BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23905_g1_i1 len=818 path=[820:0-196 925:197-527 188:528-817]

Length=818
                                                                      Score     E

ref|XP_002315473.2|  hypothetical protein POPTR_0010s00580g             444   4e-153   Populus trichocarpa [western balsam poplar]
ref|XP_011000979.1|  PREDICTED: SWI/SNF-related matrix-associated...    446   1e-149   
ref|XP_010999353.1|  PREDICTED: SWI/SNF-related matrix-associated...    446   2e-149   
emb|CDO98684.1|  unnamed protein product                                441   2e-147   
ref|XP_011073843.1|  PREDICTED: SWI/SNF-related matrix-associated...    439   2e-146   
ref|XP_008800331.1|  PREDICTED: SWI/SNF-related matrix-associated...    436   2e-146   
ref|XP_011073842.1|  PREDICTED: SWI/SNF-related matrix-associated...    438   2e-146   
ref|XP_003550580.2|  PREDICTED: SWI/SNF-related matrix-associated...    437   7e-146   
ref|XP_006593993.1|  PREDICTED: SWI/SNF-related matrix-associated...    436   1e-145   
gb|KHN45013.1|  SWI/SNF-related matrix-associated actin-dependent...    436   2e-145   
gb|KDP28020.1|  hypothetical protein JCGZ_19100                         436   2e-145   
ref|XP_008800329.1|  PREDICTED: SWI/SNF-related matrix-associated...    436   2e-145   
ref|XP_004508075.1|  PREDICTED: SWI/SNF-related matrix-associated...    435   2e-145   
gb|EYU36724.1|  hypothetical protein MIMGU_mgv1a003532mg                432   3e-145   
ref|XP_010241440.1|  PREDICTED: SWI/SNF-related matrix-associated...    432   5e-145   
ref|XP_007154488.1|  hypothetical protein PHAVU_003G123100g             434   2e-144   
ref|XP_007154489.1|  hypothetical protein PHAVU_003G123100g             434   2e-144   
ref|XP_010241439.1|  PREDICTED: SWI/SNF-related matrix-associated...    433   3e-144   
gb|KHN17794.1|  SWI/SNF-related matrix-associated actin-dependent...    436   2e-143   
ref|XP_009801772.1|  PREDICTED: SWI/SNF-related matrix-associated...    431   2e-143   
ref|XP_002519341.1|  Chromatin remodelling complex ATPase chain i...    430   3e-143   Ricinus communis
ref|XP_010909322.1|  PREDICTED: SWI/SNF-related matrix-associated...    430   4e-143   
gb|KDO72238.1|  hypothetical protein CISIN_1g005980mg                   429   6e-143   
ref|XP_002269671.1|  PREDICTED: SWI/SNF-related matrix-associated...    428   1e-142   Vitis vinifera
ref|XP_010649703.1|  PREDICTED: SWI/SNF-related matrix-associated...    428   2e-142   
ref|XP_006349875.1|  PREDICTED: SWI/SNF-related matrix-associated...    427   5e-142   
ref|XP_006419207.1|  hypothetical protein CICLE_v10004488mg             426   6e-142   
ref|XP_006488715.1|  PREDICTED: SWI/SNF-related matrix-associated...    426   7e-142   
gb|KHF98570.1|  Zinc finger Ran-binding domain-containing 3             425   9e-142   
ref|XP_010694067.1|  PREDICTED: SWI/SNF-related matrix-associated...    427   9e-142   
ref|XP_010694066.1|  PREDICTED: SWI/SNF-related matrix-associated...    427   1e-141   
gb|AES92088.2|  chromatin-remodeling complex ATPase chain               426   2e-141   
ref|XP_003562604.1|  PREDICTED: SWI/SNF-related matrix-associated...    425   6e-141   
ref|XP_010098747.1|  Zinc finger Ran-binding domain-containing pr...    422   1e-140   
ref|XP_009388210.1|  PREDICTED: SWI/SNF-related matrix-associated...    423   2e-140   
ref|XP_009388217.1|  PREDICTED: SWI/SNF-related matrix-associated...    423   2e-140   
ref|XP_008223495.1|  PREDICTED: SWI/SNF-related matrix-associated...    423   3e-140   
ref|XP_008378419.1|  PREDICTED: SWI/SNF-related matrix-associated...    424   4e-140   
ref|XP_007225110.1|  hypothetical protein PRUPE_ppa002731mg             420   8e-140   
ref|XP_008390341.1|  PREDICTED: putative SMARCAL1-like protein is...    423   8e-140   
ref|XP_008390343.1|  PREDICTED: putative SMARCAL1-like protein is...    423   8e-140   
ref|XP_009388201.1|  PREDICTED: SWI/SNF-related matrix-associated...    419   1e-139   
ref|XP_009388190.1|  PREDICTED: SWI/SNF-related matrix-associated...    419   2e-139   
ref|XP_004298251.1|  PREDICTED: DNA annealing helicase and endonu...    422   2e-139   
ref|XP_009359811.1|  PREDICTED: SWI/SNF-related matrix-associated...    422   2e-139   
ref|XP_009359810.1|  PREDICTED: SWI/SNF-related matrix-associated...    422   2e-139   
ref|XP_007029245.1|  Chromatin remodeling factor18 isoform 1            421   2e-139   
ref|XP_009359812.1|  PREDICTED: putative SMARCAL1-like protein is...    422   3e-139   
ref|XP_006658872.1|  PREDICTED: SWI/SNF-related matrix-associated...    421   3e-139   
gb|EEC82516.1|  hypothetical protein OsI_27014                          420   3e-139   Oryza sativa Indica Group [Indian rice]
ref|XP_010524599.1|  PREDICTED: SWI/SNF-related matrix-associated...    419   4e-139   
gb|EEE67662.1|  hypothetical protein OsJ_25277                          420   5e-139   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009388187.1|  PREDICTED: SWI/SNF-related matrix-associated...    419   5e-139   
ref|XP_002894105.1|  SNF2 domain-containing protein                     419   5e-139   
ref|XP_009388170.1|  PREDICTED: SWI/SNF-related matrix-associated...    419   7e-139   
ref|XP_009388175.1|  PREDICTED: SWI/SNF-related matrix-associated...    418   1e-138   
ref|NP_001060393.1|  Os07g0636200                                       420   1e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007029246.1|  Chromatin remodeling factor18 isoform 2            420   1e-138   
ref|XP_009388163.1|  PREDICTED: SWI/SNF-related matrix-associated...    418   2e-138   
ref|XP_009388148.1|  PREDICTED: SWI/SNF-related matrix-associated...    418   2e-138   
ref|XP_009145017.1|  PREDICTED: SWI/SNF-related matrix-associated...    415   8e-138   
ref|XP_009145015.1|  PREDICTED: SWI/SNF-related matrix-associated...    415   1e-137   
emb|CDY23679.1|  BnaA05g17500D                                          414   2e-137   
gb|KCW61402.1|  hypothetical protein EUGRSUZ_H04132                     414   2e-137   
ref|XP_003609891.1|  SWI/SNF-related matrix-associated actin-depe...    416   7e-137   
ref|XP_010024879.1|  PREDICTED: SWI/SNF-related matrix-associated...    413   2e-136   
gb|KFK36104.1|  hypothetical protein AALP_AA4G077700                    411   9e-136   
gb|EPS71202.1|  hypothetical protein M569_03554                         409   1e-135   
ref|XP_006393444.1|  hypothetical protein EUTSA_v10011287mg             408   7e-135   
ref|XP_004252958.1|  PREDICTED: SWI/SNF-related matrix-associated...    408   1e-134   
ref|XP_004958450.1|  PREDICTED: DNA annealing helicase and endonu...    407   2e-134   
ref|XP_004958449.1|  PREDICTED: DNA annealing helicase and endonu...    407   4e-134   
ref|XP_008439000.1|  PREDICTED: SWI/SNF-related matrix-associated...    406   2e-133   
ref|XP_010500354.1|  PREDICTED: SWI/SNF-related matrix-associated...    405   2e-133   
gb|EMT13497.1|  Zinc finger Ran-binding domain-containing protein 3     413   2e-133   
ref|NP_175265.3|  chromatin remodeling factor18                         404   3e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479250.1|  PREDICTED: SWI/SNF-related matrix-associated...    404   4e-133   
ref|XP_004147667.1|  PREDICTED: SWI/SNF-related matrix-associated...    405   5e-133   
ref|XP_010461644.1|  PREDICTED: SWI/SNF-related matrix-associated...    404   5e-133   
ref|XP_004160655.1|  PREDICTED: SWI/SNF-related matrix-associated...    402   5e-132   
ref|XP_006304942.1|  hypothetical protein CARUB_v10011429mg             400   9e-132   
ref|XP_011000980.1|  PREDICTED: SWI/SNF-related matrix-associated...    393   3e-129   
ref|XP_002461093.1|  hypothetical protein SORBIDRAFT_02g040560          396   4e-129   Sorghum bicolor [broomcorn]
ref|XP_006840364.1|  hypothetical protein AMTR_s00045p00120010          397   7e-128   
emb|CDY04297.1|  BnaC05g25590D                                          389   2e-127   
ref|XP_008651808.1|  PREDICTED: uncharacterized protein LOC100501...    389   3e-127   
ref|XP_008651806.1|  PREDICTED: uncharacterized protein LOC100501...    389   5e-127   
ref|XP_008651807.1|  PREDICTED: uncharacterized protein LOC100501...    382   1e-124   
gb|ADN34041.1|  chromatin remodelling complex ATPase chain isw-1        355   7e-118   
ref|XP_008800330.1|  PREDICTED: SWI/SNF-related matrix-associated...    354   3e-114   
ref|XP_010524600.1|  PREDICTED: SWI/SNF-related matrix-associated...    342   3e-110   
ref|XP_006349876.1|  PREDICTED: SWI/SNF-related matrix-associated...    343   4e-110   
ref|XP_001775787.1|  SNF2 family DNA-dependent ATPase                   341   6e-109   
ref|XP_011069340.1|  PREDICTED: SWI/SNF-related matrix-associated...    315   4e-104   
tpg|DAA63810.1|  TPA: hypothetical protein ZEAMMB73_058078              326   4e-103   
ref|XP_002970990.1|  hypothetical protein SELMODRAFT_171818             303   4e-94    
gb|AAD49766.2|AC007932_14  Contains similarity to HARP gene from ...    284   1e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002962099.1|  hypothetical protein SELMODRAFT_76516              280   9e-86    
ref|XP_004508077.1|  PREDICTED: SWI/SNF-related matrix-associated...    273   1e-83    
ref|XP_011073845.1|  PREDICTED: SWI/SNF-related matrix-associated...    272   3e-83    
ref|XP_003082907.1|  SNF2 domain-containing protein / helicase do...    266   8e-81    
ref|XP_009801773.1|  PREDICTED: SWI/SNF-related matrix-associated...    265   9e-81    
emb|CEG02026.1|  SNF2-related                                           266   4e-80    
ref|XP_001422675.1|  predicted protein                                  265   6e-80    Ostreococcus lucimarinus CCE9901
ref|XP_003063659.1|  predicted protein                                  258   1e-78    
ref|XP_009630710.1|  PREDICTED: putative SMARCAL1-like protein          245   5e-78    
ref|XP_002505551.1|  SNF2 super family                                  258   1e-76    Micromonas commoda
gb|AGT16318.1|  zinc finger Ran-binding domain-containing protein       244   2e-71    
ref|XP_007509886.1|  predicted protein                                  239   9e-70    
ref|XP_005826013.1|  hypothetical protein GUITHDRAFT_76774              234   3e-69    
tpg|DAA63809.1|  TPA: hypothetical protein ZEAMMB73_058078              231   3e-67    
ref|NP_001183352.1|  hypothetical protein                               231   3e-67    
gb|KFM27269.1|  SWI/SNF-related matrix-associated actin-dependent...    216   2e-62    
ref|XP_001426557.1|  hypothetical protein                               214   2e-60    Paramecium tetraurelia strain d4-2
ref|XP_006529479.1|  PREDICTED: DNA annealing helicase and endonu...    210   4e-60    
gb|KFO82962.1|  SWI/SNF-related matrix-associated actin-dependent...    206   6e-60    
dbj|BAC39315.1|  unnamed protein product                                211   1e-59    Mus musculus [mouse]
ref|XP_003073042.1|  Snf2/Rad54-like helicase                           209   1e-59    
gb|EDM09882.1|  rCG46237                                                212   1e-59    
ref|XP_010078857.1|  PREDICTED: SWI/SNF-related matrix-associated...    204   2e-59    
gb|KFV12864.1|  SWI/SNF-related matrix-associated actin-dependent...    204   3e-59    
ref|XP_009868008.1|  PREDICTED: SWI/SNF-related matrix-associated...    204   3e-59    
gb|KFP81262.1|  SWI/SNF-related matrix-associated actin-dependent...    204   3e-59    
ref|XP_001641644.1|  predicted protein                                  207   4e-59    Nematostella vectensis
ref|XP_006048270.1|  PREDICTED: DNA annealing helicase and endonu...    206   7e-59    
gb|KGL95190.1|  SWI/SNF-related matrix-associated actin-dependent...    209   9e-59    
ref|XP_006529477.1|  PREDICTED: DNA annealing helicase and endonu...    210   1e-58    
gb|KFQ73478.1|  SWI/SNF-related matrix-associated actin-dependent...    209   1e-58    
ref|XP_006249764.1|  PREDICTED: DNA annealing helicase and endonu...    212   1e-58    
ref|XP_006249763.1|  PREDICTED: DNA annealing helicase and endonu...    211   2e-58    
ref|XP_009874653.1|  PREDICTED: DNA annealing helicase and endonu...    209   2e-58    
ref|XP_008761005.1|  PREDICTED: LOW QUALITY PROTEIN: DNA annealin...    212   2e-58    
gb|KFP92233.1|  DNA annealing helicase and endonuclease ZRANB3          209   2e-58    
ref|XP_004318169.1|  PREDICTED: DNA annealing helicase and endonu...    204   2e-58    
gb|KFP27776.1|  SWI/SNF-related matrix-associated actin-dependent...    206   2e-58    
gb|KFZ60733.1|  DNA annealing helicase and endonuclease ZRANB3          209   2e-58    
ref|XP_010197541.1|  PREDICTED: SWI/SNF-related matrix-associated...    206   3e-58    
ref|XP_007098896.1|  PREDICTED: DNA annealing helicase and endonu...    211   3e-58    
gb|KFV53947.1|  DNA annealing helicase and endonuclease ZRANB3          211   3e-58    
ref|XP_005647940.1|  P-loop containing nucleoside triphosphate hy...    207   3e-58    
ref|XP_009810905.1|  PREDICTED: DNA annealing helicase and endonu...    211   3e-58    
ref|XP_005315903.1|  PREDICTED: DNA annealing helicase and endonu...    211   3e-58    
ref|XP_010144240.1|  PREDICTED: SWI/SNF-related matrix-associated...    204   4e-58    
dbj|GAM25136.1|  hypothetical protein SAMD00019534_083110               209   4e-58    
gb|KFQ85414.1|  DNA annealing helicase and endonuclease ZRANB3          209   4e-58    
ref|XP_006529476.1|  PREDICTED: DNA annealing helicase and endonu...    210   5e-58    
gb|AAI17923.1|  Zinc finger, RAN-binding domain containing 3            210   5e-58    Mus musculus [mouse]
ref|XP_005079935.1|  PREDICTED: DNA annealing helicase and endonu...    210   5e-58    
dbj|BAC34042.1|  unnamed protein product                                209   5e-58    Mus musculus [mouse]
ref|NP_001272874.1|  DNA annealing helicase and endonuclease ZRAN...    210   5e-58    
gb|EPZ31756.1|  SNF2-related domain-containing protein                  206   5e-58    
ref|XP_009885635.1|  PREDICTED: SWI/SNF-related matrix-associated...    209   6e-58    
ref|XP_002591926.1|  hypothetical protein BRAFLDRAFT_184347             205   6e-58    Branchiostoma floridae
ref|NP_081954.1|  DNA annealing helicase and endonuclease ZRANB3 ...    210   6e-58    Mus musculus [mouse]
gb|EDL39757.1|  mCG13937, isoform CRA_a                                 210   6e-58    
gb|KFP19053.1|  DNA annealing helicase and endonuclease ZRANB3          210   6e-58    
ref|XP_006529472.1|  PREDICTED: DNA annealing helicase and endonu...    210   6e-58    
gb|EDL39758.1|  mCG13937, isoform CRA_b                                 210   7e-58    
ref|XP_006529471.1|  PREDICTED: DNA annealing helicase and endonu...    210   7e-58    
ref|XP_003887429.1|  Snf2/Rad54-like helicase                           205   7e-58    
gb|KFV42065.1|  DNA annealing helicase and endonuclease ZRANB3          210   7e-58    
ref|XP_009961470.1|  PREDICTED: DNA annealing helicase and endonu...    210   8e-58    
ref|XP_006767207.1|  PREDICTED: DNA annealing helicase and endonu...    204   8e-58    
ref|XP_009950024.1|  PREDICTED: DNA annealing helicase and endonu...    209   8e-58    
gb|KFP95795.1|  DNA annealing helicase and endonuclease ZRANB3          209   8e-58    
ref|XP_009078989.1|  PREDICTED: DNA annealing helicase and endonu...    209   9e-58    
ref|XP_010180923.1|  PREDICTED: LOW QUALITY PROTEIN: DNA annealin...    209   9e-58    
gb|KFQ27087.1|  DNA annealing helicase and endonuclease ZRANB3          209   9e-58    
gb|KFU99121.1|  DNA annealing helicase and endonuclease ZRANB3          209   1e-57    
ref|XP_009991049.1|  PREDICTED: DNA annealing helicase and endonu...    209   1e-57    
gb|KFP51616.1|  DNA annealing helicase and endonuclease ZRANB3          208   1e-57    
ref|XP_004589420.1|  PREDICTED: DNA annealing helicase and endonu...    209   1e-57    
ref|XP_005154101.1|  PREDICTED: DNA annealing helicase and endonu...    210   1e-57    
gb|KFV94445.1|  DNA annealing helicase and endonuclease ZRANB3          206   1e-57    
ref|XP_009894153.1|  PREDICTED: LOW QUALITY PROTEIN: DNA annealin...    209   2e-57    
ref|XP_010297831.1|  PREDICTED: DNA annealing helicase and endonu...    209   2e-57    
ref|XP_009580734.1|  PREDICTED: DNA annealing helicase and endonu...    206   2e-57    
gb|KGL88633.1|  DNA annealing helicase and endonuclease ZRANB3          209   2e-57    
gb|KFO06924.1|  DNA annealing helicase and endonuclease ZRANB3          209   2e-57    
ref|XP_003794425.1|  PREDICTED: zinc finger Ran-binding domain-co...    208   2e-57    
ref|XP_007614497.1|  PREDICTED: DNA annealing helicase and endonu...    207   2e-57    
ref|XP_001457052.1|  hypothetical protein                               206   2e-57    Paramecium tetraurelia strain d4-2
gb|KFZ65335.1|  SWI/SNF-related matrix-associated actin-dependent...    201   2e-57    
gb|KFW63598.1|  DNA annealing helicase and endonuclease ZRANB3          208   2e-57    
gb|EOB07692.1|  SWI/SNF-related matrix-associated actin-dependent...    206   2e-57    
ref|XP_009317194.1|  PREDICTED: DNA annealing helicase and endonu...    208   2e-57    
ref|XP_006169782.1|  PREDICTED: DNA annealing helicase and endonu...    208   2e-57    
ref|XP_009895086.1|  PREDICTED: DNA annealing helicase and endonu...    208   2e-57    
ref|XP_009937028.1|  PREDICTED: DNA annealing helicase and endonu...    208   2e-57    
gb|EAX11632.1|  zinc finger, RAN-binding domain containing 3, iso...    201   2e-57    
ref|XP_006737813.1|  PREDICTED: DNA annealing helicase and endonu...    207   2e-57    
gb|KFR14031.1|  DNA annealing helicase and endonuclease ZRANB3          208   2e-57    
ref|XP_005020352.1|  PREDICTED: DNA annealing helicase and endonu...    208   3e-57    
ref|XP_007614490.1|  PREDICTED: DNA annealing helicase and endonu...    207   3e-57    
ref|XP_009640775.1|  PREDICTED: DNA annealing helicase and endonu...    208   3e-57    
ref|XP_004774319.1|  PREDICTED: DNA annealing helicase and endonu...    208   3e-57    
ref|XP_004774318.1|  PREDICTED: DNA annealing helicase and endonu...    208   3e-57    
ref|XP_007612889.1|  PREDICTED: DNA annealing helicase and endonu...    207   3e-57    
gb|KFV64518.1|  DNA annealing helicase and endonuclease ZRANB3          208   3e-57    
ref|XP_010152210.1|  PREDICTED: DNA annealing helicase and endonu...    206   3e-57    
ref|XP_005632005.1|  PREDICTED: DNA annealing helicase and endonu...    207   3e-57    
ref|XP_007614483.1|  PREDICTED: DNA annealing helicase and endonu...    207   3e-57    
ref|XP_009483544.1|  PREDICTED: DNA annealing helicase and endonu...    208   3e-57    
gb|KFQ62420.1|  DNA annealing helicase and endonuclease ZRANB3          208   3e-57    
ref|XP_010017708.1|  PREDICTED: DNA annealing helicase and endonu...    208   3e-57    
emb|CDS22513.1|  SWI:SNF matrix associated                              206   3e-57    
gb|KFP55596.1|  DNA annealing helicase and endonuclease ZRANB3          208   3e-57    
gb|KFO69672.1|  SWI/SNF-related matrix-associated actin-dependent...    205   3e-57    
gb|KFQ54035.1|  DNA annealing helicase and endonuclease ZRANB3          208   4e-57    
ref|XP_009264666.1|  Snf2/Rad54-like helicase                           203   4e-57    
gb|KFW07403.1|  DNA annealing helicase and endonuclease ZRANB3          206   4e-57    
ref|XP_005632003.1|  PREDICTED: DNA annealing helicase and endonu...    207   4e-57    
ref|XP_004403608.1|  PREDICTED: DNA annealing helicase and endonu...    207   4e-57    
ref|XP_009702694.1|  PREDICTED: DNA annealing helicase and endonu...    207   4e-57    
gb|KFQ17496.1|  SWI/SNF-related matrix-associated actin-dependent...    205   4e-57    
ref|XP_009460048.1|  PREDICTED: DNA annealing helicase and endonu...    207   4e-57    
ref|XP_010195336.1|  PREDICTED: DNA annealing helicase and endonu...    207   4e-57    
gb|KFQ94444.1|  DNA annealing helicase and endonuclease ZRANB3          207   5e-57    
ref|XP_003497777.1|  PREDICTED: DNA annealing helicase and endonu...    207   5e-57    
gb|EFB13237.1|  hypothetical protein PANDA_009544                       207   5e-57    Ailuropoda melanoleuca
gb|KFP29765.1|  DNA annealing helicase and endonuclease ZRANB3          207   5e-57    
ref|XP_742238.1|  DNA helicase                                          200   5e-57    Plasmodium chabaudi chabaudi
ref|XP_009278152.1|  PREDICTED: DNA annealing helicase and endonu...    207   5e-57    
gb|KFM01088.1|  DNA annealing helicase and endonuclease ZRANB3          207   6e-57    
ref|XP_002194081.1|  PREDICTED: DNA annealing helicase and endonu...    207   6e-57    Taeniopygia guttata
ref|XP_008997224.1|  PREDICTED: DNA annealing helicase and endonu...    207   6e-57    
ref|XP_008581735.1|  PREDICTED: DNA annealing helicase and endonu...    207   6e-57    
gb|KFQ10579.1|  DNA annealing helicase and endonuclease ZRANB3          207   6e-57    
ref|XP_008997222.1|  PREDICTED: DNA annealing helicase and endonu...    207   6e-57    
ref|XP_009925396.1|  PREDICTED: DNA annealing helicase and endonu...    207   7e-57    
ref|XP_010573453.1|  PREDICTED: DNA annealing helicase and endonu...    207   7e-57    
ref|XP_005010957.1|  PREDICTED: SWI/SNF-related matrix-associated...    206   7e-57    
emb|CDS35724.1|  SWI:SNF matrix associated                              205   7e-57    
ref|XP_008694075.1|  PREDICTED: DNA annealing helicase and endonu...    207   7e-57    
ref|XP_008997223.1|  PREDICTED: DNA annealing helicase and endonu...    207   8e-57    
ref|XP_007114337.1|  PREDICTED: DNA annealing helicase and endonu...    206   8e-57    
dbj|BAC38978.1|  unnamed protein product                                207   8e-57    Mus musculus [mouse]
ref|XP_008694074.1|  PREDICTED: DNA annealing helicase and endonu...    207   8e-57    
ref|XP_010851958.1|  PREDICTED: DNA annealing helicase and endonu...    206   9e-57    
ref|XP_002920769.1|  PREDICTED: zinc finger Ran-binding domain-co...    207   9e-57    
gb|KFQ71424.1|  DNA annealing helicase and endonuclease ZRANB3          206   1e-56    
ref|XP_007192110.1|  PREDICTED: DNA annealing helicase and endonu...    206   1e-56    
ref|XP_005202599.1|  PREDICTED: DNA annealing helicase and endonu...    206   1e-56    
ref|XP_005415794.1|  PREDICTED: DNA annealing helicase and endonu...    206   1e-56    
ref|XP_010280723.1|  PREDICTED: DNA annealing helicase and endonu...    206   1e-56    
gb|KFR00747.1|  SWI/SNF-related matrix-associated actin-dependent...    204   1e-56    
ref|XP_004668214.1|  PREDICTED: DNA annealing helicase and endonu...    206   1e-56    
ref|XP_008256740.1|  PREDICTED: DNA annealing helicase and endonu...    206   1e-56    
ref|XP_004616564.1|  PREDICTED: DNA annealing helicase and endonu...    206   1e-56    
ref|XP_005509003.1|  PREDICTED: DNA annealing helicase and endonu...    206   1e-56    
gb|ELR53718.1|  Zinc finger Ran-binding domain-containing protein 3     206   1e-56    
ref|XP_005899551.1|  PREDICTED: DNA annealing helicase and endonu...    206   1e-56    
ref|XP_010851955.1|  PREDICTED: DNA annealing helicase and endonu...    206   2e-56    
ref|XP_009481544.1|  PREDICTED: SWI/SNF-related matrix-associated...    197   2e-56    
ref|XP_644229.1|  SNF2-related domain-containing protein                207   2e-56    Dictyostelium discoideum AX4
gb|KFP76977.1|  SWI/SNF-related matrix-associated actin-dependent...    203   2e-56    
sp|E1BB03.3|ZRAB3_BOVIN  RecName: Full=DNA annealing helicase and...    206   2e-56    
ref|XP_005519666.1|  PREDICTED: DNA annealing helicase and endonu...    206   2e-56    
gb|KFQ51785.1|  SWI/SNF-related matrix-associated actin-dependent...    197   2e-56    
ref|XP_005237743.1|  PREDICTED: SWI/SNF-related matrix-associated...    205   2e-56    
ref|XP_003581888.2|  PREDICTED: DNA annealing helicase and endonu...    206   2e-56    
dbj|BAK61914.1|  zinc finger RAN-binding domain-containing protein 3    200   2e-56    
ref|XP_006993044.1|  PREDICTED: DNA annealing helicase and endonu...    205   2e-56    
ref|XP_003641641.2|  PREDICTED: DNA annealing helicase and endonu...    206   2e-56    
gb|KFP36488.1|  SWI/SNF-related matrix-associated actin-dependent...    203   2e-56    
ref|XP_010604475.1|  PREDICTED: DNA annealing helicase and endonu...    204   2e-56    
ref|XP_004255959.1|  chromodomain-helicase-DNA-binding protein, p...    206   2e-56    
ref|XP_005487961.1|  PREDICTED: DNA annealing helicase and endonu...    206   2e-56    
gb|KFV16349.1|  DNA annealing helicase and endonuclease ZRANB3          206   2e-56    
ref|XP_010083013.1|  PREDICTED: DNA annealing helicase and endonu...    206   2e-56    
ref|XP_005450038.1|  PREDICTED: DNA annealing helicase and endonu...    206   2e-56    
gb|KFV15009.1|  SWI/SNF-related matrix-associated actin-dependent...    203   2e-56    
ref|XP_009555760.1|  PREDICTED: SWI/SNF-related matrix-associated...    204   3e-56    
ref|XP_005450037.1|  PREDICTED: DNA annealing helicase and endonu...    206   3e-56    
ref|XP_005450035.1|  PREDICTED: DNA annealing helicase and endonu...    206   3e-56    
ref|XP_005573078.1|  PREDICTED: DNA annealing helicase and endonu...    204   3e-56    
gb|KFW08835.1|  SWI/SNF-related matrix-associated actin-dependent...    202   3e-56    
ref|XP_008933308.1|  PREDICTED: SWI/SNF-related matrix-associated...    204   3e-56    
ref|XP_005977063.1|  PREDICTED: DNA annealing helicase and endonu...    205   3e-56    
ref|XP_003478770.1|  PREDICTED: DNA annealing helicase and endonu...    205   3e-56    
ref|XP_009046984.1|  hypothetical protein LOTGIDRAFT_138707             205   3e-56    
ref|XP_007464068.1|  PREDICTED: DNA annealing helicase and endonu...    205   3e-56    
ref|XP_004004781.1|  PREDICTED: DNA annealing helicase and endonu...    205   4e-56    
ref|XP_006834663.1|  PREDICTED: DNA annealing helicase and endonu...    205   4e-56    
ref|XP_005676249.1|  PREDICTED: LOW QUALITY PROTEIN: DNA annealin...    205   4e-56    
ref|XP_007956137.1|  PREDICTED: LOW QUALITY PROTEIN: DNA annealin...    204   4e-56    
gb|EPQ09358.1|  Zinc finger Ran-binding domain-containing protein 3     204   4e-56    
ref|XP_006100503.1|  PREDICTED: DNA annealing helicase and endonu...    204   4e-56    
ref|XP_010604473.1|  PREDICTED: DNA annealing helicase and endonu...    204   4e-56    
ref|XP_010163605.1|  PREDICTED: DNA annealing helicase and endonu...    198   4e-56    
ref|XP_010405445.1|  PREDICTED: DNA annealing helicase and endonu...    205   4e-56    
ref|XP_010210645.1|  PREDICTED: DNA annealing helicase and endonu...    205   5e-56    
ref|XP_009939315.1|  PREDICTED: SWI/SNF-related matrix-associated...    203   5e-56    
ref|XP_010604472.1|  PREDICTED: DNA annealing helicase and endonu...    204   5e-56    
gb|KGL75714.1|  DNA annealing helicase and endonuclease ZRANB3          204   5e-56    
ref|XP_004674750.1|  PREDICTED: DNA annealing helicase and endonu...    204   5e-56    
gb|KFU91693.1|  Zinc finger Ran-binding domain-containing protein 3     204   5e-56    
ref|XP_001101449.1|  PREDICTED: zinc finger Ran-binding domain-co...    203   5e-56    
ref|XP_005443003.1|  PREDICTED: SWI/SNF-related matrix-associated...    204   6e-56    
gb|KFZ66160.1|  SWI/SNF-related matrix-associated actin-dependent...    202   6e-56    
ref|XP_003267647.1|  PREDICTED: DNA annealing helicase and endonu...    204   6e-56    
ref|XP_001746541.1|  hypothetical protein                               204   6e-56    
ref|XP_005868936.1|  PREDICTED: DNA annealing helicase and endonu...    204   6e-56    
ref|XP_008515135.1|  PREDICTED: DNA annealing helicase and endonu...    203   6e-56    
gb|KFQ04724.1|  SWI/SNF-related matrix-associated actin-dependent...    202   6e-56    
ref|XP_006921096.1|  PREDICTED: DNA annealing helicase and endonu...    204   6e-56    
gb|KFP49625.1|  SWI/SNF-related matrix-associated actin-dependent...    202   7e-56    
ref|XP_010604469.1|  PREDICTED: DNA annealing helicase and endonu...    204   7e-56    
ref|XP_005390819.1|  PREDICTED: DNA annealing helicase and endonu...    204   7e-56    
gb|KFP96752.1|  SWI/SNF-related matrix-associated actin-dependent...    201   8e-56    
ref|XP_010604471.1|  PREDICTED: DNA annealing helicase and endonu...    204   8e-56    
ref|XP_009998680.1|  PREDICTED: DNA annealing helicase and endonu...    204   8e-56    
ref|XP_005573072.1|  PREDICTED: DNA annealing helicase and endonu...    203   9e-56    
ref|XP_009675698.1|  PREDICTED: DNA annealing helicase and endonu...    204   9e-56    
ref|XP_005573076.1|  PREDICTED: DNA annealing helicase and endonu...    203   9e-56    
ref|XP_005573073.1|  PREDICTED: DNA annealing helicase and endonu...    203   9e-56    
gb|ELK04580.1|  Zinc finger Ran-binding domain-containing protein 3     204   9e-56    
ref|XP_005153888.1|  PREDICTED: SWI/SNF-related matrix-associated...    203   9e-56    
gb|KFV74745.1|  SWI/SNF-related matrix-associated actin-dependent...    201   9e-56    
ref|XP_007532759.1|  PREDICTED: DNA annealing helicase and endonu...    203   1e-55    
gb|KFV82614.1|  DNA annealing helicase and endonuclease ZRANB3          204   1e-55    
ref|XP_005573071.1|  PREDICTED: DNA annealing helicase and endonu...    203   1e-55    
ref|XP_009675699.1|  PREDICTED: DNA annealing helicase and endonu...    204   1e-55    
ref|XP_009981476.1|  PREDICTED: SWI/SNF-related matrix-associated...    203   1e-55    
ref|XP_009069581.1|  PREDICTED: SWI/SNF-related matrix-associated...    203   1e-55    
ref|XP_009675697.1|  PREDICTED: DNA annealing helicase and endonu...    204   1e-55    
ref|XP_009675700.1|  PREDICTED: DNA annealing helicase and endonu...    204   1e-55    
ref|XP_007532761.1|  PREDICTED: DNA annealing helicase and endonu...    203   1e-55    
ref|XP_008141699.1|  PREDICTED: DNA annealing helicase and endonu...    204   1e-55    
gb|KFQ81493.1|  SWI/SNF-related matrix-associated actin-dependent...    201   1e-55    
ref|XP_008141700.1|  PREDICTED: DNA annealing helicase and endonu...    203   1e-55    
ref|XP_010120798.1|  PREDICTED: SWI/SNF-related matrix-associated...    202   1e-55    
ref|XP_009086042.1|  PREDICTED: DNA annealing helicase and endonu...    204   1e-55    
ref|XP_010328993.1|  PREDICTED: DNA annealing helicase and endonu...    202   1e-55    
ref|XP_005573068.1|  PREDICTED: DNA annealing helicase and endonu...    203   1e-55    
gb|KFO12710.1|  SWI/SNF-related matrix-associated actin-dependent...    201   1e-55    
ref|XP_009235949.1|  PREDICTED: DNA annealing helicase and endonu...    201   1e-55    
ref|XP_009500196.1|  PREDICTED: DNA annealing helicase and endonu...    203   1e-55    
gb|EHH55878.1|  hypothetical protein EGM_05169                          203   1e-55    
gb|KFW89508.1|  DNA annealing helicase and endonuclease ZRANB3          203   1e-55    
ref|XP_004423928.1|  PREDICTED: DNA annealing helicase and endonu...    203   1e-55    
ref|XP_010365685.1|  PREDICTED: DNA annealing helicase and endonu...    203   1e-55    
ref|XP_005573066.1|  PREDICTED: DNA annealing helicase and endonu...    203   2e-55    
ref|XP_009580433.1|  PREDICTED: SWI/SNF-related matrix-associated...    202   2e-55    
ref|XP_005601522.1|  PREDICTED: DNA annealing helicase and endonu...    203   2e-55    
ref|XP_005573065.1|  PREDICTED: DNA annealing helicase and endonu...    203   2e-55    
ref|XP_005573067.1|  PREDICTED: DNA annealing helicase and endonu...    203   2e-55    
ref|XP_010328992.1|  PREDICTED: DNA annealing helicase and endonu...    202   2e-55    
ref|XP_009235948.1|  PREDICTED: DNA annealing helicase and endonu...    201   2e-55    
ref|XP_005433241.1|  PREDICTED: DNA annealing helicase and endonu...    203   2e-55    
gb|KFP22870.1|  SWI/SNF-related matrix-associated actin-dependent...    200   2e-55    
ref|XP_009919637.1|  PREDICTED: SWI/SNF-related matrix-associated...    202   2e-55    
ref|XP_005242423.1|  PREDICTED: DNA annealing helicase and endonu...    203   2e-55    
ref|XP_010566702.1|  PREDICTED: SWI/SNF-related matrix-associated...    202   2e-55    
ref|XP_004066741.1|  PREDICTED: DNA annealing helicase and endonu...    202   2e-55    
ref|XP_005718828.1|  unnamed protein product                            201   2e-55    
gb|KFP86529.1|  DNA annealing helicase and endonuclease ZRANB3          202   2e-55    
ref|XP_010328971.1|  PREDICTED: DNA annealing helicase and endonu...    202   3e-55    
ref|XP_010129297.1|  PREDICTED: DNA annealing helicase and endonu...    202   3e-55    
ref|XP_010328965.1|  PREDICTED: DNA annealing helicase and endonu...    202   3e-55    
ref|XP_009919627.1|  PREDICTED: SWI/SNF-related matrix-associated...    201   3e-55    
gb|KFO86536.1|  DNA annealing helicase and endonuclease ZRANB3          202   3e-55    
ref|XP_002947320.1|  hypothetical protein VOLCADRAFT_103414             201   3e-55    
ref|XP_010174302.1|  PREDICTED: SWI/SNF-related matrix-associated...    201   4e-55    
ref|XP_004480224.1|  PREDICTED: DNA annealing helicase and endonu...    202   4e-55    
gb|EHH22452.1|  hypothetical protein EGK_05722                          202   4e-55    
ref|XP_010566693.1|  PREDICTED: SWI/SNF-related matrix-associated...    201   4e-55    
ref|XP_004265489.1|  PREDICTED: DNA annealing helicase and endonu...    202   4e-55    
ref|XP_010711902.1|  PREDICTED: SWI/SNF-related matrix-associated...    201   4e-55    
ref|XP_009235947.1|  PREDICTED: DNA annealing helicase and endonu...    201   4e-55    
ref|XP_009687984.1|  PREDICTED: SWI/SNF-related matrix-associated...    201   5e-55    
ref|XP_009235946.1|  PREDICTED: DNA annealing helicase and endonu...    201   5e-55    
ref|XP_010291998.1|  PREDICTED: SWI/SNF-related matrix-associated...    201   6e-55    
gb|KFU88463.1|  SWI/SNF-related matrix-associated actin-dependent...    199   6e-55    
ref|XP_006795774.1|  PREDICTED: DNA annealing helicase and endonu...    202   6e-55    
gb|AAH78216.2|  Zranb3 protein                                          196   6e-55    
ref|XP_009959423.1|  PREDICTED: SWI/SNF-related matrix-associated...    201   6e-55    
ref|XP_003966542.1|  PREDICTED: DNA annealing helicase and endonu...    201   6e-55    
ref|XP_009235945.1|  PREDICTED: DNA annealing helicase and endonu...    201   6e-55    
gb|KFQ91747.1|  SWI/SNF-related matrix-associated actin-dependent...    199   7e-55    
ref|XP_007557112.1|  PREDICTED: DNA annealing helicase and endonu...    201   7e-55    
gb|EAX11629.1|  zinc finger, RAN-binding domain containing 3, iso...    201   7e-55    
ref|XP_005263868.1|  PREDICTED: DNA annealing helicase and endonu...    201   8e-55    
gb|EAX11635.1|  zinc finger, RAN-binding domain containing 3, iso...    201   8e-55    
ref|XP_010304475.1|  PREDICTED: SWI/SNF-related matrix-associated...    200   8e-55    
gb|KFV63424.1|  SWI/SNF-related matrix-associated actin-dependent...    199   8e-55    
ref|XP_006258165.1|  PREDICTED: DNA annealing helicase and endonu...    201   8e-55    
ref|XP_009441640.1|  PREDICTED: DNA annealing helicase and endonu...    201   9e-55    
ref|NP_115519.2|  DNA annealing helicase and endonuclease ZRANB3 ...    201   9e-55    
gb|KFP03335.1|  SWI/SNF-related matrix-associated actin-dependent...    198   9e-55    
ref|NP_001273497.1|  DNA annealing helicase and endonuclease ZRAN...    201   9e-55    
emb|CAL37572.1|  hypothetical protein                                   201   9e-55    
ref|XP_007963042.1|  PREDICTED: DNA annealing helicase and endonu...    199   9e-55    
ref|XP_008426756.1|  PREDICTED: DNA annealing helicase and endonu...    201   1e-54    
gb|KFW01731.1|  SWI/SNF-related matrix-associated actin-dependent...    198   1e-54    
ref|XP_004552616.1|  PREDICTED: DNA annealing helicase and endonu...    201   1e-54    
ref|XP_004552612.1|  PREDICTED: DNA annealing helicase and endonu...    201   1e-54    
ref|XP_009645460.1|  PREDICTED: SWI/SNF-related matrix-associated...    200   1e-54    
ref|XP_008830671.1|  PREDICTED: DNA annealing helicase and endonu...    201   1e-54    
ref|XP_005810260.1|  PREDICTED: DNA annealing helicase and endonu...    201   1e-54    
gb|KFW66757.1|  SWI/SNF-related matrix-associated actin-dependent...    198   2e-54    
ref|XP_006880868.1|  PREDICTED: DNA annealing helicase and endonu...    200   2e-54    
ref|XP_007494156.1|  PREDICTED: DNA annealing helicase and endonu...    200   2e-54    
gb|ELT88125.1|  hypothetical protein CAPTEDRAFT_113875                  200   2e-54    
ref|XP_007060943.1|  PREDICTED: DNA annealing helicase and endonu...    200   2e-54    
gb|KFQ43069.1|  SWI/SNF-related matrix-associated actin-dependent...    196   2e-54    
ref|XP_007494153.1|  PREDICTED: DNA annealing helicase and endonu...    200   2e-54    
ref|XP_003822857.1|  PREDICTED: LOW QUALITY PROTEIN: DNA annealin...    200   2e-54    
ref|XP_010210634.1|  PREDICTED: SWI/SNF-related matrix-associated...    199   2e-54    
ref|XP_008110859.1|  PREDICTED: DNA annealing helicase and endonu...    199   2e-54    
ref|XP_005049505.1|  PREDICTED: SWI/SNF-related matrix-associated...    199   2e-54    
ref|XP_005286877.1|  PREDICTED: DNA annealing helicase and endonu...    200   2e-54    
gb|EOB12241.1|  SWI/SNF-related matrix-associated actin-dependent...    196   2e-54    
ref|XP_004366954.1|  SNF2-related domain-containing protein             201   2e-54    
ref|XP_007963041.1|  PREDICTED: DNA annealing helicase and endonu...    199   3e-54    
ref|XP_007494154.1|  PREDICTED: DNA annealing helicase and endonu...    200   3e-54    
ref|XP_008110843.1|  PREDICTED: DNA annealing helicase and endonu...    200   3e-54    
ref|XP_005286874.1|  PREDICTED: DNA annealing helicase and endonu...    200   3e-54    
ref|XP_007427102.1|  PREDICTED: DNA annealing helicase and endonu...    200   3e-54    
ref|XP_006018446.1|  PREDICTED: DNA annealing helicase and endonu...    200   3e-54    
ref|XP_005049502.1|  PREDICTED: SWI/SNF-related matrix-associated...    199   3e-54    
ref|XP_005933986.1|  PREDICTED: DNA annealing helicase and endonu...    199   3e-54    
gb|KFP65773.1|  SWI/SNF-related matrix-associated actin-dependent...    197   3e-54    
ref|XP_005286870.1|  PREDICTED: DNA annealing helicase and endonu...    200   3e-54    
ref|XP_007963039.1|  PREDICTED: DNA annealing helicase and endonu...    199   3e-54    
ref|XP_007963033.1|  PREDICTED: DNA annealing helicase and endonu...    199   3e-54    
ref|XP_006186836.1|  PREDICTED: DNA annealing helicase and endonu...    199   3e-54    
ref|XP_005933985.1|  PREDICTED: DNA annealing helicase and endonu...    199   4e-54    
ref|XP_007963038.1|  PREDICTED: DNA annealing helicase and endonu...    199   4e-54    
ref|XP_005739923.1|  PREDICTED: DNA annealing helicase and endonu...    199   4e-54    
ref|XP_010186131.1|  PREDICTED: SWI/SNF-related matrix-associated...    196   4e-54    
ref|XP_009909483.1|  PREDICTED: SWI/SNF-related matrix-associated...    198   4e-54    
ref|XP_005519743.1|  PREDICTED: SWI/SNF-related matrix-associated...    198   4e-54    
gb|KFQ38256.1|  SWI/SNF-related matrix-associated actin-dependent...    196   4e-54    
ref|XP_010971522.1|  PREDICTED: DNA annealing helicase and endonu...    199   4e-54    
ref|XP_005933979.1|  PREDICTED: DNA annealing helicase and endonu...    199   4e-54    
ref|XP_005739919.1|  PREDICTED: DNA annealing helicase and endonu...    199   4e-54    
ref|XP_009994542.1|  PREDICTED: SWI/SNF-related matrix-associated...    198   4e-54    
ref|XP_006186835.1|  PREDICTED: DNA annealing helicase and endonu...    199   4e-54    
ref|XP_008553472.1|  PREDICTED: SWI/SNF-related matrix-associated...    197   5e-54    
ref|XP_007963032.1|  PREDICTED: DNA annealing helicase and endonu...    199   5e-54    
ref|XP_680379.1|  DNA helicase                                          197   5e-54    
ref|XP_008495212.1|  PREDICTED: SWI/SNF-related matrix-associated...    198   5e-54    
ref|XP_007963031.1|  PREDICTED: DNA annealing helicase and endonu...    199   5e-54    
ref|XP_009472146.1|  PREDICTED: SWI/SNF-related matrix-associated...    198   6e-54    
ref|XP_010982331.1|  PREDICTED: DNA annealing helicase and endonu...    199   6e-54    
ref|XP_005415839.1|  PREDICTED: SWI/SNF-related matrix-associated...    198   7e-54    
ref|XP_006196182.1|  PREDICTED: DNA annealing helicase and endonu...    199   7e-54    
ref|XP_005498631.1|  PREDICTED: SWI/SNF-related matrix-associated...    197   7e-54    
ref|XP_422070.3|  PREDICTED: SWI/SNF related, matrix associated, ...    197   7e-54    
ref|XP_001741408.1|  hypothetical protein                               197   7e-54    
ref|XP_007667658.1|  PREDICTED: DNA annealing helicase and endonu...    199   7e-54    
ref|XP_010146222.1|  PREDICTED: SWI/SNF-related matrix-associated...    197   8e-54    
ref|XP_006196181.1|  PREDICTED: DNA annealing helicase and endonu...    198   8e-54    
ref|XP_009321816.1|  PREDICTED: SWI/SNF-related matrix-associated...    197   9e-54    
gb|KFV51484.1|  SWI/SNF-related matrix-associated actin-dependent...    196   9e-54    
ref|XP_007667659.1|  PREDICTED: DNA annealing helicase and endonu...    197   1e-53    
ref|XP_006028752.1|  PREDICTED: SWI/SNF-related matrix-associated...    197   1e-53    
ref|XP_009919644.1|  PREDICTED: SWI/SNF-related matrix-associated...    197   1e-53    
ref|XP_008920259.1|  PREDICTED: DNA annealing helicase and endonu...    198   1e-53    
ref|XP_010566710.1|  PREDICTED: SWI/SNF-related matrix-associated...    197   1e-53    
ref|XP_006028751.1|  PREDICTED: SWI/SNF-related matrix-associated...    197   1e-53    
ref|XP_004942944.1|  PREDICTED: SWI/SNF related, matrix associate...    197   1e-53    
gb|KFO55068.1|  SWI/SNF-related matrix-associated actin-dependent...    195   1e-53    
ref|XP_007420222.1|  PREDICTED: SWI/SNF-related matrix-associated...    197   1e-53    
ref|XP_008120503.1|  PREDICTED: SWI/SNF-related matrix-associated...    197   1e-53    
ref|XP_008120501.1|  PREDICTED: SWI/SNF-related matrix-associated...    197   1e-53    
ref|XP_003763875.1|  PREDICTED: zinc finger Ran-binding domain-co...    197   1e-53    
ref|XP_009699912.1|  PREDICTED: SWI/SNF-related matrix-associated...    197   2e-53    
ref|XP_007894391.1|  PREDICTED: DNA annealing helicase and endonu...    197   3e-53    
ref|XP_009919652.1|  PREDICTED: SWI/SNF-related matrix-associated...    195   3e-53    
ref|XP_654593.2|  helicase                                              196   3e-53    
ref|XP_007894389.1|  PREDICTED: DNA annealing helicase and endonu...    197   3e-53    
ref|XP_007894390.1|  PREDICTED: DNA annealing helicase and endonu...    196   3e-53    
ref|XP_004704020.1|  PREDICTED: DNA annealing helicase and endonu...    196   3e-53    
gb|KFW81172.1|  SWI/SNF-related matrix-associated actin-dependent...    194   3e-53    
ref|XP_010405268.1|  PREDICTED: SWI/SNF-related matrix-associated...    196   4e-53    
ref|XP_008859359.1|  helicase, putative                                 196   4e-53    
ref|XP_010566719.1|  PREDICTED: SWI/SNF-related matrix-associated...    195   4e-53    
ref|XP_009086126.1|  PREDICTED: SWI/SNF-related matrix-associated...    196   4e-53    
ref|XP_007894386.1|  PREDICTED: DNA annealing helicase and endonu...    196   5e-53    
ref|XP_004375170.1|  PREDICTED: LOW QUALITY PROTEIN: DNA annealin...    196   5e-53    
ref|XP_009965728.1|  PREDICTED: SWI/SNF-related matrix-associated...    195   5e-53    
ref|XP_003201057.3|  PREDICTED: DNA annealing helicase and endonu...    196   5e-53    
ref|XP_002191300.1|  PREDICTED: SWI/SNF-related matrix-associated...    195   6e-53    
ref|XP_008643054.1|  PREDICTED: SWI/SNF-related matrix-associated...    195   7e-53    
ref|XP_009183261.1|  PREDICTED: DNA annealing helicase and endonu...    186   7e-53    
ref|XP_007257139.1|  PREDICTED: DNA annealing helicase and endonu...    191   7e-53    
ref|XP_008323426.1|  PREDICTED: DNA annealing helicase and endonu...    196   7e-53    
gb|KFO81152.1|  DNA annealing helicase and endonuclease ZRANB3          196   7e-53    
gb|EJY81131.1|  SNF2 family N-terminal domain containing protein        196   8e-53    
ref|XP_010737242.1|  PREDICTED: DNA annealing helicase and endonu...    196   8e-53    
gb|KHN69580.1|  Snf2/Rad54-like helicase                                191   8e-53    
gb|KGN57207.1|  hypothetical protein Csa_3G171150                       191   9e-53    
ref|XP_009565966.1|  PREDICTED: DNA annealing helicase and endonu...    196   9e-53    
ref|XP_006117127.1|  PREDICTED: DNA annealing helicase and endonu...    195   1e-52    
ref|XP_006117128.1|  PREDICTED: DNA annealing helicase and endonu...    195   1e-52    
ref|XP_009687979.1|  PREDICTED: SWI/SNF-related matrix-associated...    194   1e-52    
gb|EUB60117.1|  SWI/SNF-related matrix-associated actin-dependent...    193   1e-52    
emb|CDW80246.1|  snf2 family n-terminal domain containing protein       194   1e-52    



>ref|XP_002315473.2| hypothetical protein POPTR_0010s00580g [Populus trichocarpa]
 gb|EEF01644.2| hypothetical protein POPTR_0010s00580g [Populus trichocarpa]
Length=373

 Score =   444 bits (1142),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 234/291 (80%), Positives = 245/291 (84%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNL+KATVMIRRLKKDVLSELP
Sbjct  55   QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLIKATVMIRRLKKDVLSELP  114

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIK+  S EE ESLK T  NLINKIY  S
Sbjct  115  VKRRQQVFLDLPEKDMKQINTLFRELEVVKGKIKACASDEEVESLKFTEKNLINKIYTDS  174

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KIS VLDYLGTVIEA CKFLIFAHH  MID+IH++LLKKKVGCIRIDG T AASRQA
Sbjct  175  AEAKISGVLDYLGTVIEAGCKFLIFAHHQSMIDSIHEFLLKKKVGCIRIDGKTAAASRQA  234

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK +IKAAVLSI+AGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  235  LVTDFQEKDAIKAAVLSIRAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  294

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDGQEK+LEV       SP K
Sbjct  295  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGQEKTLEVSASQQRSSPAK  345



>ref|XP_011000979.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X1 
[Populus euphratica]
Length=683

 Score =   446 bits (1147),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 234/291 (80%), Positives = 245/291 (84%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  365  QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  424

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIK+  S EE ESLK T  NLINKIY  S
Sbjct  425  VKRRQQVFLDLPEKDMKQINALFRELEVVKRKIKACASDEEVESLKFTEKNLINKIYTDS  484

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KIS VLDYLGTVIEA CKFLIFAHH  MID+IH++LLKKKVGCIRIDG T AASRQA
Sbjct  485  AEAKISGVLDYLGTVIEAGCKFLIFAHHQSMIDSIHEFLLKKKVGCIRIDGKTAAASRQA  544

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK +IKAAVLSI+AGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  545  LVTDFQEKDAIKAAVLSIRAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  604

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLLANDTVDDIIWDVV++KLENLGQMLDGQEK+LEV       SP K
Sbjct  605  VNVYYLLANDTVDDIIWDVVQSKLENLGQMLDGQEKTLEVSASQQRSSPAK  655



>ref|XP_010999353.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 [Populus euphratica]
Length=687

 Score =   446 bits (1147),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 234/291 (80%), Positives = 245/291 (84%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  369  QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  428

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIK+  S EE ESLK T  NLINKIY  S
Sbjct  429  VKRRQQVFLDLPEKDMKQINALFRELEVVKRKIKACASDEEVESLKFTEKNLINKIYTDS  488

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KIS VLDYLGTVIEA CKFLIFAHH  MID+IH++LLKKKVGCIRIDG T AASRQA
Sbjct  489  AEAKISGVLDYLGTVIEAGCKFLIFAHHQSMIDSIHEFLLKKKVGCIRIDGKTAAASRQA  548

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK +IKAAVLSI+AGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  549  LVTDFQEKDAIKAAVLSIRAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  608

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLLANDTVDDIIWDVV++KLENLGQMLDGQEK+LEV       SP K
Sbjct  609  VNVYYLLANDTVDDIIWDVVQSKLENLGQMLDGQEKTLEVSASQQRSSPAK  659



>emb|CDO98684.1| unnamed protein product [Coffea canephora]
Length=705

 Score =   441 bits (1135),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 236/291 (81%), Positives = 247/291 (85%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP VYKNVHEYGNRYCKGG FGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  389  QLEALYPGVYKNVHEYGNRYCKGGTFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  448

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE++KSKI+SS SKEEAESLK    NLINKIY  S
Sbjct  449  VKRRQQVFLDLGEKEMRHVNALFCELEIIKSKIRSSHSKEEAESLKYAEKNLINKIYTDS  508

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGT+IEA CKFLIFAHH  MI +IHQYLLKKKVGCIRIDGGTPAASRQA
Sbjct  509  AEAKIPAVLDYLGTMIEAGCKFLIFAHHQPMICSIHQYLLKKKVGCIRIDGGTPAASRQA  568

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK+SIKAAVLSIKAGG GLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  569  LVTDFQEKSSIKAAVLSIKAGGFGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  628

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDG E SLEV  +  N SP K
Sbjct  629  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGHENSLEVSVNQQNSSPAK  679



>ref|XP_011073843.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X2 
[Sesamum indicum]
Length=687

 Score =   439 bits (1128),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 231/291 (79%), Positives = 250/291 (86%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QL+ALYP+VYKNVHEYG+RYCKGGIFGVYQGASNHEELHNLMKAT+MIRRLKKDVLS+LP
Sbjct  370  QLQALYPEVYKNVHEYGSRYCKGGIFGVYQGASNHEELHNLMKATLMIRRLKKDVLSQLP  429

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIKS QS+EEAESLK T  NLINKIY  S
Sbjct  430  VKRRQQVFLELGQDDMRQINALFCELEVVKLKIKSCQSREEAESLKFTEKNLINKIYTDS  489

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGT+IEA CKFLIFAHH  MID+IH++LLKKKVGCIRIDG TPAASRQA
Sbjct  490  AEAKIPAVLDYLGTIIEAGCKFLIFAHHQPMIDSIHKFLLKKKVGCIRIDGSTPAASRQA  549

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVT+FQEK S+KAAVLSIKAGGVGLTLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  550  LVTEFQEKDSVKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSS  609

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDV+++KLENLGQMLDG E SLEV  D S  SP+K
Sbjct  610  VNIYYLLANDTVDDIIWDVIQSKLENLGQMLDGHENSLEVSVDQSGCSPLK  660



>ref|XP_008800331.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X3 
[Phoenix dactylifera]
Length=615

 Score =   436 bits (1121),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 223/291 (77%), Positives = 246/291 (85%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYGNRYC+GG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  290  QLEALYPDVYKNVHEYGNRYCRGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  349

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE+VK+ I++  S E+ ESLK+T  NLINKIY  S
Sbjct  350  VKRRQQIFLDLNEKDMKQIRVLFRELELVKANIQACDSNEKIESLKVTQKNLINKIYNDS  409

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEADCKFLIFAHH  MIDAIHQ+LLKKKVGCIRIDGGTP++SRQA
Sbjct  410  AEAKIPAVLDYLNTVIEADCKFLIFAHHQPMIDAIHQFLLKKKVGCIRIDGGTPSSSRQA  469

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQEK + KAAVLSIKAGGVGLTLTAASTVIFAEL WTPGD+IQAEDR HRIGQVSS
Sbjct  470  LVSDFQEKDNFKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDIIQAEDRTHRIGQVSS  529

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDGQE +L+V    +  SP+K
Sbjct  530  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGQENALDVSTSQTISSPVK  580



>ref|XP_011073842.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X1 
[Sesamum indicum]
Length=694

 Score =   438 bits (1127),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 231/291 (79%), Positives = 250/291 (86%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QL+ALYP+VYKNVHEYG+RYCKGGIFGVYQGASNHEELHNLMKAT+MIRRLKKDVLS+LP
Sbjct  377  QLQALYPEVYKNVHEYGSRYCKGGIFGVYQGASNHEELHNLMKATLMIRRLKKDVLSQLP  436

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIKS QS+EEAESLK T  NLINKIY  S
Sbjct  437  VKRRQQVFLELGQDDMRQINALFCELEVVKLKIKSCQSREEAESLKFTEKNLINKIYTDS  496

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGT+IEA CKFLIFAHH  MID+IH++LLKKKVGCIRIDG TPAASRQA
Sbjct  497  AEAKIPAVLDYLGTIIEAGCKFLIFAHHQPMIDSIHKFLLKKKVGCIRIDGSTPAASRQA  556

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVT+FQEK S+KAAVLSIKAGGVGLTLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  557  LVTEFQEKDSVKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSS  616

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDV+++KLENLGQMLDG E SLEV  D S  SP+K
Sbjct  617  VNIYYLLANDTVDDIIWDVIQSKLENLGQMLDGHENSLEVSVDQSGCSPLK  667



>ref|XP_003550580.2| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1-like isoform 
X1 [Glycine max]
 ref|XP_006600415.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1-like isoform 
X2 [Glycine max]
Length=708

 Score =   437 bits (1125),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 229/291 (79%), Positives = 247/291 (85%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYGNRYCKGG+FGVYQGASNHEELHNL+KATVMIRRLKKDVLS+LP
Sbjct  367  QLEALYPDVYRNVHEYGNRYCKGGVFGVYQGASNHEELHNLIKATVMIRRLKKDVLSQLP  426

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE+VK+KIK+++S+EEAESLK    NLINKIY  S
Sbjct  427  VKRRQQVFLDLENKDMKQINALFQELEMVKAKIKAAKSQEEAESLKFAQKNLINKIYTDS  486

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI SVLDY+GTVIEA CKFLIFAHH  MID+IH++LLKKKVGCIRIDGGTPAASRQ 
Sbjct  487  AEAKIPSVLDYIGTVIEAGCKFLIFAHHQPMIDSIHEFLLKKKVGCIRIDGGTPAASRQQ  546

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK +IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  547  LVTDFQEKDAIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  606

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDG E  LEV       SP K
Sbjct  607  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGHENVLEVSASLPVNSPSK  657



>ref|XP_006593993.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1-like isoform 
X1 [Glycine max]
 ref|XP_006593994.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1-like isoform 
X2 [Glycine max]
Length=687

 Score =   436 bits (1122),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 229/291 (79%), Positives = 246/291 (85%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYGNRYCKGG FGVYQGASNHEELHNL+KATVMIRRLKKDVLS+LP
Sbjct  369  QLEALYPDVYRNVHEYGNRYCKGGFFGVYQGASNHEELHNLIKATVMIRRLKKDVLSQLP  428

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE+VK+KIK+++S+EEAESLK    NLINKIY  S
Sbjct  429  VKRRQQVFLDLAGKDMKQINALFRELEMVKAKIKAAKSQEEAESLKFAQKNLINKIYTDS  488

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI SVLDY+GTVIEA CKFLIFAHH  MID+IH++LLKKKVGCIRIDG TPAASRQ 
Sbjct  489  AEAKIPSVLDYVGTVIEAGCKFLIFAHHQPMIDSIHEFLLKKKVGCIRIDGSTPAASRQQ  548

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK SIKAAVLSIKAGGVGLTLTAASTVIF+EL WTPGDLIQAEDRAHRIGQVSS
Sbjct  549  LVTDFQEKDSIKAAVLSIKAGGVGLTLTAASTVIFSELSWTPGDLIQAEDRAHRIGQVSS  608

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV+NKLENLGQMLDG E +LEV       SP K
Sbjct  609  VNIYYLLANDTVDDIIWDVVQNKLENLGQMLDGHENALEVSASLPVNSPSK  659



>gb|KHN45013.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like protein 1 [Glycine soja]
Length=691

 Score =   436 bits (1121),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 229/291 (79%), Positives = 246/291 (85%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYGNRYCKGG FGVYQGASNHEELHNL+KATVMIRRLKKDVLS+LP
Sbjct  373  QLEALYPDVYRNVHEYGNRYCKGGFFGVYQGASNHEELHNLIKATVMIRRLKKDVLSQLP  432

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE+VK+KIK+++S+EEAESLK    NLINKIY  S
Sbjct  433  VKRRQQVFLDLAGKDMKQINALFRELEMVKAKIKAAKSQEEAESLKFAQKNLINKIYTDS  492

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI SVLDY+GTVIEA CKFLIFAHH  MID+IH++LLKKKVGCIRIDG TPAASRQ 
Sbjct  493  AEAKIPSVLDYVGTVIEAGCKFLIFAHHQPMIDSIHEFLLKKKVGCIRIDGSTPAASRQQ  552

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK SIKAAVLSIKAGGVGLTLTAASTVIF+EL WTPGDLIQAEDRAHRIGQVSS
Sbjct  553  LVTDFQEKDSIKAAVLSIKAGGVGLTLTAASTVIFSELSWTPGDLIQAEDRAHRIGQVSS  612

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV+NKLENLGQMLDG E +LEV       SP K
Sbjct  613  VNIYYLLANDTVDDIIWDVVQNKLENLGQMLDGHENALEVSASLPVNSPSK  663



>gb|KDP28020.1| hypothetical protein JCGZ_19100 [Jatropha curcas]
Length=686

 Score =   436 bits (1120),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 225/291 (77%), Positives = 241/291 (83%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP+VYKNVHEYGNRYCKGG+FGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  368  QLEALYPNVYKNVHEYGNRYCKGGVFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  427

Query  182  VKRRQ-------------------QLEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQ                   +LEVVK KI++  S EE ESLK +  NLINKIY  S
Sbjct  428  VKRRQRVFLDLGEKEMKKINALFRELEVVKGKIEACSSSEEVESLKFSKQNLINKIYTDS  487

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ K+  VLDYLGTVIEA CKFLIFAHH  MIDA+H++LLK+KVGCIRIDG TP ASRQA
Sbjct  488  AEAKVPGVLDYLGTVIEAGCKFLIFAHHQPMIDAVHEFLLKRKVGCIRIDGSTPPASRQA  547

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQE  +IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  548  LVTDFQENDAIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  607

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDG E +LEV       SP K
Sbjct  608  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGHENTLEVSASQQRTSPAK  658



>ref|XP_008800329.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X1 
[Phoenix dactylifera]
Length=708

 Score =   436 bits (1121),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 223/291 (77%), Positives = 246/291 (85%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYGNRYC+GG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  383  QLEALYPDVYKNVHEYGNRYCRGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  442

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE+VK+ I++  S E+ ESLK+T  NLINKIY  S
Sbjct  443  VKRRQQIFLDLNEKDMKQIRVLFRELELVKANIQACDSNEKIESLKVTQKNLINKIYNDS  502

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEADCKFLIFAHH  MIDAIHQ+LLKKKVGCIRIDGGTP++SRQA
Sbjct  503  AEAKIPAVLDYLNTVIEADCKFLIFAHHQPMIDAIHQFLLKKKVGCIRIDGGTPSSSRQA  562

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQEK + KAAVLSIKAGGVGLTLTAASTVIFAEL WTPGD+IQAEDR HRIGQVSS
Sbjct  563  LVSDFQEKDNFKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDIIQAEDRTHRIGQVSS  622

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDGQE +L+V    +  SP+K
Sbjct  623  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGQENALDVSTSQTISSPVK  673



>ref|XP_004508075.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004508076.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1-like isoform 
X2 [Cicer arietinum]
Length=682

 Score =   435 bits (1119),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 228/291 (78%), Positives = 246/291 (85%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYGNRYCKGG+FG+YQGASNHEELHNLMKAT MIRRLKKDVLSELP
Sbjct  363  QLEALYPDVYKNVHEYGNRYCKGGVFGLYQGASNHEELHNLMKATAMIRRLKKDVLSELP  422

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE VK+KIK+S SKEEAESLK T  NLINKIY  S
Sbjct  423  VKRRQQVFLDLADKDMKQINALFRELERVKAKIKASSSKEEAESLKFTQKNLINKIYTDS  482

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDY+GTVIEA CKFLIFAHH+ MIDAIH++LLKKKVGCIRIDGGTP+ SRQ 
Sbjct  483  AEAKIPAVLDYVGTVIEAGCKFLIFAHHLPMIDAIHEFLLKKKVGCIRIDGGTPSGSRQQ  542

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVT+FQEK +IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDR HRIGQVSS
Sbjct  543  LVTEFQEKDAIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRVHRIGQVSS  602

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KL+NLGQMLDG E +L+V  D    SP K
Sbjct  603  VNIYYLLANDTVDDIIWDVVQSKLDNLGQMLDGHENTLKVSADEPVSSPSK  653



>gb|EYU36724.1| hypothetical protein MIMGU_mgv1a003532mg [Erythranthe guttata]
Length=579

 Score =   432 bits (1110),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 225/291 (77%), Positives = 248/291 (85%), Gaps = 20/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVH+YGNRYCKGG+FG+YQGASNHEELHNLMKAT+MIRRLKKDVL ELP
Sbjct  233  QLEALYPDVYKNVHDYGNRYCKGGVFGLYQGASNHEELHNLMKATLMIRRLKKDVLLELP  292

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEV+K K KS QSKEEAESLK +  NLINKIY  S
Sbjct  293  VKRRQQIFLELGNEEMRKINALFRELEVLKIKTKSCQSKEEAESLKFSEKNLINKIYTDS  352

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGT+IEA CKFLIFAHH  MID+IH++LLKKKVGCIRIDG TP+ASRQA
Sbjct  353  AEAKIPAVLDYLGTIIEAGCKFLIFAHHQPMIDSIHKFLLKKKVGCIRIDGTTPSASRQA  412

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVT+FQEK S+KAAVLSIKAGGVGLTLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  413  LVTEFQEKDSVKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDMIQAEDRAHRIGQVSS  472

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLLANDTVDDIIWDV++NKLENLGQMLDG E SL+V+     +SP+K
Sbjct  473  VNVYYLLANDTVDDIIWDVIQNKLENLGQMLDGHENSLQVV-GQPGRSPLK  522



>ref|XP_010241440.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X2 
[Nelumbo nucifera]
Length=622

 Score =   432 bits (1112),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 227/291 (78%), Positives = 243/291 (84%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP+VYKNVHEYGNRYC+GGIFG+YQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  307  QLEALYPEVYKNVHEYGNRYCRGGIFGIYQGASNHEELHNLMKATVMIRRLKKDVLSELP  366

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK+KIK+   KEE ESLK +  NLINKIY  S
Sbjct  367  VKRRQQVFLDLAEKDMRQINALFRELEVVKNKIKACNLKEEVESLKFSEKNLINKIYTDS  426

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTVIEA CKFLIFAHH  MIDAI Q+L  KKVGCIRIDGGTPA+SRQ 
Sbjct  427  AEAKIPAVLDYLGTVIEAGCKFLIFAHHQAMIDAIFQFLRNKKVGCIRIDGGTPASSRQT  486

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQEK  IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  487  LVSDFQEKDDIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSS  546

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDG E +LEV    S +SP K
Sbjct  547  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGHENTLEVSVSESTRSPAK  597



>ref|XP_007154488.1| hypothetical protein PHAVU_003G123100g [Phaseolus vulgaris]
 gb|ESW26482.1| hypothetical protein PHAVU_003G123100g [Phaseolus vulgaris]
Length=705

 Score =   434 bits (1116),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 227/291 (78%), Positives = 246/291 (85%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVH+YGNRYCKGG FG+YQGASNHEELHNLMKATV+IRRLK DVL+ELP
Sbjct  368  QLEALYPDVYKNVHDYGNRYCKGGFFGLYQGASNHEELHNLMKATVLIRRLKNDVLTELP  427

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE+VK+KIK+++S+EEAESLK T  N+INKIY  S
Sbjct  428  VKRRQQVFLDLADKDMKEINALFRELEMVKTKIKAAKSQEEAESLKFTQKNIINKIYTDS  487

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI SVLDY+GTVIEA CKFLIFAHH  MID+IH +L KKKVGCIRIDGGTPAASRQ 
Sbjct  488  AEAKIPSVLDYVGTVIEAGCKFLIFAHHQPMIDSIHDFLRKKKVGCIRIDGGTPAASRQQ  547

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVT+FQEK SIKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  548  LVTEFQEKESIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  607

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDG EK+LEV       SP K
Sbjct  608  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGHEKALEVSASLPENSPSK  658



>ref|XP_007154489.1| hypothetical protein PHAVU_003G123100g [Phaseolus vulgaris]
 gb|ESW26483.1| hypothetical protein PHAVU_003G123100g [Phaseolus vulgaris]
Length=710

 Score =   434 bits (1116),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 227/291 (78%), Positives = 246/291 (85%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVH+YGNRYCKGG FG+YQGASNHEELHNLMKATV+IRRLK DVL+ELP
Sbjct  373  QLEALYPDVYKNVHDYGNRYCKGGFFGLYQGASNHEELHNLMKATVLIRRLKNDVLTELP  432

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE+VK+KIK+++S+EEAESLK T  N+INKIY  S
Sbjct  433  VKRRQQVFLDLADKDMKEINALFRELEMVKTKIKAAKSQEEAESLKFTQKNIINKIYTDS  492

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI SVLDY+GTVIEA CKFLIFAHH  MID+IH +L KKKVGCIRIDGGTPAASRQ 
Sbjct  493  AEAKIPSVLDYVGTVIEAGCKFLIFAHHQPMIDSIHDFLRKKKVGCIRIDGGTPAASRQQ  552

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVT+FQEK SIKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  553  LVTEFQEKESIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  612

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDG EK+LEV       SP K
Sbjct  613  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGHEKALEVSASLPENSPSK  663



>ref|XP_010241439.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X1 
[Nelumbo nucifera]
Length=686

 Score =   433 bits (1113),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 227/291 (78%), Positives = 243/291 (84%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP+VYKNVHEYGNRYC+GGIFG+YQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  371  QLEALYPEVYKNVHEYGNRYCRGGIFGIYQGASNHEELHNLMKATVMIRRLKKDVLSELP  430

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK+KIK+   KEE ESLK +  NLINKIY  S
Sbjct  431  VKRRQQVFLDLAEKDMRQINALFRELEVVKNKIKACNLKEEVESLKFSEKNLINKIYTDS  490

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTVIEA CKFLIFAHH  MIDAI Q+L  KKVGCIRIDGGTPA+SRQ 
Sbjct  491  AEAKIPAVLDYLGTVIEAGCKFLIFAHHQAMIDAIFQFLRNKKVGCIRIDGGTPASSRQT  550

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQEK  IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  551  LVSDFQEKDDIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSS  610

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDG E +LEV    S +SP K
Sbjct  611  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGHENTLEVSVSESTRSPAK  661



>gb|KHN17794.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like protein 1 [Glycine soja]
Length=854

 Score =   436 bits (1121),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 229/291 (79%), Positives = 247/291 (85%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYGNRYCKGG+FGVYQGASNHEELHNL+KATVMIRRLKKDVLS+LP
Sbjct  436  QLEALYPDVYRNVHEYGNRYCKGGVFGVYQGASNHEELHNLIKATVMIRRLKKDVLSQLP  495

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE+VK+KIK+++S+EEAESLK    NLINKIY  S
Sbjct  496  VKRRQQVFLDLENKDMKQINALFQELEMVKAKIKAAKSQEEAESLKFAQKNLINKIYTDS  555

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI SVLDY+GTVIEA CKFLIFAHH  MID+IH++LLKKKVGCIRIDGGTPAASRQ 
Sbjct  556  AEAKIPSVLDYIGTVIEAGCKFLIFAHHQPMIDSIHEFLLKKKVGCIRIDGGTPAASRQQ  615

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK +IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  616  LVTDFQEKDAIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  675

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDG E  LEV       SP K
Sbjct  676  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGHENVLEVSASLPVNSPSK  726



>ref|XP_009801772.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X1 
[Nicotiana sylvestris]
Length=688

 Score =   431 bits (1107),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 225/291 (77%), Positives = 245/291 (84%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP+VYKNVHEYGNRYCKGGIFGVYQGASNHEELH+LMKAT+MIRRLKKDVLSELP
Sbjct  372  QLEALYPNVYKNVHEYGNRYCKGGIFGVYQGASNHEELHSLMKATLMIRRLKKDVLSELP  431

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   LEV+K K K +QS+EEA+SLK    +LI KIY AS
Sbjct  432  QKRRQQVFLDLGEKEMRHVNILFRELEVIKGKYKLAQSEEEAKSLKFAEKSLITKIYTAS  491

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGT++EADCKFLIFAHH  MI++IH YLLKKKVGCIRIDG TP+A RQA
Sbjct  492  AEAKIPAVLDYLGTMVEADCKFLIFAHHQPMIESIHNYLLKKKVGCIRIDGSTPSALRQA  551

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK +IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  552  LVTDFQEKETIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  611

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+ YLLANDTVDDIIWDVV++KLENLGQMLDG EKSLEV  + S  SP K
Sbjct  612  VNVCYLLANDTVDDIIWDVVQSKLENLGQMLDGHEKSLEVSTNQSYSSPSK  662



>ref|XP_002519341.1| Chromatin remodelling complex ATPase chain isw-1, putative [Ricinus 
communis]
 gb|EEF43205.1| Chromatin remodelling complex ATPase chain isw-1, putative [Ricinus 
communis]
Length=674

 Score =   430 bits (1105),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 223/291 (77%), Positives = 240/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYGNRYC+GGIFGVYQGASNHEELHNLMKATVMIRRLKKDVL+ELP
Sbjct  356  QLEALYPDVYRNVHEYGNRYCRGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLAELP  415

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            +KRRQQ                   LEVVK KIK+  S EE ESLK +  N+INKIY  S
Sbjct  416  LKRRQQVFLDLAEKDMKKINALFRELEVVKGKIKACSSAEEVESLKFSEKNIINKIYTDS  475

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI  VLDYL TVIEA CKFLIFAHH  MID+IH++L+KKKVGCIRIDG TP  SRQ+
Sbjct  476  AEAKIPGVLDYLATVIEAGCKFLIFAHHQPMIDSIHEFLVKKKVGCIRIDGRTPPVSRQS  535

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK +IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  536  LVTDFQEKDAIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  595

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDG E +LEV       SP K
Sbjct  596  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGHENALEVSASQQRSSPAK  646



>ref|XP_010909322.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 [Elaeis guineensis]
Length=698

 Score =   430 bits (1106),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 222/289 (77%), Positives = 243/289 (84%), Gaps = 17/289 (6%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYGNRYC+GG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  375  QLEALYPDVYKNVHEYGNRYCRGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  434

Query  182  VKRRQQ-----------------LEVVkskikssqskeeaeslkLTMNNLINKIYVASAK  310
            VKRRQQ                 LEVVK+ I++  S E+ ESLK T  NLINKIY  SA+
Sbjct  435  VKRRQQIFLDLNEKDMKQIRVLFLEVVKANIQACDSNEKIESLKFTQKNLINKIYNDSAE  494

Query  311  GKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALV  490
             KI ++LDYL TVIEADCKFLIFAHH  MIDAIHQ+LLKKKV CIRIDGGTP++SRQALV
Sbjct  495  AKIPAILDYLNTVIEADCKFLIFAHHQCMIDAIHQFLLKKKVSCIRIDGGTPSSSRQALV  554

Query  491  TDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVN  670
             DFQEK +IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGD+IQAEDRAHRIGQ SSVN
Sbjct  555  NDFQEKDNIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDIIQAEDRAHRIGQASSVN  614

Query  671  IYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            IYYLLANDTVDDIIWDVV++KLENLGQMLDGQE +L V    ++ S +K
Sbjct  615  IYYLLANDTVDDIIWDVVQSKLENLGQMLDGQEDALRVSTSQTSNSLVK  663



>gb|KDO72238.1| hypothetical protein CISIN_1g005980mg [Citrus sinensis]
Length=666

 Score =   429 bits (1102),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 222/291 (76%), Positives = 241/291 (83%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYGNRYCKGG+FG+YQGASNHEELHNLMKATVMIRRLKKDVL++LP
Sbjct  348  QLEALYPDVYKNVHEYGNRYCKGGVFGIYQGASNHEELHNLMKATVMIRRLKKDVLAQLP  407

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIK+ +S+EE +SLK T  NLINKIY  S
Sbjct  408  VKRRQQVFLDVAEKDMRQIYALFRELEVVKGKIKACKSEEEVQSLKFTEKNLINKIYTDS  467

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEA CKFLIFAHH  M+DAIHQ  LKKKV CIRIDGGTP ASRQA
Sbjct  468  AEAKIPAVLDYLETVIEAGCKFLIFAHHQPMLDAIHQLFLKKKVHCIRIDGGTPPASRQA  527

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVT+FQEK  +KAAVLS+KAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  528  LVTEFQEKDDVKAAVLSMKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  587

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLLANDTVDDI+WDVV++KLENLGQ+LDG E SLEV       SP K
Sbjct  588  VNVYYLLANDTVDDIVWDVVRSKLENLGQVLDGHENSLEVSSSQIRSSPAK  638



>ref|XP_002269671.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X2 
[Vitis vinifera]
 emb|CBI26024.3| unnamed protein product [Vitis vinifera]
Length=677

 Score =   428 bits (1100),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 226/291 (78%), Positives = 246/291 (85%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYGNRYCKGG+FG+YQGASNHEELHNLMKATV+IRRLKKDVLSELP
Sbjct  359  QLEALYPDVYRNVHEYGNRYCKGGVFGMYQGASNHEELHNLMKATVLIRRLKKDVLSELP  418

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVKSKIK+S+SKEEAESLK +  NLINKIY  S
Sbjct  419  VKRRQQVFLDLDEKDMKQINALFRELEVVKSKIKASKSKEEAESLKFSEKNLINKIYTDS  478

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTV+EA CKFLIFAHH  MID+I Q+L+KKKVGCIRIDG TP++SRQA
Sbjct  479  AQAKIPAVLDYLGTVVEAGCKFLIFAHHQPMIDSIFQFLVKKKVGCIRIDGSTPSSSRQA  538

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
             VTDFQEK +IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDR HRIGQVSS
Sbjct  539  FVTDFQEKDTIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRVHRIGQVSS  598

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNI+YLLANDTVDDIIWDVV++KLENLGQMLDG E +LEV       SP K
Sbjct  599  VNIHYLLANDTVDDIIWDVVQSKLENLGQMLDGHENTLEVSVSQPRSSPSK  649



>ref|XP_010649703.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X1 
[Vitis vinifera]
Length=678

 Score =   428 bits (1100),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 226/291 (78%), Positives = 246/291 (85%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYGNRYCKGG+FG+YQGASNHEELHNLMKATV+IRRLKKDVLSELP
Sbjct  360  QLEALYPDVYRNVHEYGNRYCKGGVFGMYQGASNHEELHNLMKATVLIRRLKKDVLSELP  419

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVKSKIK+S+SKEEAESLK +  NLINKIY  S
Sbjct  420  VKRRQQVFLDLDEKDMKQINALFRELEVVKSKIKASKSKEEAESLKFSEKNLINKIYTDS  479

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTV+EA CKFLIFAHH  MID+I Q+L+KKKVGCIRIDG TP++SRQA
Sbjct  480  AQAKIPAVLDYLGTVVEAGCKFLIFAHHQPMIDSIFQFLVKKKVGCIRIDGSTPSSSRQA  539

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
             VTDFQEK +IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDR HRIGQVSS
Sbjct  540  FVTDFQEKDTIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRVHRIGQVSS  599

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNI+YLLANDTVDDIIWDVV++KLENLGQMLDG E +LEV       SP K
Sbjct  600  VNIHYLLANDTVDDIIWDVVQSKLENLGQMLDGHENTLEVSVSQPRSSPSK  650



>ref|XP_006349875.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1-like isoform 
X1 [Solanum tuberosum]
Length=693

 Score =   427 bits (1098),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 223/291 (77%), Positives = 247/291 (85%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEAL+P VYKNVHEYGNRYCKGGIFGVYQGASNHEELH+L+KATVMIRRLKKDVLSELP
Sbjct  378  QLEALHPTVYKNVHEYGNRYCKGGIFGVYQGASNHEELHSLIKATVMIRRLKKDVLSELP  437

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   LEV+K K KS+QS+EEA SLK    +LI+KIY AS
Sbjct  438  QKRRQQVFLNLGEKEMRQVNALFRELEVIKGKRKSAQSEEEANSLKFAEKSLISKIYTAS  497

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGT++EA+CKFLIFAHH  MID+IH+YLLKKKVGCIRIDG TP+A RQ 
Sbjct  498  AEAKIPAVLDYLGTMVEANCKFLIFAHHQSMIDSIHEYLLKKKVGCIRIDGSTPSALRQD  557

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK +IKAAVLSI+AGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  558  LVTDFQEKETIKAAVLSIRAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  617

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+ YLLANDTVDDIIWDVV++KL+NLGQMLDGQEKSLEV  + S+ SP K
Sbjct  618  VNVCYLLANDTVDDIIWDVVQSKLDNLGQMLDGQEKSLEVSTNQSHSSPSK  668



>ref|XP_006419207.1| hypothetical protein CICLE_v10004488mg [Citrus clementina]
 gb|ESR32447.1| hypothetical protein CICLE_v10004488mg [Citrus clementina]
Length=666

 Score =   426 bits (1095),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 222/291 (76%), Positives = 240/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYGNRYCKGG+FG+YQGASNHEELHNLMKATVMIRRLKKDVL++LP
Sbjct  348  QLEALYPDVYKNVHEYGNRYCKGGVFGIYQGASNHEELHNLMKATVMIRRLKKDVLAQLP  407

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIK+ +S+EE +SLK T  NLINKIY  S
Sbjct  408  VKRRQQVFLDVAEKDMRQINALFRELEVVKGKIKACKSEEEVQSLKFTEKNLINKIYTDS  467

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEA CKFLIFAHH  M+DAIHQ  LKKKV CIRIDGGTP ASRQA
Sbjct  468  AEAKIPAVLDYLETVIEAGCKFLIFAHHQPMLDAIHQLFLKKKVHCIRIDGGTPPASRQA  527

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVT+FQEK  +KAAVLS+KAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  528  LVTEFQEKDDVKAAVLSMKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  587

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLLANDTVDDIIWDVV++KLENLGQ+LDG E  LEV       SP K
Sbjct  588  VNVYYLLANDTVDDIIWDVVRSKLENLGQVLDGHENILEVSSSQIRSSPAK  638



>ref|XP_006488715.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1-like [Citrus 
sinensis]
Length=666

 Score =   426 bits (1095),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 222/291 (76%), Positives = 240/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYGNRYCKGG+FG+YQGASNHEELHNLMKATVMIRRLKKDVL++LP
Sbjct  348  QLEALYPDVYKNVHEYGNRYCKGGVFGIYQGASNHEELHNLMKATVMIRRLKKDVLAQLP  407

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIK+ +S+EE +SLK T  NLINKIY  S
Sbjct  408  VKRRQQVFLDVAEKDMRQIYALFRELEVVKGKIKACKSEEEVQSLKFTEKNLINKIYTDS  467

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEA CKFLIFAHH  M+DAIHQ  LKKKV CIRIDGGTP ASRQA
Sbjct  468  AEAKIPAVLDYLETVIEAGCKFLIFAHHQPMLDAIHQLFLKKKVHCIRIDGGTPPASRQA  527

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVT+FQEK  +KAAVLS+KAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  528  LVTEFQEKDDVKAAVLSMKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  587

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLLANDTVDDIIWDVV++KLENLGQ+LDG E  LEV       SP K
Sbjct  588  VNVYYLLANDTVDDIIWDVVRSKLENLGQVLDGHENILEVSSSQIRSSPAK  638



>gb|KHF98570.1| Zinc finger Ran-binding domain-containing 3 [Gossypium arboreum]
Length=635

 Score =   425 bits (1092),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 219/291 (75%), Positives = 241/291 (83%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP VY+ V+EYG RYCKGG+FG YQGASNHEELHNLMKATVMIRRLKKDVL +LP
Sbjct  302  QLEALYPTVYRKVYEYGERYCKGGVFGTYQGASNHEELHNLMKATVMIRRLKKDVLYQLP  361

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            +KRRQQ                   LEVVK KI   +S+EE +SLKL   NLINKIY  S
Sbjct  362  MKRRQQVFLELAEKDMKRISCLFCELEVVKGKITMCKSEEEVKSLKLVQKNLINKIYTDS  421

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGT++EADCKF+IFAHH  MI+A+HQ+LLKKKVGCIRIDG TPA+SRQA
Sbjct  422  AEAKIPAVLDYLGTIVEADCKFIIFAHHQPMIEAMHQFLLKKKVGCIRIDGTTPASSRQA  481

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV DFQEK +I+AAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  482  LVNDFQEKDAIRAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  541

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV+NKLENLGQMLDG E SLEV     ++SP K
Sbjct  542  VNIYYLLANDTVDDIIWDVVQNKLENLGQMLDGHENSLEVSSSQEHRSPTK  592



>ref|XP_010694067.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=704

 Score =   427 bits (1097),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 220/291 (76%), Positives = 245/291 (84%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP VYK+VHEYG+RYC+GG+FGVYQGASNHEELHNLMKAT+MIRRLKKDVLSELP
Sbjct  370  QLEALYPGVYKSVHEYGSRYCRGGVFGVYQGASNHEELHNLMKATLMIRRLKKDVLSELP  429

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   L V+K +IK S++K+E ESLKL+  +LINKIY  S
Sbjct  430  VKRRQQVFLDLAEKDLRQIKALFLELGVLKDRIKLSKTKDEHESLKLSEKSLINKIYTDS  489

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VL+YLGTVIEA CKFLIFAHH  M++AIHQ+L +KKVGCIRIDG TPAASRQA
Sbjct  490  AEAKIPAVLEYLGTVIEAGCKFLIFAHHQPMVEAIHQFLQRKKVGCIRIDGSTPAASRQA  549

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK +IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  550  LVTDFQEKEAIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  609

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLLANDTVDDIIWDVV+NKLENLGQ+LDGQE S++V       SP K
Sbjct  610  VNVYYLLANDTVDDIIWDVVQNKLENLGQVLDGQENSMKVSHSQPRSSPAK  660



>ref|XP_010694066.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=708

 Score =   427 bits (1097),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 220/291 (76%), Positives = 245/291 (84%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP VYK+VHEYG+RYC+GG+FGVYQGASNHEELHNLMKAT+MIRRLKKDVLSELP
Sbjct  374  QLEALYPGVYKSVHEYGSRYCRGGVFGVYQGASNHEELHNLMKATLMIRRLKKDVLSELP  433

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   L V+K +IK S++K+E ESLKL+  +LINKIY  S
Sbjct  434  VKRRQQVFLDLAEKDLRQIKALFLELGVLKDRIKLSKTKDEHESLKLSEKSLINKIYTDS  493

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VL+YLGTVIEA CKFLIFAHH  M++AIHQ+L +KKVGCIRIDG TPAASRQA
Sbjct  494  AEAKIPAVLEYLGTVIEAGCKFLIFAHHQPMVEAIHQFLQRKKVGCIRIDGSTPAASRQA  553

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK +IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  554  LVTDFQEKEAIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  613

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLLANDTVDDIIWDVV+NKLENLGQ+LDGQE S++V       SP K
Sbjct  614  VNVYYLLANDTVDDIIWDVVQNKLENLGQVLDGQENSMKVSHSQPRSSPAK  664



>gb|AES92088.2| chromatin-remodeling complex ATPase chain [Medicago truncatula]
Length=691

 Score =   426 bits (1095),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 223/292 (76%), Positives = 245/292 (84%), Gaps = 20/292 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYGNRYCKGG+FGVYQGASNHEELHNLMKAT MIRRLKKDVLSELP
Sbjct  348  QLEALYPDVYKNVHEYGNRYCKGGMFGVYQGASNHEELHNLMKATTMIRRLKKDVLSELP  407

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE VK+KIK+++S+EEAESLK +  N+INK+Y  S
Sbjct  408  VKRRQQVFLDLADKDMKQINALFRELERVKAKIKAAKSQEEAESLKFSKQNMINKLYTDS  467

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTVIEA CKFLIFAHH+ MIDAIH++LLKKKV CIRIDGGTP+ SRQ 
Sbjct  468  AEAKIPAVLDYLGTVIEAGCKFLIFAHHLPMIDAIHEFLLKKKVACIRIDGGTPSGSRQQ  527

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVT+FQEK +IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDR HRIGQ SS
Sbjct  528  LVTEFQEKDTIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRVHRIGQESS  587

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSN-KSPMK  817
            VNIYYLLANDTVDDIIWD V++KLENLGQMLDG E +L+V +D     SP K
Sbjct  588  VNIYYLLANDTVDDIIWDTVQSKLENLGQMLDGHENTLKVSDDQPPLSSPAK  639



>ref|XP_003562604.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 [Brachypodium 
distachyon]
Length=703

 Score =   425 bits (1092),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 220/291 (76%), Positives = 237/291 (81%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QL+ALYP+VYKNV+EYGNRYCKGG FG+YQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  387  QLQALYPNVYKNVNEYGNRYCKGGFFGMYQGASNHEELHNLMKATVMIRRLKKDVLSELP  446

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE VK K++S  SKE  +SLK    N+INKIY  S
Sbjct  447  VKRRQQVFLDLSEKEMKHIRALFRELETVKIKMQSCDSKEMFDSLKFNQKNIINKIYTDS  506

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLDYLGTVIEADCKFLIFAHH  MIDAIHQ+LLKKKV CIRIDG TP A RQ 
Sbjct  507  ADAKIPAVLDYLGTVIEADCKFLIFAHHQPMIDAIHQHLLKKKVNCIRIDGQTPVAVRQT  566

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQ K  IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  567  LVTDFQNKDDIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSS  626

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLAN+TVDDIIWDVV+ KLENLGQMLDGQEK+L+  +  +  SP K
Sbjct  627  VNIYYLLANETVDDIIWDVVQGKLENLGQMLDGQEKTLDCSQSETRPSPSK  677



>ref|XP_010098747.1| Zinc finger Ran-binding domain-containing protein 3 [Morus notabilis]
 gb|EXB75650.1| Zinc finger Ran-binding domain-containing protein 3 [Morus notabilis]
Length=634

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 221/298 (74%), Positives = 240/298 (81%), Gaps = 26/298 (9%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYK VHEYGNRYCKGGIFGVYQGASNHEELHNLMKAT+MIRRLKKDVLSELP
Sbjct  309  QLEALYPDVYKYVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATLMIRRLKKDVLSELP  368

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   LEV+K KIK+  SKEE ++LK T  NLINKI+  S
Sbjct  369  TKRRQQVFLDLAEKDMKQVNALFRELEVIKGKIKACTSKEEVDALKFTEKNLINKIFTES  428

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL T+IEA CKFLIFAHH  MI++IHQ+LLKKKV CIRIDG TPA  RQA
Sbjct  429  AEAKIPAVLDYLATMIEAGCKFLIFAHHQSMIESIHQFLLKKKVDCIRIDGNTPAVKRQA  488

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK S+KAAVLSI+AGGVGLTLTAASTV+FAEL WTPGDLIQAEDRAHRIGQ SS
Sbjct  489  LVTDFQEKNSVKAAVLSIRAGGVGLTLTAASTVVFAELSWTPGDLIQAEDRAHRIGQASS  548

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNS-------NKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDG E  LEV E  +         SP+K
Sbjct  549  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGHENVLEVAEHKTLDSASEPKSSPLK  606



>ref|XP_009388210.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=701

 Score =   423 bits (1087),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 217/291 (75%), Positives = 238/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP VY+NVHEYGNRYCKGGIFG+YQGASNHEELH LMKATVMIRRLKKDVLS+LP
Sbjct  385  QLEALYPGVYRNVHEYGNRYCKGGIFGLYQGASNHEELHCLMKATVMIRRLKKDVLSQLP  444

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK  I++  S E+ ESLK    NLINKIY  S
Sbjct  445  VKRRQQVFLDLKEKDMKQIRILFRELEVVKMNIQACDSPEKMESLKFMQKNLINKIYNDS  504

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEADCKFLIFAHH  MIDAIHQ+LLKKKVGCIRIDGGTP++ RQA
Sbjct  505  AEAKIPAVLDYLSTVIEADCKFLIFAHHQPMIDAIHQFLLKKKVGCIRIDGGTPSSMRQA  564

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV +FQEK  IKAAVLSIKAGGVGL LTAAST+ FAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  565  LVNEFQEKIEIKAAVLSIKAGGVGLNLTAASTIFFAELTWTPGDIIQAEDRAHRIGQVSS  624

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLL+NDTVDDIIWDVV++KLE L QMLDG+E +LEV    ++KSP K
Sbjct  625  VNIYYLLSNDTVDDIIWDVVRSKLETLSQMLDGEENTLEVSSSQTSKSPQK  675



>ref|XP_009388217.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X2 
[Musa acuminata subsp. malaccensis]
Length=700

 Score =   423 bits (1087),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 217/291 (75%), Positives = 238/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP VY+NVHEYGNRYCKGGIFG+YQGASNHEELH LMKATVMIRRLKKDVLS+LP
Sbjct  384  QLEALYPGVYRNVHEYGNRYCKGGIFGLYQGASNHEELHCLMKATVMIRRLKKDVLSQLP  443

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK  I++  S E+ ESLK    NLINKIY  S
Sbjct  444  VKRRQQVFLDLKEKDMKQIRILFRELEVVKMNIQACDSPEKMESLKFMQKNLINKIYNDS  503

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEADCKFLIFAHH  MIDAIHQ+LLKKKVGCIRIDGGTP++ RQA
Sbjct  504  AEAKIPAVLDYLSTVIEADCKFLIFAHHQPMIDAIHQFLLKKKVGCIRIDGGTPSSMRQA  563

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV +FQEK  IKAAVLSIKAGGVGL LTAAST+ FAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  564  LVNEFQEKIEIKAAVLSIKAGGVGLNLTAASTIFFAELTWTPGDIIQAEDRAHRIGQVSS  623

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLL+NDTVDDIIWDVV++KLE L QMLDG+E +LEV    ++KSP K
Sbjct  624  VNIYYLLSNDTVDDIIWDVVRSKLETLSQMLDGEENTLEVSSSQTSKSPQK  674



>ref|XP_008223495.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 [Prunus mume]
Length=706

 Score =   423 bits (1087),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 220/288 (76%), Positives = 240/288 (83%), Gaps = 19/288 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYK+VHEYGNRYCKGG FG+YQGASNHEELHNLMKATVMIRRLK DVLSELP
Sbjct  387  QLEALYPDVYKSVHEYGNRYCKGGTFGLYQGASNHEELHNLMKATVMIRRLKNDVLSELP  446

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK+KIK+ Q+KEE +SLK    NLINKIY  S
Sbjct  447  VKRRQQVFLDLAERDMKQINALFRELEVVKAKIKACQTKEEVDSLKFAEKNLINKIYTDS  506

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTVIEA CKFL+FAHH  MID+I+Q+LLKKKVGCIRIDG  P  SRQA
Sbjct  507  AEAKIPAVLDYLGTVIEAGCKFLVFAHHQSMIDSIYQFLLKKKVGCIRIDGSIPTVSRQA  566

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
             VT+FQEK S+KAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  567  YVTEFQEKDSVKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  626

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKS  808
            VN+YYLLANDTVDDIIWDVV++KLENLGQMLDGQE +L+V      +S
Sbjct  627  VNVYYLLANDTVDDIIWDVVQSKLENLGQMLDGQENTLQVSTSQPPRS  674



>ref|XP_008378419.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 [Malus domestica]
Length=729

 Score =   424 bits (1089),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 221/289 (76%), Positives = 240/289 (83%), Gaps = 19/289 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYK+VHEYGNRYCKGG FG+YQGA NHEELHNLMKATVMIRRLK DVLSELP
Sbjct  389  QLEALYPDVYKSVHEYGNRYCKGGTFGLYQGACNHEELHNLMKATVMIRRLKNDVLSELP  448

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIK+ QSKEE +SLK T  NLINKIY  S
Sbjct  449  VKRRQQVFLDLAEKDMKQINALFRELEVVKGKIKACQSKEEVDSLKFTEKNLINKIYTDS  508

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTVIEA CKFL+FAHH  MID+I+Q+LLKKKVGCIRIDG  P  +RQA
Sbjct  509  AEAKIPAVLDYLGTVIEAGCKFLVFAHHQSMIDSIYQFLLKKKVGCIRIDGSIPTVARQA  568

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
             VT+FQEK SIKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQV+S
Sbjct  569  YVTEFQEKDSIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVAS  628

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSP  811
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDGQE ++EV    +  +P
Sbjct  629  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGQENTMEVAASQTRITP  677



>ref|XP_007225110.1| hypothetical protein PRUPE_ppa002731mg [Prunus persica]
 gb|EMJ26309.1| hypothetical protein PRUPE_ppa002731mg [Prunus persica]
Length=639

 Score =   420 bits (1079),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 222/292 (76%), Positives = 239/292 (82%), Gaps = 20/292 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYK+VHEYGNRYCKGG FG+YQGASNHEELHNLMKATVMIRRLK DVLSELP
Sbjct  320  QLEALYPDVYKSVHEYGNRYCKGGTFGLYQGASNHEELHNLMKATVMIRRLKNDVLSELP  379

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK+KIK+ Q KEE +SLK    NLINKIY  S
Sbjct  380  VKRRQQVFLDLAEKDMKQINALFRELEVVKAKIKACQIKEEVDSLKFAEKNLINKIYTDS  439

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTVIEA CKFL+FAHH  MID+I+Q+LLKKKVGCIRIDG  P  SRQA
Sbjct  440  AEAKIPAVLDYLGTVIEAGCKFLVFAHHQSMIDSIYQFLLKKKVGCIRIDGSIPTVSRQA  499

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
             VT+FQEK S+KAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  500  YVTEFQEKDSVKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  559

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEV-LEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDG E +L+V        SP K
Sbjct  560  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGHENTLQVSTSQPPQSSPAK  611



>ref|XP_008390341.1| PREDICTED: putative SMARCAL1-like protein isoform X1 [Malus domestica]
 ref|XP_008390342.1| PREDICTED: putative SMARCAL1-like protein isoform X1 [Malus domestica]
Length=751

 Score =   423 bits (1088),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 221/291 (76%), Positives = 239/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYK+VHEYGNRYCKGG FG+YQGA NHEELHNLMKATVMIRRLK DVLSELP
Sbjct  419  QLEALYPDVYKSVHEYGNRYCKGGTFGLYQGACNHEELHNLMKATVMIRRLKNDVLSELP  478

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIK+ QSKEE +SLK T  NL+NKIY  S
Sbjct  479  VKRRQQVFLDLAEKDMKQINAFFRELEVVKGKIKACQSKEEVDSLKFTEKNLMNKIYTDS  538

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTV+EA CKFL+FAHH  MID+I+Q+LLKKKVGCIRIDG  P  +RQA
Sbjct  539  AEAKIPTVLDYLGTVMEAGCKFLVFAHHQSMIDSIYQFLLKKKVGCIRIDGSIPTVARQA  598

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
             VT+FQEK SIKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  599  YVTEFQEKDSIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  658

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDG E ++EV       SP K
Sbjct  659  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGHENTMEVAASQPRSSPAK  709



>ref|XP_008390343.1| PREDICTED: putative SMARCAL1-like protein isoform X2 [Malus domestica]
Length=750

 Score =   423 bits (1088),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 221/291 (76%), Positives = 239/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYK+VHEYGNRYCKGG FG+YQGA NHEELHNLMKATVMIRRLK DVLSELP
Sbjct  418  QLEALYPDVYKSVHEYGNRYCKGGTFGLYQGACNHEELHNLMKATVMIRRLKNDVLSELP  477

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIK+ QSKEE +SLK T  NL+NKIY  S
Sbjct  478  VKRRQQVFLDLAEKDMKQINAFFRELEVVKGKIKACQSKEEVDSLKFTEKNLMNKIYTDS  537

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTV+EA CKFL+FAHH  MID+I+Q+LLKKKVGCIRIDG  P  +RQA
Sbjct  538  AEAKIPTVLDYLGTVMEAGCKFLVFAHHQSMIDSIYQFLLKKKVGCIRIDGSIPTVARQA  597

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
             VT+FQEK SIKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  598  YVTEFQEKDSIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  657

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQMLDG E ++EV       SP K
Sbjct  658  VNIYYLLANDTVDDIIWDVVQSKLENLGQMLDGHENTMEVAASQPRSSPAK  708



>ref|XP_009388201.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X7 
[Musa acuminata subsp. malaccensis]
Length=642

 Score =   419 bits (1078),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 214/291 (74%), Positives = 236/291 (81%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP VY+NVHEYGNRYC+GG FG+YQGASNHEELH LMKATVMIRRLK DVLS+LP
Sbjct  326  QLEALYPGVYRNVHEYGNRYCRGGYFGLYQGASNHEELHCLMKATVMIRRLKNDVLSQLP  385

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK  I++  S E  ESLK    NLINKIY+ S
Sbjct  386  VKRRQQVFLDLNEKDMKQIRILFRELEVVKMNIQACDSPENMESLKFMQKNLINKIYIDS  445

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEADCKFLIFAHH  MIDAIHQ+LLKKKVGCIRIDGGTP++ RQA
Sbjct  446  AEAKIPAVLDYLSTVIEADCKFLIFAHHQPMIDAIHQFLLKKKVGCIRIDGGTPSSMRQA  505

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV +FQEK  IKAAVLSIKAGGVGL LTAAST+ FAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  506  LVNEFQEKIEIKAAVLSIKAGGVGLNLTAASTIFFAELTWTPGDIIQAEDRAHRIGQVSS  565

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLL+NDTVDDIIWDVV++KLE L QMLDG+E +LEV    ++KSP K
Sbjct  566  VNIYYLLSNDTVDDIIWDVVRSKLETLSQMLDGEENTLEVSSSQTSKSPQK  616



>ref|XP_009388190.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X6 
[Musa acuminata subsp. malaccensis]
 ref|XP_009388195.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X6 
[Musa acuminata subsp. malaccensis]
Length=645

 Score =   419 bits (1077),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 214/291 (74%), Positives = 236/291 (81%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP VY+NVHEYGNRYC+GG FG+YQGASNHEELH LMKATVMIRRLK DVLS+LP
Sbjct  329  QLEALYPGVYRNVHEYGNRYCRGGYFGLYQGASNHEELHCLMKATVMIRRLKNDVLSQLP  388

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK  I++  S E  ESLK    NLINKIY+ S
Sbjct  389  VKRRQQVFLDLNEKDMKQIRILFRELEVVKMNIQACDSPENMESLKFMQKNLINKIYIDS  448

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEADCKFLIFAHH  MIDAIHQ+LLKKKVGCIRIDGGTP++ RQA
Sbjct  449  AEAKIPAVLDYLSTVIEADCKFLIFAHHQPMIDAIHQFLLKKKVGCIRIDGGTPSSMRQA  508

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV +FQEK  IKAAVLSIKAGGVGL LTAAST+ FAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  509  LVNEFQEKIEIKAAVLSIKAGGVGLNLTAASTIFFAELTWTPGDIIQAEDRAHRIGQVSS  568

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLL+NDTVDDIIWDVV++KLE L QMLDG+E +LEV    ++KSP K
Sbjct  569  VNIYYLLSNDTVDDIIWDVVRSKLETLSQMLDGEENTLEVSSSQTSKSPQK  619



>ref|XP_004298251.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3-like 
[Fragaria vesca subsp. vesca]
Length=724

 Score =   422 bits (1084),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 222/291 (76%), Positives = 235/291 (81%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYG RYCKGG FGVYQGASNHEELHNLMKATVMIRRLK DVLSELP
Sbjct  367  QLEALYPDVYKNVHEYGKRYCKGGTFGVYQGASNHEELHNLMKATVMIRRLKNDVLSELP  426

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIK+ +SKEE +SLK    NLINKIY  S
Sbjct  427  VKRRQQVFLDLAEKDMKQINALFRELEVVKLKIKACKSKEEVDSLKFMEKNLINKIYTDS  486

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLDYLGTVIEA CKFL+FAHH  MIDAI+Q+LLKKKV CIRIDG  P   RQA
Sbjct  487  AVAKIPAVLDYLGTVIEAGCKFLVFAHHQSMIDAIYQFLLKKKVSCIRIDGSIPTVERQA  546

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
             VT FQEK S+KAAVLSIKAGGVGLTLTAASTV+FAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  547  YVTQFQEKDSVKAAVLSIKAGGVGLTLTAASTVLFAELSWTPGDLIQAEDRAHRIGQVSS  606

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLLANDTVDDIIWDVV++KLENLGQMLDG E SLEV +     SP K
Sbjct  607  VNVYYLLANDTVDDIIWDVVQSKLENLGQMLDGHENSLEVSDSLPRSSPAK  657



>ref|XP_009359811.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X2 
[Pyrus x bretschneideri]
Length=729

 Score =   422 bits (1084),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 220/289 (76%), Positives = 240/289 (83%), Gaps = 19/289 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYK+VHEYGNRYCKGG FG+YQGA NHEELHNLMKATVMIRRLK DVLSELP
Sbjct  389  QLEALYPDVYKSVHEYGNRYCKGGTFGLYQGACNHEELHNLMKATVMIRRLKNDVLSELP  448

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIK+ QSKEE +SLK T  NLINKIY  S
Sbjct  449  VKRRQQVFLDLAEKDMKQINALFRELEVVKGKIKACQSKEEVDSLKFTEKNLINKIYTDS  508

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTVIEA CKFL+FAHH  MID+I+Q+LLKKKVGCIRIDG  P  +RQA
Sbjct  509  AEAKIPAVLDYLGTVIEAGCKFLVFAHHQSMIDSIYQFLLKKKVGCIRIDGSIPTVARQA  568

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
             VT+FQEK SIKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  569  YVTEFQEKDSIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  628

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSP  811
            VN+YYLLANDTVDDIIWDVV++KL+NLGQMLDGQE ++EV    +  +P
Sbjct  629  VNVYYLLANDTVDDIIWDVVQSKLDNLGQMLDGQENTMEVAAGQTRITP  677



>ref|XP_009359810.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X1 
[Pyrus x bretschneideri]
Length=732

 Score =   422 bits (1084),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 220/289 (76%), Positives = 240/289 (83%), Gaps = 19/289 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYK+VHEYGNRYCKGG FG+YQGA NHEELHNLMKATVMIRRLK DVLSELP
Sbjct  392  QLEALYPDVYKSVHEYGNRYCKGGTFGLYQGACNHEELHNLMKATVMIRRLKNDVLSELP  451

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIK+ QSKEE +SLK T  NLINKIY  S
Sbjct  452  VKRRQQVFLDLAEKDMKQINALFRELEVVKGKIKACQSKEEVDSLKFTEKNLINKIYTDS  511

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTVIEA CKFL+FAHH  MID+I+Q+LLKKKVGCIRIDG  P  +RQA
Sbjct  512  AEAKIPAVLDYLGTVIEAGCKFLVFAHHQSMIDSIYQFLLKKKVGCIRIDGSIPTVARQA  571

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
             VT+FQEK SIKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  572  YVTEFQEKDSIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  631

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSP  811
            VN+YYLLANDTVDDIIWDVV++KL+NLGQMLDGQE ++EV    +  +P
Sbjct  632  VNVYYLLANDTVDDIIWDVVQSKLDNLGQMLDGQENTMEVAAGQTRITP  680



>ref|XP_007029245.1| Chromatin remodeling factor18 isoform 1 [Theobroma cacao]
 gb|EOY09747.1| Chromatin remodeling factor18 isoform 1 [Theobroma cacao]
Length=713

 Score =   421 bits (1082),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 218/291 (75%), Positives = 239/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+ ++EYG+RYCKGGIFG YQGASNHEELHNLMKATVMIRRLKKDVL +LP
Sbjct  354  QLEALYPDVYRKIYEYGDRYCKGGIFGTYQGASNHEELHNLMKATVMIRRLKKDVLCQLP  413

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            +KRRQQ                   L +VK KIK+ +S+EE  SLKL   NLINKIY  S
Sbjct  414  MKRRQQVFLELTEKDMKKISSLFQELNLVKGKIKARRSEEEVHSLKLIEKNLINKIYTDS  473

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEA CKFLIFAHH  MI+AIHQ+LLKKKVGCIRIDG TPA+SRQA
Sbjct  474  AEAKIPAVLDYLETVIEAGCKFLIFAHHQPMIEAIHQFLLKKKVGCIRIDGATPASSRQA  533

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV DFQEK +I+AAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQ SS
Sbjct  534  LVNDFQEKDAIRAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQASS  593

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV+NKLE LGQMLDG E +LEV      +SP+K
Sbjct  594  VNIYYLLANDTVDDIIWDVVQNKLETLGQMLDGHENTLEVSTSQQQRSPLK  644



>ref|XP_009359812.1| PREDICTED: putative SMARCAL1-like protein isoform X3 [Pyrus x 
bretschneideri]
Length=760

 Score =   422 bits (1085),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 220/289 (76%), Positives = 240/289 (83%), Gaps = 19/289 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYK+VHEYGNRYCKGG FG+YQGA NHEELHNLMKATVMIRRLK DVLSELP
Sbjct  420  QLEALYPDVYKSVHEYGNRYCKGGTFGLYQGACNHEELHNLMKATVMIRRLKNDVLSELP  479

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIK+ QSKEE +SLK T  NLINKIY  S
Sbjct  480  VKRRQQVFLDLAEKDMKQINALFRELEVVKGKIKACQSKEEVDSLKFTEKNLINKIYTDS  539

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTVIEA CKFL+FAHH  MID+I+Q+LLKKKVGCIRIDG  P  +RQA
Sbjct  540  AEAKIPAVLDYLGTVIEAGCKFLVFAHHQSMIDSIYQFLLKKKVGCIRIDGSIPTVARQA  599

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
             VT+FQEK SIKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  600  YVTEFQEKDSIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  659

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSP  811
            VN+YYLLANDTVDDIIWDVV++KL+NLGQMLDGQE ++EV    +  +P
Sbjct  660  VNVYYLLANDTVDDIIWDVVQSKLDNLGQMLDGQENTMEVAAGQTRITP  708



>ref|XP_006658872.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1-like [Oryza 
brachyantha]
Length=710

 Score =   421 bits (1081),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 222/291 (76%), Positives = 239/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QL+AL PDVYK+V+EYGNRYCKGG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  394  QLQALNPDVYKSVNEYGNRYCKGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  453

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE VK KIKSS SKE  +SLK    NLINKIY  S
Sbjct  454  VKRRQQVFLDLSEKEMRHIRALFHELETVKIKIKSSDSKETMDSLKFAQKNLINKIYTDS  513

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTVIEADCKFLIFAHH  M++AIHQ+LLKKKV CIRIDG TPA  RQ 
Sbjct  514  AEAKIPAVLDYLGTVIEADCKFLIFAHHQPMLEAIHQHLLKKKVKCIRIDGQTPAPVRQT  573

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQ    IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  574  LVTDFQNNDDIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  633

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV+ KLENLGQMLDGQEK+L+V + ++  SP K
Sbjct  634  VNIYYLLANDTVDDIIWDVVQGKLENLGQMLDGQEKTLDVSQSDTRPSPSK  684



>gb|EEC82516.1| hypothetical protein OsI_27014 [Oryza sativa Indica Group]
Length=700

 Score =   420 bits (1080),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 218/291 (75%), Positives = 238/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QL+ALYP VYKNV+EYGNRYCKGG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  383  QLQALYPTVYKNVNEYGNRYCKGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  442

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE VK KI+S  S+E  +SLK    NLINKIY  S
Sbjct  443  VKRRQQAFLDLSEKEMRHIRALFHELETVKIKIQSCDSQETMDSLKFAQKNLINKIYNDS  502

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGT+IEA+CKFLIFAHH  M++AIHQ+LLKKKV CIRIDG TP   RQ 
Sbjct  503  AEAKIPAVLDYLGTIIEAECKFLIFAHHQSMLEAIHQHLLKKKVKCIRIDGQTPVPVRQT  562

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQ K  IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  563  LVTDFQNKDDIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  622

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV+ KLENLGQMLDGQEK+L+V + ++  SP K
Sbjct  623  VNIYYLLANDTVDDIIWDVVQGKLENLGQMLDGQEKTLDVSQSDTRPSPSK  673



>ref|XP_010524599.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X1 
[Tarenaya hassleriana]
Length=677

 Score =   419 bits (1078),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 216/291 (74%), Positives = 238/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYGNRYCKGG FGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  350  QLEALYPDVYRNVHEYGNRYCKGGFFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  409

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   LEV+K+KIK   S++E +SLK +  NLINKIY  S
Sbjct  410  TKRRQQVFLDLAEKEMKQINALFRELEVIKAKIKDCTSEDEVQSLKFSQKNLINKIYTDS  469

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLDYLGTV+EA CKFL+FAHH  M+DA+HQ+L KKKV CIRIDG TPA+SRQ 
Sbjct  470  ADAKIPAVLDYLGTVLEAGCKFLVFAHHRSMLDALHQFLNKKKVCCIRIDGNTPASSRQT  529

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQEK  IKAAVLSI+A GVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQ SS
Sbjct  530  LVSDFQEKDEIKAAVLSIRAAGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQNSS  589

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNI+YLLANDTVDDIIWDVV++KLENLGQMLDG EK+LEV   +  +S  K
Sbjct  590  VNIHYLLANDTVDDIIWDVVQSKLENLGQMLDGHEKALEVSSGHGTRSQAK  640



>gb|EEE67662.1| hypothetical protein OsJ_25277 [Oryza sativa Japonica Group]
Length=716

 Score =   420 bits (1080),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 218/291 (75%), Positives = 238/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QL+ALYP VYKNV+EYGNRYCKGG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  399  QLQALYPTVYKNVNEYGNRYCKGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  458

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE VK KI+S  S+E  +SLK    NLINKIY  S
Sbjct  459  VKRRQQAFLDLSEKEMRHIRALFHELETVKIKIQSCDSQETMDSLKFAQKNLINKIYNDS  518

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGT+IEA+CKFLIFAHH  M++AIHQ+LLKKKV CIRIDG TP   RQ 
Sbjct  519  AEAKIPAVLDYLGTIIEAECKFLIFAHHQSMLEAIHQHLLKKKVKCIRIDGQTPVPVRQT  578

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQ K  IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  579  LVTDFQNKDDIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  638

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV+ KLENLGQMLDGQEK+L+V + ++  SP K
Sbjct  639  VNIYYLLANDTVDDIIWDVVQGKLENLGQMLDGQEKTLDVSQSDTRPSPSK  689



>ref|XP_009388187.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X5 
[Musa acuminata subsp. malaccensis]
Length=680

 Score =   419 bits (1077),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 214/291 (74%), Positives = 236/291 (81%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP VY+NVHEYGNRYC+GG FG+YQGASNHEELH LMKATVMIRRLK DVLS+LP
Sbjct  364  QLEALYPGVYRNVHEYGNRYCRGGYFGLYQGASNHEELHCLMKATVMIRRLKNDVLSQLP  423

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK  I++  S E  ESLK    NLINKIY+ S
Sbjct  424  VKRRQQVFLDLNEKDMKQIRILFRELEVVKMNIQACDSPENMESLKFMQKNLINKIYIDS  483

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEADCKFLIFAHH  MIDAIHQ+LLKKKVGCIRIDGGTP++ RQA
Sbjct  484  AEAKIPAVLDYLSTVIEADCKFLIFAHHQPMIDAIHQFLLKKKVGCIRIDGGTPSSMRQA  543

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV +FQEK  IKAAVLSIKAGGVGL LTAAST+ FAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  544  LVNEFQEKIEIKAAVLSIKAGGVGLNLTAASTIFFAELTWTPGDIIQAEDRAHRIGQVSS  603

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLL+NDTVDDIIWDVV++KLE L QMLDG+E +LEV    ++KSP K
Sbjct  604  VNIYYLLSNDTVDDIIWDVVRSKLETLSQMLDGEENTLEVSSSQTSKSPQK  654



>ref|XP_002894105.1| SNF2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70364.1| SNF2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=673

 Score =   419 bits (1076),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 216/291 (74%), Positives = 239/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYG+RYCKGG FG YQGASNHEELHNLMKATVMIRRLKKDVL+ELP
Sbjct  346  QLEALYPDVYRNVHEYGSRYCKGGFFGAYQGASNHEELHNLMKATVMIRRLKKDVLTELP  405

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   L VVKSKIK   S+++ +SLK T  NLINKIY  S
Sbjct  406  SKRRQQVFLDLAEKDMKQINALFHELRVVKSKIKDCVSEDDIKSLKFTEKNLINKIYTDS  465

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLDYLGTV+EA CKFL+FAHH  M+DAIHQ+L KKKVGCIRIDG TPA+SRQA
Sbjct  466  AGAKIPAVLDYLGTVLEAGCKFLVFAHHQSMLDAIHQFLKKKKVGCIRIDGSTPASSRQA  525

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQ+K  IKAAVLSI+A GVG+TLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  526  LVSDFQDKDEIKAAVLSIRAAGVGITLTAASTVIFAELAWTPGDLIQAEDRAHRIGQVSS  585

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNI+YLLANDTVDDIIWDVV++KL+NLGQMLDGQE +LEV   +   SP K
Sbjct  586  VNIHYLLANDTVDDIIWDVVQSKLDNLGQMLDGQENALEVSSSHMMSSPTK  636



>ref|XP_009388170.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X3 
[Musa acuminata subsp. malaccensis]
Length=683

 Score =   419 bits (1076),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 214/291 (74%), Positives = 236/291 (81%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP VY+NVHEYGNRYC+GG FG+YQGASNHEELH LMKATVMIRRLK DVLS+LP
Sbjct  367  QLEALYPGVYRNVHEYGNRYCRGGYFGLYQGASNHEELHCLMKATVMIRRLKNDVLSQLP  426

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK  I++  S E  ESLK    NLINKIY+ S
Sbjct  427  VKRRQQVFLDLNEKDMKQIRILFRELEVVKMNIQACDSPENMESLKFMQKNLINKIYIDS  486

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEADCKFLIFAHH  MIDAIHQ+LLKKKVGCIRIDGGTP++ RQA
Sbjct  487  AEAKIPAVLDYLSTVIEADCKFLIFAHHQPMIDAIHQFLLKKKVGCIRIDGGTPSSMRQA  546

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV +FQEK  IKAAVLSIKAGGVGL LTAAST+ FAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  547  LVNEFQEKIEIKAAVLSIKAGGVGLNLTAASTIFFAELTWTPGDIIQAEDRAHRIGQVSS  606

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLL+NDTVDDIIWDVV++KLE L QMLDG+E +LEV    ++KSP K
Sbjct  607  VNIYYLLSNDTVDDIIWDVVRSKLETLSQMLDGEENTLEVSSSQTSKSPQK  657



>ref|XP_009388175.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X4 
[Musa acuminata subsp. malaccensis]
 ref|XP_009388182.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X4 
[Musa acuminata subsp. malaccensis]
Length=682

 Score =   418 bits (1075),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 214/291 (74%), Positives = 236/291 (81%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP VY+NVHEYGNRYC+GG FG+YQGASNHEELH LMKATVMIRRLK DVLS+LP
Sbjct  366  QLEALYPGVYRNVHEYGNRYCRGGYFGLYQGASNHEELHCLMKATVMIRRLKNDVLSQLP  425

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK  I++  S E  ESLK    NLINKIY+ S
Sbjct  426  VKRRQQVFLDLNEKDMKQIRILFRELEVVKMNIQACDSPENMESLKFMQKNLINKIYIDS  485

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEADCKFLIFAHH  MIDAIHQ+LLKKKVGCIRIDGGTP++ RQA
Sbjct  486  AEAKIPAVLDYLSTVIEADCKFLIFAHHQPMIDAIHQFLLKKKVGCIRIDGGTPSSMRQA  545

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV +FQEK  IKAAVLSIKAGGVGL LTAAST+ FAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  546  LVNEFQEKIEIKAAVLSIKAGGVGLNLTAASTIFFAELTWTPGDIIQAEDRAHRIGQVSS  605

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLL+NDTVDDIIWDVV++KLE L QMLDG+E +LEV    ++KSP K
Sbjct  606  VNIYYLLSNDTVDDIIWDVVRSKLETLSQMLDGEENTLEVSSSQTSKSPQK  656



>ref|NP_001060393.1| Os07g0636200 [Oryza sativa Japonica Group]
 dbj|BAD30182.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin a-like [Oryza sativa Japonica Group]
 dbj|BAF22307.1| Os07g0636200 [Oryza sativa Japonica Group]
 dbj|BAG91218.1| unnamed protein product [Oryza sativa Japonica Group]
Length=747

 Score =   420 bits (1080),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 218/291 (75%), Positives = 238/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QL+ALYP VYKNV+EYGNRYCKGG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  430  QLQALYPTVYKNVNEYGNRYCKGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  489

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE VK KI+S  S+E  +SLK    NLINKIY  S
Sbjct  490  VKRRQQAFLDLSEKEMRHIRALFHELETVKIKIQSCDSQETMDSLKFAQKNLINKIYNDS  549

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGT+IEA+CKFLIFAHH  M++AIHQ+LLKKKV CIRIDG TP   RQ 
Sbjct  550  AEAKIPAVLDYLGTIIEAECKFLIFAHHQSMLEAIHQHLLKKKVKCIRIDGQTPVPVRQT  609

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQ K  IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  610  LVTDFQNKDDIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  669

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV+ KLENLGQMLDGQEK+L+V + ++  SP K
Sbjct  670  VNIYYLLANDTVDDIIWDVVQGKLENLGQMLDGQEKTLDVSQSDTRPSPSK  720



>ref|XP_007029246.1| Chromatin remodeling factor18 isoform 2 [Theobroma cacao]
 gb|EOY09748.1| Chromatin remodeling factor18 isoform 2 [Theobroma cacao]
Length=735

 Score =   420 bits (1079),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 218/292 (75%), Positives = 239/292 (82%), Gaps = 20/292 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+ ++EYG+RYCKGGIFG YQGASNHEELHNLMKATVMIRRLKKDVL +LP
Sbjct  375  QLEALYPDVYRKIYEYGDRYCKGGIFGTYQGASNHEELHNLMKATVMIRRLKKDVLCQLP  434

Query  182  VKRRQQ--------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVA  301
            +KRRQQ                    L +VK KIK+ +S+EE  SLKL   NLINKIY  
Sbjct  435  MKRRQQQVFLELTEKDMKKISSLFQELNLVKGKIKARRSEEEVHSLKLIEKNLINKIYTD  494

Query  302  SAKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQ  481
            SA+ KI +VLDYL TVIEA CKFLIFAHH  MI+AIHQ+LLKKKVGCIRIDG TPA+SRQ
Sbjct  495  SAEAKIPAVLDYLETVIEAGCKFLIFAHHQPMIEAIHQFLLKKKVGCIRIDGATPASSRQ  554

Query  482  ALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVS  661
            ALV DFQEK +I+AAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQ S
Sbjct  555  ALVNDFQEKDAIRAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQAS  614

Query  662  SVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            SVNIYYLLANDTVDDIIWDVV+NKLE LGQMLDG E +LEV      +SP+K
Sbjct  615  SVNIYYLLANDTVDDIIWDVVQNKLETLGQMLDGHENTLEVSTSQQQRSPLK  666



>ref|XP_009388163.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X2 
[Musa acuminata subsp. malaccensis]
Length=706

 Score =   418 bits (1075),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 214/291 (74%), Positives = 236/291 (81%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP VY+NVHEYGNRYC+GG FG+YQGASNHEELH LMKATVMIRRLK DVLS+LP
Sbjct  390  QLEALYPGVYRNVHEYGNRYCRGGYFGLYQGASNHEELHCLMKATVMIRRLKNDVLSQLP  449

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK  I++  S E  ESLK    NLINKIY+ S
Sbjct  450  VKRRQQVFLDLNEKDMKQIRILFRELEVVKMNIQACDSPENMESLKFMQKNLINKIYIDS  509

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEADCKFLIFAHH  MIDAIHQ+LLKKKVGCIRIDGGTP++ RQA
Sbjct  510  AEAKIPAVLDYLSTVIEADCKFLIFAHHQPMIDAIHQFLLKKKVGCIRIDGGTPSSMRQA  569

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV +FQEK  IKAAVLSIKAGGVGL LTAAST+ FAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  570  LVNEFQEKIEIKAAVLSIKAGGVGLNLTAASTIFFAELTWTPGDIIQAEDRAHRIGQVSS  629

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLL+NDTVDDIIWDVV++KLE L QMLDG+E +LEV    ++KSP K
Sbjct  630  VNIYYLLSNDTVDDIIWDVVRSKLETLSQMLDGEENTLEVSSSQTSKSPQK  680



>ref|XP_009388148.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009388155.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=709

 Score =   418 bits (1075),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 214/291 (74%), Positives = 236/291 (81%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP VY+NVHEYGNRYC+GG FG+YQGASNHEELH LMKATVMIRRLK DVLS+LP
Sbjct  393  QLEALYPGVYRNVHEYGNRYCRGGYFGLYQGASNHEELHCLMKATVMIRRLKNDVLSQLP  452

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK  I++  S E  ESLK    NLINKIY+ S
Sbjct  453  VKRRQQVFLDLNEKDMKQIRILFRELEVVKMNIQACDSPENMESLKFMQKNLINKIYIDS  512

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEADCKFLIFAHH  MIDAIHQ+LLKKKVGCIRIDGGTP++ RQA
Sbjct  513  AEAKIPAVLDYLSTVIEADCKFLIFAHHQPMIDAIHQFLLKKKVGCIRIDGGTPSSMRQA  572

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV +FQEK  IKAAVLSIKAGGVGL LTAAST+ FAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  573  LVNEFQEKIEIKAAVLSIKAGGVGLNLTAASTIFFAELTWTPGDIIQAEDRAHRIGQVSS  632

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLL+NDTVDDIIWDVV++KLE L QMLDG+E +LEV    ++KSP K
Sbjct  633  VNIYYLLSNDTVDDIIWDVVRSKLETLSQMLDGEENTLEVSSSQTSKSPQK  683



>ref|XP_009145017.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X3 
[Brassica rapa]
Length=656

 Score =   415 bits (1067),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 212/291 (73%), Positives = 240/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYG+RYCKGG+FG+YQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  329  QLEALYPDVYRNVHEYGSRYCKGGVFGIYQGASNHEELHNLMKATVMIRRLKKDVLSELP  388

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   L+VVK+KIK   S+++ +SLK T   LINKIY  S
Sbjct  389  SKRRQQVFLDLAEKDMKQINALFRELKVVKAKIKDCMSEDDIKSLKFTEKQLINKIYTDS  448

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +V DYLGTV+EA CKFL+FAHH  M++A+HQ+L KKKVGCIRIDG TPA+SRQA
Sbjct  449  AEAKIPAVTDYLGTVLEAGCKFLVFAHHQSMLEALHQFLKKKKVGCIRIDGSTPASSRQA  508

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQ    IKAAVLSI+A GVG+TLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  509  LVSDFQGNDEIKAAVLSIRAAGVGITLTAASTVIFAELAWTPGDLIQAEDRAHRIGQVSS  568

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNI+YLLANDTVDDIIWDVV++KLENLGQMLDGQE +LEV   +   SP+K
Sbjct  569  VNIHYLLANDTVDDIIWDVVQSKLENLGQMLDGQENALEVSSSHVMNSPLK  619



>ref|XP_009145015.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X1 
[Brassica rapa]
 ref|XP_009145016.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X2 
[Brassica rapa]
Length=661

 Score =   415 bits (1067),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 212/291 (73%), Positives = 240/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYG+RYCKGG+FG+YQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  334  QLEALYPDVYRNVHEYGSRYCKGGVFGIYQGASNHEELHNLMKATVMIRRLKKDVLSELP  393

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   L+VVK+KIK   S+++ +SLK T   LINKIY  S
Sbjct  394  SKRRQQVFLDLAEKDMKQINALFRELKVVKAKIKDCMSEDDIKSLKFTEKQLINKIYTDS  453

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +V DYLGTV+EA CKFL+FAHH  M++A+HQ+L KKKVGCIRIDG TPA+SRQA
Sbjct  454  AEAKIPAVTDYLGTVLEAGCKFLVFAHHQSMLEALHQFLKKKKVGCIRIDGSTPASSRQA  513

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQ    IKAAVLSI+A GVG+TLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  514  LVSDFQGNDEIKAAVLSIRAAGVGITLTAASTVIFAELAWTPGDLIQAEDRAHRIGQVSS  573

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNI+YLLANDTVDDIIWDVV++KLENLGQMLDGQE +LEV   +   SP+K
Sbjct  574  VNIHYLLANDTVDDIIWDVVQSKLENLGQMLDGQENALEVSSSHVMNSPLK  624



>emb|CDY23679.1| BnaA05g17500D [Brassica napus]
Length=662

 Score =   414 bits (1065),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 212/291 (73%), Positives = 240/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYG+RYCKGG+FG+YQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  335  QLEALYPDVYRNVHEYGSRYCKGGVFGIYQGASNHEELHNLMKATVMIRRLKKDVLSELP  394

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   L+VVK+KIK   S+++ +SLK T   LINKIY  S
Sbjct  395  SKRRQQVFLDLAEKDMKQINALFRELKVVKAKIKDCMSEDDIKSLKFTEKQLINKIYTDS  454

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +V DYLGTV+EA CKFL+FAHH  M++A+HQ+L KKKVGCIRIDG TPA+SRQA
Sbjct  455  AEAKIPAVTDYLGTVLEAGCKFLVFAHHQSMLEALHQFLKKKKVGCIRIDGSTPASSRQA  514

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQ    IKAAVLSI+A GVG+TLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  515  LVSDFQGNDEIKAAVLSIRAAGVGITLTAASTVIFAELAWTPGDLIQAEDRAHRIGQVSS  574

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNI+YLLANDTVDDIIWDVV++KLENLGQMLDGQE +LEV   +   SP+K
Sbjct  575  VNIHYLLANDTVDDIIWDVVQSKLENLGQMLDGQENALEVSSSHVMNSPLK  625



>gb|KCW61402.1| hypothetical protein EUGRSUZ_H04132 [Eucalyptus grandis]
Length=651

 Score =   414 bits (1064),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 218/292 (75%), Positives = 241/292 (83%), Gaps = 20/292 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYG RYCKGG FGVYQGASNHEELHNLMKATVMIRRLK++VL++LP
Sbjct  305  QLEALYPDVYKNVHEYGQRYCKGGFFGVYQGASNHEELHNLMKATVMIRRLKREVLTQLP  364

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   L+ +K +IK+  SKEEAESLK +  NLINKIY  S
Sbjct  365  VKRRQQVFLDLADKDMKRINALFRELKGIKERIKACTSKEEAESLKFSEKNLINKIYTDS  424

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TV+EA CKFLIFAHH  M+DAIH++LLKKKVG IRIDG TPA +RQA
Sbjct  425  AEAKIPAVLDYLETVVEAGCKFLIFAHHQPMMDAIHEFLLKKKVGSIRIDGSTPAVARQA  484

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK +IKAAVLSI+AGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  485  LVTDFQEKDAIKAAVLSIRAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  544

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK-SPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQ+LDG E +LEV      + SP K
Sbjct  545  VNIYYLLANDTVDDIIWDVVQSKLENLGQVLDGHENTLEVSASQPTRNSPAK  596



>ref|XP_003609891.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like protein [Medicago truncatula]
Length=764

 Score =   416 bits (1069),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 223/302 (74%), Positives = 245/302 (81%), Gaps = 30/302 (10%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKG----------GIFGVYQGASNHEELHNLMKATVMIRR  151
            QLEALYPDVYKNVHEYGNRYCKG          G+FGVYQGASNHEELHNLMKAT MIRR
Sbjct  411  QLEALYPDVYKNVHEYGNRYCKGSSLSFAWILQGMFGVYQGASNHEELHNLMKATTMIRR  470

Query  152  LKKDVLSELPVKRRQQ-------------------LEVVkskikssqskeeaeslkLTMN  274
            LKKDVLSELPVKRRQQ                   LE VK+KIK+++S+EEAESLK +  
Sbjct  471  LKKDVLSELPVKRRQQVFLDLADKDMKQINALFRELERVKAKIKAAKSQEEAESLKFSKQ  530

Query  275  NLINKIYVASAKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRID  454
            N+INK+Y  SA+ KI +VLDYLGTVIEA CKFLIFAHH+ MIDAIH++LLKKKV CIRID
Sbjct  531  NMINKLYTDSAEAKIPAVLDYLGTVIEAGCKFLIFAHHLPMIDAIHEFLLKKKVACIRID  590

Query  455  GGTPAASRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAED  634
            GGTP+ SRQ LVT+FQEK +IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAED
Sbjct  591  GGTPSGSRQQLVTEFQEKDTIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAED  650

Query  635  RAHRIGQVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSN-KSP  811
            R HRIGQ SSVNIYYLLANDTVDDIIWD V++KLENLGQMLDG E +L+V +D     SP
Sbjct  651  RVHRIGQESSVNIYYLLANDTVDDIIWDTVQSKLENLGQMLDGHENTLKVSDDQPPLSSP  710

Query  812  MK  817
             K
Sbjct  711  AK  712



>ref|XP_010024879.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 [Eucalyptus 
grandis]
Length=703

 Score =   413 bits (1062),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 218/292 (75%), Positives = 241/292 (83%), Gaps = 20/292 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYG RYCKGG FGVYQGASNHEELHNLMKATVMIRRLK++VL++LP
Sbjct  357  QLEALYPDVYKNVHEYGQRYCKGGFFGVYQGASNHEELHNLMKATVMIRRLKREVLTQLP  416

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   L+ +K +IK+  SKEEAESLK +  NLINKIY  S
Sbjct  417  VKRRQQVFLDLADKDMKRINALFRELKGIKERIKACTSKEEAESLKFSEKNLINKIYTDS  476

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TV+EA CKFLIFAHH  M+DAIH++LLKKKVG IRIDG TPA +RQA
Sbjct  477  AEAKIPAVLDYLETVVEAGCKFLIFAHHQPMMDAIHEFLLKKKVGSIRIDGSTPAVARQA  536

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK +IKAAVLSI+AGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  537  LVTDFQEKDAIKAAVLSIRAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  596

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK-SPMK  817
            VNIYYLLANDTVDDIIWDVV++KLENLGQ+LDG E +LEV      + SP K
Sbjct  597  VNIYYLLANDTVDDIIWDVVQSKLENLGQVLDGHENTLEVSASQPTRNSPAK  648



>gb|KFK36104.1| hypothetical protein AALP_AA4G077700 [Arabis alpina]
Length=684

 Score =   411 bits (1056),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 213/291 (73%), Positives = 236/291 (81%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYG RYCKGG FG YQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  348  QLEALYPDVYRNVHEYGGRYCKGGYFGTYQGASNHEELHNLMKATVMIRRLKKDVLSELP  407

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   L+VVK KIK   S+++ +SLK T  +LIN+IY  S
Sbjct  408  SKRRQQVFLDLADKDMKQINALFHELKVVKGKIKDCTSEDDIKSLKFTEKHLINQIYTDS  467

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLDYLGTV+EA CKFL+FAHH  M++A+HQ+L KKKVGCIRIDG TPAASRQA
Sbjct  468  AIAKIPAVLDYLGTVLEAGCKFLVFAHHQSMLEALHQFLKKKKVGCIRIDGSTPAASRQA  527

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQ    IKAAVLSI+A GVG+TLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  528  LVSDFQGNDEIKAAVLSIRAAGVGITLTAASTVIFAELAWTPGDLIQAEDRAHRIGQVSS  587

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNI+YLLANDTVDDIIWDVV+ KLENLGQMLDGQE +LEV   +   SP+K
Sbjct  588  VNIHYLLANDTVDDIIWDVVQTKLENLGQMLDGQENALEVSSSHVLSSPIK  638



>gb|EPS71202.1| hypothetical protein M569_03554, partial [Genlisea aurea]
Length=643

 Score =   409 bits (1051),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 218/291 (75%), Positives = 240/291 (82%), Gaps = 20/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP+VYKNVHEYG+RYCKG IFG YQGASNHEELHNLMKAT+MIRRLKKDVLSELP
Sbjct  342  QLEALYPNVYKNVHEYGSRYCKGAIFGAYQGASNHEELHNLMKATLMIRRLKKDVLSELP  401

Query  182  VKRRQ-------------------QLEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQ                   +LEVVK K+KS QS EEA+SLKLT  NLINKIY  S
Sbjct  402  VKRRQKVFLELKEEEMRHINALFHELEVVKRKLKSCQSIEEADSLKLTEKNLINKIYTDS  461

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VL+Y+ T+IEA CKFLIFAHH  MI+AIH+ LLKKKVGCIRIDG TPAASRQA
Sbjct  462  AEAKIPAVLNYMETIIEAGCKFLIFAHHQPMIEAIHELLLKKKVGCIRIDGSTPAASRQA  521

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVT+FQEK S+KAAVLSI+AGGVGLTLTAASTVIFAEL WTPGD+IQAEDRAHRIGQ SS
Sbjct  522  LVTEFQEKDSVKAAVLSIRAGGVGLTLTAASTVIFAELSWTPGDMIQAEDRAHRIGQRSS  581

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLL N TVDDIIWDV++NKL+NLGQMLDG E  L   E+  + SP K
Sbjct  582  VNIYYLLGNATVDDIIWDVIQNKLDNLGQMLDGHENCLLQAEEEKS-SPSK  631



>ref|XP_006393444.1| hypothetical protein EUTSA_v10011287mg [Eutrema salsugineum]
 gb|ESQ30730.1| hypothetical protein EUTSA_v10011287mg [Eutrema salsugineum]
Length=673

 Score =   408 bits (1049),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 210/291 (72%), Positives = 240/291 (82%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NV EYGNRYCKGG+FG++QGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  346  QLEALYPDVYRNVKEYGNRYCKGGVFGMFQGASNHEELHNLMKATVMIRRLKKDVLSELP  405

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   L+VVK+KIK  +S++E +SLK T  +LINKIY  S
Sbjct  406  SKRRQQVFLDLAEKDMKQINALFHELKVVKAKIKDCRSEDEIKSLKFTEKHLINKIYTYS  465

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGTV+EA CKFL+FAHH  M++A+HQ+  KKKVGCIRIDG TPA+SRQA
Sbjct  466  AEAKIPAVLDYLGTVLEAGCKFLVFAHHQSMLEALHQFFKKKKVGCIRIDGSTPASSRQA  525

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQ    IKAAVLSI+A GVG+TLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  526  LVSDFQGNDEIKAAVLSIRAAGVGITLTAASTVIFAELAWTPGDLIQAEDRAHRIGQVSS  585

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNI+YLLANDTVDDIIW+VV++KL+NLGQMLDGQE +LEV   +   SP K
Sbjct  586  VNIHYLLANDTVDDIIWEVVQSKLDNLGQMLDGQENALEVSSSHLISSPTK  636



>ref|XP_004252958.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 [Solanum lycopersicum]
Length=691

 Score =   408 bits (1049),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 213/280 (76%), Positives = 239/280 (85%), Gaps = 19/280 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEAL+P VYKNVHEYGNRYCKGGIFGVYQGASNHEELH+L+KAT+MIRRLKKDVLSELP
Sbjct  375  QLEALHPTVYKNVHEYGNRYCKGGIFGVYQGASNHEELHSLIKATLMIRRLKKDVLSELP  434

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   LEV+K+K KS+QS+EEA SLK    +LI+KIY AS
Sbjct  435  QKRRQQVFLNLGEKEMRQVNALFRELEVIKAKGKSAQSEEEANSLKFAEKSLISKIYTAS  494

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGT++EA+CKFLIFAHH  MID+IH+YLLK KVGCIRIDG TP+A RQ 
Sbjct  495  AEAKIPAVLDYLGTMVEANCKFLIFAHHQSMIDSIHEYLLKNKVGCIRIDGSTPSALRQD  554

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQ+K +IKAAVLSI+A GVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  555  LVTDFQKKETIKAAVLSIRAAGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  614

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEV  784
            VN+ YLLANDTVDDIIW VV++KL+NLGQMLDGQEKSL+V
Sbjct  615  VNVCYLLANDTVDDIIWGVVQSKLDNLGQMLDGQEKSLDV  654



>ref|XP_004958450.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3-like 
isoform X2 [Setaria italica]
Length=674

 Score =   407 bits (1046),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 209/291 (72%), Positives = 234/291 (80%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QL+ALYP VYKNV EYGNRYCKGG FGVYQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  357  QLQALYPTVYKNVSEYGNRYCKGGFFGVYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  416

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE +K KI+S+ SKE  +SLK T  NLI K+Y  S
Sbjct  417  VKRRQQIFLDLSEKDVKYVRALFHELETLKIKIESADSKEMIDSLKFTQKNLITKLYTDS  476

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLD+LGTVIEADCKFLIFAHH  M++AI QYLLKKKV CI+IDG TP  +RQ 
Sbjct  477  ATAKIPAVLDFLGTVIEADCKFLIFAHHQNMVEAIEQYLLKKKVKCIKIDGQTPVTTRQT  536

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQ K  I+AAVLSI+AGG GLTLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  537  LVTDFQNKDDIRAAVLSIRAGGYGLTLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSS  596

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLL+NDT+DD++WD V+ KLENLGQMLDGQE +L+V + +S  SP K
Sbjct  597  VNIYYLLSNDTIDDLMWDAVQGKLENLGQMLDGQENTLDVSQIDSRPSPSK  647



>ref|XP_004958449.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3-like 
isoform X1 [Setaria italica]
Length=706

 Score =   407 bits (1046),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 209/291 (72%), Positives = 234/291 (80%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QL+ALYP VYKNV EYGNRYCKGG FGVYQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  389  QLQALYPTVYKNVSEYGNRYCKGGFFGVYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  448

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE +K KI+S+ SKE  +SLK T  NLI K+Y  S
Sbjct  449  VKRRQQIFLDLSEKDVKYVRALFHELETLKIKIESADSKEMIDSLKFTQKNLITKLYTDS  508

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLD+LGTVIEADCKFLIFAHH  M++AI QYLLKKKV CI+IDG TP  +RQ 
Sbjct  509  ATAKIPAVLDFLGTVIEADCKFLIFAHHQNMVEAIEQYLLKKKVKCIKIDGQTPVTTRQT  568

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQ K  I+AAVLSI+AGG GLTLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  569  LVTDFQNKDDIRAAVLSIRAGGYGLTLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSS  628

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLL+NDT+DD++WD V+ KLENLGQMLDGQE +L+V + +S  SP K
Sbjct  629  VNIYYLLSNDTIDDLMWDAVQGKLENLGQMLDGQENTLDVSQIDSRPSPSK  679



>ref|XP_008439000.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 [Cucumis melo]
Length=728

 Score =   406 bits (1044),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 210/280 (75%), Positives = 229/280 (82%), Gaps = 20/280 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP+VYKNVHEYGNRYCKGG FG+YQGASNH ELHNLMKAT+MIRRLKKDVLSELP
Sbjct  408  QLEALYPNVYKNVHEYGNRYCKGGTFGLYQGASNHVELHNLMKATLMIRRLKKDVLSELP  467

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            +KRRQQ                   LEVVK KIK+ +S+E          NLINKIY  S
Sbjct  468  LKRRQQVFLDLAEKDIREIRALFCELEVVKGKIKACRSEEVESLK-FQQKNLINKIYTDS  526

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VL+YL TVIEA CKFL+FAHH  MIDAIHQ+  KKKV CIRIDGGTP A RQA
Sbjct  527  AEAKIPAVLNYLETVIEAGCKFLVFAHHQPMIDAIHQFFQKKKVNCIRIDGGTPPAMRQA  586

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQ+K SI AAVLSIKAGGVGLTLTAASTVIF EL WTPGDLIQAEDRAHRIGQVSS
Sbjct  587  LVSDFQQKDSIMAAVLSIKAGGVGLTLTAASTVIFTELSWTPGDLIQAEDRAHRIGQVSS  646

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEV  784
            VNI+YLLANDTVDDIIWDVV++KLENLGQMLDG+E +LEV
Sbjct  647  VNIHYLLANDTVDDIIWDVVQSKLENLGQMLDGEENTLEV  686



>ref|XP_010500354.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 [Camelina 
sativa]
Length=680

 Score =   405 bits (1040),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/291 (71%), Positives = 234/291 (80%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY++VHEYG+RYCKGG FG YQGASNH+ELHNLMKATVMIRRLKKDVL+ELP
Sbjct  351  QLEALYPDVYRSVHEYGSRYCKGGFFGTYQGASNHDELHNLMKATVMIRRLKKDVLTELP  410

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   L+VVKSKIK   S+++ +SLK T  NLINKIY  S
Sbjct  411  PKRRQQVFLELAEKNMRPVNALFHELQVVKSKIKDCISEDDIKSLKFTEKNLINKIYTES  470

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VL+YL  VIEA CKFL+FAHH+ M++A+HQ+  KKKVGCIRIDG TPA+SRQA
Sbjct  471  ALAKIPAVLEYLENVIEAGCKFLVFAHHLSMLEALHQFFKKKKVGCIRIDGSTPASSRQA  530

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQ K  IKAAVLSI+A GVG+TLTAASTVIF EL WTPGDL QAEDR HRIGQVSS
Sbjct  531  LVSDFQNKDEIKAAVLSIRAAGVGITLTAASTVIFTELSWTPGDLTQAEDRVHRIGQVSS  590

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWD V+NKL+NLGQMLDG+E +LEV   ++  SP K
Sbjct  591  VNIYYLLANDTVDDIIWDTVQNKLDNLGQMLDGEENALEVSSSHTMNSPTK  641



>gb|EMT13497.1| Zinc finger Ran-binding domain-containing protein 3 [Aegilops 
tauschii]
Length=987

 Score =   413 bits (1062),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 217/291 (75%), Positives = 233/291 (80%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QL+ALYP VY NV+EYGNRYCKGG FG+YQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  427  QLQALYPTVYNNVNEYGNRYCKGGYFGLYQGASNHEELHNLMKATVMIRRLKKDVLSELP  486

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE VK K++S  S+E  +SLK    N+INKIY  S
Sbjct  487  VKRRQQVFLDLSEKEMKHIRALFRELETVKIKMQSCDSQEMIDSLKFNQKNIINKIYNDS  546

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEADCKFLIFAHH  MIDAIHQ+LLKKKV CIRIDG TP   RQ 
Sbjct  547  AEAKIPAVLDYLATVIEADCKFLIFAHHQPMIDAIHQHLLKKKVKCIRIDGQTPVVVRQN  606

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV DFQ K  IKAAVLSIKAGGVGLTLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  607  LVMDFQNKDDIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSS  666

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWDVV+ KLENLGQMLDGQEK+L V +  +  SP K
Sbjct  667  VNIYYLLANDTVDDIIWDVVQGKLENLGQMLDGQEKTLNVSQSETRPSPSK  717



>ref|NP_175265.3| chromatin remodeling factor18 [Arabidopsis thaliana]
 gb|AEE32273.1| chromatin remodeling factor18 [Arabidopsis thaliana]
Length=673

 Score =   404 bits (1038),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 208/291 (71%), Positives = 235/291 (81%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+N+HEYG RYCKGG FG YQGASNH+ELHNLMKATVMIRRLKKDVL+ELP
Sbjct  346  QLEALYPDVYRNIHEYGGRYCKGGFFGTYQGASNHDELHNLMKATVMIRRLKKDVLTELP  405

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   L+VVKSKIK   S+++ +SLK    NLINKIY  S
Sbjct  406  SKRRQQVFLDLAAKDMKQINALFHELKVVKSKIKDCISEDDIKSLKFIEKNLINKIYTDS  465

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLDYL  VIEA CKFL+FAHH  M++ +HQ+L KKKVGCIRIDG TPA+SRQA
Sbjct  466  AVAKIPAVLDYLENVIEAGCKFLVFAHHQSMLEELHQFLKKKKVGCIRIDGSTPASSRQA  525

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQ+K  IKAAVLSI+A GVG+TLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  526  LVSDFQDKDEIKAAVLSIRAAGVGITLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  585

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNI+YLLANDTVDDIIWDVV++KL+NLGQMLDGQE +L+V   +   SP K
Sbjct  586  VNIHYLLANDTVDDIIWDVVQSKLDNLGQMLDGQENALDVASSHMMSSPTK  636



>ref|XP_010479250.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 [Camelina 
sativa]
Length=677

 Score =   404 bits (1037),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 206/291 (71%), Positives = 234/291 (80%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY++VHEYG+RYCKGG FG YQGASNH+ELHNLMKATVMIRRLKKDVL+ELP
Sbjct  350  QLEALYPDVYRSVHEYGSRYCKGGFFGTYQGASNHDELHNLMKATVMIRRLKKDVLTELP  409

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   L+VVKSKIK   S+E+ +SLK T  NLINKIY  S
Sbjct  410  SKRRQQVFLELAEKNMRPVNALFHELKVVKSKIKDCISEEDIKSLKFTEKNLINKIYTES  469

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +V++YL  V+EA CKFL+FAHH+ M++A+HQ+  KKKVGCIRIDG TPA+SRQA
Sbjct  470  ALAKIPAVIEYLENVLEAGCKFLVFAHHLSMLEALHQFFKKKKVGCIRIDGSTPASSRQA  529

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQ K  IKAAVLSI+A GVG+TLTAASTVIFAEL WTPGDL QAEDR HRIGQVSS
Sbjct  530  LVSDFQNKDEIKAAVLSIRAAGVGITLTAASTVIFAELSWTPGDLTQAEDRVHRIGQVSS  589

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWD V+NKL+NLGQMLDG+E +LEV   +   SP K
Sbjct  590  VNIYYLLANDTVDDIIWDTVQNKLDNLGQMLDGEENALEVSSSHPMNSPTK  640



>ref|XP_004147667.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1-like [Cucumis 
sativus]
Length=725

 Score =   405 bits (1040),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 210/280 (75%), Positives = 229/280 (82%), Gaps = 20/280 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP+VYKNVHEYGNRYCKGG FG+YQGASNH ELHNLMKAT+MIRRLKKDVLSELP
Sbjct  405  QLEALYPNVYKNVHEYGNRYCKGGTFGLYQGASNHVELHNLMKATLMIRRLKKDVLSELP  464

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   LEVVK KIK+ +S+E          NLINKIY  S
Sbjct  465  QKRRQQVFLDLAEKDIREIRALFCELEVVKGKIKACRSEEVESLK-FQQKNLINKIYTDS  523

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VL+YL TVIEA CKFL+FAHH  MIDAIHQ+  KKKV CIRIDGGTP A RQA
Sbjct  524  AEAKIPAVLNYLETVIEAGCKFLVFAHHQPMIDAIHQFFQKKKVNCIRIDGGTPPAMRQA  583

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV++FQ+K SI AAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  584  LVSEFQQKDSIMAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  643

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEV  784
            VNI+YLLANDTVDDIIWDVV++KLENLGQMLDG+E +LEV
Sbjct  644  VNIHYLLANDTVDDIIWDVVQSKLENLGQMLDGEENTLEV  683



>ref|XP_010461644.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 [Camelina 
sativa]
Length=681

 Score =   404 bits (1037),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 206/291 (71%), Positives = 235/291 (81%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY++VHEYG+RYCKGG FG YQGASNH+ELHNLMKATVMIRRLKKDVL+ELP
Sbjct  352  QLEALYPDVYRSVHEYGSRYCKGGFFGTYQGASNHDELHNLMKATVMIRRLKKDVLTELP  411

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   L+VVKSKIK   S+E+ +SLK T  NLINKIY  S
Sbjct  412  SKRRQQVFLELAEKNMRPVNALFHELKVVKSKIKDCISEEDIKSLKFTEKNLINKIYTES  471

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +V++YL  V+EA CKFL+FAHH+ M++A+HQ+  KKKVGCIRIDG TPA+SRQA
Sbjct  472  ALAKIPAVIEYLENVLEAGCKFLVFAHHLSMLEALHQFFKKKKVGCIRIDGSTPASSRQA  531

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQ K  IKAAVLSI+A GVG+TLTAASTVIFAEL WTPGDL QAEDR HRIGQVSS
Sbjct  532  LVSDFQNKDEIKAAVLSIRAAGVGITLTAASTVIFAELSWTPGDLTQAEDRVHRIGQVSS  591

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNIYYLLANDTVDDIIWD V+NKL+NLGQMLDG+E +LEV   ++  SP K
Sbjct  592  VNIYYLLANDTVDDIIWDTVQNKLDNLGQMLDGEENALEVSSSHTMNSPTK  642



>ref|XP_004160655.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1-like [Cucumis 
sativus]
Length=725

 Score =   402 bits (1034),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 209/280 (75%), Positives = 228/280 (81%), Gaps = 20/280 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP+VYK VHEYGNRYCKGG FG+YQGASNH ELHNLMKAT+MIRRLKKDVLSELP
Sbjct  405  QLEALYPNVYKKVHEYGNRYCKGGTFGLYQGASNHVELHNLMKATLMIRRLKKDVLSELP  464

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   LEVVK KIK+ +S+E          NLINKIY  S
Sbjct  465  QKRRQQVFLDLAEKDIREIRALFCELEVVKGKIKACRSEEVESLK-FQQKNLINKIYTDS  523

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VL+YL TVIEA CKFL+FAHH  MIDAIHQ+  KKKV CIRIDGGTP A RQA
Sbjct  524  AEAKIPAVLNYLETVIEAGCKFLVFAHHQPMIDAIHQFFQKKKVNCIRIDGGTPPAMRQA  583

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV++FQ+K SI AAVLSIKAGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  584  LVSEFQQKDSIMAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  643

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEV  784
            VNI+YLLANDTVDDIIWDVV++KLENLGQMLDG+E +LEV
Sbjct  644  VNIHYLLANDTVDDIIWDVVQSKLENLGQMLDGEENTLEV  683



>ref|XP_006304942.1| hypothetical protein CARUB_v10011429mg [Capsella rubella]
 gb|EOA37840.1| hypothetical protein CARUB_v10011429mg [Capsella rubella]
Length=671

 Score =   400 bits (1028),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 204/291 (70%), Positives = 236/291 (81%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NV EYG+RYCKGG+FG+YQGASNH+ELHNLMKATVMIRRLKKDVL+ELP
Sbjct  344  QLEALYPDVYRNVSEYGSRYCKGGVFGIYQGASNHDELHNLMKATVMIRRLKKDVLTELP  403

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   L+V+KSKIK   S+E+ +SLK T  NLINKIY  S
Sbjct  404  SKRRQQVFLELAEKNMRPVNALFQELKVIKSKIKDCISEEDVKSLKFTEKNLINKIYTDS  463

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VL+YL  V+EA CKFL+FAHH+ M++A+HQ+L KKKVGCIRIDG TPA+SRQA
Sbjct  464  AIAKIPAVLEYLENVLEAGCKFLVFAHHLSMLEALHQFLKKKKVGCIRIDGSTPASSRQA  523

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQ K  IKAAVLSI+A GVG+TLTAASTVIF EL WTPGDL QAEDR HRIGQV+S
Sbjct  524  LVSDFQNKDEIKAAVLSIRAAGVGITLTAASTVIFTELSWTPGDLTQAEDRVHRIGQVNS  583

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNI+YLLANDTVDDIIWD V+NKL+NLGQMLDG+E +LEV   ++  SP K
Sbjct  584  VNIHYLLANDTVDDIIWDTVQNKLDNLGQMLDGEENALEVSSSHTMNSPTK  634



>ref|XP_011000980.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X2 
[Populus euphratica]
Length=660

 Score =   393 bits (1010),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 217/291 (75%), Positives = 225/291 (77%), Gaps = 42/291 (14%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  365  QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  424

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIK+  S EE ESLK T  NLINKIY  S
Sbjct  425  VKRRQQVFLDLPEKDMKQINALFRELEVVKRKIKACASDEEVESLKFTEKNLINKIYTDS  484

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KIS VLDYLGTVIE                       KKKVGCIRIDG T AASRQA
Sbjct  485  AEAKISGVLDYLGTVIE-----------------------KKKVGCIRIDGKTAAASRQA  521

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQEK +IKAAVLSI+AGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  522  LVTDFQEKDAIKAAVLSIRAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSS  581

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLLANDTVDDIIWDVV++KLENLGQMLDGQEK+LEV       SP K
Sbjct  582  VNVYYLLANDTVDDIIWDVVQSKLENLGQMLDGQEKTLEVSASQQRSSPAK  632



>ref|XP_002461093.1| hypothetical protein SORBIDRAFT_02g040560 [Sorghum bicolor]
 gb|EER97614.1| hypothetical protein SORBIDRAFT_02g040560 [Sorghum bicolor]
Length=756

 Score =   396 bits (1017),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 204/291 (70%), Positives = 231/291 (79%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            Q++ALYP VYKNV+EYGNRYCKGG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  390  QMQALYPTVYKNVNEYGNRYCKGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  449

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE +K KI+SS SKE  +SL+    N++NKIY  S
Sbjct  450  VKRRQQVFLDLSEKDVKNVRALFIELETLKIKIESSDSKETIDSLRFAYQNIVNKIYTDS  509

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLD+LGT+IEA CKFLIFAHH  MIDAI Q+L KKKV CI+IDG TP  +RQ 
Sbjct  510  AVAKIPAVLDFLGTMIEAGCKFLIFAHHQPMIDAIEQHLSKKKVKCIKIDGKTPLTTRQT  569

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVT FQE   IKAAVLSIKAGG G+TLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  570  LVTSFQENDDIKAAVLSIKAGGYGITLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSS  629

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLLAN T DD++WD V+ KLENLGQMLDGQEK+L+V + +S  SP K
Sbjct  630  VNVYYLLANGTADDLMWDSVQGKLENLGQMLDGQEKTLDVSQIDSRPSPSK  680



>ref|XP_006840364.1| hypothetical protein AMTR_s00045p00120010 [Amborella trichopoda]
 gb|ERN02039.1| hypothetical protein AMTR_s00045p00120010 [Amborella trichopoda]
Length=908

 Score =   397 bits (1019),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 204/280 (73%), Positives = 233/280 (83%), Gaps = 19/280 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY NVHEYG RYCKGGIFG+YQGASNH+ELHNL+KATVM RRLKKDVLS+LP
Sbjct  559  QLEALYPDVYNNVHEYGQRYCKGGIFGLYQGASNHDELHNLIKATVMFRRLKKDVLSQLP  618

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE+VK+KIK+  S+EE ++LK +   LINKI+  S
Sbjct  619  VKRRQQVFLDLDEKEMKQIRALFRELEMVKNKIKACTSQEEVDTLKFSEKQLINKIFNDS  678

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL T++EA CKFLIFA+H  M+DAIHQ+LLKK VG IRIDG TP ++RQ 
Sbjct  679  AEAKIPAVLDYLETIVEAGCKFLIFAYHQPMMDAIHQFLLKKNVGLIRIDGSTPTSTRQD  738

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVT FQEK ++KAAVLSIKAGGVGLTLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  739  LVTQFQEKDNVKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSS  798

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEV  784
            VNIYYLLANDTVDDIIWDV+++KLENLGQ+ DG+E SLEV
Sbjct  799  VNIYYLLANDTVDDIIWDVIQSKLENLGQVFDGRENSLEV  838



>emb|CDY04297.1| BnaC05g25590D [Brassica napus]
Length=662

 Score =   389 bits (998),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 204/291 (70%), Positives = 232/291 (80%), Gaps = 20/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYG+RYCKGG+FG+YQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  336  QLEALYPDVYRNVHEYGSRYCKGGVFGIYQGASNHEELHNLMKATVMIRRLKKDVLSELP  395

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   L+VVK+KIK   S+++ +SLK T   LINKIY  S
Sbjct  396  SKRRQQVFLDLAEKDMKQINALFRELKVVKAKIKDCMSEDDIKSLKFTEKQLINKIYTDS  455

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +V DYLGTV+EA CKFL+FAHH  M++A+HQ+L KKKVGCIRIDG TPA+SRQ 
Sbjct  456  AEAKIPAVTDYLGTVLEAGCKFLVFAHHQSMLEALHQFLKKKKVGCIRIDGSTPASSRQV  515

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQ    IKAAVLSI+A GVG+TLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSS
Sbjct  516  LVSDFQGNDEIKAAVLSIRAAGVGITLTAASTVIFAELAWTPGDLIQAEDRAHRIGQVSS  575

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VNI+YLLANDTVDDIIW  + N  +NL  MLDGQE +LEV   +   SP+K
Sbjct  576  VNIHYLLANDTVDDIIWFFLINIYKNL-LMLDGQENALEVSSSHVMNSPLK  625



>ref|XP_008651808.1| PREDICTED: uncharacterized protein LOC100501760 isoform X3 [Zea 
mays]
 tpg|DAA63808.1| TPA: hypothetical protein ZEAMMB73_058078 [Zea mays]
Length=692

 Score =   389 bits (999),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/291 (69%), Positives = 230/291 (79%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            Q++ALYP VYK+V EYGN YCKGG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  377  QIQALYPTVYKSVSEYGNIYCKGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  436

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE +K KI+SS SKE  +SL+    N++NKIY  S
Sbjct  437  VKRRQQVFLDLSEKDVKNVRALFIELETLKVKIESSDSKEMIDSLRFAYQNIVNKIYTDS  496

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLD+LGT+IE  CKFLIFAHH  MIDAI ++LLKKKV CI+IDG TP  +RQ 
Sbjct  497  AVAKIPAVLDFLGTMIEEGCKFLIFAHHQPMIDAIEKHLLKKKVKCIKIDGKTPLTTRQT  556

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQ    +KAAVLSIKAGG G+TLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  557  LVTDFQNNDDVKAAVLSIKAGGYGITLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSS  616

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLL+N T+DD++WDVV+ KLENLGQMLDGQEK+LEV + +   SP K
Sbjct  617  VNVYYLLSNGTIDDLMWDVVQGKLENLGQMLDGQEKTLEVSQRDCRPSPSK  667



>ref|XP_008651806.1| PREDICTED: uncharacterized protein LOC100501760 isoform X1 [Zea 
mays]
 tpg|DAA63811.1| TPA: hypothetical protein ZEAMMB73_058078 [Zea mays]
Length=705

 Score =   389 bits (999),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 200/291 (69%), Positives = 230/291 (79%), Gaps = 19/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            Q++ALYP VYK+V EYGN YCKGG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  390  QIQALYPTVYKSVSEYGNIYCKGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  449

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE +K KI+SS SKE  +SL+    N++NKIY  S
Sbjct  450  VKRRQQVFLDLSEKDVKNVRALFIELETLKVKIESSDSKEMIDSLRFAYQNIVNKIYTDS  509

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLD+LGT+IE  CKFLIFAHH  MIDAI ++LLKKKV CI+IDG TP  +RQ 
Sbjct  510  AVAKIPAVLDFLGTMIEEGCKFLIFAHHQPMIDAIEKHLLKKKVKCIKIDGKTPLTTRQT  569

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQ    +KAAVLSIKAGG G+TLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  570  LVTDFQNNDDVKAAVLSIKAGGYGITLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSS  629

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLL+N T+DD++WDVV+ KLENLGQMLDGQEK+LEV + +   SP K
Sbjct  630  VNVYYLLSNGTIDDLMWDVVQGKLENLGQMLDGQEKTLEVSQRDCRPSPSK  680



>ref|XP_008651807.1| PREDICTED: uncharacterized protein LOC100501760 isoform X2 [Zea 
mays]
Length=704

 Score =   382 bits (982),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 199/291 (68%), Positives = 229/291 (79%), Gaps = 20/291 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            Q++ALYP VYK+V EYGN YCKGG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  390  QIQALYPTVYKSVSEYGNIYCKGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  449

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE +K KI+SS SKE  +SL+    N++NKIY  S
Sbjct  450  VKRRQQVFLDLSEKDVKNVRALFIELETLKVKIESSDSKEMIDSLRFAYQNIVNKIYTDS  509

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLD+LGT+IE  CKFLIFAHH  MIDAI ++LLKK V CI+IDG TP  +RQ 
Sbjct  510  AVAKIPAVLDFLGTMIEEGCKFLIFAHHQPMIDAIEKHLLKK-VKCIKIDGKTPLTTRQT  568

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVTDFQ    +KAAVLSIKAGG G+TLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  569  LVTDFQNNDDVKAAVLSIKAGGYGITLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSS  628

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLL+N T+DD++WDVV+ KLENLGQMLDGQEK+LEV + +   SP K
Sbjct  629  VNVYYLLSNGTIDDLMWDVVQGKLENLGQMLDGQEKTLEVSQRDCRPSPSK  679



>gb|ADN34041.1| chromatin remodelling complex ATPase chain isw-1 [Cucumis melo 
subsp. melo]
Length=385

 Score =   355 bits (911),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 194/280 (69%), Positives = 211/280 (75%), Gaps = 43/280 (15%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP+VYKNVHEYGNRYCKGG FG+YQGASNH ELHNLMKAT+MIRRLKKDVLSELP
Sbjct  88   QLEALYPNVYKNVHEYGNRYCKGGTFGLYQGASNHVELHNLMKATLMIRRLKKDVLSELP  147

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            +KRRQQ                   LEVVK KIK+ +S+E          NLINKIY  S
Sbjct  148  LKRRQQVFLDLAEKDIREIRALFCELEVVKGKIKACRSEEVESLK-FQQKNLINKIYTDS  206

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VL+YL TVIE                       KKKV CIRIDGGTP A RQA
Sbjct  207  AEAKIPAVLNYLETVIE-----------------------KKKVNCIRIDGGTPPAMRQA  243

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQ+K SI AAVLSIKAGGVGLTLTAASTVIF EL WTPGDLIQAEDRAHRIGQVSS
Sbjct  244  LVSDFQQKDSIMAAVLSIKAGGVGLTLTAASTVIFTELSWTPGDLIQAEDRAHRIGQVSS  303

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEV  784
            VNI+YLLANDTVDDIIWDVV++KLENLGQMLDG+E +LEV
Sbjct  304  VNIHYLLANDTVDDIIWDVVQSKLENLGQMLDGEENTLEV  343



>ref|XP_008800330.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X2 
[Phoenix dactylifera]
Length=633

 Score =   354 bits (908),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 201/242 (83%), Gaps = 19/242 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYGNRYC+GG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  383  QLEALYPDVYKNVHEYGNRYCRGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  442

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE+VK+ I++  S E+ ESLK+T  NLINKIY  S
Sbjct  443  VKRRQQIFLDLNEKDMKQIRVLFRELELVKANIQACDSNEKIESLKVTQKNLINKIYNDS  502

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYL TVIEADCKFLIFAHH  MIDAIHQ+LLKKKVGCIRIDGGTP++SRQA
Sbjct  503  AEAKIPAVLDYLNTVIEADCKFLIFAHHQPMIDAIHQFLLKKKVGCIRIDGGTPSSSRQA  562

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV+DFQEK + KAAVLSIKAGGVGLTLTAASTVIFAEL WTPGD+IQAEDR HRIGQ  S
Sbjct  563  LVSDFQEKDNFKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDIIQAEDRTHRIGQFCS  622

Query  665  VN  670
            + 
Sbjct  623  LQ  624



>ref|XP_010524600.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X2 
[Tarenaya hassleriana]
Length=603

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 177/237 (75%), Positives = 193/237 (81%), Gaps = 19/237 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVY+NVHEYGNRYCKGG FGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP
Sbjct  350  QLEALYPDVYRNVHEYGNRYCKGGFFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  409

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   LEV+K+KIK   S++E +SLK +  NLINKIY  S
Sbjct  410  TKRRQQVFLDLAEKEMKQINALFRELEVIKAKIKDCTSEDEVQSLKFSQKNLINKIYTDS  469

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLDYLGTV+EA CKFL+FAHH  M+DA+HQ+L KKKV CIRIDG TPA+SRQ 
Sbjct  470  ADAKIPAVLDYLGTVLEAGCKFLVFAHHRSMLDALHQFLNKKKVCCIRIDGNTPASSRQT  529

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQ  655
            LV+DFQEK  IKAAVLSI+A GVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQ
Sbjct  530  LVSDFQEKDEIKAAVLSIRAAGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQ  586



>ref|XP_006349876.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1-like isoform 
X2 [Solanum tuberosum]
Length=628

 Score =   343 bits (880),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 181/237 (76%), Positives = 199/237 (84%), Gaps = 19/237 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEAL+P VYKNVHEYGNRYCKGGIFGVYQGASNHEELH+L+KATVMIRRLKKDVLSELP
Sbjct  378  QLEALHPTVYKNVHEYGNRYCKGGIFGVYQGASNHEELHSLIKATVMIRRLKKDVLSELP  437

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   LEV+K K KS+QS+EEA SLK    +LI+KIY AS
Sbjct  438  QKRRQQVFLNLGEKEMRQVNALFRELEVIKGKRKSAQSEEEANSLKFAEKSLISKIYTAS  497

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGT++EA+CKFLIFAHH  MID+IH+YLLKKKVGCIRIDG TP+A RQ 
Sbjct  498  AEAKIPAVLDYLGTMVEANCKFLIFAHHQSMIDSIHEYLLKKKVGCIRIDGSTPSALRQD  557

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQ  655
            LVTDFQEK +IKAAVLSI+AGGVGLTLTAASTVIFAEL WTPGDLIQAEDRAHRIGQ
Sbjct  558  LVTDFQEKETIKAAVLSIRAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRAHRIGQ  614



>ref|XP_001775787.1| SNF2 family DNA-dependent ATPase [Physcomitrella patens]
 gb|EDQ59326.1| SNF2 family DNA-dependent ATPase [Physcomitrella patens]
Length=657

 Score =   341 bits (874),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 176/280 (63%), Positives = 210/280 (75%), Gaps = 19/280 (7%)
 Frame = +2

Query  2    QLEALYPDVYKN-VHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSEL  178
            QLEAL P VYKN V EYGNRYC GG FG+YQG+SN +ELH L+K+TVMIRRLKKDVLSEL
Sbjct  375  QLEALQPTVYKNGVSEYGNRYCLGGHFGMYQGSSNLQELHALVKSTVMIRRLKKDVLSEL  434

Query  179  PVKRRQQLEVVk------------------skikssqskeeaeslkLTMNNLINKIYVAS  304
            P KRRQQ+ V                            ++E E +K +   L+NKIY  S
Sbjct  435  PQKRRQQVFVSLEDKGIRHMKALFHELNEIKDAMKLCKEDEKERMKYSEKQLLNKIYTES  494

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  K+ +V +YL T+I+A+CKFL+FAHH  M+D I Q L+KKKVG IRIDGGTP ++RQA
Sbjct  495  AVVKLPAVQEYLTTMIDAECKFLVFAHHQSMLDGIEQLLMKKKVGLIRIDGGTPQSARQA  554

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LVT FQE  +I AAVL I+A GVGLTLTAASTVIFAE+ WTPGDL+QAEDRAHRIGQ SS
Sbjct  555  LVTRFQENDNIIAAVLGIRAAGVGLTLTAASTVIFAEMSWTPGDLVQAEDRAHRIGQASS  614

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEV  784
            VN+YYL A+DT+DDIIWD V+NKLENL Q+LDGQE +L++
Sbjct  615  VNVYYLHAHDTIDDIIWDTVQNKLENLSQVLDGQENTLQL  654



>ref|XP_011069340.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1, partial [Sesamum 
indicum]
Length=252

 Score =   315 bits (807),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = +2

Query  197  QLEVVkskikssqskeeaeslkLTMNNLINKIYVASAKGKISSVLDYLGTVIEADCKFLI  376
            +LEVVK KIKS QS+EEAESLK T  NLINKIY  SA+ KI +VLDYLGT+IEA CKFLI
Sbjct  19   ELEVVKLKIKSCQSREEAESLKFTEKNLINKIYTDSAEAKIPAVLDYLGTIIEAGCKFLI  78

Query  377  FAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQEKASIKAAVLSIKAGGVG  556
            FAHH  MID+IH++LLKKKVGCIRIDG TPAASRQALVT+FQEK S+KAAVLSIKAGGVG
Sbjct  79   FAHHQPMIDSIHKFLLKKKVGCIRIDGSTPAASRQALVTEFQEKDSVKAAVLSIKAGGVG  138

Query  557  LTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLLANDTVDDIIWDVVKNKL  736
            LTLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSSVNIYYLLANDTVDDIIWDV+++KL
Sbjct  139  LTLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSSVNIYYLLANDTVDDIIWDVIQSKL  198

Query  737  ENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            ENLGQMLDG E SLEV  D S  SP+K
Sbjct  199  ENLGQMLDGHENSLEVSVDQSGCSPLK  225



>tpg|DAA63810.1| TPA: hypothetical protein ZEAMMB73_058078 [Zea mays]
Length=657

 Score =   326 bits (835),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 177/291 (61%), Positives = 204/291 (70%), Gaps = 54/291 (19%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            Q++ALYP VYK+V EYGN YCKGG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  377  QIQALYPTVYKSVSEYGNIYCKGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  436

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE +K KI+SS SKE  +SL+    N++NKIY  S
Sbjct  437  VKRRQQVFLDLSEKDVKNVRALFIELETLKVKIESSDSKEMIDSLRFAYQNIVNKIYTDS  496

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLD+LGT+IE  CKFLIFAHH  MIDAI ++LL                    
Sbjct  497  AVAKIPAVLDFLGTMIEEGCKFLIFAHHQPMIDAIEKHLL--------------------  536

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
                           LSIKAGG G+TLTAASTVIFAEL WTPGD+IQAEDRAHRIGQVSS
Sbjct  537  ---------------LSIKAGGYGITLTAASTVIFAELSWTPGDIIQAEDRAHRIGQVSS  581

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            VN+YYLL+N T+DD++WDVV+ KLENLGQMLDGQEK+LEV + +   SP K
Sbjct  582  VNVYYLLSNGTIDDLMWDVVQGKLENLGQMLDGQEKTLEVSQRDCRPSPSK  632



>ref|XP_002970990.1| hypothetical protein SELMODRAFT_171818 [Selaginella moellendorffii]
 gb|EFJ27588.1| hypothetical protein SELMODRAFT_171818 [Selaginella moellendorffii]
Length=692

 Score =   303 bits (777),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 157/279 (56%), Positives = 196/279 (70%), Gaps = 18/279 (6%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEAL P VY + HEYG RYC G  FG+YQGASN EELH L+K+TVMIRRLK DVLSELP
Sbjct  349  QLEALQPSVYSDFHEYGQRYCSGSHFGIYQGASNREELHALLKSTVMIRRLKNDVLSELP  408

Query  182  VKRRQQLEV---VkskikssqskeeaeslkLTMNN---------------LINKIYVASA  307
             K R+Q+ +   +KS  +      E +S++  M N               LI KIY  SA
Sbjct  409  EKCREQVFLSLDMKSTRQLRALINELKSIREKMQNSTESETEKLKREEKVLITKIYAESA  468

Query  308  KGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQAL  487
              K+ +V DYL T++E +CKFL+FAHH  M++ I ++L KK V  IRIDG T    RQ++
Sbjct  469  VVKVPAVQDYLSTMLETNCKFLVFAHHHTMVNGIDEHLKKKNVEFIRIDGDTSPVIRQSM  528

Query  488  VTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSV  667
            V  FQ    ++AAVLSI+A G+GLTLT+ASTVIFAE+ WTPGDLIQAEDRAHRIGQ SSV
Sbjct  529  VDKFQNNEKVRAAVLSIRAAGLGLTLTSASTVIFAEMTWTPGDLIQAEDRAHRIGQRSSV  588

Query  668  NIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEV  784
            NIYYL A DT+DD IW+ +  KL NLGQ+L+G+E+++ V
Sbjct  589  NIYYLHAPDTIDDFIWETIHRKLGNLGQVLNGREETMRV  627



>gb|AAD49766.2|AC007932_14 Contains similarity to HARP gene from Homo sapiens gb|AF210842. 
It contains SNF2 N-terminal PF|00176 and helicase C-terminal 
PF|00271 domains [Arabidopsis thaliana]
Length=592

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 158/287 (55%), Positives = 179/287 (62%), Gaps = 75/287 (26%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKG---------------GIFGVYQGASNHEELHNLMKAT  136
            QLEALYPDVY+N+HEYG RYCKG               G FG YQGASNH+ELHNLMKAT
Sbjct  329  QLEALYPDVYRNIHEYGGRYCKGVSPLHIEKLPRSSYKGFFGTYQGASNHDELHNLMKAT  388

Query  137  VMIRRLKKDVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINKIYVASAKGK  316
            VMIRRLKKDVL+ELP KRRQQ+ +  +     Q           +N L ++IY  SA  K
Sbjct  389  VMIRRLKKDVLTELPSKRRQQVFLDLAAKDMKQ-----------INALFHEIYTDSAVAK  437

Query  317  ISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTD  496
            I +VLDYL  VIE                                               
Sbjct  438  IPAVLDYLENVIE-----------------------------------------------  450

Query  497  FQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIY  676
              +K  IKAAVLSI+A GVG+TLTAASTVIFAEL WTPGDLIQAEDRAHRIGQVSSVNI+
Sbjct  451  --DKDEIKAAVLSIRAAGVGITLTAASTVIFAELSWTPGDLIQAEDRAHRIGQVSSVNIH  508

Query  677  YLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            YLLANDTVDDIIWDVV++KL+NLGQMLDGQE +L+V   +   SP K
Sbjct  509  YLLANDTVDDIIWDVVQSKLDNLGQMLDGQENALDVASSHMMSSPTK  555



>ref|XP_002962099.1| hypothetical protein SELMODRAFT_76516 [Selaginella moellendorffii]
 gb|EFJ37359.1| hypothetical protein SELMODRAFT_76516 [Selaginella moellendorffii]
Length=616

 Score =   280 bits (715),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 147/256 (57%), Positives = 178/256 (70%), Gaps = 18/256 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEAL P VY + HEYG RYC G  FG+YQGASN EELH L+K+TVMIRRLK DVLSELP
Sbjct  350  QLEALQPSVYSDFHEYGQRYCSGSHFGIYQGASNREELHALLKSTVMIRRLKNDVLSELP  409

Query  182  VKRRQQLEV---VkskikssqskeeaeslkLTMNN---------------LINKIYVASA  307
             K R+Q+ +   +KS  +      E +S++  M N               LI KIY  SA
Sbjct  410  EKCREQVFLSLDMKSTRQLRALINELKSIREKMQNSTESETEKLKREEKVLITKIYAESA  469

Query  308  KGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQAL  487
              K+ +V DYL T++E +CKFL+FAHH  M++ I ++L KK V  IRIDG T    RQ++
Sbjct  470  VVKVPAVQDYLSTMLETNCKFLVFAHHHTMVNGIDEHLKKKNVEFIRIDGDTSPVIRQSM  529

Query  488  VTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSV  667
            V  FQ    ++AAVLSI+A G+GLTLT+ASTVIFAE+ WTPGDLIQAEDRAHRIGQ SSV
Sbjct  530  VDKFQNNEKVRAAVLSIRAAGLGLTLTSASTVIFAEMSWTPGDLIQAEDRAHRIGQRSSV  589

Query  668  NIYYLLANDTVDDIIW  715
            NIYYL A DT+DD IW
Sbjct  590  NIYYLHAPDTIDDFIW  605



>ref|XP_004508077.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1-like isoform 
X3 [Cicer arietinum]
Length=576

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 162/196 (83%), Gaps = 19/196 (10%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYPDVYKNVHEYGNRYCKGG+FG+YQGASNHEELHNLMKAT MIRRLKKDVLSELP
Sbjct  363  QLEALYPDVYKNVHEYGNRYCKGGVFGLYQGASNHEELHNLMKATAMIRRLKKDVLSELP  422

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE VK+KIK+S SKEEAESLK T  NLINKIY  S
Sbjct  423  VKRRQQVFLDLADKDMKQINALFRELERVKAKIKASSSKEEAESLKFTQKNLINKIYTDS  482

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDY+GTVIEA CKFLIFAHH+ MIDAIH++LLKKKVGCIRIDGGTP+ SRQ 
Sbjct  483  AEAKIPAVLDYVGTVIEAGCKFLIFAHHLPMIDAIHEFLLKKKVGCIRIDGGTPSGSRQQ  542

Query  485  LVTDFQEKASIKAAVL  532
            LVT+FQEK +IKAAV+
Sbjct  543  LVTEFQEKDAIKAAVV  558



>ref|XP_011073845.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X3 
[Sesamum indicum]
Length=585

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 168/209 (80%), Gaps = 19/209 (9%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QL+ALYP+VYKNVHEYG+RYCKGGIFGVYQGASNHEELHNLMKAT+MIRRLKKDVLS+LP
Sbjct  377  QLQALYPEVYKNVHEYGSRYCKGGIFGVYQGASNHEELHNLMKATLMIRRLKKDVLSQLP  436

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LEVVK KIKS QS+EEAESLK T  NLINKIY  S
Sbjct  437  VKRRQQVFLELGQDDMRQINALFCELEVVKLKIKSCQSREEAESLKFTEKNLINKIYTDS  496

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGT+IEA CKFLIFAHH  MID+IH++LLKKKVGCIRIDG TPAASRQA
Sbjct  497  AEAKIPAVLDYLGTIIEAGCKFLIFAHHQPMIDSIHKFLLKKKVGCIRIDGSTPAASRQA  556

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTA  571
            LVT+FQEK S+KAAVL + +    L + A
Sbjct  557  LVTEFQEKDSVKAAVLWMSSCPSKLEVLA  585



>ref|XP_003082907.1| SNF2 domain-containing protein / helicase domain-containing protein 
(ISS) [Ostreococcus tauri]
Length=596

 Score =   266 bits (680),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 179/267 (67%), Gaps = 12/267 (4%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI-FGVYQGASNHEELHNLMKATVMIRRLKKDVLSEL  178
            QLEAL P V+  +H+YG RYC+GG  FG+Y G S  +ELH ++    M+RRLK+DVL  L
Sbjct  247  QLEALVPRVFFRLHDYGTRYCQGGAPFGMYTGCSRADELHVMISKLCMVRRLKRDVLKSL  306

Query  179  PVKRRQQ---------LEVVkskikssqskeeaeslkLTMNNLINKIYVASAKGKISSVL  331
            P K+R Q         L  V+          EA   +     L+N++++ASAK K+++V 
Sbjct  307  PPKQRTQQFLTVEKSCLGDVRRIKTQLDKLREAGGSEFEEKRLLNELFLASAKAKVNAVC  366

Query  332  DYLGTVIE--ADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQE  505
            DYL T+I+  A  KF+ FAHH  M+DA+  +L KKK   IRIDG TP+A+R  LV  FQ 
Sbjct  367  DYLETLIDGSASEKFIFFAHHGVMLDAVSAFLEKKKCKHIRIDGSTPSAARGDLVNKFQR  426

Query  506  KASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLL  685
              S + AVLSIKA G+GLTLTAASTVIF E+ WTPGDLIQAEDRAHRIGQ SSV + YL 
Sbjct  427  DDSTRIAVLSIKAAGMGLTLTAASTVIFGEMVWTPGDLIQAEDRAHRIGQASSVLVQYLH  486

Query  686  ANDTVDDIIWDVVKNKLENLGQMLDGQ  766
            A DT+D+IIW  ++ KL+ LG +L+GQ
Sbjct  487  ARDTIDEIIWQTIRRKLDTLGTVLNGQ  513



>ref|XP_009801773.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X2 
[Nicotiana sylvestris]
Length=566

 Score =   265 bits (678),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 158/195 (81%), Gaps = 19/195 (10%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEALYP+VYKNVHEYGNRYCKGGIFGVYQGASNHEELH+LMKAT+MIRRLKKDVLSELP
Sbjct  372  QLEALYPNVYKNVHEYGNRYCKGGIFGVYQGASNHEELHSLMKATLMIRRLKKDVLSELP  431

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
             KRRQQ                   LEV+K K K +QS+EEA+SLK    +LI KIY AS
Sbjct  432  QKRRQQVFLDLGEKEMRHVNILFRELEVIKGKYKLAQSEEEAKSLKFAEKSLITKIYTAS  491

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A+ KI +VLDYLGT++EADCKFLIFAHH  MI++IH YLLKKKVGCIRIDG TP+A RQA
Sbjct  492  AEAKIPAVLDYLGTMVEADCKFLIFAHHQPMIESIHNYLLKKKVGCIRIDGSTPSALRQA  551

Query  485  LVTDFQEKASIKAAV  529
            LVTDFQEK +IKAAV
Sbjct  552  LVTDFQEKETIKAAV  566



>emb|CEG02026.1| SNF2-related [Ostreococcus tauri]
Length=674

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 179/267 (67%), Gaps = 12/267 (4%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI-FGVYQGASNHEELHNLMKATVMIRRLKKDVLSEL  178
            QLEAL P V+  +H+YG RYC+GG  FG+Y G S  +ELH ++    M+RRLK+DVL  L
Sbjct  325  QLEALVPRVFFRLHDYGTRYCQGGAPFGMYTGCSRADELHVMISKLCMVRRLKRDVLKSL  384

Query  179  PVKRRQQ---------LEVVkskikssqskeeaeslkLTMNNLINKIYVASAKGKISSVL  331
            P K+R Q         L  V+          EA   +     L+N++++ASAK K+++V 
Sbjct  385  PPKQRTQQFLTVEKSCLGDVRRIKTQLDKLREAGGSEFEEKRLLNELFLASAKAKVNAVC  444

Query  332  DYLGTVIE--ADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQE  505
            DYL T+I+  A  KF+ FAHH  M+DA+  +L KKK   IRIDG TP+A+R  LV  FQ 
Sbjct  445  DYLETLIDGSASEKFIFFAHHGVMLDAVSAFLEKKKCKHIRIDGSTPSAARGDLVNKFQR  504

Query  506  KASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLL  685
              S + AVLSIKA G+GLTLTAASTVIF E+ WTPGDLIQAEDRAHRIGQ SSV + YL 
Sbjct  505  DDSTRIAVLSIKAAGMGLTLTAASTVIFGEMVWTPGDLIQAEDRAHRIGQASSVLVQYLH  564

Query  686  ANDTVDDIIWDVVKNKLENLGQMLDGQ  766
            A DT+D+IIW  ++ KL+ LG +L+GQ
Sbjct  565  ARDTIDEIIWQTIRRKLDTLGTVLNGQ  591



>ref|XP_001422675.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00992.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=638

 Score =   265 bits (677),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 187/285 (66%), Gaps = 14/285 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYC-KGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSEL  178
            QLEAL P V+  ++EYG RYC  GG FG+Y G ++ +ELH ++    M+RRLKKDVL +L
Sbjct  317  QLEALVPKVFARLNEYGARYCANGGPFGMYTGCTHADELHVMISKLCMVRRLKKDVLKDL  376

Query  179  PVKRRQQLEV---------VkskikssqskeeaeslkLTMNNLINKIYVASAKGKISSVL  331
            P K+R Q+ +         V+          +    +L    L+N++++ASAK K  SV 
Sbjct  377  PPKQRTQVWLALEKSSMGDVRRIKSLLDELRQRGGNELEEKRLLNELFLASAKAKTKSVC  436

Query  332  DYLGTVIE-ADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQEK  508
            +YL T+I+ +  KFL FAHH  ++DA+ Q +  KKV  IRIDG TPAA R  LV  FQ +
Sbjct  437  EYLETLIDGSTSKFLFFAHHGVLLDAVAQCMDAKKVKTIRIDGSTPAAVRGDLVNAFQRR  496

Query  509  ASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLLA  688
              ++ A+LSIKA G+GLTLTAASTVIF E+ WTPGDLIQAEDRAHRIGQ SSV + YL A
Sbjct  497  DDVRVAILSIKAAGMGLTLTAASTVIFGEMVWTPGDLIQAEDRAHRIGQQSSVLVQYLHA  556

Query  689  NDTVDDIIWDVVKNKLENLGQMLDGQEKS--LEVLEDNSNKSPMK  817
             DT+D+IIW  +K KL+NLG +L+GQ     LE    N  KSP +
Sbjct  557  KDTIDEIIWQSIKKKLDNLGAVLNGQTSGNHLETTSTN-GKSPKR  600



>ref|XP_003063659.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH52032.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=518

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/259 (51%), Positives = 176/259 (68%), Gaps = 9/259 (3%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QLEAL P+V+   +E+  RYC G  FG +QG +N +EL  ++   VM+RRLKKDVL++LP
Sbjct  261  QLEALRPNVFTKFNEFAQRYCSGSRFG-WQGCTNADELFGVISRLVMVRRLKKDVLTQLP  319

Query  182  VKRRQQL-------EVVkskikssqskeeaeslkLTMNNLINKIYVASAKGKISSVLDYL  340
             K R+Q+       E +       +   + +        L+N++YVASAK KI  V +YL
Sbjct  320  PKTREQVFLPLPKSEALSEVKAIRERLNDIKESNRDEGRLMNQLYVASAKAKIGPVQEYL  379

Query  341  GTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQEKASI  517
             T+I+    KFL FAHH E++DA    L K+K+  IRIDG TP+ +R  LV  FQ   ++
Sbjct  380  ETLIDGGADKFLFFAHHAELLDAAAATLKKRKIQHIRIDGSTPSTARGKLVETFQTVDAV  439

Query  518  KAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLLANDT  697
            + AVLSIKA GVGLTLTAAS VIF EL WTPG+++QAEDRAHRIGQV+SV++ +L A +T
Sbjct  440  RVAVLSIKAAGVGLTLTAASAVIFGELSWTPGEIVQAEDRAHRIGQVNSVSVQFLCARNT  499

Query  698  VDDIIWDVVKNKLENLGQM  754
            VDDI+W  V+NKLENLGQ+
Sbjct  500  VDDIMWGSVQNKLENLGQV  518



>ref|XP_009630710.1| PREDICTED: putative SMARCAL1-like protein [Nicotiana tomentosiformis]
Length=167

 Score =   245 bits (626),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  395  MIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAA  574
            MI++IH YLLKKKVGCIRIDG TP+A RQALVTDFQEK +IKAAVLSIKAGGVGLTLTAA
Sbjct  1    MIESIHNYLLKKKVGCIRIDGSTPSALRQALVTDFQEKETIKAAVLSIKAGGVGLTLTAA  60

Query  575  STVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQM  754
            STVIFAEL WTPGDLIQAEDRAHRIGQVSSVN+ YLLANDTVDDIIWDVV++KLENLGQM
Sbjct  61   STVIFAELSWTPGDLIQAEDRAHRIGQVSSVNVCYLLANDTVDDIIWDVVQSKLENLGQM  120

Query  755  LDGQEKSLEVLEDNSNKSPMK  817
            LDG EKSLEV  + S  SP K
Sbjct  121  LDGHEKSLEVSTNQSYSSPSK  141



>ref|XP_002505551.1| SNF2 super family [Micromonas sp. RCC299]
 gb|ACO66809.1| SNF2 super family [Micromonas sp. RCC299]
Length=700

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/297 (48%), Positives = 189/297 (64%), Gaps = 29/297 (10%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            Q+EAL P+V+    E+  RYC G  FG +QG  N +EL+ ++   VM+RRLK+DVL++LP
Sbjct  328  QVEALRPNVFTKFTEFAQRYCSGSRFG-WQGCENPDELYAIISRLVMVRRLKRDVLTQLP  386

Query  182  VKRRQQLEVVkskikssqskeeaeslkLT--------------------MN----NLINK  289
             KRR+Q+ +   K   +  + +A   +L                     MN     L+N 
Sbjct  387  PKRREQVYIALDKKTEAYREMKAVQEQLQRLRDHAKDNGLLLGAGGDGKMNVEEKRLMNA  446

Query  290  IYVASAKGKISSVLDYLGTVIE---ADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGG  460
             YVASAK K +SV DYL T+++   A  KFL FAHH E++DA    L K+K   IRIDG 
Sbjct  447  YYVASAKAKATSVQDYLETLLDGSGAGDKFLFFAHHKELLDAASTVLRKRKTQFIRIDGT  506

Query  461  TPAASRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRA  640
            TP   R  LV  FQ   +IK AVLSIKA G+GLTLTAASTV+F EL WTPGD++QAEDRA
Sbjct  507  TPTTERGGLVQQFQTVDAIKVAVLSIKAAGMGLTLTAASTVVFGELSWTPGDIVQAEDRA  566

Query  641  HRIGQVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQ-EKSLEVLEDNSNKS  808
            HRIGQ SSV + +L A ++VDD++W  V+NKLENLGQ+LDG     LE+ +D ++++
Sbjct  567  HRIGQASSVLVQFLHAKNSVDDVMWGSVQNKLENLGQVLDGHMGDHLEIHDDQTHRA  623



>gb|AGT16318.1| zinc finger Ran-binding domain-containing protein [Saccharum 
hybrid cultivar R570]
Length=694

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 150/196 (77%), Gaps = 19/196 (10%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            Q++ALYP VYKNV+EYGNRYCKGG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  389  QIQALYPTVYKNVNEYGNRYCKGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  448

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE +K KI+SS SKE  +SL+    N++NKIY+ S
Sbjct  449  VKRRQQVFLDLSEKDVKNVRALFIELETLKIKIESSDSKEMIDSLRFAYQNIVNKIYIDS  508

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLD+LGT+IEA CKFLIFAHH  MIDAI Q+LLKKKV CI+IDG TP  +RQ 
Sbjct  509  AVAKIPAVLDFLGTMIEAGCKFLIFAHHQPMIDAIEQHLLKKKVKCIKIDGKTPLTTRQT  568

Query  485  LVTDFQEKASIKAAVL  532
            LVT+FQE   IKAAV+
Sbjct  569  LVTNFQENDDIKAAVM  584



>ref|XP_007509886.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19001.1| predicted protein [Bathycoccus prasinos]
Length=698

 Score =   239 bits (610),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 128/270 (47%), Positives = 174/270 (64%), Gaps = 13/270 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            QL +L PD++  + EYG RYC GG FG + G+S  +EL  ++ ++VMIRR KKDVL++LP
Sbjct  398  QLTSLRPDIFPKLSEYGQRYCSGGRFGAFSGSSESQELFAVVSSSVMIRRKKKDVLTQLP  457

Query  182  VKRRQQ--LEVVkskikssqskeeaeslkLTMNN------LINKIYVASAKGKISSVLDY  337
             K+R+Q  LE+ K++  S           L          L+NK Y+++A+ K+ +V +Y
Sbjct  458  PKQREQIFLEIPKAERTSKIQPIVQAMNALPETETLERKMLMNKYYLSTAEAKVKTVQNY  517

Query  338  LGTVIEA---DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ--  502
            L  ++E+   + K L FAHH  ++ A  + + K K   IRIDG TP+  RQ LV  FQ  
Sbjct  518  LQNLLESVDEEKKILFFAHHKCLLHAAVETMEKTKTKFIRIDGETPSGLRQGLVDSFQRC  577

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
            +  S K AVLSIKA GVGLTLT AS V+F+E  WTP +++QAEDRAHRIGQ  SV + +L
Sbjct  578  DANSPKVAVLSIKAAGVGLTLTRASLVVFSEYSWTPAEILQAEDRAHRIGQRDSVLVQFL  637

Query  683  LANDTVDDIIWDVVKNKLENLGQMLDGQEK  772
             A D+VDDIIW  V+NKLE LG  LDG +K
Sbjct  638  HAKDSVDDIIWQSVQNKLETLGHFLDGTKK  667



>ref|XP_005826013.1| hypothetical protein GUITHDRAFT_76774, partial [Guillardia theta 
CCMP2712]
 gb|EKX39033.1| hypothetical protein GUITHDRAFT_76774, partial [Guillardia theta 
CCMP2712]
Length=522

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/281 (44%), Positives = 172/281 (61%), Gaps = 23/281 (8%)
 Frame = +2

Query  5    LEALYPDVYKNVHEYGNRYCKG--GIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLSE  175
            L +L+P ++ N  E+  RYC    G FG+   GASN EELH L+    M+RRLKKDVL++
Sbjct  240  LNSLHPRLFNNFLEFAYRYCDAHQGPFGLETSGASNLEELHVLLDQHTMVRRLKKDVLTQ  299

Query  176  LPVKRRQQL--------------------EVVkskikssqskeeaeslkLTMNNLINKIY  295
            LP KRRQ++                    E+ +      +  E     +     LI K+Y
Sbjct  300  LPAKRRQKILIKISEAESKRFATEMDKLKELERVTQDEEEDSEARFRAQSRKKALIMKMY  359

Query  296  VASAKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAAS  475
            V +   K+ ++ +Y+  +IE   KFL+FAHH+E++D +   + KKKV  IRIDG TP+  
Sbjct  360  VDTGVAKLQAIQEYVADLIECGAKFLVFAHHMEILDGLEDVVSKKKVQYIRIDGSTPSRE  419

Query  476  RQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQ  655
            RQ  V+ FQE +S++ A+LS+ A G GLTLTAA+ V+FAEL WTPG L+QAEDRAHRIGQ
Sbjct  420  RQLRVSSFQESSSVRVAILSVTAAGTGLTLTAANLVVFAELHWTPGILLQAEDRAHRIGQ  479

Query  656  VSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSL  778
             SSVN+ YL+   T D++IWD +  K++ +G+ LDG   S 
Sbjct  480  QSSVNVMYLVGQGTCDELIWDSISYKVKVIGRALDGMRTSF  520



>tpg|DAA63809.1| TPA: hypothetical protein ZEAMMB73_058078 [Zea mays]
Length=618

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 145/196 (74%), Gaps = 19/196 (10%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            Q++ALYP VYK+V EYGN YCKGG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  377  QIQALYPTVYKSVSEYGNIYCKGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  436

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE +K KI+SS SKE  +SL+    N++NKIY  S
Sbjct  437  VKRRQQVFLDLSEKDVKNVRALFIELETLKVKIESSDSKEMIDSLRFAYQNIVNKIYTDS  496

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLD+LGT+IE  CKFLIFAHH  MIDAI ++LLKKKV CI+IDG TP  +RQ 
Sbjct  497  AVAKIPAVLDFLGTMIEEGCKFLIFAHHQPMIDAIEKHLLKKKVKCIKIDGKTPLTTRQT  556

Query  485  LVTDFQEKASIKAAVL  532
            LVTDFQ    +KAAV+
Sbjct  557  LVTDFQNNDDVKAAVM  572



>ref|NP_001183352.1| hypothetical protein [Zea mays]
 gb|ACR36504.1| unknown [Zea mays]
Length=631

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 145/196 (74%), Gaps = 19/196 (10%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELP  181
            Q++ALYP VYK+V EYGN YCKGG FG+YQGASNHEELHNLMKATVMIRRLKKDVLS+LP
Sbjct  390  QIQALYPTVYKSVSEYGNIYCKGGFFGLYQGASNHEELHNLMKATVMIRRLKKDVLSQLP  449

Query  182  VKRRQQ-------------------LEVVkskikssqskeeaeslkLTMNNLINKIYVAS  304
            VKRRQQ                   LE +K KI+SS SKE  +SL+    N++NKIY  S
Sbjct  450  VKRRQQVFLDLSEKDVKNVRALFIELETLKVKIESSDSKEMIDSLRFAYQNIVNKIYTDS  509

Query  305  AKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
            A  KI +VLD+LGT+IE  CKFLIFAHH  MIDAI ++LLKKKV CI+IDG TP  +RQ 
Sbjct  510  AVAKIPAVLDFLGTMIEEGCKFLIFAHHQPMIDAIEKHLLKKKVKCIKIDGKTPLTTRQT  569

Query  485  LVTDFQEKASIKAAVL  532
            LVTDFQ    +KAAV+
Sbjct  570  LVTDFQNNDDVKAAVM  585



>gb|KFM27269.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like protein 1 [Auxenochlorella protothecoides]
Length=528

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/261 (46%), Positives = 155/261 (59%), Gaps = 51/261 (20%)
 Frame = +2

Query  5    LEALYPDVYKNVHEYGNRYCKGGIFGVYQGASNHEELHNLMKATVMIRRLKKDVLSELPV  184
            L AL P     + ++G RYC G  +  Y GASN  ELH L++A VM+ RL          
Sbjct  241  LSALVPGARLKMKDFGERYCAGTRWDRYGGASNLPELHALLRA-VMLYRL----------  289

Query  185  KRRQQLEVVkskikssqskeeaeslkLTMNNLINKIYVASAKGKISSVLDYLGTVIEADC  364
                                                   SA+ K  +V +Y+GT+++   
Sbjct  290  ---------------------------------------SAEVKGPAVQEYVGTLLDGGT  310

Query  365  KFLIFAHHVEMIDAI-HQYLLKKKVGCIRIDGGTPAASRQALVTDFQEKASIKAAVLSIK  541
            KFL FAHH  M+DAI H+   +K +  IRIDG T  + RQ LV  FQE A ++ A+LSIK
Sbjct  311  KFLAFAHHTCMLDAIEHECNRRKGLRFIRIDGSTQTSDRQRLVNSFQENADVQVAILSIK  370

Query  542  AGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLLANDTVDDIIWDV  721
            A GVGLTLTAASTV+FAE+ WTPGDLIQAEDRAHRIGQ SSVNI++L A  +VDDIIW  
Sbjct  371  AAGVGLTLTAASTVVFAEMTWTPGDLIQAEDRAHRIGQASSVNIHFLHAKGSVDDIIWST  430

Query  722  VKNKLENLGQMLDGQEKSLEV  784
            +++KLE++G+ LDGQ ++LEV
Sbjct  431  IQSKLESVGEALDGQGQALEV  451



>ref|XP_001426557.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK59159.1| unnamed protein product [Paramecium tetraurelia]
Length=746

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/288 (38%), Positives = 180/288 (63%), Gaps = 17/288 (6%)
 Frame = +2

Query  5    LEALYPDVYKNVHEYGNRYCKGGIF----GV-YQGASNHEELHNLMKATVMIRRLKKDVL  169
            L  + PD++ +  E+G RYC   +     G+ + GASN +ELH L+   +MIRRLKKDVL
Sbjct  286  LNIIRPDIFGSFKEFGYRYCDPKLSRYTKGIDFDGASNLKELHFLLTNYIMIRRLKKDVL  345

Query  170  SELPVKRRQ------QL------EVVkskikssqskeeaeslkLTMNNLINKIYVASAKG  313
            ++LP KRRQ      QL      +++       +S ++     L++N+++ K Y+ + + 
Sbjct  346  NQLPEKRRQIDALLKQLGNIDIQQLINKDAIFQESSKDHSEQLLSINSILQKCYMLTGQA  405

Query  314  KISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVT  493
            KI ++ DY+ T+ E + KFL FAHH +++DA+ +Y ++  +  +RIDG      R   V 
Sbjct  406  KIKAIKDYINTLFENEIKFLFFAHHQDVLDAVQEYCVENNIQYMRIDGSVSIEQRHLNVQ  465

Query  494  DFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNI  673
             FQ   +I+ A+LS+ +   G+TLTAAST++F E+ WTP  ++QAEDRAHRIGQV  V+ 
Sbjct  466  MFQNNEAIRIAILSVTSANYGITLTAASTIVFGEMHWTPAIMMQAEDRAHRIGQVQCVDC  525

Query  674  YYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSPMK  817
            +YL+ + T+DD I++ ++NK+  +   +DGQ+++L   E ++N+  MK
Sbjct  526  HYLIGDGTLDDHIFNKIENKMNTVSNFIDGQKQNLGAQEFSANEILMK  573



>ref|XP_006529479.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X9 [Mus musculus]
 dbj|BAB30499.1| unnamed protein product [Mus musculus]
Length=530

 Score =   210 bits (535),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  205  QIEALFPQKFGTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  263

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  264  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITRMFKQTA  323

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  324  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRYIRIDGSVPSSERIH  383

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  384  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  443

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  444  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  490



>gb|KFO82962.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like 1, partial [Buceros rhinoceros 
silvestris]
Length=374

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 159/263 (60%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGV---YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ P  +   H +G RYC          Y G+SN  EL  L++ ++MIRRLK DVLS
Sbjct  29   QIAAVQPSFFPQFHSFGLRYCDARKMPWGWDYSGSSNLTELKILLEESIMIRRLKSDVLS  88

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A   K+      +K          Y  +A+ KI S
Sbjct  89   QLPAKQRKMVVVAPEGISAKTKAVLAAEAKMMAKGYKSKQQEKEALLLFYNKTAEAKIRS  148

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+ + KFL+FAHH  ++DAI   L KK V  IRIDG TP+A RQ+L   FQ
Sbjct  149  VVEYILELLESGNRKFLVFAHHKIVLDAIAAELEKKHVEYIRIDGSTPSAERQSLCQKFQ  208

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVNI+YL
Sbjct  209  FSEKQVVAVLSLTAANMGLTLSAADLVVFAELFWNPGILIQAEDRAHRIGQTSSVNIHYL  268

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K++ LG+
Sbjct  269  VAQGTADDYLWPMIQEKIKVLGE  291



>dbj|BAC39315.1| unnamed protein product [Mus musculus]
Length=616

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  201  QIEALFPQKFGTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  259

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  260  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITRMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  440  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  486



>ref|XP_003073042.1| Snf2/Rad54-like helicase [Encephalitozoon intestinalis ATCC 50506]
 gb|ADM11682.1| Snf2/Rad54-like helicase [Encephalitozoon intestinalis ATCC 50506]
Length=556

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 158/258 (61%), Gaps = 16/258 (6%)
 Frame = +2

Query  14   LYP-------DVYKNVHEYGNRYCKG---GIFGVYQGASNHEELHNLMKATVMIRRLKKD  163
            LYP        ++    EYG RYC G   G +  Y+G SN EELH ++K  +MIRR K +
Sbjct  275  LYPIISSIDRTIFPRFAEYGARYCNGRKVGQWYDYKGCSNAEELHYILKKCLMIRRTKDE  334

Query  164  VLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINKIYVASAKGKISSVLDYLG  343
            VLS+LP K R+Q  VV       +   +    +    N++ + Y  + K KI  V  Y+ 
Sbjct  335  VLSQLPPKFRRQ--VVLQCKGKQRDPAKELVGENVDTNVVAQ-YREAVKLKIDQVKQYIS  391

Query  344  TVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQEKASIKA  523
            T++E D KF+IF HHVEM+D + ++L +K V  IRIDG TP+++R  LV  FQE   IK 
Sbjct  392  TIVEKDMKFIIFCHHVEMMDGLEEFLREKGVSIIRIDGSTPSSNRHMLVKSFQENEEIKT  451

Query  524  AVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLLANDTVD  703
            A+LSI A   GLTLTA   V+FAEL W PG L+QAEDR HRIGQ +SV+I YL+A  T+D
Sbjct  452  ALLSITACSTGLTLTAGRAVVFAELYWNPGVLLQAEDRIHRIGQKNSVDIIYLVARGTID  511

Query  704  DIIWDVVKNK---LENLG  748
            + +W  + +K   LE+LG
Sbjct  512  EYVWPKLLSKLNVLESLG  529



>gb|EDM09882.1| rCG46237 [Rattus norvegicus]
Length=716

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/287 (41%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  201  QIEALFPQRFGTWVEYAKRYCNAHIRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  259

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  260  EVLSQLPPKVRQRIPFDLAPATVKELNASFEEWQKLMRAPDAGAMETVMGLITRMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKARYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELFWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  440  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  486



>ref|XP_010078857.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1, partial [Pterocles 
gutturalis]
Length=373

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 158/263 (60%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGV---YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ P  +   H +G RYC          Y G+SN  EL  L++ ++MIRRLK DVLS
Sbjct  23   QIAAVQPAFFPQFHSFGLRYCDARKMPWGWDYSGSSNLTELKILLEESIMIRRLKSDVLS  82

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A   K       NK          Y  +A+ K+ S
Sbjct  83   QLPAKQRKMVVVAPEGISAKTKAVLAAEAKKMAKGYANKQQQKEALLLFYNRTAEAKMHS  142

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+ + KFL+FAHH  M+DAI   L KK V  IRIDG TP+A RQ+L   FQ
Sbjct  143  VVEYILELLESGNDKFLVFAHHKIMLDAIGGELEKKHVEYIRIDGSTPSAERQSLCQKFQ  202

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVN++YL
Sbjct  203  FSEKQVVAVLSLTAANMGLTLSAADLVVFAELFWNPGVLIQAEDRAHRIGQTSSVNVHYL  262

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K++ LG+
Sbjct  263  VAKGTADDYLWPMIQEKIKVLGE  285



>gb|KFV12864.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like 1, partial [Pterocles gutturalis]
Length=368

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 158/263 (60%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGV---YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ P  +   H +G RYC          Y G+SN  EL  L++ ++MIRRLK DVLS
Sbjct  23   QIAAVQPAFFPQFHSFGLRYCDARKMPWGWDYSGSSNLTELKILLEESIMIRRLKSDVLS  82

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A   K       NK          Y  +A+ K+ S
Sbjct  83   QLPAKQRKMVVVAPEGISAKTKAVLAAEAKKMAKGYANKQQQKEALLLFYNRTAEAKMHS  142

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+ + KFL+FAHH  M+DAI   L KK V  IRIDG TP+A RQ+L   FQ
Sbjct  143  VVEYILELLESGNDKFLVFAHHKIMLDAIGGELEKKHVEYIRIDGSTPSAERQSLCQKFQ  202

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVN++YL
Sbjct  203  FSEKQVVAVLSLTAANMGLTLSAADLVVFAELFWNPGVLIQAEDRAHRIGQTSSVNVHYL  262

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K++ LG+
Sbjct  263  VAKGTADDYLWPMIQEKIKVLGE  285



>ref|XP_009868008.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1, partial [Apaloderma 
vittatum]
Length=380

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 161/263 (61%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYC--KGGIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ PD +   H +G RYC  +   +G  Y G+SN  EL  L++ ++MIRRLK DVLS
Sbjct  98   QIAAVQPDFFPQFHSFGLRYCDARKMPWGWDYSGSSNLTELKILLEESIMIRRLKSDVLS  157

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A   K       +K          Y  +A+ KI S
Sbjct  158  QLPAKQRKMVIVAPEGISAKTKAALAAEAKRMAKGHKSKQQEKEVLLLFYARTAEAKIHS  217

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+ + KFL+FAHH  M+DAI   L KK V  IRIDG T +A RQ+L   FQ
Sbjct  218  VVEYILELLESGNRKFLVFAHHKIMLDAIVAELEKKHVEYIRIDGSTSSAERQSLCQKFQ  277

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVN++YL
Sbjct  278  FSEKQMVAVLSLTAANMGLTLSAADLVVFAELFWNPGILIQAEDRAHRIGQTSSVNVHYL  337

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K++ LG+
Sbjct  338  VAKGTADDYLWPMIQEKIKVLGE  360



>gb|KFP81262.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like 1, partial [Apaloderma vittatum]
Length=385

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/283 (43%), Positives = 168/283 (59%), Gaps = 14/283 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYC--KGGIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ PD +   H +G RYC  +   +G  Y G+SN  EL  L++ ++MIRRLK DVLS
Sbjct  103  QIAAVQPDFFPQFHSFGLRYCDARKMPWGWDYSGSSNLTELKILLEESIMIRRLKSDVLS  162

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A   K       +K          Y  +A+ KI S
Sbjct  163  QLPAKQRKMVIVAPEGISAKTKAALAAEAKRMAKGHKSKQQEKEVLLLFYARTAEAKIHS  222

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+ + KFL+FAHH  M+DAI   L KK V  IRIDG T +A RQ+L   FQ
Sbjct  223  VVEYILELLESGNRKFLVFAHHKIMLDAIVAELEKKHVEYIRIDGSTSSAERQSLCQKFQ  282

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVN++YL
Sbjct  283  FSEKQMVAVLSLTAANMGLTLSAADLVVFAELFWNPGILIQAEDRAHRIGQTSSVNVHYL  342

Query  683  LANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSP  811
            +A  T DD +W +++ K++ LG+     E +     ++SN  P
Sbjct  343  VAKGTADDYLWPMIQEKIKVLGEA-GLSETNFSETAESSNYCP  384



>ref|XP_001641644.1| predicted protein [Nematostella vectensis]
 gb|EDO49581.1| predicted protein [Nematostella vectensis]
Length=532

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/257 (44%), Positives = 164/257 (64%), Gaps = 7/257 (3%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKG--GIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ P ++ + HE+G RYC G    +G  Y GASN EEL  +++ ++MIRRLKKDVL 
Sbjct  257  QICAVNPRMFPSFHEFGKRYCAGVENRWGWDYSGASNMEELQLVLEQSIMIRRLKKDVLH  316

Query  173  ELPVKRRQQL----EVVkskikssqskeeaeslkLTMNNLINKIYVASAKGKISSVLDYL  340
            +LP KRRQ +     ++K K     +KE   + K   +  +   +  ++  KI++V +Y+
Sbjct  317  QLPSKRRQMVLLDPSLIKVKPLMKAAKEVETAKKKEQHGALLNYFCETSASKIAAVRNYV  376

Query  341  GTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQEKASIK  520
              ++E   KFL+F HH +M+DAI   L+ KK   IRIDG TP++ RQ L   FQ+  +  
Sbjct  377  LDLLEGGHKFLVFGHHQDMLDAISDCLMHKKYSYIRIDGKTPSSKRQMLCDQFQKDKNTV  436

Query  521  AAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLLANDTV  700
             AVLSI A   GLTLT  + V+FAEL W PG L+QAEDR +RIGQ +SVNI+YL+A  T 
Sbjct  437  VAVLSITAANTGLTLTEGTAVVFAELFWNPGALVQAEDRVYRIGQKNSVNIHYLVAKGTA  496

Query  701  DDIIWDVVKNKLENLGQ  751
            DD +W ++++KL+ L +
Sbjct  497  DDYLWPLIQHKLDVLSK  513



>ref|XP_006048270.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3, partial 
[Bubalus bubalis]
Length=513

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/287 (40%), Positives = 170/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  201  QIEALFPQKFGTWTEYAKRYCNAHVRYFGRRPQWDCRGASNLNELHQLL-SNIMIRRLKT  259

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNN-----------LINKIYVASA  307
            +VL++LP K RQ++        + +     E  +  M +           LI +++  +A
Sbjct  260  EVLTQLPPKIRQRIPFDLPSAAAKELNSSFEEWEKLMRDPHSGATETVMGLITRMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPETRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  440  VNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKLQAEEGDKEK  486



>gb|KGL95190.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like 1, partial [Charadrius vociferus]
Length=709

 Score =   209 bits (533),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 120/263 (46%), Positives = 163/263 (62%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYC--KGGIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ PD +   H +G RYC  +   +G  Y G+SN  EL  L+K ++MIRRLK DVLS
Sbjct  364  QIAAVQPDFFPQFHSFGLRYCDARKMPWGWDYSGSSNLTELKILLKESIMIRRLKSDVLS  423

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A+  K       +K          Y  +A+ KI S
Sbjct  424  QLPAKQRKMVVVAPEGISAKTKAVLADEAKKMAKGYDSKQQEKEALLLFYKRTAEAKIHS  483

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+   KFL+FAHH  M+DAI   L KK+V  IRIDG TP+A RQ+L   FQ
Sbjct  484  VVEYILELLESGKDKFLVFAHHKIMLDAIVAELEKKRVEYIRIDGSTPSAERQSLCQKFQ  543

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVN++YL
Sbjct  544  FSEKQIVAVLSLTAANMGLTLSAADLVVFAELFWNPGVLIQAEDRAHRIGQTSSVNVHYL  603

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K+E LG+
Sbjct  604  VARGTADDYLWPMIQEKIEVLGE  626



>ref|XP_006529477.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X7 [Mus musculus]
Length=857

 Score =   210 bits (535),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  205  QIEALFPQKFGTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  263

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  264  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITRMFKQTA  323

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  324  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRYIRIDGSVPSSERIH  383

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  384  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  443

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  444  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  490



>gb|KFQ73478.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like 1, partial [Phoenicopterus ruber 
ruber]
Length=709

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 163/263 (62%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYC--KGGIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ PD +   H +G RYC  K   +G  Y G+SN  EL  L++ ++MIRRLK DVLS
Sbjct  364  QIAAVQPDFFPQFHSFGLRYCDAKKMPWGWDYSGSSNLTELKILLEESIMIRRLKSDVLS  423

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A   K       NK          Y  +A+ KI S
Sbjct  424  QLPAKQRKMVVVAPEGISAKTKAVLAAEAKKMAKGYENKQQEKEALLLFYSRTAEAKIHS  483

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+ + KFL+FAHH  ++DAI   L KK+V  IRIDG TP+A RQ+L   FQ
Sbjct  484  VVEYILELLESGNNKFLVFAHHKIVLDAIVAELEKKRVEYIRIDGSTPSAERQSLCQKFQ  543

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVN++YL
Sbjct  544  FSEKQVVAVLSLTAANMGLTLSAADLVVFAELFWNPGILIQAEDRAHRIGQTSSVNVHYL  603

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K++ LG+
Sbjct  604  VAKGTADDYLWPMIQEKIKVLGE  626



>ref|XP_006249764.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X3 [Rattus norvegicus]
 ref|XP_006249766.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X3 [Rattus norvegicus]
Length=1056

 Score =   212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/287 (41%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  201  QIEALFPQRFGTWVEYAKRYCNAHIRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  259

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  260  EVLSQLPPKVRQRIPFDLAPATVKELNASFEEWQKLMRAPDAGAMETVMGLITRMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKARYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELFWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  440  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  486



>ref|XP_006249763.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X2 [Rattus norvegicus]
Length=1083

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/287 (41%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  228  QIEALFPQRFGTWVEYAKRYCNAHIRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  286

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  287  EVLSQLPPKVRQRIPFDLAPATVKELNASFEEWQKLMRAPDAGAMETVMGLITRMFKQTA  346

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  347  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKARYIRIDGSVPSSERIH  406

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  407  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELFWDPGHIKQAEDRAHRIGQCSS  466

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  467  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  513



>ref|XP_009874653.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3-like, 
partial [Apaloderma vittatum]
Length=738

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 171/291 (59%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +M+RRLK 
Sbjct  198  QIEALFPRRFGTWSEYAKKYCNAHVRFFGKRTQWDCRGASNLEELHQLL-SEIMVRRLKD  256

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMN---------------NLINKIY  295
            DVL++LP K RQ++     +  +          +  M                NL+ ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNATFAEWEKLMRKLNSDASENHFSQVMNLVTRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++KKV  IR+DG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIEKKVRYIRVDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGRKEKMQAEEGDKEK  487



>ref|XP_008761005.1| PREDICTED: LOW QUALITY PROTEIN: DNA annealing helicase and endonuclease 
ZRANB3 isoform X1 [Rattus norvegicus]
Length=1130

 Score =   212 bits (539),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/287 (41%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  228  QIEALFPQRFGTWVEYAKRYCNAHIRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  286

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  287  EVLSQLPPKVRQRIPFDLAPATVKELNASFEEWQKLMRAPDAGAMETVMGLITRMFKQTA  346

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  347  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKARYIRIDGSVPSSERIH  406

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  407  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELFWDPGHIKQAEDRAHRIGQCSS  466

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  467  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  513



>gb|KFP92233.1| DNA annealing helicase and endonuclease ZRANB3, partial [Apaloderma 
vittatum]
Length=733

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 171/291 (59%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +M+RRLK 
Sbjct  193  QIEALFPRRFGTWSEYAKKYCNAHVRFFGKRTQWDCRGASNLEELHQLL-SEIMVRRLKD  251

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMN---------------NLINKIY  295
            DVL++LP K RQ++     +  +          +  M                NL+ ++Y
Sbjct  252  DVLTQLPPKVRQRIPFDLPQAAAKNLNATFAEWEKLMRKLNSDASENHFSQVMNLVTRMY  311

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++KKV  IR+DG  P+A
Sbjct  312  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIEKKVRYIRVDGSVPSA  371

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  372  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  431

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  432  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGRKEKMQAEEGDKEK  482



>ref|XP_004318169.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3-like, 
partial [Tursiops truncatus]
Length=453

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/287 (40%), Positives = 167/287 (58%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  141  QIEALFPQKFGTWTEYAKRYCNAHVRYFGKRPQWDCRGASNLNELHQLL-SDIMIRRLKA  199

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNN-----------LINKIYVASA  307
            +VL++LP K RQ++        + +     E  +  M             L  +++  +A
Sbjct  200  EVLTQLPPKIRQRIPFDLPAAAAKELNSSFEEWEKLMRTPNSGATQTVVGLFTRMFKQTA  259

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  ++  D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  260  IAKAGAVKDYIKMMLRNDLLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  319

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  320  LVNQFQKDPETRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  379

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  380  VNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKLKAEEGDKEK  426



>gb|KFP27776.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like 1, partial [Colius striatus]
Length=549

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/263 (45%), Positives = 162/263 (62%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYC--KGGIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ P  +   H +G RYC  +   +G  Y G+SN  EL  L++ ++MIRRLK DVL 
Sbjct  207  QIAAVQPAFFPQFHSFGLRYCDARKMPWGWDYSGSSNLTELKILLEESIMIRRLKSDVLL  266

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A   K       +K          Y  +A+ KI S
Sbjct  267  QLPAKQRKMVVVAPEGISAKTKAALAAETKKMAKGYESKQQQKEALLLFYNRTAEAKIHS  326

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+ + KFL+FAHH  M+DAI + L KK VG IRIDG TP+A RQ+L   FQ
Sbjct  327  VIEYILELLESGNDKFLVFAHHKIMLDAIVEELEKKCVGYIRIDGSTPSAERQSLCQKFQ  386

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVNI+YL
Sbjct  387  LSEKQTVAVLSLTAANMGLTLSAADLVVFAELSWNPGILIQAEDRAHRIGQTSSVNIHYL  446

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K++ LG+
Sbjct  447  VAKGTADDYLWPMIQEKIKVLGE  469



>gb|KFZ60733.1| DNA annealing helicase and endonuclease ZRANB3, partial [Podiceps 
cristatus]
Length=799

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 175/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  194  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  252

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  253  DVLTQLPPKVRQRIPFDLPQATAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  312

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++K+V  IRIDG  P+A
Sbjct  313  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIEKQVRYIRIDGSVPSA  372

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  373  ERIHLVNKFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  432

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  433  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  483



>ref|XP_010197541.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1, partial [Colius 
striatus]
Length=560

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/263 (45%), Positives = 162/263 (62%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYC--KGGIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ P  +   H +G RYC  +   +G  Y G+SN  EL  L++ ++MIRRLK DVL 
Sbjct  208  QIAAVQPAFFPQFHSFGLRYCDARKMPWGWDYSGSSNLTELKILLEESIMIRRLKSDVLL  267

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A   K       +K          Y  +A+ KI S
Sbjct  268  QLPAKQRKMVVVAPEGISAKTKAALAAETKKMAKGYESKQQQKEALLLFYNRTAEAKIHS  327

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+ + KFL+FAHH  M+DAI + L KK VG IRIDG TP+A RQ+L   FQ
Sbjct  328  VIEYILELLESGNDKFLVFAHHKIMLDAIVEELEKKCVGYIRIDGSTPSAERQSLCQKFQ  387

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVNI+YL
Sbjct  388  LSEKQTVAVLSLTAANMGLTLSAADLVVFAELSWNPGILIQAEDRAHRIGQTSSVNIHYL  447

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K++ LG+
Sbjct  448  VAKGTADDYLWPMIQEKIKVLGE  470



>ref|XP_007098896.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Panthera 
tigris altaica]
Length=1069

 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 170/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGV-----YQGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG      Y+GASN  ELH+L+ + +MIRRLK 
Sbjct  202  QIEALFPQKFGTWTEYAKRYCNAHVRFFGKRPQWDYRGASNLSELHHLL-SDIMIRRLKT  260

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            DVL++LP K RQ++                +      +        T+  LI +++  +A
Sbjct  261  DVLTQLPPKVRQRIPFDLPSAAAKELNTSFEEWEKLMRAPNSGATETVMGLITRMFKQTA  320

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  321  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  380

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  381  LVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIGQCSS  440

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  441  VNIHYLVANGTLDTLMWGMLNRKTQVTGSTLNGRKEQLQAEEGDKEK  487



>gb|KFV53947.1| DNA annealing helicase and endonuclease ZRANB3, partial [Gavia 
stellata]
Length=1050

 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 121/291 (42%), Positives = 175/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  142  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  200

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  201  DVLTQLPPKVRQRIPFDLPQATAKNLNTTFAEWEKLMRNLNADATESHFSQVMNLITRMY  260

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++KKV  IRIDG  P+A
Sbjct  261  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIEKKVRYIRIDGSVPSA  320

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  321  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  380

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  381  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  431



>ref|XP_005647940.1| P-loop containing nucleoside triphosphate hydrolase protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE23396.1| P-loop containing nucleoside triphosphate hydrolase protein [Coccomyxa 
subellipsoidea C-169]
Length=645

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 120/279 (43%), Positives = 171/279 (61%), Gaps = 30/279 (11%)
 Frame = +2

Query  5    LEALYPDVYKNVHEYGNRYC-------KGGIF--GVYQGASNHEELHNLMKATVMIRRLK  157
            ++ L P    +  ++G RYC       +G  F    Y GA+  EEL++++ + +MIRRLK
Sbjct  363  IDCLLPASKVSFTKFGERYCLTQNHFPRGQSFYSNKYDGATETEELYHVLTSCIMIRRLK  422

Query  158  KDVLSELPVKRR------------QQLEVVkskikssqskeeaeslkLTMNNL-------  280
            KDVLS+LP KRR            +QLE ++ +I + ++   A     ++++        
Sbjct  423  KDVLSQLPPKRRTQVFLQLDAEAKKQLEAMQKEIGAVKAAVAAAKTDASLDSFGGGTVKR  482

Query  281  -INKIYVASAKGKISSVLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRID  454
             I  +Y  +AK K+ +V +YL  ++E  D K L+FAHH +M+D I   + K K   +RID
Sbjct  483  TILDLYYRNAKLKVKAVQEYLKELLETTDQKLLVFAHHKDMLDGIEFIMNKTKQRYMRID  542

Query  455  GGTPAASRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAED  634
            G    ++R  LV DFQ    I+AAVLSI+A G GLTLT AS V+FAE  WTPGDL+QAED
Sbjct  543  GSVKTSARADLVNDFQNNRDIRAAVLSIQAAGTGLTLTGASVVVFAEYTWTPGDLVQAED  602

Query  635  RAHRIGQVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQ  751
            RAHRIGQ +SVNIY L A  +VDD+IW  +++KLE++GQ
Sbjct  603  RAHRIGQATSVNIYMLHARGSVDDVIWAKLQSKLEHVGQ  641



>ref|XP_009810905.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Gavia 
stellata]
Length=1050

 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 121/291 (42%), Positives = 175/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  141  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  199

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  200  DVLTQLPPKVRQRIPFDLPQATAKNLNTTFAEWEKLMRNLNADATESHFSQVMNLITRMY  259

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++KKV  IRIDG  P+A
Sbjct  260  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIEKKVRYIRIDGSVPSA  319

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  320  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  379

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  380  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  430



>ref|XP_005315903.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Ictidomys 
tridecemlineatus]
Length=1066

 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/287 (41%), Positives = 169/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGV-----YQGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    +Y  RYC   I  FG      Y+GASN +ELH+L+   +MIRRLK 
Sbjct  201  QIEALFPQKFGTWTDYAKRYCNARIRYFGKRPQWDYRGASNLKELHHLLN-DIMIRRLKT  259

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNN-----------LINKIYVASA  307
            +VL++LP K RQ +        +       E  K  M +           LI +I+  +A
Sbjct  260  EVLTQLPPKIRQHIPFDLPDKAAKDLNTSLEEWKRLMRSPNPGGTETVLGLITRIFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMILQNDSLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ     + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQNDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            V I+YL+AN T+D ++W ++  K+   G  L+G+++ L+  ED+  K
Sbjct  440  VTIHYLIANGTLDTLMWGMLNRKVRVTGSTLNGRQEQLQAEEDDKEK  486



>ref|XP_010144240.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1, partial [Buceros 
rhinoceros silvestris]
Length=488

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 117/263 (44%), Positives = 162/263 (62%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYC--KGGIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ P  +   H +G RYC  +   +G  Y G+SN  EL  L++ ++MIRRLK DVLS
Sbjct  40   QIAAVQPSFFPQFHSFGLRYCDARKMPWGWDYSGSSNLTELKILLEESIMIRRLKSDVLS  99

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A   K+      +K          Y  +A+ KI S
Sbjct  100  QLPAKQRKMVVVAPEGISAKTKAVLAAEAKMMAKGYKSKQQEKEALLLFYNKTAEAKIRS  159

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+ + KFL+FAHH  ++DAI   L KK V  IRIDG TP+A RQ+L   FQ
Sbjct  160  VVEYILELLESGNRKFLVFAHHKIVLDAIAAELEKKHVEYIRIDGSTPSAERQSLCQKFQ  219

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVNI+YL
Sbjct  220  FSEKQVVAVLSLTAANMGLTLSAADLVVFAELFWNPGILIQAEDRAHRIGQTSSVNIHYL  279

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K++ LG+
Sbjct  280  VAQGTADDYLWPMIQEKIKVLGE  302



>dbj|GAM25136.1| hypothetical protein SAMD00019534_083110, partial [Acytostelium 
subglobosum LB1]
Length=943

 Score =   209 bits (532),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 115/273 (42%), Positives = 160/273 (59%), Gaps = 15/273 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKG--GIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            QL AL   +Y N++E+G R+C    G +G  Y G S+  ELH L++  +MIRRLK +VL 
Sbjct  483  QLVALESPIYANINEFGQRFCNAFKGRYGWDYTGNSHLPELHVLLRG-IMIRRLKDNVLK  541

Query  173  ELPVKRRQQLEVVksk----ikssqskeeaeslkLTMNNLIN-------KIYVASAKGKI  319
            ELP K R Q+ +                  +   ++   L++        +Y  + + K+
Sbjct  542  ELPPKHRMQITIDVPLNMRGTLKEVFSSNHKRSMISNGKLVDTERSKMLSLYQETGRAKL  601

Query  320  SSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDF  499
                DY+  +I+   KFLIFAHH E++D + + +     G +RIDG TP ++RQ+ V  F
Sbjct  602  PGAQDYITKLIKEKKKFLIFAHHSEVLDGLEKAIQATDAGYMRIDGSTPPSNRQSHVLRF  661

Query  500  QEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYY  679
            Q     + A+LSI A G GLTLTA+S V+F EL WTPG L QAEDR HRIGQ   VNI+Y
Sbjct  662  QNSDKCQVALLSITAAGTGLTLTASSLVVFVELYWTPGVLRQAEDRVHRIGQKDEVNIHY  721

Query  680  LLANDTVDDIIWDVVKNKLENLGQMLDGQEKSL  778
            L+  +T+DD IW  + NKLE LG+ LDGQE+ L
Sbjct  722  LIGKNTLDDKIWPTICNKLEVLGETLDGQEEIL  754



>gb|KFQ85414.1| DNA annealing helicase and endonuclease ZRANB3, partial [Phoenicopterus 
ruber ruber]
Length=799

 Score =   209 bits (531),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  193  QIEALFPRRFGTWSEYAKKYCNAHVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  251

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  252  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  311

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  312  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  371

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  372  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  431

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  432  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  482



>ref|XP_006529476.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X6 [Mus musculus]
Length=1056

 Score =   210 bits (534),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  141  QIEALFPQKFGTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  199

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  200  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITRMFKQTA  259

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  260  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRYIRIDGSVPSSERIH  319

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  320  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  379

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  380  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  426



>gb|AAI17923.1| Zinc finger, RAN-binding domain containing 3 [Mus musculus]
 gb|AAI17922.1| Zranb3 protein [Mus musculus]
Length=1069

 Score =   210 bits (534),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  201  QIEALFPQKFGTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  259

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  260  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITRMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  440  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  486



>ref|XP_005079935.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Mesocricetus 
auratus]
Length=1065

 Score =   210 bits (534),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 117/287 (41%), Positives = 169/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG  +     GASN  ELH L+ + +MIRRLK 
Sbjct  201  QIEALFPQKFGTWMEYAKRYCNAHIRYFGKRRQWDCRGASNLGELHQLL-SNIMIRRLKS  259

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI  ++  +A
Sbjct  260  EVLSQLPPKVRQRIPFDLPPVAVKELNASFEEWQKLMRAPNSGAMETVMGLITCMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ +  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMLLQNESLKFLVFAHHLSMLQACTEAVIENKARYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+  S + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPSTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  440  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKERLQATEDDKEK  486



>dbj|BAC34042.1| unnamed protein product [Mus musculus]
Length=904

 Score =   209 bits (531),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  36   QIEALFPQKFGTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  94

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  L+ +++  +A
Sbjct  95   EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLMTRMFKQTA  154

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  155  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRYIRIDGSVPSSERIH  214

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  215  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  274

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  275  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  321



>ref|NP_001272874.1| DNA annealing helicase and endonuclease ZRANB3 isoform 2 [Mus 
musculus]
Length=1073

 Score =   210 bits (534),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  205  QIEALFPQKFGTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  263

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  264  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITRMFKQTA  323

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  324  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRYIRIDGSVPSSERIH  383

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  384  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  443

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  444  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  490



>gb|EPZ31756.1| SNF2-related domain-containing protein [Rozella allomycis CSF55]
Length=597

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/252 (44%), Positives = 159/252 (63%), Gaps = 4/252 (2%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKG--GIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            QL+ + P ++KN  +YG RYC      FG  ++GASN  EL  +++   MIRRLK  VLS
Sbjct  256  QLQIIQPALFKNFFDYGARYCAAFKSHFGWNFKGASNVRELQVILENLFMIRRLKDQVLS  315

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMN-NLINKIYVASAKGKISSVLDYLGTV  349
            +LP KRRQQ +                 L+  +N N +   +  +A  K+ S+++Y+  +
Sbjct  316  QLPPKRRQQRKDYPKSQTLESLLNSKNGLESEINDNSLLTSWKETAAAKLPSMINYVEGL  375

Query  350  IEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQEKASIKAAV  529
            +E+  K L+FAHH +++D   + +++KK+  IRIDG T   SR A   +FQ+K  IK A+
Sbjct  376  VESGHKLLLFAHHRDIMDEFEKRIIEKKINYIRIDGSTATNSRFAKCDEFQKKEDIKVAL  435

Query  530  LSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLLANDTVDDI  709
            LSI A  VGLTLT+A+TV+FAEL W PG L+QAEDRA RIGQ  SVN+++LLA  T+DDI
Sbjct  436  LSITAASVGLTLTSATTVVFAELYWNPGVLVQAEDRARRIGQKDSVNVHFLLAKGTLDDI  495

Query  710  IWDVVKNKLENL  745
             W ++  KL+ L
Sbjct  496  FWPLILKKLDIL  507



>ref|XP_009885635.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 [Charadrius 
vociferus]
Length=970

 Score =   209 bits (532),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 160/263 (61%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGV---YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ PD +   H +G RYC          Y G+SN  EL  L+K ++MIRRLK DVLS
Sbjct  620  QIAAVQPDFFPQFHSFGLRYCDARKMPWGWDYSGSSNLTELKILLKESIMIRRLKSDVLS  679

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A+  K       +K          Y  +A+ KI S
Sbjct  680  QLPAKQRKMVVVAPEGISAKTKAVLADEAKKMAKGYDSKQQEKEALLLFYKRTAEAKIHS  739

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+   KFL+FAHH  M+DAI   L KK+V  IRIDG TP+A RQ+L   FQ
Sbjct  740  VVEYILELLESGKDKFLVFAHHKIMLDAIVAELEKKRVEYIRIDGSTPSAERQSLCQKFQ  799

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVN++YL
Sbjct  800  FSEKQIVAVLSLTAANMGLTLSAADLVVFAELFWNPGVLIQAEDRAHRIGQTSSVNVHYL  859

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K+E LG+
Sbjct  860  VARGTADDYLWPMIQEKIEVLGE  882



>ref|XP_002591926.1| hypothetical protein BRAFLDRAFT_184347 [Branchiostoma floridae]
 gb|EEN47937.1| hypothetical protein BRAFLDRAFT_184347 [Branchiostoma floridae]
Length=563

 Score =   205 bits (521),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 160/261 (61%), Gaps = 13/261 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKG---GIFGVYQGASNHEELHNLMKATVMIRRLKKDVLS  172
            QL A+ P ++ + HE+G RYC+G        Y G+ N +EL  +++  VMIRRLKKDVLS
Sbjct  296  QLSAVEPRLFSSFHEFGIRYCEGKQTAFCWDYSGSCNMKELQLVLEERVMIRRLKKDVLS  355

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLIN--------KIYVASAKGKISSV  328
            +LP K+RQ   VV      +     A + ++T  +  N        + +  +A  KI  +
Sbjct  356  QLPAKQRQ--VVVMEPGAVNTKSFNAAANEMTKKHKNNAEQRGALLQYFNETALVKIPHI  413

Query  329  LDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQEK  508
             DY+  ++EAD KFL+FAHH  ++D++   L KK  G IRIDG TP+  RQ L   +Q +
Sbjct  414  KDYVLDLLEADRKFLVFAHHQIVLDSLRDALDKKGYGYIRIDGKTPSDIRQQLCDRYQTQ  473

Query  509  ASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLLA  688
             S + A+LSI A   GLTLTAAS V+F EL W PG L+QAEDRAHRIGQ   VN++YL+A
Sbjct  474  DSCQVALLSITAASTGLTLTAASLVVFTELFWNPGVLVQAEDRAHRIGQQDCVNVHYLVA  533

Query  689  NDTVDDIIWDVVKNKLENLGQ  751
              T DD IW +V+ KL+ L +
Sbjct  534  RGTADDYIWPLVQGKLDVLSK  554



>ref|NP_081954.1| DNA annealing helicase and endonuclease ZRANB3 isoform 1 [Mus 
musculus]
 ref|XP_006529475.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X5 [Mus musculus]
 sp|Q6NZP1.1|ZRAB3_MOUSE RecName: Full=DNA annealing helicase and endonuclease ZRANB3; 
AltName: Full=Annealing helicase 2; Short=AH2; AltName: Full=Zinc 
finger Ran-binding domain-containing protein 3; Includes: 
RecName: Full=DNA annealing helicase ZRANB3; Includes: 
RecName: Full=Endonuclease ZRANB3 [Mus musculus]
 gb|AAH66035.1| Zinc finger, RAN-binding domain containing 3 [Mus musculus]
Length=1069

 Score =   210 bits (534),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  201  QIEALFPQKFGTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  259

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  260  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITRMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  440  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  486



>gb|EDL39757.1| mCG13937, isoform CRA_a [Mus musculus]
Length=1073

 Score =   210 bits (534),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  205  QIEALFPQKFGTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  263

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  264  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITRMFKQTA  323

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  324  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRYIRIDGSVPSSERIH  383

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  384  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  443

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  444  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  490



>gb|KFP19053.1| DNA annealing helicase and endonuclease ZRANB3, partial [Egretta 
garzetta]
Length=1100

 Score =   210 bits (534),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/291 (40%), Positives = 171/291 (59%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  193  QMEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  251

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNN---------------LINKIY  295
            DVL++LP K RQ++     +  +          +  M N               LI ++Y
Sbjct  252  DVLTQLPPKVRQRIPFDLPQAAAKNLNATFAEWEKLMRNLNSDATESHFSQVMSLITRMY  311

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K+ +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  312  KETAIAKVRAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  371

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  372  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  431

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  432  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  482



>ref|XP_006529472.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X2 [Mus musculus]
 ref|XP_006529473.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X3 [Mus musculus]
 ref|XP_006529474.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X4 [Mus musculus]
Length=1116

 Score =   210 bits (534),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  201  QIEALFPQKFGTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  259

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  260  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITRMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  440  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  486



>gb|EDL39758.1| mCG13937, isoform CRA_b [Mus musculus]
Length=1097

 Score =   210 bits (534),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  229  QIEALFPQKFGTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  287

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  288  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITRMFKQTA  347

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  348  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRYIRIDGSVPSSERIH  407

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  408  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  467

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  468  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  514



>ref|XP_006529471.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X1 [Mus musculus]
Length=1120

 Score =   210 bits (534),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  205  QIEALFPQKFGTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  263

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  264  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITRMFKQTA  323

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  324  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRYIRIDGSVPSSERIH  383

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  384  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  443

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  444  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  490



>ref|XP_003887429.1| Snf2/Rad54-like helicase [Encephalitozoon hellem ATCC 50504]
 gb|AFM98448.1| Snf2/Rad54-like helicase [Encephalitozoon hellem ATCC 50504]
Length=559

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/258 (44%), Positives = 161/258 (62%), Gaps = 16/258 (6%)
 Frame = +2

Query  14   LYP-------DVYKNVHEYGNRYCKG---GIFGVYQGASNHEELHNLMKATVMIRRLKKD  163
            LYP        ++    EYG RYC G   G++  Y+G SN EELH ++K  +MIRR K +
Sbjct  275  LYPIIASIDRTIFPRFAEYGARYCNGRKVGLWYDYKGCSNAEELHYVLKKCLMIRRTKDE  334

Query  164  VLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINKIYVASAKGKISSVLDYLG  343
            VLS+LP K R+Q+ +++ + K S  ++E     +  N ++   Y  + K K+  V  YL 
Sbjct  335  VLSQLPPKFRRQV-ILQCEGKQSDPRKEVVGESVDANVVVQ--YKEAVKLKMGPVKQYLA  391

Query  344  TVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQEKASIKA  523
            T++E   KF++F HH EM+D I ++ ++++V  IRIDG  P+ +R  LV DFQE   I+ 
Sbjct  392  TMLEKSMKFVVFCHHSEMMDGIEEFFVERRVPMIRIDGSVPSGNRHPLVRDFQENDEIRV  451

Query  524  AVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLLANDTVD  703
            A+LSI A   GLTLTA   V+FAEL W PG L+QAEDR HRIGQ  SV+I YL+A  T+D
Sbjct  452  ALLSITACSTGLTLTAGRAVVFAELYWNPGVLLQAEDRIHRIGQKGSVDIIYLVARGTID  511

Query  704  DIIWDVVKNK---LENLG  748
            + +W  + +K   LE+LG
Sbjct  512  EYVWPKLLSKLNVLESLG  529



>gb|KFV42065.1| DNA annealing helicase and endonuclease ZRANB3, partial [Tyto 
alba]
Length=1101

 Score =   210 bits (534),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 175/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLKK
Sbjct  193  QIEALFPRRFGTWTEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SKIMIRRLKK  251

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  252  DVLTQLPPKVRQRIPFDLPQTAAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  311

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P++
Sbjct  312  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSS  371

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  372  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  431

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  432  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  482



>ref|XP_009961470.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Tyto 
alba]
Length=1106

 Score =   210 bits (534),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 175/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLKK
Sbjct  198  QIEALFPRRFGTWTEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SKIMIRRLKK  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQTAAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P++
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSS  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  487



>ref|XP_006767207.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3-like, 
partial [Myotis davidii]
Length=510

 Score =   204 bits (518),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 113/287 (39%), Positives = 166/287 (58%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  198  QIEALFPQKFGTWTEYAKRYCNAHVRYFGKRSQWDCRGASNLNELHQLL-SDIMIRRLKT  256

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            DVL++LP K RQ +                +      +        T   LI +++  +A
Sbjct  257  DVLTQLPPKIRQCIPFDLPSAAAKELNASFEEWEKLMRAPNSVATETAMGLITRMFKQTA  316

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   +RIDG  P++ R  
Sbjct  317  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLLMLQACTEAVIENKTRYVRIDGSVPSSERIH  376

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  377  LVNQFQKDPETRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIGQCSS  436

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K++  G  L+G+++ L+  E    K
Sbjct  437  VNIHYLIANGTLDTLMWGMLNRKVQVTGSTLNGRKERLQAEEGEKEK  483



>ref|XP_009950024.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3, partial 
[Leptosomus discolor]
Length=989

 Score =   209 bits (531),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  81   QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  139

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  140  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLSSDATESHFSQVMNLITRMY  199

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  200  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  259

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  260  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  319

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  320  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  370



>gb|KFP95795.1| DNA annealing helicase and endonuclease ZRANB3, partial [Leptosomus 
discolor]
Length=988

 Score =   209 bits (531),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  81   QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  139

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  140  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLSSDATESHFSQVMNLITRMY  199

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  200  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  259

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  260  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  319

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  320  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  370



>ref|XP_009078989.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Acanthisitta 
chloris]
Length=1096

 Score =   209 bits (533),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 116/291 (40%), Positives = 170/291 (58%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EALYP  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  196  QIEALYPRRFGTWSEYAKKYCNARVRFFGKRARWDCRGASNLEELHQLL-SEIMIRRLKN  254

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNN---------------LINKIY  295
            DVL++LP K RQ++     +  +          +  M N               L+ ++Y
Sbjct  255  DVLTQLPPKVRQRIPFDLPQAAAKNLNATFAEWEKLMRNLNSDATESHFSQVMSLVTRMY  314

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  315  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  374

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  375  ERIHLVNQFQKDPETRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  434

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  435  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  485



>ref|XP_010180923.1| PREDICTED: LOW QUALITY PROTEIN: DNA annealing helicase and endonuclease 
ZRANB3 [Mesitornis unicolor]
Length=1102

 Score =   209 bits (533),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 175/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +   +EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWNEYAKKYCNARVRFFGKRTLWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   A+  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNTIFADWEKLMRNLNSDATENRFSQVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHHV M+ A  + +++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHVSMLQACTEAVIETKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGRKEKMQAEEGDKEK  487



>gb|KFQ27087.1| DNA annealing helicase and endonuclease ZRANB3, partial [Mesitornis 
unicolor]
Length=1086

 Score =   209 bits (533),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 175/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +   +EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  193  QIEALFPRRFGTWNEYAKKYCNARVRFFGKRTLWDCRGASNLEELHQLL-SEIMIRRLKN  251

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   A+  KL  N              NLI ++Y
Sbjct  252  DVLTQLPPKVRQRIPFDLPQAAAKNLNTIFADWEKLMRNLNSDATENRFSQVMNLITRMY  311

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHHV M+ A  + +++ KV  IRIDG  P+A
Sbjct  312  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHVSMLQACTEAVIETKVRYIRIDGSVPSA  371

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  372  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  431

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  432  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGRKEKMQAEEGDKEK  482



>gb|KFU99121.1| DNA annealing helicase and endonuclease ZRANB3, partial [Tauraco 
erythrolophus]
Length=1100

 Score =   209 bits (533),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  193  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTHWDCRGASNLEELHQLL-SEIMIRRLKN  251

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  252  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDSTESHFSQVMNLITRMY  311

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  312  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  371

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  372  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  431

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  432  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEESDKEK  482



>ref|XP_009991049.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Tauraco 
erythrolophus]
Length=1106

 Score =   209 bits (533),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTHWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDSTESHFSQVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEESDKEK  487



>gb|KFP51616.1| DNA annealing helicase and endonuclease ZRANB3, partial [Cathartes 
aura]
Length=987

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  81   QIEALFPRRFGTWSEYAKKYCDARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  139

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  140  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  199

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  200  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  259

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  260  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  319

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  320  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  370



>ref|XP_004589420.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Ochotona 
princeps]
Length=1078

 Score =   209 bits (532),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGV-----YQGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    +Y  RYC   I  +G      Y+GASN  ELH L+ + +MIRRLK 
Sbjct  201  QVEALFPQKFGTWIDYAKRYCNAHIRYYGRRSQWDYRGASNLNELHQLL-SNIMIRRLKS  259

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VL++LP K RQ++                +      K       +++  LI +IY  +A
Sbjct  260  EVLTQLPPKIRQRIPFDLPSASAKELNTSFEEWERLMKSPNSDTPVSLMGLITRIYKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D  +W ++  K    G  L+G+++ L+  E +  K
Sbjct  440  VNIHYLIANGTLDTYMWGILNRKTRVTGSTLNGRKEQLQAEEGDKEK  486



>ref|XP_005154101.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Melopsittacus 
undulatus]
Length=1292

 Score =   210 bits (534),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/291 (42%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  384  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRAQWDCRGASNLEELHQLL-SEIMIRRLKN  442

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  443  DVLTQLPPKVRQRISFDLPQAAAKNLNTTFAEWEKLMRNLNSDTAESHFSEVMNLITRMY  502

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++KKV  IRIDG  P+A
Sbjct  503  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIEKKVRYIRIDGSVPSA  562

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  563  ERTHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  622

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ +   E +  K
Sbjct  623  QCSSVNIHFLIAKGTMDILMWAMLNRKAKVTGSTLNGKKEKMHAEEGDKEK  673



>gb|KFV94445.1| DNA annealing helicase and endonuclease ZRANB3, partial [Fulmarus 
glacialis]
Length=747

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/291 (41%), Positives = 173/291 (59%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  142  QIEALFPRRFGTWSEYAKKYCNAHVRFFGKRTLWDCRGASNLEELHQLL-SEIMIRRLKN  200

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  201  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  260

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+ 
Sbjct  261  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSV  320

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  321  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  380

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  381  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  431



>ref|XP_009894153.1| PREDICTED: LOW QUALITY PROTEIN: DNA annealing helicase and endonuclease 
ZRANB3 [Charadrius vociferus]
Length=1109

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIESKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  487



>ref|XP_010297831.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Balearica 
regulorum gibbericeps]
Length=1106

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRIQWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  487



>ref|XP_009580734.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3-like, 
partial [Fulmarus glacialis]
Length=751

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 119/291 (41%), Positives = 173/291 (59%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  147  QIEALFPRRFGTWSEYAKKYCNAHVRFFGKRTLWDCRGASNLEELHQLL-SEIMIRRLKN  205

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  206  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  265

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+ 
Sbjct  266  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSV  325

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  326  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  385

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  386  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  436



>gb|KGL88633.1| DNA annealing helicase and endonuclease ZRANB3, partial [Charadrius 
vociferus]
Length=1094

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  193  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  251

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  252  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  311

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  312  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIESKVRYIRIDGSVPSA  371

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  372  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  431

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  432  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  482



>gb|KFO06924.1| DNA annealing helicase and endonuclease ZRANB3, partial [Balearica 
regulorum gibbericeps]
Length=1100

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  193  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRIQWDCRGASNLEELHQLL-SEIMIRRLKN  251

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  252  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  311

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  312  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  371

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  372  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  431

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  432  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  482



>ref|XP_003794425.1| PREDICTED: zinc finger Ran-binding domain-containing protein 
3 [Otolemur garnettii]
Length=1077

 Score =   208 bits (530),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/287 (40%), Positives = 171/287 (60%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  + + ++Y  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  201  QIEALFPQKFGSWNDYAKRYCNAHIRYFGKRPQWDCRGASNLNELHQLL-SDIMIRRLKT  259

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VL++LP K RQ++                +      +        T+  LI +I+  +A
Sbjct  260  EVLTQLPPKIRQRIPFDLLPAAAKELNTSLEEWEKLMRGPNSGATETVMGLITRIFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIQ  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D+++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  440  VNIHYLIANGTLDNLMWGMLNRKAQVTGSTLNGRKEKIQAEESDKEK  486



>ref|XP_007614497.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X3 [Cricetulus griseus]
Length=967

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 169/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG  +     GASN  ELH L+ + +MIRRLK 
Sbjct  99   QIEALFPQKFGTWIEYAKRYCNAHIRYFGKRRQWDCRGASNLGELHQLL-SDIMIRRLKS  157

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI  ++  +A
Sbjct  158  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITCMFKQTA  217

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ +  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  218  IAKAGAVKDYIKMLLQNESLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  277

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+  + + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  278  LVNQFQKDPNTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  337

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  338  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKERLQATEDDKEK  384



>ref|XP_001457052.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK89655.1| unnamed protein product [Paramecium tetraurelia]
Length=767

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/291 (37%), Positives = 175/291 (60%), Gaps = 29/291 (10%)
 Frame = +2

Query  5    LEALYPDVYKNVHEYGNRYCKGGIF----GV-YQGASNHEELHNLMKATVMIRRLKKDVL  169
            L  + PD++ N  E+G RYC   +     G+ + GASN +EL+ L++  +MIRR KKDVL
Sbjct  292  LNIIRPDIFGNFKEFGYRYCDPKLSRFTKGIDFDGASNLKELYFLLRNYIMIRRQKKDVL  351

Query  170  SELPVKRRQQLEV------------------------VkskikssqskeeaeslkLTMNN  277
            S+LP KRR ++ +                        + +K    Q +++     LT+N+
Sbjct  352  SQLPEKRRVKVRIPGETSQVKQIGALLNQLGNIDIQQLINKDTIFQEQKDQSEQLLTINS  411

Query  278  LINKIYVASAKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDG  457
            ++ K Y+ + + KI ++ DY+ T+ E + KFL FAHH +++DA+ +Y ++ ++  +RIDG
Sbjct  412  ILQKCYMLTGQAKIKAIKDYICTLFENEIKFLFFAHHQDVLDAVQEYCVQNEIQYMRIDG  471

Query  458  GTPAASRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDR  637
                  R   V  FQ    I+ A+LS+ +   G+TLTAAST++F E+ WTP  ++QAEDR
Sbjct  472  NVGVEQRHLNVQMFQNNDEIRIAILSVTSANYGITLTAASTIVFGEMHWTPAIMLQAEDR  531

Query  638  AHRIGQVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLE  790
            AHRIGQV  V+ +YL+ + T+DD I++ ++NK+  +   +DGQ+++L  LE
Sbjct  532  AHRIGQVQCVDCHYLIGDGTLDDHIFNKIENKMNTVSNFIDGQKQNLGALE  582



>gb|KFZ65335.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like 1, partial [Podiceps cristatus]
Length=445

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 160/263 (61%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYC--KGGIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ P  +   H +G RYC  +   +G  Y G+SN  EL  L++ ++MIRRLK DVLS
Sbjct  103  QIAAVQPAFFPQFHSFGLRYCDARKMPWGWDYSGSSNLTELKILLEESIMIRRLKSDVLS  162

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A   K       +K          Y  +A+ KI S
Sbjct  163  QLPAKQRKMVVVAPEGISAKTKAVLAAEAKKMAKGYGSKQQEKEALLLFYSRTAEAKIHS  222

Query  326  VLDYLGTVIE-ADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E  + KFL+FAHH  ++DAI   L KK V  IRIDG TP+A RQ+L   FQ
Sbjct  223  VVEYILELLERGNDKFLVFAHHKIVMDAIVAELEKKHVEYIRIDGSTPSAERQSLCQKFQ  282

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVN++YL
Sbjct  283  FSEKQAVAVLSLTAANMGLTLSAADLVVFAELFWNPGILIQAEDRAHRIGQTSSVNVHYL  342

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K++ LG+
Sbjct  343  VAKGTADDYLWPMIQEKIKVLGE  365



>gb|KFW63598.1| DNA annealing helicase and endonuclease ZRANB3, partial [Pygoscelis 
adeliae]
Length=1100

 Score =   208 bits (530),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  193  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  251

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  252  DVLTQLPPKVRQRIPFDLPQAAAKNLNATFAEWEKLMRNLNSDATESHFSQVMNLITRMY  311

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  312  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  371

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  372  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  431

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  432  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  482



>gb|EOB07692.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like protein 1, partial [Anas platyrhynchos]
Length=711

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 162/263 (62%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYC--KGGIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ PD +   H +G RYC  K   +G  Y G+SN  EL  L++ ++MIRRLK DVLS
Sbjct  366  QIAAVQPDFFPQFHTFGLRYCDAKQMPWGWDYSGSSNLAELKILLEESIMIRRLKSDVLS  425

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A   K       NK          Y  +A+ KI S
Sbjct  426  QLPAKQRKMVVVSPEGINAKTKAALAVEAKKMAKGYGNKQQEKEALLLFYNRTAEAKIHS  485

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+   KFL+FAHH  M+DAI + L KK+V  IRIDG T +A RQ+L   FQ
Sbjct  486  VVEYILELLESGKDKFLVFAHHKIMLDAIVEELEKKRVEYIRIDGSTSSAERQSLCQKFQ  545

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVN++YL
Sbjct  546  LSEKQAVAVLSLTAANMGLTLSAADLVVFAELFWNPGVLIQAEDRAHRIGQTSSVNVHYL  605

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K++ LG+
Sbjct  606  VAKGTADDFLWPMIQEKIKVLGE  628



>ref|XP_009317194.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Pygoscelis 
adeliae]
Length=1106

 Score =   208 bits (530),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNATFAEWEKLMRNLNSDATESHFSQVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  487



>ref|XP_006169782.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X2 [Tupaia chinensis]
Length=1076

 Score =   208 bits (530),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    +Y  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  201  QIEALFPQKFGTWSDYAKRYCNAHIRYFGKRPQWDCRGASNLNELHQLL-SDIMIRRLKT  259

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                       +        T+  LI +++  +A
Sbjct  260  EVLSQLPPKIRQRIPFDLPSAAAKELNTSFGEWEKLMRAPHSGATETVMGLITRMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ ++  ED+  K
Sbjct  440  VNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKIQAEEDDKEK  486



>ref|XP_009895086.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Picoides 
pubescens]
Length=1094

 Score =   208 bits (530),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/291 (42%), Positives = 169/291 (58%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L++  +MIRRLK 
Sbjct  197  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLLRE-IMIRRLKN  255

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +        +   AE  KL  N              NLI  +Y
Sbjct  256  DVLTQLPPKVRQRIPFDLPEAAAKKLNATFAEWEKLMRNLNSEATESHFSQVMNLITYMY  315

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  Q +++ KV  IRIDG  P+A
Sbjct  316  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTQAVIESKVRYIRIDGSVPSA  375

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  L   FQ+    + A+LSIKA G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  376  ERIHLANQFQKDPDTRVAILSIKAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  435

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D  +W ++  K    G  L+G+++ ++  E +  K
Sbjct  436  QCSSVNIHFLIAKGTMDTFMWAMLNRKARVTGSTLNGKKEKIQAEEGDKEK  486



>ref|XP_009937028.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Opisthocomus 
hoazin]
Length=1112

 Score =   208 bits (530),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTHWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  487



>gb|EAX11632.1| zinc finger, RAN-binding domain containing 3, isoform CRA_d [Homo 
sapiens]
Length=458

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/287 (39%), Positives = 167/287 (58%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    +Y  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  146  QIEALFPQKFGRWTDYAKRYCNAHIRYFGKRPQWDCRGASNLNELHQLL-SDIMIRRLKT  204

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VL++LP K RQ++                +      +        T+  LI +++  +A
Sbjct  205  EVLTQLPPKVRQRIPFDLPSAAAKELNTSFEEWEKIMRTPNSGAMETVMGLITRMFKQTA  264

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG   ++ R  
Sbjct  265  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVSSSERIH  324

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  325  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  384

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  385  VNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKIQAEEGDKEK  431



>ref|XP_006737813.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Leptonychotes 
weddellii]
Length=994

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  202  QIEALFPQKFGTWTEYAKRYCNAHIRFFGKRPQWDCRGASNLNELHQLL-SDIMIRRLKT  260

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            DVL++LP K RQ++                +      +        T+  LI +++  +A
Sbjct  261  DVLTQLPPKVRQRIPFDLPSAAAKELNTSFEEWEKLMRAPNSGATETVMGLITRMFKQTA  320

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  321  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKARYIRIDGSVPSSERIH  380

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  381  LVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIGQCSS  440

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  441  VNIHYLVANGTLDTLMWGMLNRKTQVTGSTLNGRKEQLQAEEGDKEK  487



>gb|KFR14031.1| DNA annealing helicase and endonuclease ZRANB3, partial [Opisthocomus 
hoazin]
Length=1106

 Score =   208 bits (530),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  193  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTHWDCRGASNLEELHQLL-SEIMIRRLKN  251

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  252  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  311

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  312  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  371

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  372  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  431

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  432  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  482



>ref|XP_005020352.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Anas 
platyrhynchos]
Length=1100

 Score =   208 bits (530),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/291 (40%), Positives = 171/291 (59%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +   +EY  +YC   +  FG       +GASN EELH L++  +MIRRLK 
Sbjct  198  QIEALFPKRFGTWNEYAKKYCNAHLRFFGKRAQWDCRGASNLEELHQLLRE-IMIRRLKN  256

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNNL---------------INKIY  295
            DVL++LP K RQ++     +  +          +  M NL               I ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQATAKNLNATFAEWEKLMRNLNSDANESHFVEVMSLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P++
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSS  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTLDPLMWAMLNRKAKVTGSTLNGKKERMQAEEGDKEK  487



>ref|XP_007614490.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X2 [Cricetulus griseus]
Length=1003

 Score =   207 bits (528),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 169/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG  +     GASN  ELH L+ + +MIRRLK 
Sbjct  135  QIEALFPQKFGTWIEYAKRYCNAHIRYFGKRRQWDCRGASNLGELHQLL-SDIMIRRLKS  193

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI  ++  +A
Sbjct  194  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITCMFKQTA  253

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ +  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  254  IAKAGAVKDYIKMLLQNESLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  313

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+  + + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  314  LVNQFQKDPNTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  373

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  374  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKERLQATEDDKEK  420



>ref|XP_009640775.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Egretta 
garzetta]
Length=1106

 Score =   208 bits (530),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/291 (40%), Positives = 170/291 (58%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  198  QMEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNN---------------LINKIY  295
            DVL++LP K RQ++     +  +          +  M N               LI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNATFAEWEKLMRNLNSDATESHFSQVMSLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  487



>ref|XP_004774319.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X2 [Mustela putorius furo]
Length=1066

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/287 (41%), Positives = 173/287 (60%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  201  QIEALFPQKFGTWTEYAKRYCNAHIRFFGRRPQWDCRGASNLNELHQLL-SNIMIRRLKT  259

Query  161  DVLSELPVKRRQQL--EVVkskikssqskeeaeslkLTMNN---------LINKIYVASA  307
            DVL++LP K RQ++  ++  +  K   +  E     +   N         LI +++  +A
Sbjct  260  DVLTQLPPKVRQRIPFDLPSAAAKELNASFEEWEKLIRAPNSGATEIVMGLITRMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKARYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+V E +  K
Sbjct  440  VNIHYLVANGTLDTLMWGMLNRKTQVTGSTLNGRKEKLQVEEGDKEK  486



>ref|XP_004774318.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X1 [Mustela putorius furo]
Length=1084

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/287 (41%), Positives = 173/287 (60%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  215  QIEALFPQKFGTWTEYAKRYCNAHIRFFGRRPQWDCRGASNLNELHQLL-SNIMIRRLKT  273

Query  161  DVLSELPVKRRQQL--EVVkskikssqskeeaeslkLTMNN---------LINKIYVASA  307
            DVL++LP K RQ++  ++  +  K   +  E     +   N         LI +++  +A
Sbjct  274  DVLTQLPPKVRQRIPFDLPSAAAKELNASFEEWEKLIRAPNSGATEIVMGLITRMFKQTA  333

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  334  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKARYIRIDGSVPSSERIH  393

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  394  LVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIGQCSS  453

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+V E +  K
Sbjct  454  VNIHYLVANGTLDTLMWGMLNRKTQVTGSTLNGRKEKLQVEEGDKEK  500



>ref|XP_007612889.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X4 [Cricetulus griseus]
Length=1009

 Score =   207 bits (528),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 169/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG  +     GASN  ELH L+ + +MIRRLK 
Sbjct  141  QIEALFPQKFGTWIEYAKRYCNAHIRYFGKRRQWDCRGASNLGELHQLL-SDIMIRRLKS  199

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI  ++  +A
Sbjct  200  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITCMFKQTA  259

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ +  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  260  IAKAGAVKDYIKMLLQNESLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  319

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+  + + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  320  LVNQFQKDPNTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  379

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  380  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKERLQATEDDKEK  426



>gb|KFV64518.1| DNA annealing helicase and endonuclease ZRANB3, partial [Picoides 
pubescens]
Length=1083

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 121/291 (42%), Positives = 169/291 (58%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L++  +MIRRLK 
Sbjct  192  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLLRE-IMIRRLKN  250

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +        +   AE  KL  N              NLI  +Y
Sbjct  251  DVLTQLPPKVRQRIPFDLPEAAAKKLNATFAEWEKLMRNLNSEATESHFSQVMNLITYMY  310

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  Q +++ KV  IRIDG  P+A
Sbjct  311  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTQAVIESKVRYIRIDGSVPSA  370

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  L   FQ+    + A+LSIKA G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  371  ERIHLANQFQKDPDTRVAILSIKAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  430

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D  +W ++  K    G  L+G+++ ++  E +  K
Sbjct  431  QCSSVNIHFLIAKGTMDTFMWAMLNRKARVTGSTLNGKKEKIQAEEGDKEK  481



>ref|XP_010152210.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Eurypyga 
helias]
Length=895

 Score =   206 bits (525),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 119/291 (41%), Positives = 173/291 (59%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPEAAAKTLNTTFAEWEKLMRNLNSDANENHFSQVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++  D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLANDKLKFLVFAHHLSMLQACTEAVIETKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  487



>ref|XP_005632005.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X3 [Canis lupus familiaris]
Length=1008

 Score =   207 bits (528),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 169/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  141  QIEALFPQKFGTWTEYAKRYCNAHIRFFGRRPQWDCRGASNLNELHQLL-SDIMIRRLKN  199

Query  161  DVLSELPVKRRQQLEVVkskikssq-----------skeeaeslkLTMNNLINKIYVASA  307
            DVL++LP K RQ++        + +            K        T+  LI +++  +A
Sbjct  200  DVLTQLPPKVRQRIPFDLPSAAAKELNSSFEEWEKLMKAPNSGATKTVMGLITRMFKQTA  259

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  260  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIESKTRYIRIDGSVPSSERIH  319

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  320  LVNQFQKDPDTRVAILSIQAAGQGLTFTAATYVVFAELYWDPGHIKQAEDRAHRIGQCSS  379

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  380  VNIHYLVANGTLDTLMWGMLNRKTQVTGSTLNGRKEQLQAEEGDKEK  426



>ref|XP_007614483.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X4 [Cricetulus griseus]
Length=1009

 Score =   207 bits (528),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 169/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG  +     GASN  ELH L+ + +MIRRLK 
Sbjct  141  QIEALFPQKFGTWIEYAKRYCNAHIRYFGKRRQWDCRGASNLGELHQLL-SDIMIRRLKS  199

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI  ++  +A
Sbjct  200  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITCMFKQTA  259

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ +  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  260  IAKAGAVKDYIKMLLQNESLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  319

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+  + + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  320  LVNQFQKDPNTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  379

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  380  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKERLQATEDDKEK  426



>ref|XP_009483544.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Pelecanus 
crispus]
Length=1106

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/291 (40%), Positives = 170/291 (58%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNNL---------------INKIY  295
            DVL++LP K RQ++     +  +          +  M NL               I ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAVAKNLNTSFAEWEKLMRNLNSDASESHFSQVLNVITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERVHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGRKEKMQAEEGDKEK  487



>gb|KFQ62420.1| DNA annealing helicase and endonuclease ZRANB3, partial [Pelecanus 
crispus]
Length=1100

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/291 (40%), Positives = 170/291 (58%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  193  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  251

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNNL---------------INKIY  295
            DVL++LP K RQ++     +  +          +  M NL               I ++Y
Sbjct  252  DVLTQLPPKVRQRIPFDLPQAVAKNLNTSFAEWEKLMRNLNSDASESHFSQVLNVITRMY  311

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  312  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  371

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  372  ERVHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  431

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  432  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGRKEKMQAEEGDKEK  482



>ref|XP_010017708.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Nestor 
notabilis]
Length=1106

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 173/291 (59%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPGRFGTWSEYAKKYCNARVRFFGKRAQWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRISFDLPRAAAKNLNTTFAEWEKLMRNLNSDSTERHFPEVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++KKV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIEKKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDR HRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRVHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K    G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDILMWAMLNRKARVTGSTLNGKKEKMQAEESDKEK  487



>emb|CDS22513.1| SWI:SNF matrix associated [Echinococcus granulosus]
Length=849

 Score =   206 bits (524),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/268 (43%), Positives = 170/268 (63%), Gaps = 12/268 (4%)
 Frame = +2

Query  2    QLEALYPDVYKN-VHEYGNRYC--KGGIFGV-YQGASNHEELHNLMKATVMIRRLKKDVL  169
            Q+  + P++++   HE+G RYC  K   +G  Y G SN +ELH L++ T+MIRR+K +VL
Sbjct  441  QIIGIRPNLFRGGFHEFGLRYCAAKERTWGWDYSGCSNLQELHILLQETIMIRRVKSEVL  500

Query  170  SELPVKRRQQLEV---VkskikssqskeeaeslkLTMNNL-----INKIYVASAKGKISS  325
             +LP K RQ + +   +  K  + +++       L +N +     + + ++ + + KI +
Sbjct  501  GQLPPKFRQVVILDPDLVKKTPNGKNQRLENLASLDLNGVEKHGEMLRFFMQTCQAKIPA  560

Query  326  VLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQE  505
            V  Y+  ++E D KF+++AHH EM+DAI + +  K +  IRIDG TP+  R+A    FQ 
Sbjct  561  VSQYITDLLEEDRKFILYAHHQEMLDAITRVMESKHIEYIRIDGKTPSEQRRASCERFQN  620

Query  506  KASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLL  685
            +++ + A+LSI     GL LTAA+ V+FAEL W PG L+QAEDRAHRIGQ   VNI+YLL
Sbjct  621  QSACRVALLSITTASTGLNLTAANLVVFAELFWNPGVLVQAEDRAHRIGQQDPVNIHYLL  680

Query  686  ANDTVDDIIWDVVKNKLENLGQMLDGQE  769
            A+ TVDD +W +VKNKLE L Q+   QE
Sbjct  681  ASGTVDDQLWALVKNKLEVLSQVGLNQE  708



>gb|KFP55596.1| DNA annealing helicase and endonuclease ZRANB3, partial [Cariama 
cristata]
Length=1090

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  193  QIEALFPRRFGTWTEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  251

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  252  DVLTQLPPKVRQRIPFDLPQAAAKNLNTIFAEWEKLMRNLNSDATESRFSEVMNLITRMY  311

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  312  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIESKVRYIRIDGSVPSA  371

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  372  ERIHLVNRFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  431

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  432  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  482



>gb|KFO69672.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like 1, partial [Cuculus canorus]
Length=708

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 121/283 (43%), Positives = 168/283 (59%), Gaps = 14/283 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYC--KGGIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ P  +   H +G RYC  K   +G  Y G+SN  EL  L++ ++MIRRLK DVLS
Sbjct  364  QIAAVQPAFFPQFHSFGLRYCDAKKMPWGWDYSGSSNLTELKILLEESIMIRRLKSDVLS  423

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A   K       NK          Y  +A+ KI S
Sbjct  424  QLPAKQRKMVIVAPEGISAKTKAVLAAEAKRMAKGYANKQQEKEALLLFYNRTAEAKIHS  483

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+ + KFL+FAHH  M+DA+   L KK V  IRIDG TP+A RQ+L   FQ
Sbjct  484  VVEYVLELLESGNNKFLVFAHHKIMLDAVVAELEKKHVEYIRIDGSTPSADRQSLCQKFQ  543

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   A+LS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVN++YL
Sbjct  544  FSEKKIVAILSLTAANMGLTLSAADLVVFAELFWNPGILIQAEDRAHRIGQTSSVNVHYL  603

Query  683  LANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNKSP  811
            +A  T DD +W +++ K++ LG+     E S     +++N  P
Sbjct  604  VAKGTADDYLWPMIQEKIKVLGEA-GLSETSFSKTAESTNYCP  645



>gb|KFQ54035.1| DNA annealing helicase and endonuclease ZRANB3, partial [Nestor 
notabilis]
Length=1101

 Score =   208 bits (529),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 173/291 (59%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  194  QIEALFPGRFGTWSEYAKKYCNARVRFFGKRAQWDCRGASNLEELHQLL-SEIMIRRLKN  252

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  253  DVLTQLPPKVRQRISFDLPRAAAKNLNTTFAEWEKLMRNLNSDSTERHFPEVMNLITRMY  312

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++KKV  IRIDG  P+A
Sbjct  313  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIEKKVRYIRIDGSVPSA  372

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDR HRIG
Sbjct  373  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRVHRIG  432

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K    G  L+G+++ ++  E +  K
Sbjct  433  QCSSVNIHFLIAKGTMDILMWAMLNRKARVTGSTLNGKKEKMQAEESDKEK  483



>ref|XP_009264666.1| Snf2/Rad54-like helicase [Encephalitozoon romaleae SJ-2008]
 gb|AFN83169.1| Snf2/Rad54-like helicase [Encephalitozoon romaleae SJ-2008]
Length=559

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 162/258 (63%), Gaps = 16/258 (6%)
 Frame = +2

Query  14   LYP-------DVYKNVHEYGNRYCKG---GIFGVYQGASNHEELHNLMKATVMIRRLKKD  163
            LYP        ++    EYG RYC G   G++  Y+G SN EEL+ ++K   MIRR K +
Sbjct  275  LYPIIASIDRTIFPRFAEYGARYCNGRKVGLWYDYKGCSNAEELNYILKKCFMIRRTKDE  334

Query  164  VLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINKIYVASAKGKISSVLDYLG  343
            VL++LP K R+Q+ V++ + K S  ++E     + MN ++   Y  + K K+  V  YL 
Sbjct  335  VLAQLPPKFRRQV-VLQCEGKQSDPRKEVVGESVDMNVVVQ--YREAVKLKMEQVKQYLA  391

Query  344  TVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQEKASIKA  523
            T++E + KF+IF HH EM+D I ++ +++KV  IRIDG  P+ +R  LV +FQE   I+ 
Sbjct  392  TMMEKNMKFVIFCHHSEMMDGIEEFCVERKVPMIRIDGSIPSGNRHLLVKNFQENDEIRV  451

Query  524  AVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLLANDTVD  703
            A+LSI A   GLTLTA   V+FAEL W PG L+QAEDR HRIGQ SSV+I YL+   T+D
Sbjct  452  ALLSITACSTGLTLTAGRAVVFAELYWNPGVLLQAEDRIHRIGQKSSVDIIYLVGRGTID  511

Query  704  DIIWDVVKNK---LENLG  748
            + +W  + +K   LE+LG
Sbjct  512  EYVWPKLLSKLNVLESLG  529



>gb|KFW07403.1| DNA annealing helicase and endonuclease ZRANB3, partial [Eurypyga 
helias]
Length=891

 Score =   206 bits (524),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 119/291 (41%), Positives = 173/291 (59%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  194  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  252

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  253  DVLTQLPPKVRQRIPFDLPEAAAKTLNTTFAEWEKLMRNLNSDANENHFSQVMNLITRMY  312

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++  D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  313  KETAIAKAGAVKDYIKMMLANDKLKFLVFAHHLSMLQACTEAVIETKVRYIRIDGSVPSA  372

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  373  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  432

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  433  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  483



>ref|XP_005632003.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X1 [Canis lupus familiaris]
 ref|XP_005632004.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X2 [Canis lupus familiaris]
Length=1069

 Score =   207 bits (528),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 169/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  202  QIEALFPQKFGTWTEYAKRYCNAHIRFFGRRPQWDCRGASNLNELHQLL-SDIMIRRLKN  260

Query  161  DVLSELPVKRRQQLEVVkskikssq-----------skeeaeslkLTMNNLINKIYVASA  307
            DVL++LP K RQ++        + +            K        T+  LI +++  +A
Sbjct  261  DVLTQLPPKVRQRIPFDLPSAAAKELNSSFEEWEKLMKAPNSGATKTVMGLITRMFKQTA  320

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  321  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIESKTRYIRIDGSVPSSERIH  380

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  381  LVNQFQKDPDTRVAILSIQAAGQGLTFTAATYVVFAELYWDPGHIKQAEDRAHRIGQCSS  440

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  441  VNIHYLVANGTLDTLMWGMLNRKTQVTGSTLNGRKEQLQAEEGDKEK  487



>ref|XP_004403608.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Odobenus 
rosmarus divergens]
Length=1073

 Score =   207 bits (528),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  202  QIEALFPQKFGTWTEYAKRYCNAHIRFFGKRPQWDCRGASNLNELHQLL-SDIMIRRLKT  260

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            DVL++LP K RQ++                +      +        T+  LI +++  +A
Sbjct  261  DVLTQLPPKVRQRIPFDLPSAAAKELNTSFEAWEKLMRAPNSGATETVMGLITRMFKQTA  320

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  321  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKARYIRIDGSVPSSERIH  380

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  381  LVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIGQCSS  440

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  441  VNIHYLVANGTLDTLMWGMLNRKTQVTGSTLNGRKEQLQAEEGDKEK  487



>ref|XP_009702694.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Cariama 
cristata]
Length=1110

 Score =   207 bits (528),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWTEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNTIFAEWEKLMRNLNSDATESRFSEVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIESKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNRFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  487



>gb|KFQ17496.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like 1, partial [Merops nubicus]
Length=709

 Score =   205 bits (521),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 157/263 (60%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGIFGV---YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            QL A+ P  +   H +G RYC          Y G+SN  EL  L++ ++MIRRLK DVLS
Sbjct  364  QLAAVQPAFFPQFHAFGLRYCNARKMPWGWDYSGSSNLTELKVLLEESIMIRRLKSDVLS  423

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A           +K          Y  +A+ KI S
Sbjct  424  QLPAKQRKMVVVAPEGISAKTKAVLAAEAMKMAKGYKSKQQEKEALLIFYSKTAEAKIHS  483

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+ + KFL+FAHH  M+DAI   L KK+   IRIDG TP++ RQ+L   FQ
Sbjct  484  VVEYILELLESGNLKFLVFAHHKIMLDAIVAELEKKRAEYIRIDGSTPSSERQSLCQKFQ  543

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVN++YL
Sbjct  544  LSEKQVVAVLSLTAANMGLTLSAADLVVFAELFWNPGILIQAEDRAHRIGQTSSVNVHYL  603

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K++ LG+
Sbjct  604  VAKGTADDYLWPIIQEKIKVLGE  626



>ref|XP_009460048.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Nipponia 
nippon]
Length=1107

 Score =   207 bits (528),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +   +EY  +YC   +  FG       +GASN E+LH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWNEYAKKYCNARVRFFGKRTHWDCRGASNLEQLHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESQCSQVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFLIFAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLIFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ +   E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMHAEEGDKEK  487



>ref|XP_010195336.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Colius 
striatus]
Length=1106

 Score =   207 bits (528),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/291 (41%), Positives = 173/291 (59%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +M+RRLK 
Sbjct  198  QIEALFPGRFGTWSEYAKKYCNARVRFFGRRTMWDCRGASNLEELHQLL-SEIMVRRLKN  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNATFAEWEKLMRNLNSDATESQFSQVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+ 
Sbjct  317  KETAVAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSV  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERTRLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKSKVTGSTLNGKKEKMQAEEGDKEK  487



>gb|KFQ94444.1| DNA annealing helicase and endonuclease ZRANB3, partial [Nipponia 
nippon]
Length=1102

 Score =   207 bits (528),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +   +EY  +YC   +  FG       +GASN E+LH L+ + +MIRRLK 
Sbjct  194  QIEALFPRRFGTWNEYAKKYCNARVRFFGKRTHWDCRGASNLEQLHQLL-SEIMIRRLKN  252

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  253  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESQCSQVMNLITRMY  312

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFLIFAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  313  KETAIAKAGAVKDYIKMMLENDKLKFLIFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  372

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  373  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  432

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ +   E +  K
Sbjct  433  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMHAEEGDKEK  483



>ref|XP_003497777.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X1 [Cricetulus griseus]
Length=1069

 Score =   207 bits (527),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 169/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG  +     GASN  ELH L+ + +MIRRLK 
Sbjct  201  QIEALFPQKFGTWIEYAKRYCNAHIRYFGKRRQWDCRGASNLGELHQLL-SDIMIRRLKS  259

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI  ++  +A
Sbjct  260  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITCMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ +  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMLLQNESLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+  + + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPNTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  440  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKERLQATEDDKEK  486



>gb|EFB13237.1| hypothetical protein PANDA_009544 [Ailuropoda melanoleuca]
Length=1008

 Score =   207 bits (526),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  141  QIEALFPQKFGTWTEYAKRYCNAHIRFFGKRPQWDCRGASNLNELHQLL-SDIMIRRLKT  199

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            DVL++LP K RQ++                +      +        T+  LI +++  +A
Sbjct  200  DVLTQLPPKVRQRIPFDIPSAAAKELNTSFEEWEKLMRAPNSGATETVMGLITRLFKQTA  259

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  260  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKARYIRIDGSVPSSERIH  319

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ +S
Sbjct  320  LVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIGQCTS  379

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  380  VNIHYLVANGTLDTLMWGMLNRKTQVTGSTLNGRKEQLQAEEGDKEK  426



>gb|KFP29765.1| DNA annealing helicase and endonuclease ZRANB3, partial [Colius 
striatus]
Length=1101

 Score =   207 bits (528),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 118/291 (41%), Positives = 173/291 (59%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +M+RRLK 
Sbjct  194  QIEALFPGRFGTWSEYAKKYCNARVRFFGRRTMWDCRGASNLEELHQLL-SEIMVRRLKN  252

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  253  DVLTQLPPKVRQRIPFDLPQAAAKNLNATFAEWEKLMRNLNSDATESQFSQVMNLITRMY  312

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+ 
Sbjct  313  KETAVAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSV  372

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  373  ERTRLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  432

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  433  QCSSVNIHFLIAKGTMDTLMWAMLNRKSKVTGSTLNGKKEKMQAEEGDKEK  483



>ref|XP_742238.1| DNA helicase [Plasmodium chabaudi chabaudi]
 emb|CAH78659.1| DNA helicase, putative [Plasmodium chabaudi chabaudi]
Length=437

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/298 (37%), Positives = 175/298 (59%), Gaps = 36/298 (12%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYC--KGGIFGV---YQGASNHEELHNLMKATVMIRRLKKDV  166
            Q+ ++ P+++ N +E+ +RYC     I+     Y G  + EELH  +  T+MIRRLKKDV
Sbjct  35   QVSSIIPNLF-NYNEFCDRYCYKDKNIYTRKIEYVGCKHTEELHLFLTNTIMIRRLKKDV  93

Query  167  LSELPVKRRQQLEVVkskikssq----skeeaeslkLTMNNL------------------  280
            L ELP K R ++ +   + + S+    +K+      + +N+L                  
Sbjct  94   LKELPDKLRSKIPIEIPQNELSEILLYAKKLESKKNININDLDNISLSRFNDFNSNHDNN  153

Query  281  -------INKIYVASAKGKISSVLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVG  439
                   I++++  +   K+ ++ +Y+  +I+AD KFL+F HH  ++D I ++L +KK+G
Sbjct  154  IDEENITISQLFKMTGYAKVKAIKEYITYLIDADIKFLLFCHHKLVMDEIDEFLKEKKLG  213

Query  440  CIRIDGGTPAASRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDL  619
             IR+DG TP   R+  + +FQ    I+ A+LSI A GVGL LTAA+TV+F EL W PG +
Sbjct  214  FIRVDGLTPIDKREVYIKNFQSDEKIRIAILSITACGVGLNLTAANTVVFGELYWVPGQM  273

Query  620  IQAEDRAHRIGQV-SSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLE  790
            IQAEDRAHRIG    ++NI+YL+A +T+D+++W ++  K   L   L+G E SL V E
Sbjct  274  IQAEDRAHRIGTTHDTINIHYLVAQNTIDEVVWKIINRKWNTLTTALNGAEDSLNVKE  331



>ref|XP_009278152.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Aptenodytes 
forsteri]
Length=1106

 Score =   207 bits (528),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/291 (40%), Positives = 169/291 (58%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMN---------------NLINKIY  295
            DVL++LP K RQ++     +  +          +  M                NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQATAKNLNATFAEWEKLMRSLNSDATESHFSQVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  +  ++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAAIENKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  487



>gb|KFM01088.1| DNA annealing helicase and endonuclease ZRANB3, partial [Aptenodytes 
forsteri]
Length=1100

 Score =   207 bits (527),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 116/291 (40%), Positives = 169/291 (58%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  193  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  251

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMN---------------NLINKIY  295
            DVL++LP K RQ++     +  +          +  M                NLI ++Y
Sbjct  252  DVLTQLPPKVRQRIPFDLPQATAKNLNATFAEWEKLMRSLNSDATESHFSQVMNLITRMY  311

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++E D  KFL+FAHH+ M+ A  +  ++ KV  IRIDG  P+A
Sbjct  312  KETAIAKAGAVKDYIKMMLENDKLKFLVFAHHLSMLQACTEAAIENKVRYIRIDGSVPSA  371

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  372  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  431

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  432  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  482



>ref|XP_002194081.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Taeniopygia 
guttata]
Length=1026

 Score =   207 bits (526),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 171/291 (59%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +   +EY  +YC   +  FG  +     GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWNEYAKKYCDARVRFFGKRRQWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMN---------------NLINKIY  295
            DVL++LP K RQ++     +  +          +  M                NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNATFAEWEKLMRSLSSDASESHFSQVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLDNDKLKFLVFAHHLSMLQACTEAVIESKARYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPETRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E + +K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKDK  487



>ref|XP_008997224.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X3 [Callithrix jacchus]
 ref|XP_008997225.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X3 [Callithrix jacchus]
Length=1076

 Score =   207 bits (527),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 176/287 (61%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  + +  +Y  RYC   I  FG       +GASN +ELH L+ + +MIRRLK 
Sbjct  201  QIEALFPQKFGSWTDYAKRYCNAHIRYFGKRPQWDCRGASNLKELHQLL-SDIMIRRLKT  259

Query  161  DVLSELPVKRRQQL--EVVkskikssqskeeaeslkLTMNN---------LINKIYVASA  307
            +VL++LP K RQ++  ++  +  K   +  E     + M N         LI +++  +A
Sbjct  260  EVLTQLPPKIRQRIPFDLPSAAAKELNTSFEEWKKLMRMPNSGAMETVMGLITRMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K+  IRIDG   ++ R  
Sbjct  320  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKIRYIRIDGSVSSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ ++  ED+  K
Sbjct  440  VNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKIQAEEDDKEK  486



>ref|XP_008581735.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Galeopterus 
variegatus]
Length=1089

 Score =   207 bits (527),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 169/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    +Y  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  215  QIEALFPQKFGTWTDYAKRYCNAHIRYFGKRPQWDCRGASNLYELHQLL-SDIMIRRLKT  273

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VL++LP K RQ++                +      +        T+  LI +++  +A
Sbjct  274  EVLTQLPPKIRQRIPFDLPSAAAKELNTSFEEWEKLMRAPNSGATETVMGLITRMFKQTA  333

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  334  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  393

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+   I+ A+LSI+A G GLT TAAS VIFAEL W PG + QAEDRAHRIGQ SS
Sbjct  394  LVNQFQKDPDIRVAILSIQAAGQGLTFTAASHVIFAELYWDPGHIKQAEDRAHRIGQCSS  453

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  454  VNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEQIQAEESDKEK  500



>gb|KFQ10579.1| DNA annealing helicase and endonuclease ZRANB3, partial [Haliaeetus 
albicilla]
Length=1100

 Score =   207 bits (527),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 119/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  193  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  251

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  252  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESHFSEVMNLITRMY  311

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  312  KETAIAKAGAVKDYIKMMLQNDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  371

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  372  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  431

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  432  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQADEGDKEK  482



>ref|XP_008997222.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X1 [Callithrix jacchus]
Length=1103

 Score =   207 bits (527),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 176/287 (61%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  + +  +Y  RYC   I  FG       +GASN +ELH L+ + +MIRRLK 
Sbjct  228  QIEALFPQKFGSWTDYAKRYCNAHIRYFGKRPQWDCRGASNLKELHQLL-SDIMIRRLKT  286

Query  161  DVLSELPVKRRQQL--EVVkskikssqskeeaeslkLTMNN---------LINKIYVASA  307
            +VL++LP K RQ++  ++  +  K   +  E     + M N         LI +++  +A
Sbjct  287  EVLTQLPPKIRQRIPFDLPSAAAKELNTSFEEWKKLMRMPNSGAMETVMGLITRMFKQTA  346

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K+  IRIDG   ++ R  
Sbjct  347  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKIRYIRIDGSVSSSERIH  406

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  407  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  466

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ ++  ED+  K
Sbjct  467  VNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKIQAEEDDKEK  513



>ref|XP_009925396.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Haliaeetus 
albicilla]
Length=1106

 Score =   207 bits (527),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 119/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESHFSEVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLQNDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQADEGDKEK  487



>ref|XP_010573453.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Haliaeetus 
leucocephalus]
 ref|XP_010573454.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Haliaeetus 
leucocephalus]
Length=1106

 Score =   207 bits (527),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 119/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNTTFAEWEKLMRNLNSDATESHFSEVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLQNDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQADEGDKEK  487



>ref|XP_005010957.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily A-like protein 1 isoform X1 
[Anas platyrhynchos]
Length=974

 Score =   206 bits (524),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 162/263 (62%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYC--KGGIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ PD +   H +G RYC  K   +G  Y G+SN  EL  L++ ++MIRRLK DVLS
Sbjct  622  QIAAVQPDFFPQFHTFGLRYCDAKQMPWGWDYSGSSNLAELKILLEESIMIRRLKSDVLS  681

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A   K       NK          Y  +A+ KI S
Sbjct  682  QLPAKQRKMVVVSPEGINAKTKAALAVEAKKMAKGYGNKQQEKEALLLFYNRTAEAKIHS  741

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+   KFL+FAHH  M+DAI + L KK+V  IRIDG T +A RQ+L   FQ
Sbjct  742  VVEYILELLESGKDKFLVFAHHKIMLDAIVEELEKKRVEYIRIDGSTSSAERQSLCQKFQ  801

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVN++YL
Sbjct  802  LSEKQAVAVLSLTAANMGLTLSAADLVVFAELFWNPGVLIQAEDRAHRIGQTSSVNVHYL  861

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K++ LG+
Sbjct  862  VAKGTADDFLWPMIQEKIKVLGE  884



>emb|CDS35724.1| SWI:SNF matrix associated [Echinococcus multilocularis]
Length=849

 Score =   205 bits (522),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 114/268 (43%), Positives = 170/268 (63%), Gaps = 12/268 (4%)
 Frame = +2

Query  2    QLEALYPDVYKN-VHEYGNRYC--KGGIFGV-YQGASNHEELHNLMKATVMIRRLKKDVL  169
            Q+  + P++++   HE+G RYC  K   +G  Y G SN +ELH L++ T+MIRR+K +VL
Sbjct  441  QIIGIQPNLFRGGFHEFGLRYCAAKERTWGWDYSGCSNLQELHILLQETIMIRRVKSEVL  500

Query  170  SELPVKRRQQLEV---VkskikssqskeeaeslkLTMNNL-----INKIYVASAKGKISS  325
             +LP K RQ + +   +  K  S +++       L +N +     + + ++ + + KI +
Sbjct  501  GQLPPKFRQVVILDPDLVKKTPSGKNQRLENLASLDLNGVEKHGEMLRFFMQTCQAKIPA  560

Query  326  VLDYLGTVIEADCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQE  505
            V  Y+  ++E D KF+++AHH EM+DAI + +  K +  IRIDG TP+  R+A    FQ 
Sbjct  561  VSQYITDLLEEDRKFILYAHHQEMLDAITRVMESKHIEYIRIDGKTPSEQRRASCERFQN  620

Query  506  KASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYLL  685
            +++ + A+LSI     GL LTAA+ V+FAEL W PG L+QAEDRAHRIGQ   VNI+YLL
Sbjct  621  QSACRVALLSITTASTGLNLTAANLVVFAELFWNPGVLVQAEDRAHRIGQQDPVNIHYLL  680

Query  686  ANDTVDDIIWDVVKNKLENLGQMLDGQE  769
            A+ TVDD +W +VKNKL+ L Q+   QE
Sbjct  681  ASGTVDDQLWALVKNKLDVLSQVGLNQE  708



>ref|XP_008694075.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X2 [Ursus maritimus]
Length=1047

 Score =   207 bits (526),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 118/287 (41%), Positives = 172/287 (60%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  201  QIEALFPQKFGTWTEYAKRYCNAHIRFFGKRPQWDCRGASNLNELHQLL-SDIMIRRLKT  259

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkL----------TMNNLINKIYVASA  307
            DVL++LP K RQ++   + S      +    E  KL          T+  LI +++  +A
Sbjct  260  DVLTQLPPKVRQRIPFDIPSAAAKELNTSFEEWEKLIRAPNAGATETVMGLITRLFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKARYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ +S
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIGQCTS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  440  VNIHYLVANGTLDTLMWGMLNRKTQVTGSTLNGRKEQLQAEEGDKEK  486



>ref|XP_008997223.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X2 [Callithrix jacchus]
Length=1101

 Score =   207 bits (526),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 176/287 (61%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  + +  +Y  RYC   I  FG       +GASN +ELH L+ + +MIRRLK 
Sbjct  228  QIEALFPQKFGSWTDYAKRYCNAHIRYFGKRPQWDCRGASNLKELHQLL-SDIMIRRLKT  286

Query  161  DVLSELPVKRRQQL--EVVkskikssqskeeaeslkLTMNN---------LINKIYVASA  307
            +VL++LP K RQ++  ++  +  K   +  E     + M N         LI +++  +A
Sbjct  287  EVLTQLPPKIRQRIPFDLPSAAAKELNTSFEEWKKLMRMPNSGAMETVMGLITRMFKQTA  346

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K+  IRIDG   ++ R  
Sbjct  347  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKIRYIRIDGSVSSSERIH  406

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  407  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  466

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ ++  ED+  K
Sbjct  467  VNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKIQAEEDDKEK  513



>ref|XP_007114337.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Physeter 
catodon]
Length=1019

 Score =   206 bits (525),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 113/287 (39%), Positives = 170/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    +Y  RYC   +  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  146  QIEALFPQKFGTWTDYAKRYCNAHVRYFGKRPQWDCRGASNLNELHQLL-SDIMIRRLKA  204

Query  161  DVLSELPVKRRQQLEVVkskikssq-----------skeeaeslkLTMNNLINKIYVASA  307
            +VL++LP K RQ++        + +            +        T+  LI +++  +A
Sbjct  205  EVLTQLPPKIRQRIPFDLPSAAAKELNSSFEEWEKLMRAPNSGATKTVMGLITRMFKQTA  264

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  265  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  324

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  325  LVNQFQKDPETRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHVKQAEDRAHRIGQCSS  384

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  385  VNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKLQAEEDDKEK  431



>dbj|BAC38978.1| unnamed protein product [Mus musculus]
Length=1069

 Score =   207 bits (526),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 167/287 (58%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG  +     GASN  ELH L+   +MIRRLK 
Sbjct  201  QIEALFPQKFGTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLN-DIMIRRLKS  259

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VLS+LP K RQ++                +      +        T+  LI +++  +A
Sbjct  260  EVLSQLPPKVRQRIPFDLPPAAVKELNASFEEWQKLMRAPNSGAMETVMGLITRMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRI Q SS
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIRQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  440  VNIHYLIANGTLDSLMWAMLNRKAQVTGSTLNGRKEKLQATEDDKEK  486



>ref|XP_008694074.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X1 [Ursus maritimus]
Length=1068

 Score =   207 bits (526),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 118/287 (41%), Positives = 172/287 (60%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  201  QIEALFPQKFGTWTEYAKRYCNAHIRFFGKRPQWDCRGASNLNELHQLL-SDIMIRRLKT  259

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkL----------TMNNLINKIYVASA  307
            DVL++LP K RQ++   + S      +    E  KL          T+  LI +++  +A
Sbjct  260  DVLTQLPPKVRQRIPFDIPSAAAKELNTSFEEWEKLIRAPNAGATETVMGLITRLFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKARYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ +S
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIGQCTS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  440  VNIHYLVANGTLDTLMWGMLNRKTQVTGSTLNGRKEQLQAEEGDKEK  486



>ref|XP_010851958.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X3 [Bison bison bison]
Length=988

 Score =   206 bits (524),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 114/287 (40%), Positives = 170/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  119  QIEALFPQKFGTWTEYAKRYCNAHVRYFGRRSQWDCRGASNLNELHQLL-SDIMIRRLKT  177

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNN-----------LINKIYVASA  307
            +VL++LP K RQ++        + +     E  +  M +           LI +++  +A
Sbjct  178  EVLTQLPPKIRQRIPFDLPSAAAKELNSSFEEWEKLMRDPYSGATETVMGLITRMFKQTA  237

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  238  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  297

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  298  LVNQFQKDPETRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIGQCSS  357

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  358  VNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKLQAEEGDKEK  404



>ref|XP_002920769.1| PREDICTED: zinc finger Ran-binding domain-containing protein 
3-like [Ailuropoda melanoleuca]
Length=1087

 Score =   207 bits (526),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 114/287 (40%), Positives = 168/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  216  QIEALFPQKFGTWTEYAKRYCNAHIRFFGKRPQWDCRGASNLNELHQLL-SDIMIRRLKT  274

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            DVL++LP K RQ++                +      +        T+  LI +++  +A
Sbjct  275  DVLTQLPPKVRQRIPFDIPSAAAKELNTSFEEWEKLMRAPNSGATETVMGLITRLFKQTA  334

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  335  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKARYIRIDGSVPSSERIH  394

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ +S
Sbjct  395  LVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIGQCTS  454

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  455  VNIHYLVANGTLDTLMWGMLNRKTQVTGSTLNGRKEQLQAEEGDKEK  501



>gb|KFQ71424.1| DNA annealing helicase and endonuclease ZRANB3, partial [Phaethon 
lepturus]
Length=1049

 Score =   206 bits (525),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/291 (40%), Positives = 176/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH+L+ + +MIRRLK 
Sbjct  142  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHHLL-SEIMIRRLKN  200

Query  161  DVLSELPVKRRQQL-----EVVkskikssqskeeaeslkLTMN----------NLINKIY  295
            DVL++LP K RQ++     +V    + ++ ++ E     L  +          NLI ++Y
Sbjct  201  DVLTQLPPKVRQRIPFDLPQVAAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  260

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++  D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  261  KETAIAKAGAVKDYIKMMLANDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  320

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  321  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  380

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  381  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  431



>ref|XP_007192110.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Balaenoptera 
acutorostrata scammoni]
Length=1074

 Score =   206 bits (525),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/287 (40%), Positives = 170/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    +Y  RYC   +  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  201  QIEALFPQKFGTWTDYAKRYCNAHVRYFGKRPQWDCRGASNLNELHQLL-SDIMIRRLKA  259

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaes-----------lkLTMNNLINKIYVASA  307
            +VL++LP K RQ++        + +     E               T+  LI +++  +A
Sbjct  260  EVLTQLPPKIRQRIPFDLPSAAAKELNSSFEEWEKLMRAPNSGATKTVMGLITRMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPETRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  ED+  K
Sbjct  440  VNIHYLIANGTLDTLMWGMLTRKAQVTGSTLNGRKEKLQAEEDDKEK  486



>ref|XP_005202599.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform 
X2 [Bos taurus]
Length=988

 Score =   206 bits (523),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/287 (40%), Positives = 170/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  RYC   +  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  119  QIEALFPQKFGTWTEYAKRYCNAHVRYFGRRSQWDCRGASNLNELHQLL-SDIMIRRLKT  177

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMNN-----------LINKIYVASA  307
            +VL++LP K RQ++        + +     E  +  M +           LI +++  +A
Sbjct  178  EVLTQLPPKIRQRIPFDLPSAAAKELNSSFEEWEKLMRDPYSGATETVMGLITRMFKQTA  237

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  238  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIH  297

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  298  LVNQFQKDPETRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIGQCSS  357

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  358  VNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKLQAEEGDKEK  404



>ref|XP_005415794.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Geospiza 
fortis]
Length=1094

 Score =   206 bits (525),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 171/291 (59%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVYQ-----GASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +   +EY  +YC   +  FG  +     GASN EELH L+ + +MIRRLK 
Sbjct  198  QIEALFPRRFGTWNEYAKKYCDARVRFFGKRRQWDCRGASNLEELHQLL-SEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEVVkskikssqskeeaeslkLTMN---------------NLINKIY  295
            DVL++LP K RQ++     +  +          +  M                NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNATFAEWEKLMRSLRSDATDSHFSQVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLDNDKLKFLVFAHHLSMLQACTEAVIESKARYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPETRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E + +K
Sbjct  437  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKDK  487



>ref|XP_010280723.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3, partial 
[Phaethon lepturus]
Length=1055

 Score =   206 bits (525),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/291 (40%), Positives = 176/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    EY  +YC   +  FG       +GASN EELH+L+ + +MIRRLK 
Sbjct  147  QIEALFPRRFGTWSEYAKKYCNARVRFFGKRTQWDCRGASNLEELHHLL-SEIMIRRLKN  205

Query  161  DVLSELPVKRRQQL-----EVVkskikssqskeeaeslkLTMN----------NLINKIY  295
            DVL++LP K RQ++     +V    + ++ ++ E     L  +          NLI ++Y
Sbjct  206  DVLTQLPPKVRQRIPFDLPQVAAKNLNTTFAEWEKLMRNLNSDATESHFSQVMNLITRMY  265

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  ++  D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  266  KETAIAKAGAVKDYIKMMLANDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  325

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  326  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  385

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVNI++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  386  QCSSVNIHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  436



>gb|KFR00747.1| SWI/SNF-related matrix-associated actin-dependent regulator of 
chromatin subfamily A-like 1, partial [Opisthocomus hoazin]
Length=705

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 163/263 (62%), Gaps = 13/263 (5%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYC--KGGIFGV-YQGASNHEELHNLMKATVMIRRLKKDVLS  172
            Q+ A+ P  +   H +G RYC  +   +G  Y G+SN  EL  L++ ++MIRRLK DVLS
Sbjct  364  QIAAVQPAFFPQFHSFGLRYCDARKMPWGWDYSGSSNLTELKILLEESIMIRRLKSDVLS  423

Query  173  ELPVKRRQQLEVVkskikssqskeeaeslkLTMNNLINK---------IYVASAKGKISS  325
            +LP K+R+ + V    I +      A   K       +K          Y  +A+ KI S
Sbjct  424  QLPAKQRKMVVVAPEGISAKTKAVLAAEAKKMTKGYGSKQQEKEALLLFYSRTAEAKIHS  483

Query  326  VLDYLGTVIEA-DCKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQALVTDFQ  502
            V++Y+  ++E+ + KFL+FAHH+ ++DAI   L KK+V  IRIDG TP+A RQ+L   FQ
Sbjct  484  VVEYILELLESGNDKFLVFAHHMIVLDAIVAELEKKRVEYIRIDGSTPSAERQSLCQKFQ  543

Query  503  EKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSVNIYYL  682
                   AVLS+ A  +GLTL+AA  V+FAEL W PG LIQAEDRAHRIGQ SSVN++YL
Sbjct  544  VSEKQVVAVLSLTAANMGLTLSAADLVVFAELFWNPGVLIQAEDRAHRIGQTSSVNVHYL  603

Query  683  LANDTVDDIIWDVVKNKLENLGQ  751
            +A  T DD +W +++ K++ LG+
Sbjct  604  VAKGTADDYLWPMIQEKIKVLGE  626



>ref|XP_004668214.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Jaculus 
jaculus]
Length=1067

 Score =   206 bits (525),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 169/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    +Y  RYC   I  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  201  QIEALFPQKFGTWTDYAKRYCNAHIRYFGKRTQWDCRGASNLNELHQLL-SDIMIRRLKT  259

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VL++LP K RQ++                +      +    S   T+  LI +++  +A
Sbjct  260  EVLTQLPPKIRQRIPFDLPSAAAKELNTSFEEWQKLMRAPNSSTTNTVMELITRMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLTMLQACTEAVIENKTRYIRIDGSVPSSERIH  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  440  VNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKLQAEEGDKEK  486



>ref|XP_008256740.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Oryctolagus 
cuniculus]
Length=1075

 Score =   206 bits (525),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/287 (40%), Positives = 169/287 (59%), Gaps = 20/287 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    +Y  RYC   +  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  201  QIEALFPQKFGTWTDYAKRYCNAHVRYFGKRSQWDCRGASNLNELHQLL-SDIMIRRLKT  259

Query  161  DVLSELPVKRRQQLEV-----------VkskikssqskeeaeslkLTMNNLINKIYVASA  307
            +VL++LP K RQ++                +      K       +T+  LI +++  +A
Sbjct  260  EVLTQLPPKIRQRIPFDLPSAAAKELNASFEEWEKLMKSPNSDATVTVMGLITRMFKQTA  319

Query  308  KGKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQA  484
              K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  
Sbjct  320  IAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVPSSERIR  379

Query  485  LVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSS  664
            LV  FQ+    + A+LSI+A G GLT TAAS V+FAEL W PG + QAEDRAHRIGQ SS
Sbjct  380  LVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSS  439

Query  665  VNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            VNI+YL+AN T+D ++W ++  K +  G  L+G+++ L+  E +  K
Sbjct  440  VNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKERLQAEEGDKEK  486



>ref|XP_004616564.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Sorex 
araneus]
Length=1074

 Score =   206 bits (524),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/286 (40%), Positives = 173/286 (60%), Gaps = 19/286 (7%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +    +Y  RYC   +  FG       +GASN  ELH L+ + +MIRRLK 
Sbjct  200  QIEALFPQKFGKWTDYAKRYCNAHVRYFGKRSRWDCRGASNLNELHQLL-SDIMIRRLKT  258

Query  161  DVLSELPVKRRQQL----------EVVkskikssqskeeaeslkLTMNNLINKIYVASAK  310
            +VL++LP K RQ++          E+  S  +  +      S   T+  LI +++  +A 
Sbjct  259  EVLTQLPPKIRQRIPFDVPAAAAKELNSSFEEWEKLMRAPSSAAETIMGLITRMFKQTAI  318

Query  311  GKISSVLDYLGTVIEADC-KFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAASRQAL  487
             K  +V DY+  +++ +  KFL+FAHH+ M+ A  + +++ K   IRIDG  P++ R  L
Sbjct  319  AKAGAVKDYIKMMLQNETLKFLVFAHHLSMLQACTEAVVENKTRYIRIDGSVPSSERIHL  378

Query  488  VTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIGQVSSV  667
            V  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIGQ SSV
Sbjct  379  VNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHITQAEDRAHRIGQCSSV  438

Query  668  NIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            NI+YL+AN T+D ++W ++  K    G+ L+G+++ ++  ED+  K
Sbjct  439  NIHYLIANGTLDTLMWGMLNRKTLVTGRTLNGRKEQIQAKEDDKGK  484



>ref|XP_005509003.1| PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Columba 
livia]
Length=1105

 Score =   206 bits (525),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/291 (41%), Positives = 174/291 (60%), Gaps = 24/291 (8%)
 Frame = +2

Query  2    QLEALYPDVYKNVHEYGNRYCKGGI--FGVY-----QGASNHEELHNLMKATVMIRRLKK  160
            Q+EAL+P  +   +EY  +YC   +  FG       +GASN EELH L+   +MIRRLK 
Sbjct  198  QIEALFPRRFGTWNEYAKKYCNAHVRFFGKRTQWDCRGASNLEELHQLL-GEIMIRRLKN  256

Query  161  DVLSELPVKRRQQLEV-VkskikssqskeeaeslkLTMN--------------NLINKIY  295
            DVL++LP K RQ++   +      + +   AE  KL  N              NLI ++Y
Sbjct  257  DVLTQLPPKVRQRIPFDLPQAAAKNLNNTFAEWEKLMRNLSSDATESHFSQVMNLITRMY  316

Query  296  VASAKGKISSVLDYLGTVIEAD-CKFLIFAHHVEMIDAIHQYLLKKKVGCIRIDGGTPAA  472
              +A  K  +V DY+  +++ D  KFL+FAHH+ M+ A  + +++ KV  IRIDG  P+A
Sbjct  317  KETAIAKAGAVKDYIKMMLQNDKLKFLVFAHHLSMLQACTEAVIENKVRYIRIDGSVPSA  376

Query  473  SRQALVTDFQEKASIKAAVLSIKAGGVGLTLTAASTVIFAELCWTPGDLIQAEDRAHRIG  652
             R  LV  FQ+    + A+LSI+A G GLT TAA+ V+FAEL W PG + QAEDRAHRIG
Sbjct  377  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAATHVVFAELYWDPGHIKQAEDRAHRIG  436

Query  653  QVSSVNIYYLLANDTVDDIIWDVVKNKLENLGQMLDGQEKSLEVLEDNSNK  805
            Q SSVN+++L+A  T+D ++W ++  K +  G  L+G+++ ++  E +  K
Sbjct  437  QCSSVNVHFLIAKGTMDTLMWAMLNRKAKVTGSTLNGKKEKMQAEEGDKEK  487



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1549013027184