
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRAGIMKKAQELTVLCDAEVSLIMFSNTGKLFEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            ST+TK++FD+YQ   G++LW+SH+E+MQ+ L + +++N  LRREIRQR+GE LNDL+ ++
Sbjct  61   STSTKKIFDRYQHAQGINLWNSHYERMQDNLNRQKEINNKLRREIRQRIGEELNDLNIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L +++++S+K++R+RKY+VIG   +T++KKV+N+EE  +NLL + E   EDP Y LV
Sbjct  121  LRGLEQNLESSLKIVRDRKYQVIGTSTDTYRKKVKNLEETRKNLLRDFEMTDEDPHYALV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            DHEG Y+++ G ANGG  I A RLQP
Sbjct  181  DHEGQYDAI-GLANGGSHIFAFRLQP  205



>gb|AAD51895.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
             TTTK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   DTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHH++ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE  232



>gb|AGH39931.1| MADS domain protein [Nigella damascena]
Length=221

 Score =   260 bits (664),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 165/206 (80%), Gaps = 5/206 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS++M S++GKL EYISP
Sbjct  1    MGRGKIEIKRIENTTNRQVTYSKRRTGIVKKARELTVLCDAEVSLIMFSSTGKLSEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTK+ FDQYQ+   ++LW SH+EKMQE L+K +++N  LR+EIRQR+GES++DL+FE+
Sbjct  61   STTTKKFFDQYQQVTAINLWDSHYEKMQENLRKQKEINMKLRKEIRQRIGESVDDLTFEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  650
            L  L +D+D S+K++R+RKY +I  Q ET++KK+RN++E H +L+ E EAR EDPY    
Sbjct  121  LRGLEQDLDGSLKVVRDRKYHMIATQTETYRKKLRNLQETHTHLVREFEARGEDPY----  176

Query  651  HEGDYNSVLGFANG-GHRILALRLQP  725
            ++ DY S+LG ++G GH +   RLQP
Sbjct  177  YDADYESLLGMSSGAGHLLPYHRLQP  202



>gb|KFK34668.1| hypothetical protein AALP_AA5G175900 [Arabis alpina]
Length=232

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+WS+ +E+MQE  +KL + NR LR +I+QR+GE L++L  E+
Sbjct  61   NTTTKEIVDLYQTVSDVDVWSTQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKIKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY++VLG+   G R  ALR   +HHHH+ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDAVLGYQIEGSRAYALRYHQNHHHHYPNHSLHAPSASDIITFHLLE  232



>gb|AGH39924.1| MADS domain protein [Enemion raddeanum]
Length=222

 Score =   259 bits (663),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 169/207 (82%), Gaps = 6/207 (3%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS++M S++GKL E+ISP
Sbjct  1    MGRGKIEIKRIENTTNRQVTYSKRRTGIVKKARELTVLCDAEVSLIMFSSTGKLSEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESL-NDLSFE  467
            STTTK+++DQYQ+  G++LW+SH+EKMQE LKK ++ N  LR+EIRQR+GESL +D+SF+
Sbjct  61   STTTKKIYDQYQQLSGINLWNSHYEKMQESLKKQKETNMKLRKEIRQRIGESLDDDMSFD  120

Query  468  QLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLV  647
            +L  L +D+D S+KL+R+RKY +I  Q ET++KK+RN++E H +L+ E EAR EDPY   
Sbjct  121  ELRSLEQDLDESVKLVRDRKYHMIATQTETYRKKLRNLQETHTHLVCEFEARGEDPY---  177

Query  648  DHEGDYNSVLGFANGG-HRILALRLQP  725
             +EGDY ++LG ++GG   +++ R+QP
Sbjct  178  -YEGDYEALLGMSSGGAAHLVSYRVQP  203



>ref|XP_010515958.1| PREDICTED: floral homeotic protein APETALA 3 [Camelina sativa]
Length=232

 Score =   260 bits (664),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 180/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+WS+ +E+MQE  +KL + NR LR +I+QR+GE L +L + +
Sbjct  61   NTTTKEIVDLYQSISDVDVWSTQYERMQETKRKLLETNRNLRTQIKQRLGECLEELDYHE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKIKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHHH+ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRYHQNHHHHYPNHALHAPSASDIITFHLLE  232



>gb|AAD51887.1| floral homeotic protein AP3 [Arabidopsis thaliana]
 gb|AAD51892.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L+ L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDKLDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHH++ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE  232



>dbj|BAG68950.1| APETALA3 like protein [Hydrangea macrophylla]
Length=226

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RG+I+IKRIEN TNRQVTYSKRRNG+ KKA ELTVLCDAKVS++MIST+GK HEY SP
Sbjct  1    MGRGRIEIKRIENPTNRQVTYSKRRNGIIKKAQELTVLCDAKVSLIMISTTGKFHEYTSP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQ++DQYQKT+ +DLWS+H+E+MQE L+KL++VN  LRREI QR+GE LNDL+  +
Sbjct  61   STTTKQIYDQYQKTLDIDLWSTHYERMQEHLRKLKEVNNKLRREISQRLGEDLNDLNLNE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQED-PYGLV  647
            L +L +    S  +IRERKY V+  Q ET +KKVRN+EE + NL L+ E + ED  YGLV
Sbjct  121  LRDLEQKSAASTAVIRERKYHVLKTQTETCRKKVRNLEERYGNLFLDWEGKCEDLQYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            +++G+Y+S + FAN      A  LQP
Sbjct  181  ENDGEYDSAVAFANRVPNSYAFGLQP  206



>ref|XP_010427128.1| PREDICTED: floral homeotic protein APETALA 3-like [Camelina sativa]
Length=232

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 180/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+WS+ +E+MQE  +KL + NR LR +I+QR+GE L +L + +
Sbjct  61   NTTTKEIVDLYQSISEVDVWSTQYERMQETKRKLLETNRNLRTQIKQRLGECLEELDYHE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKIKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHHH+ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRYHQNHHHHYPNHALHAPSASDIITFHLLE  232



>gb|AAD51897.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 182/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFK+AHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKRAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHH++ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE  232



>gb|ABQ51322.1| B-class MADS-box protein TM6-2 [Carica papaya]
Length=227

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 164/206 (80%), Gaps = 2/206 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS++MIS +GKLHE+ISP
Sbjct  1    MGRGKIEIKRIENPTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMISNTGKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            + TTK++ DQYQ T+GVDLWS+H++KMQ+ LKKLR++N  LRREIRQR GE L+D S E+
Sbjct  61   TATTKKMIDQYQSTLGVDLWSTHYQKMQDNLKKLREINNKLRREIRQRSGEDLHDASVEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEAR-QEDP-YGL  644
            L  L +++ +++++IRERK+  I  Q +T+KKKVRN+EE + NLLL+ E R   DP YGL
Sbjct  121  LRGLEQNMASALEVIRERKFHTIKTQTDTYKKKVRNLEEQNGNLLLKFETRYHGDPHYGL  180

Query  645  VDHEGDYNSVLGFANGGHRILALRLQ  722
            +++E DY S +  ANG   + A RL 
Sbjct  181  IENERDYESAIALANGASNLHAFRLH  206



>dbj|BAA04665.1| APETALA3 [Arabidopsis thaliana]
Length=232

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 182/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHH++ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRRYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE  232



>gb|AAD51902.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++ +N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEKENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHH++ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHTPSASDIITFHLLE  232



>ref|XP_008241774.1| PREDICTED: floral homeotic protein DEFICIENS-like isoform X2 
[Prunus mume]
Length=235

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IK IEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS++M+S +GK+HEYISP
Sbjct  1    MGRGKIEIKLIENHTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMLSNTGKMHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK+++D YQKT+GVDLWSSH++ M++ L KL+++N  LRREIRQR+G  LN L++EQ
Sbjct  61   TTTTKRMYDDYQKTLGVDLWSSHYQAMKDTLWKLKEINNKLRREIRQRLGHDLNGLTYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L + + +S++ IRERKY V+  Q+ET+KKKV+N++E   N+L   E   EDP YG V
Sbjct  121  LHSLEDKMASSLEAIRERKYHVLKTQMETYKKKVKNLQERRGNMLHGYEVASEDPQYGYV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQ  722
            D+EGDY S +  ANG   +  + L 
Sbjct  181  DNEGDYESAVALANGASNLFTIHLH  205



>gb|AAF28894.1|AF124814_1 APETALA3 [Brassica napus]
 gb|AAT42251.1| floral homeotic protein APETALA3 [Brassica rapa subsp. chinensis]
 gb|ABD24435.1| APETALA3-4 [Brassica napus]
 emb|CDX76152.1| BnaA04g04160D [Brassica napus]
Length=224

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 160/192 (83%), Gaps = 1/192 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+WS+H+E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIIDLYQTVSDVDVWSAHYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGF  683
            D+ GDY+SVLG+
Sbjct  181  DNGGDYDSVLGY  192



>gb|AGA61783.1| apetala 3, partial [Cornus officinalis]
Length=194

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 150/173 (87%), Gaps = 1/173 (1%)
 Frame = +3

Query  210  ELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKK  389
            ELTVLCDAKVSI+M S++GKLHE+ISP TTTKQLFDQYQKT+G+DLW+SH+E+MQE LKK
Sbjct  1    ELTVLCDAKVSIIMFSSTGKLHEFISPCTTTKQLFDQYQKTLGIDLWNSHYERMQESLKK  60

Query  390  LRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKK  569
            L+D+NR  RREIRQR GESLNDLS+E L  L ED++ S+K+IR+RKYKVIGNQI+T+KKK
Sbjct  61   LKDINRNFRREIRQRTGESLNDLSYEDLLRLQEDMEISLKIIRDRKYKVIGNQIDTYKKK  120

Query  570  VRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNSVLGFANGGHRILALRLQP  725
            +R+  EIHRNLL E E ++EDP YGLVD+  DY+SVLGF+ G   I+ALRLQP
Sbjct  121  LRSAVEIHRNLLNEFEIKEEDPHYGLVDNGADYDSVLGFSGGDPHIIALRLQP  173



>gb|AAD51899.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 182/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK+K +G+QIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGSQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHH++ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE  232



>gb|ABF56128.1| APETALA3-like protein [Corylopsis pauciflora]
Length=205

 Score =   258 bits (658),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 164/209 (78%), Gaps = 9/209 (4%)
 Frame = +3

Query  189  GLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQKTVGVDLWSSHFEK  368
            GLFKKA+ELTVLCDAKVSI+M+S++GKLHEYISPSTTTKQ FDQYQ+T G+DLWSSH+E+
Sbjct  2    GLFKKANELTVLCDAKVSIIMLSSTGKLHEYISPSTTTKQSFDQYQRTSGIDLWSSHYER  61

Query  369  MQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIKLIRERKYKVIGNQ  548
            MQE L++L++VN  LRR+IRQRMGE LNDLS  +L +L ED DNS+K+IR+RKY+ I NQ
Sbjct  62   MQENLRELKEVNNKLRRQIRQRMGEHLNDLSVWELRDLEEDTDNSLKIIRDRKYRAITNQ  121

Query  549  IETHKKKVRNVEEIHRNLLLE---CEARQEDP-YGLVDHEGDYNSVLGFANGGHRILALR  716
            IET KKK RN E++HRNLL E    +AR  DP +GLVD+ GDY+SVLG  N G R+ ALR
Sbjct  122  IETCKKKKRNGEQVHRNLLHEFVSMDARNVDPHFGLVDNGGDYDSVLGLQNVGARLFALR  181

Query  717  LQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            LQP     +          SDLTT+TLLE
Sbjct  182  LQP-----NQPNLRSGSARSDLTTYTLLE  205



>ref|XP_010263856.1| PREDICTED: floral homeotic protein DEFICIENS-like [Nelumbo nucifera]
Length=225

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRR G+FKKA ELTVLCDA+VS++M S++GKL EY+S 
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRGGIFKKAAELTVLCDAEVSLIMFSSTGKLSEYVSH  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            + TTK++FD+YQ+  G++LW+SH+E+MQE L K ++VN  LRREIRQRMGE L+DLS ++
Sbjct  61   TATTKKIFDRYQQVSGINLWNSHYERMQEHLSKQKEVNNNLRREIRQRMGEDLDDLSVDE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++NS+K++RERKY VI  Q +T KKK+RN+++ + +LL + E R E P +G V
Sbjct  121  LRGLEQNMENSLKVVRERKYHVISTQTDTCKKKIRNLQDTNASLLRQLEERDEIPHFGFV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ GDY S LG AN G  + A RLQP
Sbjct  181  DNGGDYESALGLANNGSHLFAFRLQP  206



>gb|AGH39926.1| MADS domain protein [Isopyrum manshuricum]
Length=227

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 159/206 (77%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS++M+S++GK+HEYISP
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRAGIVKKAKELTVLCDAEVSLLMVSSTGKIHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S T K L+D+YQ+  G+DLW  H+EKMQE L+KL+D+N  LR+EIRQR GE L+DLSF+Q
Sbjct  61   SCTHKNLYDRYQQASGIDLWQPHYEKMQEHLQKLKDINNKLRKEIRQRNGEDLDDLSFQQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQED-PYGLV  647
            L  L ++++ S++ +R RK+ VI  Q +T KKKV+N EE H +LL E E R  D  +  +
Sbjct  121  LRGLEQNMEKSVECVRNRKFHVITTQTDTFKKKVKNHEETHNSLLREFEERDADFRFPSL  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D EGDY S +GFANG  +I A RLQP
Sbjct  181  DFEGDYQSTIGFANGNPQIFAFRLQP  206



>gb|AAY63866.1| APETALA3 [Brassica juncea]
Length=224

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 179/232 (77%), Gaps = 9/232 (4%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+WS+H+E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIIDLYQTVSDVDVWSAHYERMQETKRKLLETNRNLRTQIKQRLGECLDELDTQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E+++N+ KL+R RK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRGRKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D  GDY+SVLG+         LR QP+ HHH+ +  LH+   SD+ TF LLE
Sbjct  181  DDGGDYDSVLGY--------QLRFQPNQHHHYPNHALHAASASDIITFHLLE  224



>gb|AAD51896.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+  S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIITFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHH++ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE  232



>dbj|BAN13567.1| apetala3/pistillata-like protein [Chrysanthemum seticuspe f. 
boreale]
Length=232

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 163/205 (80%), Gaps = 2/205 (1%)
 Frame = +3

Query  117  RGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPST  296
            RGKIQIK+I + TNRQVTYSKRRNGLFKKA ELTVLCDA VSI+M+S + KLHEYISPS 
Sbjct  2    RGKIQIKKIFHSTNRQVTYSKRRNGLFKKASELTVLCDANVSIIMVSCTDKLHEYISPSI  61

Query  297  TTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLT  476
            T KQ FDQYQKT G+DLW+SH++KMQE+L++ ++VNR LR++IRQR+G+ L DL FE+L 
Sbjct  62   TMKQFFDQYQKTTGIDLWNSHYQKMQEELRQQKEVNRNLRKQIRQRLGDCLEDLGFEELL  121

Query  477  ELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDH  653
             L +D   ++ +IRERK KVIGN++ET KKKVR+ +++++ L+ E + R EDP YG+++ 
Sbjct  122  ALEKDSQEAVYIIRERKLKVIGNKVETSKKKVRSAQDVYKKLMHEFDIRGEDPQYGMIED  181

Query  654  EGDYNSVLGFAN-GGHRILALRLQP  725
              DY +V G+ + G   IL LRLQP
Sbjct  182  GVDYENVYGYPHMGAQHILTLRLQP  206



>gb|AGN54424.1| PFTM6 [Physalis pubescens]
Length=226

 Score =   258 bits (658),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 161/207 (78%), Gaps = 2/207 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IK+IEN TNRQVTYSKRRNG+FKK  ELTVLCDAK+SI+M+S++ K HEY SP
Sbjct  1    MGRGKIEIKKIENSTNRQVTYSKRRNGIFKKVKELTVLCDAKISIIMLSSTRKYHEYTSP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TT K + DQYQ T+GVD+WS+H+EKMQE L++L+++N  LRREIRQR GE ++ L+ ++
Sbjct  61   NTTIKMMIDQYQSTLGVDIWSTHYEKMQENLRRLKEINNKLRREIRQRTGEDMSGLNLQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQED--PYGL  644
            L  L E++  ++  IRERKY VI NQ  T KKKV+N+E+ H NL+L  EA+ E+   YG+
Sbjct  121  LCHLQENISEAVAEIRERKYHVIQNQTGTFKKKVKNLEQQHGNLVLGLEAKCEEDSKYGV  180

Query  645  VDHEGDYNSVLGFANGGHRILALRLQP  725
            V++EG YNS + FANG H + A RLQ 
Sbjct  181  VENEGQYNSAVAFANGVHNLYAFRLQA  207



>gb|AAP93899.1| APETALA3 [Brassica napus]
 emb|CDY13200.1| BnaC04g26350D [Brassica napus]
Length=224

 Score =   258 bits (658),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 159/192 (83%), Gaps = 1/192 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+WS+H+E+MQE  +KL + NR LR +I+QR+GE L++   ++
Sbjct  61   NTTTKEILDLYQTVSDVDVWSAHYERMQETKRKLLETNRNLRTQIKQRLGECLDEFDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGF  683
            D+ GDY+SVLG+
Sbjct  181  DNGGDYDSVLGY  192



>gb|AAD51890.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 180/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQSISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK+K +GNQIET KKK ++ + I ++L+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTKKKNKSQQNIQKDLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHH+  +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHYCPNHGLHAPSASDIITFHLLE  232



>gb|EPS57782.1| hypothetical protein M569_17035, partial [Genlisea aurea]
Length=155

 Score =   255 bits (651),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSI+MIS++ KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMISSTQKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            STTTKQ+FD YQKT+GVDLW++H+E++Q+ LKKL++ NR LR+EIRQRMGE LN+L +E+
Sbjct  61   STTTKQVFDLYQKTLGVDLWNTHYERLQDHLKKLKEGNRNLRKEIRQRMGECLNELGYEE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVR  575
            +  LIE++D S+KLIRERKYKV+ NQI+T KKKVR
Sbjct  121  VVNLIENIDASLKLIRERKYKVLANQIDTSKKKVR  155



>gb|AEM60229.1| MADS box transcription factor, partial [Solanum pennellii]
Length=204

 Score =   256 bits (655),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 158/198 (80%), Gaps = 1/198 (1%)
 Frame = +3

Query  135  KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLF  314
            K+IEN TNRQVTYSKRRNG+FKKA ELTVLCDAK+S++M+S++ K HEY SP+TTTK++ 
Sbjct  1    KKIENSTNRQVTYSKRRNGIFKKAKELTVLCDAKISLIMLSSTRKYHEYTSPNTTTKKMI  60

Query  315  DQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDV  494
            DQYQ  +GVD+WS+H EKMQE LK+L+++N  LRREIRQR GE ++ L+ ++L  L E++
Sbjct  61   DQYQSALGVDIWSTHHEKMQENLKRLKEINNKLRREIRQRTGEDMSGLNLQELCHLQENI  120

Query  495  DNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHEGDYNS  671
              S+  IRERKY VI NQ +T KKK RN+EE + NL+L+ EA+ EDP YG+V++EG YNS
Sbjct  121  TESVAEIRERKYHVIKNQTDTCKKKARNLEEQNGNLVLDLEAKCEDPKYGVVENEGHYNS  180

Query  672  VLGFANGGHRILALRLQP  725
             + FANG H + A RLQP
Sbjct  181  AVAFANGVHNLYAFRLQP  198



>gb|AAF73933.1|AF230704_1 MADS box transcription factor TM6 [Petunia x hybrida]
 gb|AAS46017.1| MADS-box protein TM6 [Petunia x hybrida]
Length=225

 Score =   257 bits (657),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 162/205 (79%), Gaps = 1/205 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IK+IEN TNRQVTYSKRRNGLFKKA ELTVLCDAK+ ++M+S++ K HEY SP
Sbjct  1    MGRGKIEIKKIENSTNRQVTYSKRRNGLFKKAKELTVLCDAKICLIMLSSTRKFHEYTSP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ+T+GVD+W+ H+EKMQE L +L+D+N  LRREIRQR GE ++ L+ ++
Sbjct  61   NTTTKKMIDLYQRTLGVDIWNKHYEKMQENLNRLKDINNKLRREIRQRTGEDMSGLNLQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L  +V +S+  IRERKY VI  Q +T +K+VRN+EE H +L+ + EA+ EDP YG+V
Sbjct  121  LCHLQGNVSDSLAEIRERKYHVIKTQTDTCRKRVRNLEEQHGSLVHDLEAKSEDPTYGVV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQ  722
            ++EG +NS + FANG H + A RLQ
Sbjct  181  ENEGHFNSAMAFANGVHNLYAFRLQ  205



>emb|CAA43171.1| TDR6 [Solanum lycopersicum]
Length=222

 Score =   257 bits (656),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 161/203 (79%), Gaps = 1/203 (0%)
 Frame = +3

Query  120  GKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTT  299
            GKI+IK+IEN TNRQVTYSKRRNG+FKK  ELTVLCDAK+S++M+S++ K HEY SP+TT
Sbjct  1    GKIEIKKIENSTNRQVTYSKRRNGIFKKRKELTVLCDAKISLIMLSSTRKYHEYTSPNTT  60

Query  300  TKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTE  479
            TK++ DQYQ  +GVD+WS H+EKMQE LK+L+++N  LRREIRQR GE ++ L+ ++L  
Sbjct  61   TKKMIDQYQSALGVDIWSIHYEKMQENLKRLKEINNKLRREIRQRTGEDMSGLNLQELCH  120

Query  480  LIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHE  656
            L E++  S+  IRERKY VI NQ +T KKK RN+EE +  L+L+ EA+ EDP YG+V++E
Sbjct  121  LQENITESVAEIRERKYHVIKNQTDTCKKKARNLEEQNGTLVLDLEAKCEDPKYGVVENE  180

Query  657  GDYNSVLGFANGGHRILALRLQP  725
            G Y+S + FANG H + A RLQP
Sbjct  181  GHYHSAVAFANGVHNLYAFRLQP  203



>ref|XP_009139246.1| PREDICTED: floral homeotic protein APETALA 3-like [Brassica rapa]
Length=224

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 160/192 (83%), Gaps = 1/192 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+WS+H+E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIIDLYQTVSDVDVWSAHYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGF  683
            ++ GDY+SVLG+
Sbjct  181  ENGGDYDSVLGY  192



>gb|AAD51898.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 181/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+R RK++ +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRARKFESLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHH++ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE  232



>gb|AAM33100.2| TDR6 transcription factor [Solanum lycopersicum]
Length=222

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 162/203 (80%), Gaps = 1/203 (0%)
 Frame = +3

Query  120  GKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTT  299
            GKI+IK+IEN TNRQVT+SKRRNG+FKK  ELTVLCDAK+S++M+S++ K HEY SP+TT
Sbjct  1    GKIEIKKIENLTNRQVTFSKRRNGIFKKRKELTVLCDAKISLIMLSSTRKYHEYTSPNTT  60

Query  300  TKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTE  479
            TK++ DQYQ  +GVD+WS H+EKMQE LK+L+++N  LRREIRQR GE ++ L+ ++L  
Sbjct  61   TKKMIDQYQSALGVDIWSIHYEKMQENLKRLKEINNKLRREIRQRTGEDMSGLNLQELCH  120

Query  480  LIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLVDHE  656
            L E++  S+  IRERKY VI NQ +T KKK RN+EE + NL+L+ EA+ EDP YG+V++E
Sbjct  121  LQENITESVAEIRERKYHVIKNQTDTCKKKARNLEEQNGNLVLDLEAKCEDPKYGVVENE  180

Query  657  GDYNSVLGFANGGHRILALRLQP  725
            G Y+S + FANG H + A RLQP
Sbjct  181  GHYHSAVAFANGVHNLYAFRLQP  203



>ref|XP_007046776.1| Floral homeotic protein DEFICIENS, putative isoform 3 [Theobroma 
cacao]
 gb|EOX90933.1| Floral homeotic protein DEFICIENS, putative isoform 3 [Theobroma 
cacao]
Length=224

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 162/203 (80%), Gaps = 2/203 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IK+IEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS++M S+SGK HE+ISP
Sbjct  1    MGRGKIEIKKIENTTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSSSGKFHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            + +TK  FD YQKT+G+DLWSSH+EKMQE  ++L+++N  LRREIRQR+GE L+DL+ ++
Sbjct  61   NISTKTFFDLYQKTLGIDLWSSHYEKMQENYRRLKEINNRLRREIRQRIGEDLDDLNIKE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDPYGLVD  650
            L  L   + +S++ +R+RKY VI  Q +T+KKKVRN+E+ H NL+L+ EA+ ED  G+V+
Sbjct  121  LQALEAKMASSLEAVRQRKYHVIKTQTDTYKKKVRNLEQRHANLVLDLEAKLED--GIVE  178

Query  651  HEGDYNSVLGFANGGHRILALRL  719
            +E  Y S +G ANG   + ALRL
Sbjct  179  NEAYYESSMGLANGASNLYALRL  201



>gb|AAD51894.1| floral homeotic protein AP3 [Arabidopsis thaliana]
Length=232

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 180/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHEYISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+W++ +E+MQE  +KL + NR LR +I+QR+GE L++L  ++
Sbjct  61   NTTTKEIVDLYQTISDVDVWATQYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++++N+ KL+RERK+K +GNQIET  KK ++ + I +NL+ E E R EDP YGLV
Sbjct  121  LRRLEDEMENTFKLVRERKFKSLGNQIETTMKKNKSQQGIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQPdhhhhhhhghlhsgggsdlTTFTLLE  803
            D+ GDY+SVLG+   G R  ALR   +HHH++ +  LH+   SD+ TF LLE
Sbjct  181  DNGGDYDSVLGYQIEGSRAYALRFHQNHHHYYPNHGLHAPSASDIITFHLLE  232



>gb|ABE11655.1| DEFICIENS [Nicotiana benthamiana]
Length=150

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +3

Query  150  QTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISPSTTTKQLFDQYQK  329
            QTNRQVTYSKRRNGLFKKA+ELTVLCDAKVSI+MIS++GKLHE+ISPS TTKQLFD YQK
Sbjct  3    QTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMISSTGKLHEFISPSVTTKQLFDLYQK  62

Query  330  TVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQLTELIEDVDNSIK  509
            TVGVDLW+SH+EKMQEQL+KL+DVNR LRREIRQRMGESLNDL++EQL EL E+VDNS+K
Sbjct  63   TVGVDLWNSHYEKMQEQLRKLKDVNRNLRREIRQRMGESLNDLNYEQLEELNENVDNSLK  122

Query  510  LIRERKYKVIGNQIETHKKKVR  575
            LIRERKYKVI NQIET+KKKVR
Sbjct  123  LIRERKYKVISNQIETYKKKVR  144



>gb|AGS42080.1| AP3.b [Brassica oleracea var. viridis]
Length=224

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 159/192 (83%), Gaps = 1/192 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+W++H+E+MQE  +KL + NR LR +I+QR+GE L++   ++
Sbjct  61   NTTTKEILDLYQTVSDVDVWNAHYERMQETKRKLLETNRNLRTQIKQRLGECLDEFDMQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGF  683
            D+ GDY+SVLG+
Sbjct  181  DNGGDYDSVLGY  192



>ref|XP_010672335.1| PREDICTED: floral homeotic protein DEFICIENS-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=225

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 166/206 (81%), Gaps = 3/206 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIK+IENQTNRQVTYSKRRNGLFKKA+ELTVLCDA VSI+M+S S K+HEYISP
Sbjct  1    MARGKIQIKKIENQTNRQVTYSKRRNGLFKKANELTVLCDATVSIIMVSNSNKIHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
              TTK+++D+YQK   VD+W   ++KMQ++L KL + NR L+R+IR+RMG+ L DL+  +
Sbjct  61   GNTTKEIYDRYQKDKKVDVWMKQYQKMQQELMKLNETNRELQRDIRRRMGDCLEDLTLNE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L ++V+NS+ +IRERK K + +QI+T KKK+RN  E+H+NLL + +  +E+P YGLV
Sbjct  121  LCCLGQEVNNSVTVIRERKMKKLDSQIDTTKKKLRNSSEVHKNLLSQFDLPKEEPQYGLV  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D+ G+YN VLG+ N   RILALRLQP
Sbjct  181  DN-GEYNHVLGY-NDDSRILALRLQP  204



>gb|AAP93898.1| APETALA3-2 [Brassica napus]
Length=224

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 158/192 (82%), Gaps = 1/192 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRIE QTNRQVTYSKRRNGLFKKAHELTVLCDA+VSI+M S+S KLHE+ISP
Sbjct  1    MARGKIQIKRIETQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK++ D YQ    VD+WS+H+E+MQE  +KL + NR LR +I+QR+GE L++   ++
Sbjct  61   NTTTKEILDLYQTVSDVDVWSAHYERMQETKRKLLETNRNLRTQIKQRLGECLDEFDIQE  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L E+++N+ KL+RERK+K +GNQIET KKK ++ ++I +NL+ E E R EDP YGLV
Sbjct  121  LRSLEEEMENTFKLVRERKFKSLGNQIETTKKKNKSQQDIQKNLIHELELRAEDPHYGLV  180

Query  648  DHEGDYNSVLGF  683
            D+ GDY+SVLG+
Sbjct  181  DNGGDYDSVLGY  192



>ref|XP_008241773.1| PREDICTED: floral homeotic protein DEFICIENS-like isoform X1 
[Prunus mume]
Length=238

 Score =   256 bits (653),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 161/208 (77%), Gaps = 4/208 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IK IEN TNRQVTYSKRRNG+FKKA ELTVLCDAKVS++M+S +GK+HEYISP
Sbjct  1    MGRGKIEIKLIENHTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMLSNTGKMHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            +TTTK+++D YQKT+GVDLWSSH++ M++ L KL+++N  LRREIRQR+G  LN L++EQ
Sbjct  61   TTTTKRMYDDYQKTLGVDLWSSHYQAMKDTLWKLKEINNKLRREIRQRLGHDLNGLTYEQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLL---LECEARQEDP-Y  638
            L  L + + +S++ IRERKY V+  Q+ET+KKKV+N++E   N+L    + E   EDP Y
Sbjct  121  LHSLEDKMASSLEAIRERKYHVLKTQMETYKKKVKNLQERRGNMLHGYFDQEVASEDPQY  180

Query  639  GLVDHEGDYNSVLGFANGGHRILALRLQ  722
            G VD+EGDY S +  ANG   +  + L 
Sbjct  181  GYVDNEGDYESAVALANGASNLFTIHLH  208



>gb|ABF67488.1| MADS-domain protein [Impatiens hawkeri]
Length=188

 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 155/187 (83%), Gaps = 2/187 (1%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MARGKIQIKRI+N TNRQVTYSKRRNGLFKKA ELTVLCDAKVSI+M S++GKLHEYIS 
Sbjct  1    MARGKIQIKRIDNDTNRQVTYSKRRNGLFKKAGELTVLCDAKVSIIMXSSTGKLHEYISS  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S +TKQLFD YQ T+ VDLWSS +++MQE LKKL++ NR LR EI QRMGE+L+ L +E 
Sbjct  61   SISTKQLFDHYQNTLAVDLWSSKYQRMQEHLKKLKEANRLLRLEISQRMGENLSQLCYED  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP--YGL  644
            + +L +DVD+S++ IR+RK+KV+GNQIE HKKK+RNVE+ HRNLL +   R+E+   Y L
Sbjct  121  VMKLEQDVDSSLQQIRDRKFKVLGNQIEIHKKKLRNVEQTHRNLLQQFGFREEEETQYAL  180

Query  645  VDHEGDY  665
             ++EG +
Sbjct  181  AENEGGW  187



>gb|AGH39923.1| MADS domain protein [Enemion raddeanum]
Length=227

 Score =   255 bits (651),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN TNRQVTYSKRR G+ KKA ELTVLCDA+VS++M+S++GK+HEYISP
Sbjct  1    MGRGKIEIKRIENSTNRQVTYSKRRAGIVKKAKELTVLCDAEVSLLMVSSTGKIHEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S T K L+D+YQ+  G DLW  H+EKMQE L+KL+D+N  LR+EIRQR GE L+DL F+Q
Sbjct  61   SCTHKNLYDRYQQASGTDLWQPHYEKMQEHLQKLKDINNKLRKEIRQRHGEDLDDLGFQQ  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQED-PYGLV  647
            L  L ++++ S++ +R RK+ VI  Q +T KKKV+N EE H +L+ E E R  D  +  +
Sbjct  121  LRGLEQNMEKSVECVRNRKFHVITTQTDTFKKKVKNHEETHNSLIREFEERDADFRFPSL  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQP  725
            D EGDY S +GFANG  +I A RLQP
Sbjct  181  DFEGDYQSTIGFANGNPQIFAFRLQP  206



>gb|AAT46097.1| APETALA3-like protein [Akebia trifoliata]
Length=225

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 157/205 (77%), Gaps = 1/205 (0%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            M RGKI+IKRIEN T+RQVTYSKRR G+ KKA ELTVLCDA+VS++M S++GK  EYISP
Sbjct  1    MGRGKIEIKRIENSTSRQVTYSKRRAGIMKKAQELTVLCDAEVSLIMFSSTGKFTEYISP  60

Query  291  STTTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSFEQ  470
            S TTKQ+FDQYQK  G+++W  H+E+MQ+ L K +++N  LRREIRQR+GE L+DL+   
Sbjct  61   SVTTKQIFDQYQKVSGINIWQPHYERMQDNLNKQKEINNKLRREIRQRIGEDLDDLTIHD  120

Query  471  LTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECEARQEDP-YGLV  647
            L  L +++++S+K +R+RK++VI  + ETHKKK +N+EE H  LL E E R ++P + + 
Sbjct  121  LRGLEQNMESSLKTVRDRKFQVISTRTETHKKKFKNMEETHAKLLREFEGRDDEPHFAMA  180

Query  648  DHEGDYNSVLGFANGGHRILALRLQ  722
             HEG+Y SVLG  NGG  + A RLQ
Sbjct  181  GHEGEYESVLGLGNGGSHVFAFRLQ  205



>emb|CAA56657.1| SLM3 [Silene latifolia subsp. alba]
Length=227

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = +3

Query  111  MARGKIQIKRIENQTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIVMISTSGKLHEYISP  290
            MAR KIQIK+IEN TNRQVTYSKRRNGLFKKA+ELTVLCDA VSI+M+S++ KLHE++SP
Sbjct  1    MARRKIQIKKIENLTNRQVTYSKRRNGLFKKANELTVLCDATVSIIMLSSNLKLHEFLSP  60

Query  291  ST--TTKQLFDQYQKTVGVDLWSSHFEKMQEQLKKLRDVNRALRREIRQRMGESLNDLSF  464
             +  TTK ++D+YQK +GVD+W +H ++MQ+ L+KL ++NR L+ +IRQRMG+ L DLSF
Sbjct  61   GSNLTTKDVYDRYQKALGVDIWVTHEKRMQDDLQKLNELNRKLQTDIRQRMGDCLEDLSF  120

Query  465  EQLTELIEDVDNSIKLIRERKYKVIGNQIETHKKKVRNVEEIHRNLLLECE-ARQEDPYG  641
            E+L  L +++  ++ LIRERKYK I NQI+T KKKVRN +E+H+ LL E E  + E PYG
Sbjct  121  EELCRLGQEMQEAVTLIRERKYKKIDNQIDTTKKKVRNGQEVHKGLLQEFEIPKDEPPYG  180

Query  642  LVDHEGDYNSVLGFANGGHRILALRLQP  725
            LVD+ GDY++V+G+ N   R+LALRLQP
Sbjct  181  LVDN-GDYSNVMGY-NDASRVLALRLQP  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2327078598528